2BJDA

Sulfolobus solfataricus acylphosphatase. triclinic space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Conformational Stability, and Enzymatic Properties of Acylphosphatase from the Hyperthermophile Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords ACYLPHOSPHATASE
total genus 25
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bjdA00
1CC7A 1YG0A 1Q53A 2AW0A 2OFGX 2PGCA 2VH7A 3HX9A 4NPOA 5A6WA 4A47A 2KYZA 1VQYA 4FNHA 4ZA1A 1JK9B 2AJ1A 2FB0A 1S6OA 5B0FA 1X0PA 3FRYA 4OIXA 2RSQA 3HHLA 1IUJA 2N4CA 2BJEA 2GGPA 2GO8A 2XMMA 1S6UA 4QOTA 3HF5A 1XBWA 1Y3JA 3K7RA 1MWYA 1Q4RA 2L3MA 3KG0A 3QMQA 4OJGA 1APSA 3FGVA 4EFAC 1N5VA 1TL5A 1KVJA 4OJHA 3BM7A 2ASYA 4Q2LA 3QGPA 4Y2MA 4NL5A 1YJTA 1OSDA 1FD8A 2IFXA 3CJKA 1Y0HA 2RMLA 2AP6A 2IYIA 1FVQA 2W4DA 2ROPA 4A4JA 2GGPB 2ZDOA 1Y3KA 5F0WA 1TUVA 2LXFA 2XMKA 2XMUA 1K0VA 2BYCA 1MWZA 2KT2A 2LDIA 2K1RB 5T7LA 2BJDA 2GFFA 2QYCA 3IWXA 2K7KA 4A48A 5KAKA 4HH1A 4HI2A 1RJJA 5A6PA 1KQKA 3BR8A 1QUPA 5F0UA 1SQEA 2OMOA 4A46A 1SB6A 3LGMA 4DL0C 2RILA 1N5SA 4HL9A 4DPOA 3FMBA 1P8GA 3VTIA 2KKHA 4Q2MA 1OQ6A 1ULRA 3MCSA 3HHLD 3CJKB 3BGUA 1YJRA 2OD6A 1AFIA 2OP5A 2FHMA 3IWLA 4ZOSA 2JDJA 5B09A 3HHLB 2BUNA 3BDEA 1FVSA 2FTRA 4OJ1A 2OAUA 2XMTA 3HHLC 3DCAA 4HI1A 5B0EA 5IXUA 2ROEA 1YJVA 4U9RA 1Y9OA 1Q8LA 2KT3A 3KKFA 1P6TA 2AJ0A 3GZ7A 2XMVA 1TL4A 2K2PA 2HFOA 1OQ3A 2HQIA 3KNGA 2K7JA 4Y2KA 1JWWA 2QIFA 3DXSX 1KVIA 1X8DA 5B0AA 5B0BA 1VQSA 1OPZA 3HDSA 1SI9A 3KG1A 1GXUA 1AW0A 3TOQA 2OFHX 2HLTA 2K1RA 5T7LB 1R6YA 2CRLA 2N7YA 3LO3A 2IYGA 2XMWA 4YEAA 2W4PA 3WDOA 3BB5A 5B08A 3T9NA 1FE0A 2PD1A 3HFKA 4OJ3A 2W4CA 3BN7A 2GCFA 5B0GA 2EW9A 1TZ0A 5B0CA 2HFNA 1FE4A 3LGNA 4HH0A 4F67A 2ACYA 1FESA 3BF4A 2G9OA 2OKQA 1URRA 2VV5A 3MZIA 1CPZA 2RU9A 3I9ZA 1U7LA 2LQBA 1X7VA 1LQ9A 3E8OA 1N5TA 1YRXA 1AFJA 2BBEA 5B0DA 1Q8BA 4Y2IA 4FNIA 2HLUA 1GXTA 2ZDPA 2LQ9A 2N4DA 2ROGA 4YDXA 3TRGA 2OD4A 2GV1A 4DN9A 1N5QA 3TNVA 2GA7A 2QLXA 2FIUA 1TR0A 2HIQA 2QLWA 1CC8A 1FEEA 2XMJA 1W2IA 5K9FA 2Q3PA 1YJUA 3F44A 1WD6A 3UDCA 1V3ZA
chains in the Genus database with same CATH superfamily
2YKPA 4DCPB 2OELA 4ZLNA 1CBKA 2CADA 4EO8A 5L9NA 2KB2A 2D1CA 3M2VB 2C2ZB 1S6OA 2AMCB 2AYMA 4CM2A 1UJ6A 2VHGA 2AJQA 3LP2A 4DSFA 1IKYB 4JI8J 2XWXA 2GO8A 2E7XA 1O0PA 4MJKA 2PMHA 3JSMB 5CZXA 1AXQA 2IAJB 3GJTB 1U8SA 3R6GB 4KGVB 4KY3A 2DNZA 1F9HA 2ALZA 1SKRA 2XLIA 1DTQB 3W1YC 1FCAA 1UZHA 3FGVA 4RLEA 1R7IA 2J9DA 2KHDA 2NXUA 2LA4A 4KHRA 5EDWA 4PZVA 4MTPA 3R1HA 2CPXA 4C0OC 1SL1A 2ASYA 3DRRB 3P45B 4Y2MA 1C0UB 2OPPB 1OSDA 2CQDA 2EXUA 4OX6A 4QPTA 1Y0HA 2X3DA 1TV6B 3VQTA 3R8YA 5GAHU 1BMQB 3C16A 4ZJOA 5K20B 1XR7A 4DPYA 2IBOA 3QFWA 5F3ZA 3CCQS 2A6OA 3E01B 2DGUA 4E98A 3I5AA 3I32A 3RUBL 3AY0A 1VQKS 1H2VZ 2YNGB 1C4AA 3EVWA 5DQIA 1WF1A 3O1LA 1VCTA 4P75A 1OIAA 4ZPVR 2D3O1 1DRZA 5JJBA 3J81j 3T5JA 2FLOA 1URNA 1HIYA 3THVA 2YWWA 3MR6A 2CPYA 2NXJA 2XZWA 5ETVA 3TW0A 1SQGA 4DPOA 2VICA 4KGKA 1J5EJ 4Q2MA 1Y5IB 3KLEA 2GVDA 3AD9C 1REVB 5AT1B 2MQQA 3HHLD 4PAAA 3BGUA 2GMJA 4JI4F 4I1TA 5CA5A 1RHMB 3AOCA 3G6VA 1KS2A 2FLNA 3CF5Q 5A2QU 4U96A 2XQCA 5DETA 2YPYA 2HHTA 1KDNA 6FDRA 1ZAXA 3W2WB 2KN4A 3ENWA 3RW7A 1A7GE 1Q5YA 2EPIA 4EK2A 5RUBA 1KNZA 1DFDA 4RUAA 4R0JA 4TY9A 3K5OA 5HLFB 1N36J 1D9FA 5EN1A 1V6HA 2MSSA 2LMIA 4IDKB 4D3GA 2WB4A 1UMJA 1VQ6S 2J8AA 2FZGB 3NGRA 4B3MJ 4JV5F 3NY0A 4KPCA 2Z58B 3JQMA 3SMZA 3GIRA 3G6XA 3PO4A 1TAUA 1RWPB 2QL9B 1TL7A 3AFGA 4BC9A 1FKPB 3MUVP 2EBEA 1PC4A 3V81B 1YK9A 4RO0A 1AW0A 1OY8A 2XS2A 4ZHRB 5HBMB 1HI8A 2GQCA 1UJ5A 4DLEA 2DHHA 1NJXA 1I51B 2MDAA 4ECUA 3R3TA 1W25A 2DK2A 3I4HX 4OHZA 4OJ3A 3UN5A 2JFKA 2HFZA 1GK8A 2PMWA 3I0RB 3U1MA 4U67Q 3H4DA 3CB4A 5J2PB 2E5LJ 1VC5A 5DDOC 4YY3F 2XMAA 1TL1B 2G9OA 1WKLA 3EUNA 2DR5A 2DNYA 3JTPA 3QSYB 2XLJA 1CVJA 2QSWA 3KK3A 2YKNA 3CO0P 3TA1A 3RB6A 3RBEA 2VQEJ 3WC2A 1REGX 3IM8A 5D3GA 2CJKA 2PC6A 4LSLB 4QZVB 2UVVA 4I6AA 1TKZA 2NXEA 2B8PA 2LU2A 1PKUA 4Q5VA 2QO3A 4BC7A 2DGTA 3TNVA 3FDSA 3JQJA 3OTOF 1BQXA 3J7AN 4OYWA 3WHIA 4LBHA 4N8OA 2WSCC 1HYSB 3NGTA 4WPAA 5IQQA 1FEEA 4B9VA 5JVGQ 3CWJA 4ITSA 3AA8A 1TUGB 3EGZA 1NKBA 1S4EA 5DRKA 4GKJJ 3UDCA 4H4MB 4GC6A 1WEXA 1WSVA 1S5ZA 2YNIB 2PA3A 4JYAF 1Y11A 3IR6B 1RLCL 2LEAA 3MECA 4OLOA 4C7QA 2FB0A 5CH7B 2MJUA 3OR1B 4J9OA 4DV4J 2NSBA 5F9NA 3RB3A 1FKAF 3M6XA 2BJEA 3FQLA 4NLVA 1FJEB 1NMEB 1TKXA 3M8PA 1QTMA 3HHKA 4YB7A 4Y6IA 4OMFG 2JEJA 3H98A 2J9DE 1PBAA 1QAYA 2BXJA 1FFGB 1G4CA 2XSJB 3AOBA 1QSSA 5LJ5Y 4ICLA 1NJYA 3MM8A 3KJVA 1IR1A 1B4SA 1REVA 1ZH5A 4UZBA 3HFZB 2G4BA 3V2UC 2DGVA 3PRBA 4ZDNA 3KDOA 3OR2B 2CIMA 3T5HA 4B3SJ 1K47A 2KG0A 5HVFA 1U2CA 4ID5B 2QV6A 3EXYA 3PRVA 2JC1A 3MPYA 1W2BR 2R8JA 4X4SA 4LIRA 1W26A 3MM7A 4BWJA 4I68A 4CYUB 5KFFA 1OWXA 3JXOA 2KXNB 3CXCR 4DUZJ 4X64J 2DISA 1L3UA 3ADAC 3MURP 2F7VA 3N6LA 2FVQA 4ED6A 4NXMJ 1JJ4A 1NXIA 1AYEA 2HZCA 1DTTB 4P9SA 3KXDA 3TA0A 3PV8A 1UVNA 4DR4J 1ZM2A 1WOSA 5E7OB 2V5HG 4WP3A 2EFVA 8RUCA 1XNRF 2RNEA 4F3MA 5D4PA 4DR2J 2CNKB 1Z2LA 2CPHA 3CJKB 3Q86A 1H2TZ 5BXIA 1BUXA 4DR1F 2RT3A 2CQ2A 2HYIB 3RW6A 1Q78A 2V34A 2Z2MA 3IMQJ 2XM3A 4JV5J 3I6PA 3IM9A 4DV1F 5A8WA 1QSYA 3HKZD 2DRBA 2I38A 2P5VA 4DG1A 2V4JB 5HQ8A 5JVHQ 1LW2B 4B3TJ 5KFHA 4FPIA 5IT4A 3FSXA 5IXUA 5J1EB 1N48A 2R3VA 1TL1A 2WOMA 3HVAA 3TX0A 3CCRS 3HJFA 4G1QA 4QBUA 4ED5A 5ITHA 2UZAA 3DNCA 2R7UA 2K2PA 3CDUA 1R0BG 2UXBJ 4Q45A 4QIEA 2WAQD 1JLAB 4FKYA 4WXWA 5HVHA 1UA1A 1NK7A 4JI7J 3RG6A 3BQ2A 1EIYB 3H5YA 2PDAA 1VK8A 2M52A 3FVYA 4P6QA 2MGZB 5E2QA 1NH7A 2XSFA 1IWAA 1U0SA 3TVYA 5G4DA 3TI0A 4F04B 2GJIA 5J2NA 2AHOB 2VG6A 2FDNA 2W4CA 1QE1B 3GPAA 2EG2A 4ES3A 5A2QY 5CCLA 1UEVA 3PW2A 3K5NA 2BABA 4J9KA 1NDKA 3K8WA 2IVYA 3CCLS 4DLGA 4DV1J 3ISNC 4Q44A 3HZEA 3FEZA 3SCLE 2KXFA 2NLWA 4UF4A 2AF6A 5CD4A 3NGDA 3OVAA 5IOLA 2B5JB 1NZ8A 4A8WA 1NB7A 1VQ8S 2IM3A 2Z4PA 2ZC4A 3B8HA 1FKOA 2RDDA 4DR2F 1HI0P 5HQLA 2H54B 1FXLA 2LXIA 3PNIA 4P2XA 5E33A 2ZVIA 3R5DA 4ECRA 4O44B 1OPIA 4RW8A 2E7WA 2ZE2A 2OMLA 4LUBA 6FD1A 1HNZJ 4LF4J 1I5OB 2MQLA 2G1DA 2MY7A 4IG0B 4F4ZA 3CCTA 4QCLA 1RBLA 2HHWA 1HNVA 3POTB 5HO4A 4AD6A 2UXBF 2M2BA 3UDLA 5KT7A 3I82A 1HD1A 5E0OA 3R2CJ 1LW0B 1LXJA 4RW7B 3M30A 1F5CA 1TV6A 3CIMA 2FPHX 2AW0A 2L08A 2YH0A 3GU0A 1RTJB 3HX9A 4NPOA 4OYZA 5K8OA 3M8SA 2AYGA 3MOZA 2I2YA 2LP4A 2HBRB 5EWGA 1HNIB 1NSKL 3HM9A 2ZH7A 4NLWA 3V6DB 4K4WA 2ZD1A 3DRSA 3F41A 1RWMB 3HHLA 4IFYA 4ID8A 4AXJA 3E51A 4JI2F 1IQZA 4M5GA 3LALA 2HG4A 2KJWA 4UOCA 2KM8C 5K8PA 3W3SA 4WU3A 4DS5A 4IRDA 5AJ3F 2IM2A 2L3MA 4URSA 2DGXA 3R2DJ 3UWTA 3EDQB 2QSFA 1UEKA 2QT7A 3B6BA 4NLUA 1TL3B 2ZWPA 2X7IA 1IKVB 4ILRA 3AB2B 1F3VA 1JLQB 4EBCA 3BSNA 2HNZB 4RNHA 5KFBA 2NQPA 2EC0A 4NLPA 2OGUA 1SPBP 3G96A 2ASDA 2R7RA 2RAQA 4K59A 3P49B 4X4OA 4U95A 4OHVA 1M5PC 1IWGA 4IO1A 1RA7A 4WZQA 1GMWA 2J9CA 3UE2A 4OZLA 5F8IA 1KONA 4A8SA 1O5JA 4HI2A 3D1QA 5C42A 4ELUA 2MKJA 4YUDA 1X31C 3ETMA 1MMDA 2RS8A 5KT3A 1VMBA 2HNDB 2NPIA 3OTCA 2ZWOA 3FEYB 2MJNA 1ZBTA 5F3TA 1JKHA 4FBUA 1S76D 2XS5A 2YBVA 1HW9A 2VZ9A 1JJ2R 2VA3A 4FF1A 3C8YA 4HVZA 5CZVA 4PXEA 1RWWB 3LH2S 4K4TA 1T7PA 1VRTB 2WVBA 1K9MT 1U0HB 4YY3J 3BSAA 5KFYA 1LFWA 2FJXA 4CDIA 1R0CB 3OLAA 3DOLA 5L46A 2J6TA 2X1BA 1FK9B 4WZMA 1WG5A 3I0SA 5MLCV 4USWA 5J2PA 4LFAF 1WWHA 1L3SA 1AUSL 2VFRA 1F5AA 3CDWA 3KKFA 4WIIA 3MCOA 4N5SA 1IKXB 2NYHA 2KH9A 2MKKA 2E66A 4PPZA 5AE2A 3Q8SB 4J7CA 4ZVEA 1CJVA 3SZ2A 5SUHA 1MW7A 2XHCA 3BKTA 3E3XA 3IRXB 3BH6B 1LNQA 3QFHA 3TJAA 3W65A 4IR9A 1UVMA 5F41A 2Q66A 1N32J 4IOBA 1VBYA 3O2IA 2IC3B 1RZMA 2CDQA 3SCIE 4WCEQ 1FERA 1VK3A 4P52A 2M9KA 1CJKA 4R5PB 5B08A 2KRBA 1UVKA 3TEHB 4O3OA 4CT9A 4DHVA 4DV5F 3UD4P 4C3KA 3Q0AA 2DR8A 2J0SD 1PO6A 2R7OA 2YNHB 2XHWA 5B0GA 3BO2A 4TU9A 3KWMA 3OSPA 3SDEB 2MXYA 1U8WA 2LQ5A 2H4WB 2CPDA 2YNIA 3EWGA 1T9VA 2BM0A 4KO0B 4RBVA 4TY8A 4ZVSB 3TAPA 2CFXA 1L5UA 2ATCB 1R0AA 3NOCA 1TVRA 3ZTSA 1HQ2A 3NLCA 3AD7C 3UR3C 3MEEA 2XI2A 1FTCA 1FNMA 2HLUA 3MPWA 4ES2A 2UUBJ 3SEOA 1FNXH 1YJ9S 2B8QA 1X9MA 5AE3A 4NYOA 4DN9A 1HD0A 1B7YB 4CO4A 3LP2B 3UD3P 1UVLA 2HGMA 5KG6A 1DQAA 2QLWA 4J91A 4KHPJ 4DL3A 5K8NA 1N33F 1RT1B 3LUYA 1R8BA 1BY9A 3CD0A 1FX2A 1QJHA 4QU7A 1JB0C 2VC0A 4TU7A 2Q43A 3IP0A 3OR2A 3QQCD 3JYTB 1B3TA 2APOA 3LPYA 3J7YU 3J7YI 4FNHA 2EFGA 4I4BA 4NOHA 3BH7B 4F25A 4FP9A 4AFFA 3VAKA 4LF6J 5B0FA 4ECWA 3HXMA 3TVZA 1N6QA 2FY8A 2K8GA 2OPSA 1IUJA 4FDFA 3IR7B 1I6JA 2MKSA 2W25A 1U2FA 3MEDB 3T1AA 5IQ6A 3TARA 4KH1B 4NLRA 3HF5A 3CC2S 1RHJB 4A8KA 1TMMA 2X1AA 2DNRA 4OYXA 3HZGA 4OI0A 4O3QA 4C3LA 2XO6A 1J27A 2CPJA 1HL6A 3L4BC 4M5NA 4NMXA 1T95A 3GYXB 4OYPA 4DR7J 2EBGA 2Z30B 1EETB 4DFKA 4IOCQ 3CJKA 1JJHA 3C3LA 1K73T 3CDBA 5KFRA 4OX9F 4J9RA 1M5OC 2BE7D 5A8RA 3NWGA 1MMLA 2Y3YA 4DX8H 1QAJA 4ATNA 1EB0A 4B9LA 4DUZF 2VBZA 4CLLA 3NCPA 1CULA 1H74A 3JYTA 2GMLA 1YSJA 2RUGA 1S6PB 3I0SB 4ZCIA 5HMXA 1QAIA 2BZ2A 1WC3A 1S1UB 1SVDA 3L7PA 1N8RT 1JLFA 3MMCA 1NNDA 4OZNA 1RAAB 2HZVA 4A8QA 3PO5A 3NCRA 3IRXA 1OQ6A 5KFLA 2HBQB 4XIUA 2AJ4A 1JNRB 1YJRA 2BMBA 3GV7B 4X64F 2G0CA 2KXHA 2KFYA 1ZAWA 3W8PA 4BDPA 3M05A 2D3ZA 1AZSA 1TL7B 2KFNA 2JDJA 1P1TA 2HRYA 4NLQA 4ZVPB 5B09A 3BDEA 2W01A 1VBZA 3N5FA 3HD2A 2DR9A 1SH3A 5AXKA 5AXLA 2DY1A 1KLNA 3HHLC 3R5AA 2NCKL 4TQRA 1FDNA 2PEBA 3C16B 3AH6A 4S0MA 1NDCA 1UW4A 4EWTA 4C97A 4IKAA 2UXCF 1C1BA 2WVDA 2CQBA 2HFOA 1BWVA 3RU0A 4CCHA 2U2FA 2UV8G 3DGPA 3R97A 5MAOA 3CJ5A 4DI6A 2DB1A 2VU5A 4NYPA 4AE5A 3KHLA 2V8GA 5D0HA 1T0TV 1IBKJ 2XO7A 1KWMA 1EZZB 2YPZA 2B7CB 3LO3A 1QSLA 2WBRA 4NA1A 4PQUB 2QFIA 1NSPA 3J7A1 2R7WA 4WK3A 5IM0A 2W2OP 3GV8B 3M30B 4ZLPA 2XBPA 4LQ3A 1YGYA 3SXLA 2CXEA 2XYGB 4B3RJ 1X9SA 1URRA 2QLJB 5KT6A 3BYPA 5H9FK 1S79A 4I6WA 4ZCMA 3Q8PB 2MZSA 2E5IA 3NG8A 1FRXA 1YRXA 4QIGA 2IA6A 1M5KC 1MSWD 3OBIA 1YZ6A 2DCLA 1RB0A 2V69A 2A0FB 2HQGA 2N3LA 3D6MB 1NK4A 2JZ5A 3CDEA 4YDXA 3QRQA 3EJMA 3SQGB 4ZMMA 2CG4A 2FC8A 4FYWB 1C4CA 1RADB 1S0NA 3OVSA 2MEWA 2AWZA 3HMJG 4ZPWR 1RWXB 3S7RA 1RHRB 1B70B 3PRDA 4HACA 1YBTA 2XMJA 4QWEA 4ED0A 4OHXA 5HN0A 2K3IA 5M2RA 1X60A 2VDIA 3D5MA 5K9FA 3HSJA 4MKAA 4RUCA 4O4GA 1N36F 3QJLA 2MZRA 2E5LF 4L6V3 1UL3A 5ETQA 3RYLA 4B08A 1UWBA 4V1Ak 2YKAA 1Q7YT 1X4HA 1H72C 2G2OA 2GQ2A 5L1KA 3PW0A 4AUKA 2OH2A 2RSQA 1HR0F 1MN9A 4RPFA 3CJ8A 4Y00A 2H48B 1BLUA 2XCAA 3HFVA 3VVTA 5C24B 1T94A 3OV7A 1S1UA 1RTDA 2MKYA 1C1CB 2HPUA 3K0JA 3CCES 4F3QA 1N5VA 3ITHB 1FI4A 3W8GA 4WK1A 3OHBA 4QYZJ 1KQGB 1JKHB 1WC0A 2RQ4A 4UY8T 3K59A 1NPRA 4GMKA 2HS3A 2C2OB 1NDPA 2WONA 1FD8A 4USJC 3ZZRA 3AQPA 1YTYA 2M5YA 1HLWA 3SCJE 1KN6A 1PYTA 1SQFA 2MB0B 1RGVA 1R8CA 2RF2A 1WHWA 2MHEA 1D09B 4PEOA 1BQNB 3D3BJ 1UPMB 2GS8A 2H9ZA 4L72B 4ZP6A 1D1UA 2R7VA 2W9AA 2LEPA 2HIYA 2VDHA 1S59A 1Q81T 1F2GA 1RT7B 3N9UC 1JIHA 1N54B 2F5GA 3GSDA 3MEGB 1KQKA 5H9FJ 1MG7A 2AT1B 5A6PA 1LW2A 2G2ZA 5F0UA 5I42B 5FLXU 3OUYA 4Y3CA 2HMIA 2M8DB 4IQXA 4LF9F 3RBXA 4QR2A 1N32F 4QIVA 1CJVB 4IG3B 5D4LA 3RB4A 1T03A 2MKCA 5JXSA 5HL7Q 3KLFB 2JNJA 1WORA 4DR1J 4IFVA 4LRFA 1CS4B 4KQZA 4DJBA 5HSPA 1TK8A 3NNAA 1Q0NA 2VOOA 5A76A 5E3RA 5DDPC 4K5RA 5KT4A 1TKXB 3IFEA 3OFEA 1X4FA 1RP5A 2OP5A 4I2QA 3QGGA 3A13A 4PABA 5D0RA 5U47A 5KFMA 4LFAJ 5AXNA 3D28A 2WTFA 4DV3F 2AZ3A 2FTRA 2V2KA 4JOUA 4DWIA 3RTVA 4QWAA 3H2UB 1K1QA 3U02A 2W2PP 1DTQA 1EHWA 4PPDA 2V4QA 3G4SS 1RAHB 4LFBJ 3KLHB 4DZ6A 3A8EA 2LVWA 5IT9Y 1HWKA 2PN6A 2K7JA 3HVWA 3KNGA 3QLHA 3BGFA 2FC9A 2ZBQA 3I4PA 4ZVOB 5B0BA 2R8IA 1XNRJ 4DV2F 2P9EA 3CJ3A 3MGJA 3C66A 2ZH3A 3U27A 3VF0B 3CMAS 2DHSA 1WOPA 2HQDA 3AB4B 5GADU 2PI4A 1IQTA 3EXCX 2KI2A 1NDLA 1TK5A 4USVA 4U6PA 3HT3A 1G3OA 3D54A 1WKJA 1RCOB 2R8HA 3C2PA 3KK1B 1RTIB 3LGNA 3PJXA 3W61A 3POTA 2ZBIA 3FBFA 3K17A 1BQMA 4MIAA 3DGVA 2VV5A 2MYFA 2D41A 3MOJB 3G2XA 2LQBA 4USMA 1M1HA 1LW0A 4LF8J 5DZ7A 1CLFA 5DG9A 3N0VA 2A1BA 1TMJA 4FNIA 4K4SA 1RAGB 4HHUA 3F73A 1LXNA 3R7NB 3AHPA 4LVNP 5KFZA 4DV0F 4DF4A 4X84A 3TRGA 2R7XA 1NZAA 4ILMA 4ZVGA 2HQCA 3K5LA 4WIQA 2XTJP 4CP5A 3GV5B 1C1CA 1P9QC 3ILIA 4D3HA 3QAEA 3D7SB 2B4PA 4YN3B 5K8MA 4QWCA 2Q3PA 4QYRA 2VOPA 3IC1A 4DU7A 1JLAA 1ACMB 1FXDA 1HWJA 3KK2B 1AROP 4FXWA 2W9BB 1RT5B 2ADBA 3CCUS 5A6WA 3SBMA 2DVIA 3GE9A 2KYZA 2DNQA 3ZNUA 3CC7S 4GKJF 2JEGA 5IT0A 1FKPA 3QJPA 2NS1B 3FRYA 4RNMA 3EGNA 2DRDA 4OIXA 5D77A 1VLOA 1LWFA 5J2NB 2DJWA 3R5BA 2O01C 2WB1D 4UQTA 3JAMY 2HURA 1OJ4A 1DURA 4FXDA 3C6UB 4NRTA 4P7TA 4O3SA 2P9GA 3HULA 4J9UE 5FIIA 3SQOP 3K8VA 3UCZP 3HHEA 4L76A 1SJQA 1XN9A 3VHQA 4EFAC 1HMVA 3CMQA 2LEBA 5D15A 2CA9A 4M5DB 5A0YB 4DR6J 2F1FA 4QR0A 4DQSA 1CS4A 1SKWA 3N4WA 2DIVA 4JV2A 1N88A 1CEZA 2ZE2B 3BBBA 4QWDA 4OV6A 2I6WA 5JUMA 4TLRA 3BSCA 4PKDB 1T8EA 2HHXA 5HROA 2ATLA 2IJRA 1M5VC 3EYZA 3LP0A 5BJRA 1EKRA 2LDIA 1RT4A 4G6VB 4HHJA 1DLOA 2K1RB 2UUWA 1V9OA 1H98A 4B17A 2B9EA 2C3YA 2I9SA 1SV5B 1YX2A 4MK7A 1HNWF 1DJ0A 1LKZA 4Q8EA 2HHHJ 3QT7A 4NCGA 3BEGB 4EU0A 7AT1B 3DLKA 3CC4S 4ZVTB 1VI7A 4ANDA 1PJ6A 3N01A 3PHEA 4KKOA 2VFUA 4CO1A 3MCSA 2YY3A 5F8LA 2BM1A 2DPIA 4TLQA 2JX2A 4QQBA 2PFFB 5DLFA 4CO0A 2I5JB 2P8IA 1RHUB 4ZOSA 1S72S 2DGOA 3M9NB 3PJ9A 2FHJD 4ED8A 4C0BA 3M7VA 4NE9C 4YB5A 5GMEA 5IM0B 4MKBA 3RRGA 3KMSA 2EK6A 2V6AA 2F3JA 3UI3A 4HTJA 4ES1A 3A3NB 3AJ2A 4R5PA 1QUVA 3F0NA 2MQNA 1U49A 3X3UA 4NLYA 4IUFA 3BKUA 5EX0A 3PXGa 1P6TA 1S0MA 1LOUA 3G71S 4B9TA 3GYNA 1M90T 2OPPA 2NUUG 4Y2KA 2LKZA 5L1JA 3MMJA 1X8DA 4X66F 3KUGA 4JV0A 1UTAA 3R6LB 5KFIA 4BBYA 1R0AB 2PFDA 3D4JA 4LBIA 2Q1LA 3CJ2A 3WIUA 1NLKL 1S7IA 3K58A 3V4IA 4M94A 3W5XA 2JSXA 2V2ZA 4JV1A 1FDBA 3SSRA 5IFMA 5LXRA 2RDJA 2FUG9 1FE0A 1GXLA 2DTJA 2NYIA 3HFKA 2CYYA 3ZO7A 2R9LA 3V6JA 1IBMF 1OY6A 2VPXB 4N47A 1FE4A 4IH7A 3BQ0A 9RUBA 2IDEA 4DX5A 5KFWA 1YJ7A 2B6AB 4I2PB 1OO0B 3H0PA 2OI2A 4CO2A 2HHPA 3OLBA 3E8OA 2BV3A 3IN5A 2FQQB 2V8HA 3MPDA 4P2SA 1Q5VA 1WI8A 2CJAA 1UP1A 4Y2IA 2ZUAA 1DBDA 3UD5A 2LQ9A 3GIIA 3K2YA 4OZJA 1QY7A 4C11B 4DU8A 2U1AA 5A8WB 2ZH5A 3BO3A 1NJZA 3KNAA 2OJ3A 1N0UA 4WWSA 2XS7A 4P2MA 2HIQA 4C8MA 3MEDA 5BYQA 2UU9F 3A8IA 3J81U 4QJVA 4EBEA 1RWOB 1JXEA 4TYBA 3QO9B 3V6KA 4HT5A 2WHOA 4EYIB 1BD6A 3SYZA 3DFEA 3BSOA 1N34F 5I4MA 4MMOA 1EETA 1K44A 3TYTA 1FA0A 4C9DA 1BQNA 1XR6A 1JK9B 1RT2B 2QA4S 4F2RA 3JSYA 4F0MA 1VQNS 2BJ9A 2IJNA 2NUHA 3UO0A 4RUHA 3I56S 4DL6A 2FJVA 3OFGA 4ERDA 2J7WA 1RLDA 2OLWA 1RXOB 1ZM9A 2R2UA 1N33J 1S6UA 1IBKF 4JUZA 4WTYA 4K5SA 4DSEA 1VQ5S 4C2MA 5LXYA 4ECYA 2JEIA 3JTOA 3JSBA 5C2CA 2EWHA 2OEMA 5I3UA 1ZYQA 1T03B 3P6YC 1TL5A 1KVJA 2IVFB 3KLFA 1U2RA 3RAXA 2WSEC 3MDFA 2DGQA 4LVOP 2KG1A 2QN6B 3DLHA 1HNWJ 4O4RA 4R8UB 2XEXA 1KC8T 4ENOA 1RBAA 2P2CB 2BQUA 2H3EB 5DG7A 3PCOB 4LSLA 4CLFA 2Y8YA 1UJ4A 5DZ6A 1HWIA 2CWXA 1MWZA 1VRQC 2W2MP 4AL7A 2JJ4D 2GFFA 4X4RA 5FD1A 3MFHA 2W9CB 4W4MA 3ET6B 5J2MB 1VBKA 1HYSA 3PR5B 1VQ7S 1UAWA 3T1YF 1U4BA 3PFEA 1NSQA 3NCQA 5HMZA 4XPEA 3NEKA 3Q23A 4A46A 3T1HJ 3T6BA 2HW3A 4M5HA 3IR5B 3F56A 4OHWA 3EX7B 4FF2A 2QG9B 3CCMS 4QR1A 1RYSA 3KJQB 1HKAA 1C1BB 4KBIA 2B4VA 4C48A 2GJFA 3UQSA 1VHFA 3VAHA 4I0WA 5D4NA 4X62J 3HHLB 1UVJA 4NLXA 3NKYA 5DLGA 1L3TA 1FFWB 5I3PA 3EPGA 3TZZA 1M5SA 3IG1B 4G65A 1RTIA 4HI1A 4HDHA 3NGUA 3W64A 1EP4A 2ROEA 3ZTQA 1U24A 4O3RA 1NO8A 2KVIA 1LWEB 2CPZA 2W9BA 1J5OA 1VR6A 1HFEL 3MM9A 2JOQA 3KJVB 5CYJA 1IKVA 1VDHA 1XMOJ 5AXMA 5HMYA 1GMUA 1SUQA 1FJCA 4H4OB 1VC0A 1X5OA 2CVEA 3OTDA 2FYXA 4XK8C 4DV7J 3MD1A 5KT2A 3D67A 3OT9A 4MK9A 3HVTB 3UVJB 4CM0A 4CLPA 5KFDA 4OYMA 2M88A 1YQHA 3NAHA 4QW8A 3X1LB 4PQAA 4GO7X 3DOKB 3CUNA 4G1PA 3QNWB 2BKOA 2IYGA 4DX7A 1CJUA 1BGXT 3OJSA 3CCJS 1MNEA 5K14B 4MH8A 1LK7A 4F7VA 5B0CA 2HFNA 1NSAA 2QE5A 4F67A 2IIHA 4DCJB 4C8OA 4LF5J 1JLEA 5IC6B 3LQVA 5KFJA 2XY7A 3DOMB 4Q0BB 3MFIA 2IPOB 1KEKA 4C8KA 2E5GA 4O4GB 3PJWA 5F8MA 2CZ4A 3VWSA 3TANA 1MU2A 2HHSA 3FCHA 2KVQE 2ZDPA 4J90A 4PCQA 1XERA 4PG7A 4C8ZA 4DV2J 4M8LA 5E3QA 3CE8A 3PZPA 3QGIA 4O0NA 1RACB 3DXBA 1JLCB 2KU7A 3OL9A 3R27A 1EJ7L 1RAIB 4L73A 1NAQA 1V3SA 2HK2A 4EUVA 5KG0A 4YDDB 2F63A 4DL5A 2C2RA 1IBLF 2XZTB 1GH8A 2FLLA 2GHPA 4KGXB 4A8YA 3CIZA 3FK4A 3R5CA 1IKXA 1V3ZA 3D9BA 3A3OB 5CCMA 1RWUA 3BPSP 2VODA 4DPTA 1GMWD 3RR8A 3M2VA 1WC6A 4J9SA 3O6QA 5HROB 2BA9A 1DY3A 2YVSA 3MUTP 3CGIA 4MIWA 5H1SV 2QEXS 3WQPA 4CIOA 2IAJA 2XMMA 4LBPA 4QOTA 5CYQB 2LA6A 4Z2XA 2QTWA 1FTRA 3DN9A 2HVIA 3FNNA 3JB9k 2J6SA 1Q4RA 2HS4A 4P10A 1KHVA 3CTRA 1Q16B 1NPPA 1WF2A 4OJHA 2A18A 2UUBF 4JI5F 1T9XA 4JI6J 2VG7A 1Z4UA 3LP1A 4PXBA 3OUYB 2IMOA 2ZNZA 4Q2LA 4WFNQ 3RGIA 3NL0A 4J9NA 3GJSB 2HHUA 4X4UA 3PR4A 3MMAB 1RDRA 2YX4A 3TUPA 2ZJQQ 1PJ5A 4DFJA 1KSPA 3CJ0A 4A8MP 1SIZA 5HP1B 2AGPA 3MR3A 4MYTA 5LMUJ 2C2DA 3K57A 3MAAA 5KAKA 4TQSA 1XNQF 2G0JA 3VAMA 5L8RC 1SH0A 2O67A 4CTAA 3VZHA 1QUPA 1WJ9A 3FUYA 4OYOA 4ZIVA 4A8FA 1HW8A 2B7BB 1ELOA 3K5MA 5C25B 4UOFA 2VBWA 4BS2A 1TKTA 3MM9B 2F4VJ 1FFSB 1FO1A 1U1OA 3LW5C 1R8PA 3G82B 5CXTA 2XNRA 1BC6A 2ZBPA 3W60A 4F02A 4ZCLA 5CD4H 1MMNA 1T02A 2WRMA 3KG4A 4GVBA 4ECVA 2BJ3A 2H5JB 2OD6A 3NRBA 4IYQA 4ZVHA 4ZITA 2XC9A 2DCUB 1SBRA 5D6GA 1B64A 1PYOB 5J2QA 2BJ1A 3PEHA 1VIOA 3Q8UA 5THWA 1RUSA 1VQ9S 1FVSA 3ENAA 4P71A 5D0EA 2BJ8A 4M1KA 2D74B 2WONB 2B6AA 4G1IA 4KT0C 3NAIA 1JXVA 4ZVUB 2MLXA 3QATA 3QWPA 3TAMA 3ILOA 3GZ7A 3VAFA 4F3OA 1NPKA 1LWCA 2HQIA 2YX7A 2ZKTA 1UCNA 3ZC4A 3DXSX 1TTHB 4C3MA 3DHWC 3J80U 2J0XA 3VZIA 1NCLA 1AUDA 1VQSA 1OPZA 2YWEA 4C11A 1KOHA 1UETA 2D7SA 4ZHRA 3TUZC 2H4YB 5L1IA 2E1MC 2MY8A 2GC8A 2XZDB 3W5YA 1U1PA 2HMIB 1CULB 3ICLA 3NNCA 1RU2A 2EEYA 1I3OB 3FC9A 4K7QA 1ZM3A 4ELVA 2QMUB 2VUGA 3I96A 1IM4A 3I0RA 4OLPA 3M2UA 3MTKA 5HANA 2AQ4A 2ZM6J 4U7UD 1HWUA 4I6YA 2B9YA 3UN2A 2D9OA 1WG1A 4DV6J 4JI0J 1FESA 1ZZFA 2WW4A 3BF4A 2AX1A 4KV8B 1CPZA 3UDEA 2ERRA 3OD2A 4X4VA 4B9SA 1DQ8A 3SSQA 1QLNA 4CWBA 4LRAA 3CCZA 5D4OA 1AFJA 4NCBA 3AAWB 1C0TB 1WTFA 2CQCA 3GSIA 3VGUA 3T5LA 4LF4F 4LFCJ 1S99A 2ROGA 2YQ3A 3QBCA 1VRTA 2JFDA 3GCWP 4LIWA 3SCKE 2AEFA 4X65F 4RU9A 3WC0A 1D9AA 4NASA 4U8VA 1WHVA 3CNQP 5CYMB 4M5IA 1K8AT 4Y34A 4FYDA 3JS9A 2UUAF 3PYFA 1UWAA 2MMYA 1CC8A 1H7XA 1RHQB 2OPRA 1YJWS 5LSRA 1W2IA 3CPWR 2DHGA 1U09A 4NXNJ 3TJ8A 4WYLA 4GKKF 1MROB 4ELTA 2A2DA 1YG0A 2DEIA 3IXQA 3ILLA 2D3UA 1KFSA 5FDLA 5M2PA 1F60B 3AJ1A 3M4XA 2ALYB 2MZJA 2J0WA 4NLTA 2VA2A 2DIUA 2PI5A 1MLAA 2ASLA 1RABB 1WDDA 3M8PB 3D6TB 1T05A 2EC2A 1HBUA 2J0QD 3CJTA 1IKYA 2DNGA 2QA2A 1UFLA 2W7PA 1RE1B 4RL1A 1U1KA 3CW2C 1F1BB 3M2RA 4OJGA 1E6VB 3M6WA 4EMDA 3A8JA 2XG8A 3DRRA 3HHDA 3NOGA 4PG8A 5C25A 5FLXY 3BJYA 1NH8A 2D3OR 4ZP9A 3HSZA 4FYVB 1ZPVA 4KO0A 1PCAA 4LSNA 2IFXA 5I3QA 3DLKB 4X4QA 1XK8A 2RMLA 1VQMS 1U1LA 3E01A 3EZUA 1Q1KA 3LTOA 4NLDA 2W1BA 3MM6B 4RWXA 4W98A 3BBFA 2VQEF 3HKWA 2DO0A 1O51A 2DNNA 2L9NA 1TUVA 2F8MA 1WF0A 2LXFA 3PM9A 4BHQA 4GRSA 4DCOB 2DNLA 1K0VA 1G7CB 2BYCA 3Q2TC 3IWXA 4AT1B 1PAUB 1LK5A 1YWXA 2K7KA 4AQYF 3NS7B 4ZVFA 2GIQA 4FS2A 4MK8A 3KUHA 1SQEA 2AJ2A 2P9CA 2V4RA 1NK5A 3FSIA 2M3DA 4NLOA 2B9WA 2P6SA 2RILA 5GADI 3OHAA 1SJ3P 2UU9J 4PUOA 2DR6A 3QWUA 4NCAA 1X4BA 3Q8VA 4H4OA 4NA2A 4Y65A 3B54A 2ZHBA 4CLUA 4DR4F 2E29A 3K5PA 2GVDB 1Y10A 4MT1A 6AT1B 4B9NA 1N6QB 2HFUA 2MLZA 4RNOA 4MKYA 2A6MA 2RRAA 4F4XA 1RA6A 4XTTA 5GAGU 3QIPA 4WP9A 5BR8F 3MR2A 3R5GA 5K14A 1XMQF 3M2UB 3V4IB 4DSJA 4DR5F 2XB2D 4KSEB 2CNNB 1FT8A 2AZ1A 5B0EA 1S12A 3CCVS 4F50A 2R8KA 1YJVA 4TVAB 2C22A 1RAFB 3NGKA 1L3KA 4P72A 2BDPA 1Y00A 5E3CA 4PYDA 9ATCB 2AJ0A 4NXNF 3KFWX 1TL4A 4DV7F 2NZ4A 2Y9HA 4JB8B 3FRZA 3CMES 4URQU 2OTJS 1EAYC 1EKSA 4J9MA 1C0TA 2MGZA 5IZHA 3DRXA 4ECTA 1I94J 1R3NA 4FKXA 3W9JA 1OYDA 1SI9A 1ZZNA 1U45A 3OXGA 1RKJA 2GVZB 4C4WA 2OFHX 2HLTA 2ZEJA 3P3DA 5KG4A 4JI3J 2CQ3A 3P5BP 3D0IE 3SFUA 1S6PA 2G13A 2I8EA 3BB5A 1U47A 5KT5A 2YX1A 4OZ0A 1WI6A 2C2KB 2MLYA 4DV4F 4KPYA 5I42A 2JLEA 1S1WB 1XMBA 3BYRA 1YVFA 3N6NA 3U1NA 1S77D 3G9CA 1OY9A 1R31A 4A8OA 4ZIWA 3DM2A 2CQGA 3RAQA 2R7SA 2F9DA 1ITPA 2RU9A 1IBCB 3BGOP 3I9ZA 3CDAA 1X7VA 1NKEA 4DSIA 1RT6A 4RW9A 1TKZB 2F40A 1WACA 4I7FB 4MKVA 3D2WA 1RWNB 3TEGA 2BVZA 1SKSA 4B9MA 3FEXB 2XLKA 1JLBA 2LDYA 3KUEA 3RRHA 4K50A 2G0IA 2OD4A 4WKYA 4N41A 4IG0A 5GMKa 4QW9A 2BW7A 4GVLA 1TR0A 4B02A 4O0IA 1IKWB 3M2RB 2UUCJ 1QAXA 2VKRA 3AOAA 1SJRA 2OTLS 3PY8A 4YHHJ 4UT4A 4B3MF 1SC1B 4ZVQB 1WUUA 3OW2R 4K4YA 4WFXA 2DNHA 5DM6Q 5LMUF 1VS3A 3MMAA 3JSMA 3EZOA 2O1PA 3GP9A 1TAQA 2VH7A 2BKNA 2CQHA 2DGSA 1W7WA 5GAHI 2XY6A 2FVPA 4JI1J 4B3RF 3MF5A 2VG5A 5DGBA 2GAGC 4QPXA 2B43A 2H5IB 1TP7A 1FRLA 2XCPA 1X0PA 2M0GB 2RE1A 4J9VA 1AB8A 1YIJS 3MECB 1JLGB 5G0RB 3R7SB 3NMRA 3M8YA 1R43A 1YZ7A 1S6QA 4CQ1A 2E5HA 1SC6A 3P5TL 2VD3A 5K5MA 3H20A 3K7RA 4WFYA 4PG4A 2MQPA 4J37A 2R2RA 4M95A 4F36A 2YQ1A 2V8VA 3LANA 4PUOB 3LA0A 1RI7A 2DH7A 3W63A 4HTIA 3O44A 1VC6A 3TX8A 1MWQA 3VQSA 5ADZA 2CZVC 1BQMB 3GCXP 1YJTA 4HT7A 1JNZB 2DXEA 4PXDA 1T9TA 5AE1A 4W92B 1EQ0A 2N3OA 1KHWA 1FVQA 2GAHC 2Q79A 4IH5A 2KO1A 2QFJA 1NU4A 3G87A 2ZHOA 4DZDA 5E5NA 1FEHA 1LV5A 1U48A 1S1XA 4BLGA 3OJUA 3GONA 4DQRA 1SC4B 2BJDA 2YKQA 3QIPB 5T14A 4DQQA 3QRRA 4WKRA 1CG2A 4HH1A 3L9ZA 3A8KA 2F8EX 1ZAVA 2X51A 3DU6A 5H9EK 2XI3A 2ZOFA 4ZCKA 3UN3A 1WOOA 4OI4A 2AYBA 2OMOA 2ZNYA 3JTNA 4YB1P 1GMVA 1CJTB 1N5SA 2BW2A 2QA1A 1NKCA 3H2VE 4LREA 4UTGA 2CG8A 4JP8A 5M2UA 1HNXJ 2KZZA 4Z7CA 2ZH1A 4JI5J 5IWAF 3C19A 2EFPA 1GT8A 3C15B 5F8HA 4P73A 2RKIB 2WVCA 3W66A 1FF2A 4DXLA 3I55S 1V3RA 2V9KA 2ZUGA 2UVRA 4USTA 3N79A 2HZAA 4KAIA 1BHNA 4TXSA 3W2VA 4TU8A 4UQGA 1PG5B 1WSRA 2B4UA 3SIPB 2AIRB 3TQ1A 1OMSA 1IJEB 3C6UA 4ZVRB 1CQNA 3ZZOA 1A0OB 1RWKB 1N5YA 4WXOA 4G1QB 1YRUA 4L75A 3G6ES 2C42A 1T11A 2PSZA 1WC4A 1Y9OA 4KV8A 4CO3A 1RYRA 3OSNA 5J1EA 3I87A 1T9YA 8ATCB 2YWHA 2DT9A 5CABA 1YBUA 4IDKA 1HQEA 4ECQA 2HWHA 1VQPS 1TK0A 2JHEA 4IQMA 3V81A 3KG1A 3HO1A 4KTQA 3C14A 1H0HB 3OL8A 1J2VA 1FWLA 1RT4B 2XNQA 3IAS9 3NP5A 1JXLA 3BN7A 4X4PA 3K89A 3RB0A 1S9FA 1UZDA 1QTNB 1GAOA 1NK8A 1MROA 4NCGB 1WHYA 2QZ8A 1BWEA 4TY8B 3M8RA 3MAQA 2MHNA 3JSRA 3PIOQ 3MZIA 4OV1A 1XEZA 4YR0A 4P74A 2C3PA 1S7HA 2ACMA 1O6XA 1X9WA 1WELA 4U8YA 3DLLQ 7FD1A 2HVHA 3P96A 5HAOA 1T05B 2PMZD 1BXNA 3MD3A 3MCNA 3RBZA 4CO5A 5KFEA 4UY85 2UV8A 4UW2A 3BQ1A 3NMAA 2CJXB 2V94A 3NXZA 2K06A 1B99A 3NBPB 2AEMA 4L74A 4ZJLA 3R9LA 2XGQA 3W7BA 4OI6A 3FCWA 4WBFA 1ZA1B 3DI6A 1YJNS 2CPIA 1P27B 2Z0GA 4PRFA 4W90B 3FBBA 3FFIA 3T41A 3PHTA 1WD6A 4DUTA 1IR2A 1YKWA 2FHJA 1Q53A 1G6BA 2GQQA 1VJQA 3P8BB 3BV8A 4DSLA 3PACA 2COLA 2WW8A 4YMEA 4HR2A 3DOKA 2EKYA 4DS4A 1OSCA 2ZFHA 4IOAQ 2HKEA 1S1XB 4PR6A 3BREA 5HP1A 1UA0A 4ZPCA 2ZHAA 2G1HA 1H7WA 1T3NA 2RIJA 3GWCA 2E9TA 2HVDA 1KVKA 4IFYB 4USUA 3T3FA 3QMQA 1S0VA 2F65A 2UUAJ 2GZOA 1U6BA 2IA0A 3O3LA 3EVMA 4HDGA 4LSZB 4TYAA 2GO9A 4FF3A 2PEHA 4X4TA 5F8JA 2DEJA 2QYGA 4P2FA 2UXCJ 4CLSA 3QRPA 2OHDA 1WDTA 3I5CA 1DZ5A 3ENVA 4EZ6A 4RW4B 2NPFA 3GIMA 3BDPA 2HNZA 5F0WA 5HI7A 3SSSA 2ZH2A 2XMUA 2F8HA 5ETKA 2QX0A 5T7LA 4PWDA 2FHOB 2OUGA 3NGSA 3BGLA 1M0SA 5C2GA 2H5EA 1FWPA 1RCXB 3ZZPA 2VPYB 3MM7B 2C3OA 2Y0SD 2YXLA 4PXCA 3THPA 1G2EA 2C2MB 4HYKA 2FVSA 4P7VA 1WTBA 3AD8C 2E1PA 3CO9A 1YITS 3FMBA 1DTTA 2IMWP 4DN0A 1HQEB 1GEHA 2NXCA 3N5BA 4CLKA 1NHVA 4ZKAA 3Q24A 5LMNJ 4DOZA 3EGWB 4XPCA 3PX6A 2V0NA 3RR7A 2GVZA 1KLMA 5L38A 4ZLLA 2W7OA 3BR9A 3ZTRA 4RWWA 3Q8QB 4JYAJ 1P1LA 4EZ9A 2O5DA 2IY5B 1O8BA 1U02A 3LP1B 1LFPA 2YNFB 5SZTA 4IR1A 5L9XA 1FK9A 1HBNB 2OEJA 3DM2B 3GTYX 3ISZA 4LQ9A 4NEZA 4C8NA 4ZLJA 2UP1A 2ZC3A 2DNOA 4NZ7A 2PE8A 4KFBB 3M9OB 2JL9A 3M8QA 1OQ3A 3B78A 1HBOA 3NWRA 3HK2A 5CHCB 5J1NA 1RAJA 4GC7A 3PW4A 2J7KA 4RKUC 3HLUA 2ADCA 4OYIA 3CEDA 4CH7A 2LXUA 3HSGA 3LF0A 3M32B 3THTA 2E7VA 2L41A 3QZ7A 2HFVA 2K1RA 1DLOB 4ZS6A 2N7YA 2HVZA 1D8ZA 4CTAB 4JI2J 4IRCA 2XMWA 3KTQA 3A3PB 3HD1A 3WDOA 2W9CA 1CQMA 4DL2A 5B7WA 5CYMA 4LF6F 3S01A 2EG1A 5BR8J 2E1RA 2W24A 3GB0A 1XMQJ 1VIXA 2HQFA 2Z56B 4AYBD 2UXDF 2ZH9A 4ER8A 4E0DA 4KC5A 4MFBB 1Q95G 2X3GA 2OKQA 3H2LA 1X4GA 5ETRA 2EFNA 4PWUA 2LQ8A 3D0HE 4TKTA 4WJBA 4YR2A 1RISA 2VG5B 4E2FB 2W8KA 1SCJB 1TKDA 1N5TA 1TELA 5J2QB 5DM7Q 1TUWA 4CNZA 4WF9Q 1UFWA 4NI2B 3NS6A 3I9V9 1RK8A 1X0FA 1FKOB 2GIFA 3FQKA 5D0GA 4CRJA 2GV1A 1S57A 2PO4A 4RZRA 1HHSA 1UW9A 2GA7A 2FGCA 4GO5X 2Y1JA 2MSTA 4YQWA 2MQ8A 2Z8QA 3C6TB 3PYEA 2X1FA 4ALZA 1FRMA 2KL8A 3IG1A 1HQUB 2MTLA 1F9FA 1LWCB 2GX8A 3AT1B 1VHIA 2HGNA 1T9UA 3FJ2A 3UR0A 3KK3B 2XYHB 2M8HA 2Y1LB 2IRYA 2GHVC 2XYPB 3PW5A 4M5KA 4C8YA 4OYAA 1RHKB 2E9ZA 1VQYA 1XNQJ 1KQSR 1HWLA 1ZS6A 3GYGA 1S9EA 2Q6BA 2VF3A 2RVJA 4DR6F 3Q2SC 3MM6A 1IBMJ 2CWKA 3J80Y 3HVTA 4FVCA 3UVJA 4FBTA 1M1GA 4FPRA 1DHMA 4DF8A 4OYBA 2DHXA 3A1YG 1KTVA 4PG6A 5C5JA 2DR7A 3IBWA 1J5EF 1JMTA 1RT3A 1APSA 3Q8YA 1CJTA 2BOPA 3ZTPA 2VPZB 2NR0A 1S48A 5EWFA 3BM7A 2VB6A 3ENQA 2V50A 4PWWA 3CD7A 4L3KA 2BOAA 5IV3A 4YP3A 5EGYA 2Z2ZA 2IVMA 4UZCA 2AP6A 2IYIA 3D1OA 3DLEA 3DLJA 4DL4A 1F5BA 4A4JA 2GGPB 2A10A 1Q79A 4X62F 2BX6A 4OZ1A 4AQYJ 1M1KT 2O3DA 2X1GA 1VQLS 5HBMA 2QL7B 1R8AA 3MEGA 3PYGA 2OPRB 3VALA 2CNLB 3H8YA 4O3NA 1N5YB 3QJJA 4I69A 5GVQA 4PG5A 1JLFB 1Y5NB 3MMCB 4PYAA 4QWBA 4BWMA 2CZ9A 1PSDA 1VISA 2JLFA 3EMTA 4L3NA 2JEFA 4B9UA 2HHHF 3N6MA 5KFNA 5ETPA 4KHPF 3ZZTA 3M1VA 4HL9A 4DV0J 4IFVB 2HNDA 3A4TA 3VV2B 5EWEA 2J7UA 3ISND 4KR0B 2KYXA 3HI9A 1ZM4A 1HBOB 4C98A 4F0HA 4WFAQ 1HBMB 4FS1A 2YKNB 3GFXA 1KKHA 2EFQA 2Y8WA 1HBUB 1YBAA 1ZPWX 2HNYB 2RDIA 3HT0A 4NWBA 5A8KA 1SJFA 4JI0F 4DV6F 3L95X 2BUNA 4Z37A 3EM1A 3ZZUA 4OZ2A 2ZM6F 1KD1T 2WVFA 4WE1A 4M5LA 4OJ1A 4JI1F 3O8WA 4G3IA 4X2BA 1UEUA 2KM8B 2CQPA 2XMTA 4JBCA 3DCAA 2BR0A 2GNKA 4FN5A 2AJFE 1XJWB 3V5RA 4YFUA 2HAIA 1D3WA 3HHNB 2FZKB 3KJFB 4FXVA 3U7JA 2BQ3A 4CLTA 4DV5J 2OSRA 3QLHB 1S1WA 2UUCF 4R8UA 1JWWA 4F4AA 1XWLA 3D66A 4NI2A 5B0AA 2DITA 4B3OA 4K4ZA 3SV3A 3UPFA 5IWAJ 4TNOA 2GHWA 1RBOB 3DGPB 3GILA 1VOMA 2UUTA 1TU0B 1PYSB 3G86A 4EGLA 4EI2A 4LRDA 3NBPA 4ZPDA 2VQFF 5DGAA 4OI2A 3T9NA 1VBXA 2MZQA 2ZOGA 3PEJA 3TWZA 2K3KA 1N34J 2DXFA 2RHQB 2XWYA 2EKNA 1ZOTA 2ACYA 2CQ1A 1H6KX 4IO9Q 2CVIA 1VYAA 4F26A 4HKQA 2B3TB 1FNOA 1IVZA 2IM0A 1U7LA 1IR0A 1K1SA 2EVZA 4K8RA 4RNNA 2RB7A 2VQFJ 4I67A 1FHTA 4GVBB 1ROFA 3CD5A 1GXTA 1X4AA 1WEZA 2YWGA 1IXKA 3MEEB 2ZH4A 4DEZA 3PFOA 3RAMA 3ZZYA 2LU1A 2JVOA 3IWNC 1SKUB 4CYUA 4ED7A 2KT5A 2FIUA 4RBUA 3UCUP 3SQGA 5KG2A 1KTQA 1RTZA 1E6YB 1RT3B 2VJVA 3ONQA 2WBMA 4DR3F 1AA1B 1SL2A 2ZBRA 4LF1A 1UWBB 1YJUA 3ULHA 5IS2A 3PKYA 3D1HA 1HHQA 1BE4A 4ED2A 2QMXA 3BKFA 2RQKA 4LR8A 2OFGX 2PGCA 3GR1A 1WC5A 5GMDA 2AJ1A 1P9YA 1X5PA 2CJ9A 2W7AA 4DR5J 2DKOB 2R42A 4YB6A 2PIIA 4TN2A 3T19A 4PWDB 2NZCA 2VKZG 4KRWA 2BQRA 2V68A 5C24A 1PGZA 1B7FA 2QGFB 3ZZ0A 3W2WA 2W8LA 4N76A 2V8DA 1VRUA 4DQPA 1CJUB 2KFZA 4NZ6A 1MWYA 1VJWA 3CT9A 1NHUA 1YRTA 4V19J 1FXRA 2KTQA 4NYZA 4AL6A 1FDAA 5DS7A 2JVRA 2ZJPQ 4A8XA 4I7FA 4J5OA 3ITHA 1HI1A 3W9HA 2WCXA 1HBMA 3OFHA 5DJBA 5ETMA 1JLBB 4XAKA 4CZCA 3TJ9A 4YR3A 3BBCA 4RX6A 4CT8A 4NA3A 1S4FA 1S97A 2ROPA 3OL6A 2ZDOA 1VFJA 3D68A 4CH0S 2VC1A 2M7SA 3C15A 2VPWB 2RF2B 2KT2A 1Q82T 2DH9A 3D6HB 2C28A 2V9WA 3AJDA 4A48A 2HHQA 2OO4A 3BGRA 1RJJA 3OVBA 3LPEA 4U7CA 3V6HA 2FJWA 3BR8A 2F4FA 3A12A 3AXKA 3MI7X 3S6EA 1PBUA 2W2NP 5KG3A 3KHRA 2BACA 2R8GA 3J7Z5 4JI4J 3MTJA 3ILJA 5LM7E 2YWKA 2HFSA 3M6VA 4I56A 3VTIA 3ZTOA 4DPUA 4YS2A 4JI6F 5BYSA 4JI3F 1NK9A 4AL5A 5C42B 2XGPA 4OHYA 1ULRA 2HRUA 2PA8D 3EE3A 3MHYA 5L39A 4X66J 5DQGA 3W9IA 3EICA 5D8HB 2XY5A 1AFIA 1HARA 1GNKA 1UKUA 3QZ8A 4LF8F 1U6ZA 4O44A 3IWLA 3T9ZA 3KLGA 3FZBA 5LL6d 4M5JA 2JLGA 4QU6A 3ZNJ1 1AZSB 4KGMA 1A9NB 2YKOA 3H5SA 4OQJA 3FMWA 5CYQA 3IRWP 4ECZA 4LF7F 2AD9A 3ELHA 4F4YA 2MKIA 1E6VA 2ABYA 1Z1ZA 2CPEA 1Q8LA 2KT3A 4USKA 5DDRC 4WFBQ 1B0PA 2VG7B 2XULA 2ZITA 2BE9B 4H4MA 4RW7A 2DNPA 4ZPBA 2XMVA 2V2VA 4LSNB 2HWIA 3QIDA 1Z2ZA 2A2CA 3R7BB 3MM5A 5F8GA 2B51A 3DMJB 4O3PA 3OR1A 2WZ1A 2E44A 1NBEB 2DNKA 3HDSA 1XQIA 4RBTA 4USHA 3KMQA 1S1VA 2HWTA 4F8RA 4ZN1A 4NZ0A 3HJVA 2F9JA 4FVMA 2A3JA 4ED4A 5GAEI 2CKWA 1X5TA 2QA4G 2L9DA 4C6AA 4EEYA 3VGTA 4YEAA 3S8SA 2OIHA 1S9GA 2KJVA 2EW9A 3MCMA 1GX6A 1D9DA 3EDRB 2HGLA 5KFTA 4C0HA 1F3FA 3MM8B 4CI0B 2DYAA 2RU3A 2JWNA 3DI6B 2C3UA 1HA1A 2RRNA 2LQJA 4Y0FA 1YI2S 2LCWA 1LQ9A 3DYAB 3FFIB 3H5XA 2HBYB 4DUYF 3AA9A 1PIEA 1SC3B 2C2NA 1HPZB 5KFAA 1S49A 2DGWA 3OQ2A 2N7CA 3OTOJ 3EZ5A 4ZPAA 1U1QA 2Z57B 3DRYA 4WYWA 4ZP8A 2OSQA 1TFWA 3MMBB 1N5QA 2FVRA 1FRJA 1VRUB 3T1YJ 1VLYA 3MUMP 3EPIA 2V2QA 1PAEX 2HHVA 2YNGA 3GG1A 2HEKA 3UNYA 4DUYJ 3F44A 2ZVSA 3JQKA 4OL8A 3IS9A 2BRKA 3TZWA 1PILA 3N28A 4WFZA 1CC7A 2RQMA 3L7OA 1F0XA 4A47A 4ZJQA 2DO4A 2YKMB 3DLEB 2QC3A 3PVXA 1FD2A 3B82A 3BPDA 3C14B 1PC5A 4RR5A 2R7QA 1XTZA 1LWFB 2JRSA 4ZA1A 3SFGA 8AT1B 4URGA 5KG7A 4RW4A 1HHTP 2LLZA 3FKBA 4KGZB 2V4JA 4DR7F 4OX7A 2N4CA 3QSIA 2MZ1A 3GJQB 4ILLA 3DOLB 4ED3A 2YH1A 3CJSA 1XBWA 1Y3JA 2DHAA 4NLSA 5LSOA 4NRUA 3QPIA 4Y2CA 1EARA 2BE2A 3LAMA 3M1VB 5A0YA 4U7UK 1Y7PA 1RTDB 1RTHA 1B0VA 2YWFA 4DDFA 2VONA 2VASA 2GJ2A 2C2EA 2J8SA 2I0XA 5HLFA 1U26A 4X65J 4RUBA 2MPUA 2AGOA 4KH0B 2H1YA 4Q43A 5A8KB 1RT6B 1RAEB 2W4DA 4RW9B 5KFKA 2QLBB 2QLFB 4K4XA 2DH8A 2XMKA 1XR5A 4WE1B 3DU5A 5ETNA 3ET6A 2RD5C 5J2MA 4WTOB 1SL0A 1RKIA 2DPJA 2Y1IA 1QE1A 2IRXA 4DFPA 4FYYB 3DLBA 4UUWA 2GMHA 3LGMA 2NREA 1SV5A 4ED1A 4DPWA 2AYEA 1FDDA 3PKMA 3QT8A 2DD8S 1P8GA 1SXLA 3DLGA 3H5UA 4FZVA 1HNZF 4IRKA 2RJZA 1TQLA 4KE5A 3W5ZA 3UDVA 3KDNA 1N0VC 1I94F 3OTBA 1KFDA 1TVRB 2AX0A 4KFBA 3B4DA 1FJGJ 2EI5A 5FDLB 4KKOB 3J7ZT 4YOEA 4OZ5A 3V4MA 1S1VB 5EHHA 4RW8B 2FJEB 1OYEA 3DDIA 5HQMA 4DL7A 3FSYA 2JH3A 5KFVA 3RBDA 1JLGA 2H51B 5G0RA 2MQOA 5D3GB 2I5JA 2M4MA 1S6QB 1EP4B 2OAUA 2BANA 5CQGA 4Y2AA 4BCAA 1CSJA 1FX4A 4U9RA 4F0KA 3TZXA 3QGHA 2G2YA 1PJ7A 5BYRA 2ZZMA 3HCXA 2I1RA 1DARA 1SUQB 3UW1A 2LYVA 4WP8A 1RTJA 1U6FA 4OI3A 5KFXA 3H90A 2VIHA 2ILYA 3WBZA 4MIBA 4OX8A 1HPZA 3EGVA 3JAMU 4ECSA 1RSCA 1T9WA 4H4KA 1U1MA 2E1CA 2FHKA 4Q8FA 4JI8F 4V19X 1S1TA 3KOAA 1GXUA 2FJAB 4KHMA 1F2HA 2W2QP 2F4VF 3U1LA 3DKDA 3OPKA 2W4PA 2QJ3A 3IAM9 4N56A 5J1PA 3HVRA 4DX6A 3D0GE 4LF9J 3MR5A 2QL5B 4LF5F 1S10A 4Q0BA 1NJIT 4HH0A 3IO1A 4LF2A 2HS0A 5HATA 3VAIA 2VFVA 1WG4A 2CQ4A 1KLMB 2CJQA 4KYZA 5IC4B 3TUIC 1MN7A 4I2PA 3LGHA 2BBEA 2N82B 4ICLB 2R4FA 3CJ4A 2QMWA 3KYLA 4CH1A 2RKIA 2CJBA 2N4DA 4DPXA 3G8QA 3US5A 1JLCA 1LWXA 1Q8KA 2JC0A 3DRPB 2LFVA 3PDNA 3TUJC 3VCDA 2HVEA 3AQOA 5IV4A 5GAEU 1NEEA 4XDDA 3NNHA 1XMOF 4LR7A 2VL1A 3MEKA 1RTHB 4R25A 1ZTWA 3SV4A 1IM6A 2CNOB 4LMZA 3MR7A 1RQ0A 5HJYA 4KJIA 2FLPA 1XIQA 3L3CA 1JJCB 4XO0A 2ASJA 2WSFC 2PT0A 3IBCB 1RT5A 3M32A 3PX4A 2RRBA 1X4DA 2CAJA 3NS5A 2AU0A 4K4UA 5ETTA 1V5IB 2BJ7A 3PIPQ 3Q89A 4B3SF 3DC2A 2KZMA 1VQOS 3GR0A 5IT9U 4GKKJ 2GGPA 5I3UB 3IGVA 7FDRA 5LMNF 4X4NA 2V8PA 2L9WA 5HK4A 3TA2A 1H2UX 2ZOMA 3KG0A 3L09A 1ZA2B 1U25A 2R2TA 3Q83A 4H4KC 4RW6A 2RUSA 1H3DA 1HNXF 2RH3A 2J5AA 3DLGB 3TAQA 1HMVB 5EX3A 3QGPA 1QD1A 1QDUB 4NL5A 1U1NA 1KBRA 3I5BA 4HLBA 2QRRA 5T41A 5KOXA 2FY1A 3H40A 3HSDA 2LECA 2GW8A 2E1AA 2ZBCA 2FJDB 1YLXA 4Z7YA 1Y3KA 4LRCA 4ZP7A 4N7TA 3C6TA 5GAGI 1QM9A 3TZYA 2CQIA 1HQUA 3LP0B 5KFPA 3HP6A 3WZ0A 2BANB 2XSJA 1IKWA 4XDCA 2YNHA 1N56A 4Y28C 5F8NA 3PTWA 3SDEA 3ZXWA 1F9EB 3MXHP 1WNEA 1VQ4S 2DNMA 1GTHA 4N77A 5KG1A 4RNFA 5KFSA 2VG6B 3HPOA 1GQEA 2VFSA 3MM5B 3W62A 3CD6S 1C0UA 5HVGA 5E41A 1UVIA 4UUXA 5DG8A 3UNGC 4K4VA 4ECXA 1JX4A 2L48A 4F4KA 2MKHA 1S1TB 2HBZB 4H54A 2BKPA 2Z2YB 4KIAA 2POKA 3M8WA 4K2JA 3H25A 3C46A 1G1XA 2SXLA 5HJXA 5F9LA 1S9GB 2NXNA 2DXDA 3PW7A 4Q7AA 4J9QA 1NK0A 3LOUA 4HACB 1LWEA 1VGYA 1ZETA 2AGQA 2KDOA 2V63A 1L3VA 1F6TA 1RT1A 2Y1RI 4LR9A 3IBFB 4ZK7M 2IRUA 3H7HB 1XC9A 1N4LA 1B0TA 2B56A 4UOGA 1KRPA 4K2XA 3UFCX 2ZKUA 3WIVA 3KLVA 2UVWA 3EVOA 5AJ3J 1NJWA 4IH6A 2HRTA 3KLEB 4RJVA 3AXMA 5KFGA 4ETZA 3OL7A 1JQGA 2C1EB 2OPSB 3DRPA 1H38A 2BEFA 5E3PA 4DSKA 2WVEA 2CRLA 1R6YA 3T1HF 1HNIA 1Q7LB 2YQ0A 2FVCA 2OPQA 5KFCA 4J9PA 1R8HA 4FYXB 2E5JA 4M5MA 3G6YA 2ZD1B 2PD1A 3BZQA 2WOMB 3DRSB 3KLIA 3GIJA 1QVFR 3MWBA 1JLEB 3MPUB 1RAOA 2J9EA 4DV3J 1TZ0A 3FBCA 3PX0A 1FJ7A 3CCWA 3OXLA 4DBQA 3PG9A 2KHCA 3OXFA 5KFOA 2YKMA 3CJQA 1D8YA 1D0EA 3R1LA 3D3CJ 4O23A 3OTEA 3RJMB 3DOMA 3P4UB 4N8NA 4F4WA 1TL3A 1NUEA 4DFMA 1Q8BA 1H73A 2HQ3A 3VVUA 2Q6CA 4CLYA 2MZTA 3DHXA 3W2VB 2R7TA 1KOOA 2B4OA 1FRIA 2R2SA 5C7PA 2QLXA 4RU2A 3FBEA 2BE2B 3GIKA 4OI1A 4EYHB 1Q86T 3E2EA 2YNFA 5KOWA 4OFZA 1IN0A 4RW6B 4NEYA 3H59A 3GFZA 3BO4A 1HBNA 1EX8A 2FD2A 3G8TA 2ZH8A 2DRAA 2B5JA 2VFTA 3GG0A 4B3OB 2KRRA 4LJMA 3TO8A 4LFBF 3QO9A 5L1LA 4C8LA 3M8QB 2ZZTA 3WX8A 1NB2A 1WHXA 1IJFB 1C2PA 3BS9A 3M9MB 1NM2A 3T6JA 4B3TF 3WX4A 4I2QB 4WU2A 4M63A 1RT2A 3QYYA 2Z2LA 1IBLJ 1KR4A 2C3MA 4MAKA 5ETSA 5KFQA 1GFWB 1HNVB 3G8SA 3QAUA 3MPVA 1NHKL 5LOQA 3ETOA 2EFOA 5DQHA 1M5HA 2DY9A 3PYDA 2M70A 3GQCA 5KTQA 3OFFA 1A6LA 2HK3A 4JI7F 1GTEA 1Y4ZB 3DDKA 4ZPTR 1Q8IA 3FCVA 3KLHA 5DO2A 1WEYA 1ZTTA 1R27B 5EUHA 4MFBA 3VR1A 2DBBA 3TQEA 4QYZK 3M6UA 1RWVB 1QVGR 3H42A 3V6DA 4USIA 3VGSA 2ZZNA 1X5SA 3VAGA 2UXDJ 1SJ1A 1E6YA 2D9PA 1EQMA 5DDQC 2NSCA 2QYCA 4DQIA 3TP2A 4PQUA 3KLGB 3IGNA 3UCGA 1SIWB 3B4MA 3MAAB 2D69A 2CJYB 2IC3A 3KHGA 1AT1B 1YDLA 5ETLA 1DAXA 3VAJA 1WC1A 3M8ZA 4HHHA 3G82A 3KK1A 4DR3J 4ETXA 1SB6A 1JLQA 4DL0C 3LWLA 1FJGF 3ZZZA 2P6TA 3LWMA 3CSKA 2FGOA 3CJRA 1Y5LB 2KKHA 3MAHA 1N52B 4NMLA 2B0GA 3GMGA 1R89A 1FWKA 1SH2A 2B9XA 1FRKA 1TKTB 1TFYA 3R5JB 1DQ9A 1R6VA 1V5VA 2IJFA 2FZCB 2CQ0A 4NXMF 2E9RX 3CULA 2EK1A 2RQCA 2IHR1 1UPPA 3BN4A 1S0OA 1S9EB 2FHMA 1UFKA 5KFUA 5LJ3Y 1I1GA 2IM1A 2J76E 2OEKA 4HEA9 3GJRB 4ID5A 2YTCA 4LT6A 2GIRA 2OPQB 4CLZA 1HR0J 2UVUA 4ANEA 1X4EA 4LFCF 3KLIB 3I31A 1FRHA 4ANCA 3RZAA 4QIWD 5CAAA 1NRKA 4OZ3A 2V67A 4YHHF 4FF4A 4K0KJ 4MYUA 4CLWA 3KK2A 3CCSS 2BRLA 4J9LA 4EBDA 2CPFA 3FZ2A 3D6FB 1J5OB 1KVIA 2QIFA 3TAMB 1U0HA 4ZN3A 2HAFA 3DYAA 3DDNA 3BGRB 2AV5A 3Q8RB 2VJUA 3TOQA 4CNYA 4EO6A 1NK6A 5T7LB 3H4BA 2WK4A 2AEJA 2O66A 1YHQS 2CUYA 2CDRB 3KJNB 1T3OA 3TVKA 4DG1B 2FJBB 3S1TA 5LSLA 4K0KF 2IDLA 3MMBA 3QT5A 2GCFA 4LF7J 3GFHA 1WKKA 5LT5A 1KP6A 1OS5A 3KHHA 1GX5A 2HSEB 3L7UA 5ETOA 3RRKA 4NLGA 3VGVA 4I64A 5KG5A 3J81Y 2ZH6A 4M5DA 4QIFA 2AKWB 2IBKA 1K0TA 1LEOA 2RHSB 4OX9J 3IA0A 4DMZA 4E8UA 3IS9B 3SI8A 1RU1A 5HMWA 3QT6A 4AXIA 1X4CA 2Y0BB 3TR5A 2MQMA 5B0DA 4F2SA 5JMNA 5H9EJ 1MU2B 1CJKB 3Q22A 3AODA 2RS2A 1SJ4P 5FJ4A 2HNYA 2VBYA 3O5TB 5A8RB 3T5KA 2J6UA 1RT7A 3CVKA 3GFYA 3LAKA 4UOHA 4KB7A 2VBXA 1U1RA 3ZFVA 3GLJA 2ZJRQ 2ILZA 5E3AA 4IG3A 4NX9A 4LRBA 1KQFB 1ICEB 4R0EA 5D78A 2H65B 3DMJA
chains in the Genus database with same CATH topology
2YKPA 4EO8A 5L9NA 2KB2A 2D1CA 3M2VB 1S6OA 2AYMA 1UJ6A 3LP2A 4DSFA 1IKYB 2XWXA 2GO8A 2E7XA 1O0PA 4MJKA 2PMHA 3JSMB 5CZXA 1AXQA 2IAJB 3M9OB 1U8SA 1YIJS 1SKRA 2ALZA 2DNZA 2XLIA 1DTQB 1FCAA 3FGVA 4RLEA 1R7IA 2J9DA 2KHDA 2NXUA 2LA4A 4KHRA 5EDWA 1SL1A 4MTPA 3R1HA 2CPXA 4C0OC 4B3MF 2ASYA 3DRRB 4Y2MA 3H25A 1C0UB 2OPPB 1OSDA 2CQDA 4OX6A 4QPTA 3VQTA 1Y0HA 3J7YU 1TV6B 2AJQA 5EN1A 5GAHU 1XR7A 2IBOA 3CCQS 5F3ZA 3E01B 2DGUA 4E98A 3I5AA 3I32A 3AY0A 1VQKS 1H2VZ 2YNGB 1C4AA 5DQIA 1WF1A 3O1LA 4ZPVR 1OIAA 1DRZA 5JJBA 3T5JA 1URNA 2FLOA 3THVA 3MR6A 2CPYA 2XZWA 3TW0A 4DPOA 4QCLA 4KGKA 4Q2MA 1Y5IB 3KLEA 1REVB 2MQQA 3HHLD 4JI4F 3BGUA 2GMJA 4I1TA 5CA5A 3G6VA 1KS2A 2FLNA 3CF5Q 5DETA 2HHTA 6FDRA 1ZAXA 3W2WB 2KN4A 3ENWA 3RW7A 1A7GE 1KNZA 2EPIA 1DFDA 4RUAA 4R0JA 4TY9A 3K5OA 5HLFB 1D9FA 1V6HA 2MSSA 2LMIA 4IDKB 4D3GA 2WB4A 1UMJA 1VQ6S 2J8AA 3SMZA 1TAUA 3G6XA 3PO4A 4BC9A 3V81B 3MUVP 1FKPB 1PC4A 2EBEA 1AW0A 2XS2A 4ZHRB 5HBMB 1HI8A 2GQCA 1UJ5A 4DLEA 1NJXA 2MDAA 4ECUA 3R3TA 1W25A 2DK2A 3I4HX 4OHZA 4OJ3A 2JFKA 2HFZA 4U67Q 3I0RB 3U1MA 3H4DA 3CB4A 5J2PB 1VC5A 5DDOC 4YY3F 1TL1B 2G9OA 3EUNA 2DR5A 2DNYA 3JTPA 2XLJA 1CVJA 2QSWA 2YKNA 3TA1A 3RB6A 3RBEA 3WC2A 5D3GA 2CJKA 2PC6A 4LSLB 4QZVB 4I6AA 1TKZA 2LU2A 4Q5VA 2QO3A 4BC7A 2DGTA 3TNVA 3FDSA 3OTOF 1BQXA 1HYSB 4N8OA 2WSCC 5IQQA 1FEEA 4B9VA 5JVGQ 3CWJA 4ITSA 3AA8A 3EGZA 1NKBA 5DRKA 3UDCA 4H4MB 4GC6A 1WEXA 2YNIB 2PA3A 4JYAF 3IR6B 3MECA 2LEAA 4OLOA 4C7QA 2FB0A 5CH7B 2MJUA 3OR1B 4J9OA 3RB3A 2NSBA 5F9NA 1FKAF 3M6XA 2BJEA 3FQLA 4NLVA 1FJEB 1TKXA 3M8PA 1QTMA 3HHKA 4YB7A 4Y6IA 4OMFG 2JEJA 3H98A 2J9DE 1QAYA 2BXJA 2XSJB 1QSSA 5LJ5Y 4ICLA 1NJYA 3MM8A 3KJVA 1REVA 1ZH5A 2G4BA 3V2UC 2DGVA 3PRBA 4ZDNA 3OR2B 2CIMA 3T5HA 2KG0A 4ID5B 2QV6A 3EXYA 2JC1A 3MPYA 1W2BR 2R8JA 4X4SA 4LIRA 3MM7A 4BWJA 4I68A 4ED5A 5KFFA 1OWXA 2KXNB 3CXCR 1B7FA 1L3UA 2DISA 3MURP 2F7VA 3N6LA 2FVQA 4ED6A 1JJ4A 2HZCA 1DTTB 3TA0A 3PV8A 1UVNA 1ZM2A 5E7OB 2V5HG 1XNRF 2EFVA 2RNEA 4F3MA 5D4PA 3CJKB 1Z2LA 2CPHA 1H2TZ 3RW6A 2RT3A 2CQ2A 2HYIB 1Q78A 2Z2MA 3I6PA 4DV1F 5A8WA 1QSYA 3HKZD 2DRBA 2I38A 2P5VA 4DG1A 2V4JB 5HQ8A 5JVHQ 1LW2B 5KFHA 5IT4A 3FSXA 5IXUA 5J1EB 1N48A 1TL1A 2WOMA 3HVAA 3HJFA 3CCRS 4G1QA 4QBUA 5ITHA 2UZAA 3DNCA 2R7UA 2K2PA 3CDUA 4Q45A 4QIEA 2WAQD 1JLAB 1UA1A 4WXWA 1NK7A 3H5YA 2PDAA 1VK8A 2M52A 3FVYA 4P6QA 2MGZB 5E2QA 1NH7A 2XSFA 3TVYA 5G4DA 3TI0A 2GJIA 5J2NA 2VG6A 2W4CA 2FDNA 1QE1B 2EG2A 4ES3A 5A2QY 5CCLA 1UEVA 3PW2A 3K5NA 2BABA 4J9KA 3K8WA 2IVYA 3CCLS 4DLGA 3ISNC 4Q44A 3HZEA 3FEZA 3SCLE 2KXFA 2NLWA 3OVAA 2AF6A 3NGDA 4A8WA 2B5JB 1NB7A 1VQ8S 2IM3A 2Z4PA 3B8HA 2ZC4A 1FKOA 4DR2F 1HI0P 1FXLA 2LXIA 3PNIA 4ECRA 5E33A 3R5DA 4O44B 1OPIA 4RW8A 2E7WA 2ZE2A 2OMLA 4LUBA 6FD1A 5IT9Y 2MQLA 4IG0B 2G1DA 2MY7A 4F4ZA 2HHWA 3CCTA 1HNVA 3POTB 5HO4A 2UXBF 2M2BA 3UDLA 5KT7A 3I82A 1HD1A 5E0OA 1LW0B 1LXJA 4RW7B 3M30A 1F5CA 1TV6A 3CIMA 2FPHX 2AW0A 2L08A 2YH0A 4NPOA 1RTJB 3HX9A 3M8SA 5K8OA 2AYGA 2E1CA 2I2YA 3MOZA 5EWGA 1HNIB 3HM9A 2ZH7A 4NLWA 3V6DB 4K4WA 2ZD1A 3DRSA 3F41A 3HHLA 4IFYA 4ID8A 4AXJA 3E51A 4JI2F 1IQZA 3LALA 2HG4A 2KJWA 4UOCA 2KM8C 5K8PA 3W3SA 4WU3A 4DS5A 4IRDA 5AJ3F 2IM2A 2L3MA 4URSA 2DGXA 3UWTA 2QSFA 2QT7A 4NLUA 1TL3B 1IKVB 4ILRA 3AB2B 1JLQB 4EBCA 3BSNA 2HNZB 4RNHA 5KFBA 2NQPA 2EC0A 4NLPA 3G96A 2ASDA 2R7RA 4K59A 3P49B 4X4OA 4OHVA 1M5PC 4IO1A 1RA7A 4WZQA 2J9CA 3UE2A 4OZLA 5F8IA 1KONA 4A8SA 1O5JA 4HI2A 3D1QA 5C42A 4ELUA 2MKJA 4YUDA 1MMDA 2RS8A 5KT3A 1VMBA 2HNDB 2NPIA 3OTCA 3FEYB 2MJNA 1ZBTA 5F3TA 1JKHA 4FBUA 1S76D 2XS5A 1HW9A 2VZ9A 1JJ2R 2VA3A 4FF1A 3C8YA 4HVZA 5CZVA 4PXEA 3LH2S 4K4TA 1VRTB 1K9MT 3BSAA 5KFYA 1LFWA 2FJXA 3OLAA 3DOLA 2J6TA 2X1BA 1FK9B 4WZMA 1WG5A 3I0SA 5MLCV 5J2PA 4LFAF 1WWHA 1L3SA 2VFRA 3CDWA 1F5AA 3KKFA 4WIIA 4N5SA 1IKXB 2KH9A 2MKKA 2E66A 4PPZA 5AE2A 3Q8SB 4ZVEA 3SZ2A 5SUHA 1MW7A 3IRXB 3E3XA 1UVMA 5F41A 2Q66A 4IOBA 1VBYA 3O2IA 2IC3B 3SCIE 2CDQA 4YFUA 4WCEQ 1FERA 1VK3A 2M9KA 4R5PB 5B08A 2KRBA 1UVKA 3UD4P 4O3OA 4CT9A 4DHVA 4DV5F 2DR8A 4C3KA 3Q0AA 2J0SD 1PO6A 2R7OA 2YNHB 2XHWA 5B0GA 3BO2A 4TU9A 3KWMA 3OSPA 3SDEB 2MXYA 2LQ5A 2CPDA 2YNIA 4KO0B 2BM0A 1L5UA 1KQSR 4RBVA 4TY8A 3TAPA 2CFXA 1R0AA 1TVRA 3NLCA 3UR3C 3MEEA 2XI2A 1FTCA 1FNMA 2HLUA 3MPWA 4ES2A 3SEOA 1FNXH 1YJ9S 1X9MA 5AE3A 4NYOA 4DN9A 1HD0A 4CO4A 3LP2B 3UD3P 1UVLA 2HGMA 5KG6A 1DQAA 2QLWA 4DL3A 5K8NA 1N33F 1RT1B 3LUYA 1R8BA 1BY9A 3CD0A 1QJHA 4QU7A 1JB0C 2VC0A 4TU7A 2Q43A 3OR2A 2APOA 3LPYA 3J7YI 4FNHA 2EFGA 4I4BA 4NOHA 4F25A 3VAKA 4FP9A 4AFFA 5B0FA 4ECWA 3HXMA 3TVZA 1N6QA 2K8GA 2OPSA 1IUJA 3IR7B 1I6JA 2MKSA 2W25A 1U2FA 3MEDB 3T1AA 5IQ6A 3TARA 4NLRA 3HF5A 3CC2S 4A8KA 2X1AA 2DNRA 3HZGA 4OI0A 4O3QA 4C3LA 1HL6A 2CPJA 1T95A 3GYXB 2EBGA 4DFKA 1EETB 4IOCQ 3CJKA 1JJHA 3C3LA 1K73T 3CDBA 5KFRA 4OX9F 4J9RA 1M5OC 5A8RA 3NWGA 1MMLA 4DX8H 1QAJA 4ATNA 4B9LA 4DUZF 2VBZA 3NCPA 3JYTA 2GMLA 1YSJA 2RUGA 1S6PB 3I0SB 4ZCIA 5HMXA 2BZ2A 1S1UB 3L7PA 1N8RT 1JLFA 3MMCA 1NNDA 4OZNA 4A8QA 3PO5A 3NCRA 3IRXA 1OQ6A 5KFLA 4XIUA 2AJ4A 1JNRB 1YJRA 3GV7B 4X64F 2G0CA 2KXHA 2KFYA 1ZAWA 4BDPA 3M05A 2D3ZA 2KFNA 2JDJA 1P1TA 2HRYA 4NLQA 5B09A 3BDEA 1VBZA 3N5FA 2DR9A 1SH3A 5AXKA 5AXLA 1KLNA 3HHLC 3R5AA 4TQRA 1FDNA 4EWTA 3AH6A 1UW4A 4C97A 4IKAA 2UXCF 1C1BA 2CQBA 2HFOA 3RU0A 4CCHA 2U2FA 2UV8G 3DGPA 5MAOA 3CJ5A 2DB1A 4NYPA 4AE5A 3KHLA 2V8GA 2XO7A 2B7CB 3LO3A 1QSLA 2WBRA 4NA1A 4PQUB 3J7A1 2R7WA 4WK3A 5IM0A 3GV8B 3M30B 4ZLPA 2XBPA 4LQ3A 1YGYA 3SXLA 1X9SA 1URRA 5KT6A 1S79A 4I6WA 4ZCMA 3Q8PB 2MZSA 2E5IA 3NG8A 1FRXA 1YRXA 4QIGA 2IA6A 1M5KC 1MSWD 3OBIA 2DCLA 2N3LA 1NK4A 2JZ5A 3CDEA 4YDXA 3SQGB 4ZMMA 2CG4A 2FC8A 1C4CA 1S0NA 3OVSA 2AWZA 3HMJG 4ZPWR 3S7RA 3PRDA 2XMJA 4QWEA 4ED0A 4OHXA 5HN0A 2K3IA 5M2RA 5K9FA 3D5MA 1N36F 4MKAA 4RUCA 4O4GA 3QJLA 2MZRA 2E5LF 4L6V3 1UL3A 3RYLA 4B08A 1UWBA 2YKAA 1Q7YT 1X4HA 2GQ2A 5L1KA 3PW0A 4AUKA 2OH2A 2RSQA 1HR0F 4Y00A 1BLUA 2XCAA 5C24B 1T94A 3OV7A 1S1UA 1RTDA 3K0JA 1C1CB 2HPUA 3CCES 4F3QA 1N5VA 3ITHB 3OHBA 4WK1A 4QYZJ 1KQGB 1JKHB 2RQ4A 4UY8T 3K59A 4GMKA 2HS3A 2WONA 1FD8A 4USJC 3ZZRA 3AQPA 1YTYA 2M5YA 3SCJE 1KN6A 2MB0B 1RGVA 1R8CA 2RF2A 1WHWA 2MHEA 1BQNB 2H9ZA 4L72B 1D1UA 4ZP6A 2R7VA 2W9AA 2LEPA 1Q81T 1F2GA 1RT7B 3N9UC 1JIHA 1N54B 3GSDA 3MEGB 5A6PA 1KQKA 5H9FJ 5I42B 2HMIA 1LW2A 3OUYA 5F0UA 4LF9F 4Y3CA 2M8DB 4IQXA 1N32F 4QR2A 4QIVA 5D4LA 4IG3B 1T03A 3RB4A 2MKCA 5JXSA 5HL7Q 3KLFB 4IFVA 4DJBA 4KQZA 1TK8A 3NNAA 2VOOA 5E3RA 5DDPC 4K5RA 5KT4A 1TKXB 3IFEA 3OFEA 1X4FA 1RP5A 2OP5A 4I2QA 3QGGA 5KFMA 1T7PA 5U47A 5AXNA 3D28A 2WTFA 4DV3F 2FTRA 2V2KA 4JOUA 4DWIA 3RTVA 4QWAA 3H2UB 1K1QA 3U02A 1DTQA 4PPDA 2V4QA 3G4SS 3KLHB 3A8EA 2LVWA 1HWKA 2PN6A 2K7JA 3HVWA 3KNGA 3QLHA 3BGFA 2FC9A 3I4PA 5B0BA 2R8IA 4DV2F 2P9EA 3CJ3A 3MGJA 3C66A 2ZH3A 3U27A 3VF0B 3CMAS 2DHSA 3AB4B 5GADU 2PI4A 1IQTA 3EXCX 2KI2A 1TK5A 4U6PA 3HT3A 1G3OA 3D54A 2R8HA 3C2PA 3KK1B 1RTIB 3LGNA 3PJXA 3POTA 2ZBIA 1BQMA 4MIAA 2VV5A 2MYFA 2D41A 3MOJB 2LQBA 1LW0A 1CLFA 5DG9A 3N0VA 2A1BA 4FNIA 4K4SA 3F73A 1LXNA 3AHPA 4LVNP 5KFZA 4DV0F 4DF4A 4X84A 3TRGA 2R7XA 1NZAA 4ILMA 4ZVGA 3K5LA 3GV5B 1C1CA 1P9QC 4D3HA