2BJEA

Acylphosphatase from sulfolobus solfataricus. monclinic p21 space group
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Conformational Stability, and Enzymatic Properties of Acylphosphatase from the Hyperthermophile Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords ACYLPHOSPHATASE
total genus 23
structure length 90
sequence length 90
chains with identical sequence C, E, G
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bjeA00
1FESA 2EW9A 2JDJA 3HHLC 4OIXA 2HFNA 1GXUA 1VQSA 4HH1A 2XMJA 1SQEA 2AW0A 1N5SA 4QOTA 1Q8BA 4HI2A 1Y9OA 2LQ9A 5B0DA 2RMLA 1WD6A 2K1RB 1Q53A 1Y3KA 2ROEA 4OJGA 1JK9B 2BJDA 3LO3A 4DPOA 5T7LB 1AW0A 2GA7A 2GCFA 5B0GA 1YJRA 1YJUA 4YDXA 2BBEA 4HH0A 4ZOSA 3TOQA 2IFXA 3MZIA 2K2PA 5A6PA 1W2IA 2CRLA 2XMTA 2OAUA 5B0FA 4NPOA 4ZA1A 2G9OA 2N4CA 2N4DA 2ROGA 3BDEA 1QUPA 4DN9A 2RILA 3FGVA 2PD1A 2VV5A 1OQ3A 3GZ7A 5T7LA 4A4JA 1TUVA 3FMBA 1MWYA 1Q4RA 3KNGA 5B0AA 2XMVA 2BUNA 1VQYA 2K7JA 3HX9A 2FB0A 3BB5A 2ACYA 2VH7A 3F44A 2LXFA 2KYZA 3TNVA 2OKQA 4YEAA 2XMMA 3LGMA 2QIFA 4NL5A 1S6UA 1S6OA 5B08A 1N5QA 3KG1A 5B0EA 1FVQA 1KVJA 3DXSX 3QMQA 1ULRA 2BYCA 1KQKA 5KAKA 1GXTA 1XBWA 3HDSA 2HQIA 1SI9A 2XMKA 2KKHA 1X8DA 2GGPB 1Y3JA 3WDOA 2FTRA 1URRA 3CJKB 3BM7A 1YJTA 2FHMA 2GGPA 2Q3PA 3IWLA 2W4DA 4DL0C 3IWXA 1V3ZA 2FIUA 2GFFA 2IYIA 2W4CA 1AFIA 2RSQA 2AP6A 4OJ1A 1MWZA 3HHLA 2BJEA 1OSDA 2ROPA 1RJJA 2QLWA 1TL4A 2OD6A 2ZDOA 3BR8A 4Y2IA 5F0WA 5B0CA 1X0PA 3KKFA 2AJ1A 2ZDPA 1TL5A 3E8OA 2HLUA 4HL9A 2KT3A 2OP5A 4Y2MA 1IUJA 1FE0A 3K7RA 2ASYA 2GO8A 3FRYA 1Y0HA 4OJ3A 4HI1A 3UDCA 2L3MA 4U9RA 5F0UA 1P6TA 3LGNA 4F67A 3KG0A 3T9NA 4FNIA 1Q8LA 1YJVA 2IYGA 1FEEA 1JWWA 2HFOA 2XMUA 3HHLD 2OFHX 3HHLB 2GV1A 1SB6A 3HF5A 1OPZA 4FNHA 1P8GA 2QYCA 2W4PA 1AFJA 2HLTA 1YRXA 1KVIA 2QLXA 4Y2KA 1X7VA 4EFAC 2XMWA 2PGCA 3VTIA 1APSA 5B09A 4A48A 2HIQA 4OJHA 2N7YA 3HFKA 1YG0A 3BF4A 3I9ZA 4Q2MA 3CJKA 5IXUA 5A6WA 1CC7A 3BN7A 2RU9A 3DCAA 1FE4A 1FD8A 1R6YA 2AJ0A 2K1RA 2LDIA 2OD4A 2OFGX 3TRGA 5B0BA 1N5VA 1FVSA 4Q2LA 4A46A 1CPZA 1CC8A 1TR0A 2LQBA 1TZ0A 4A47A 2K7KA 1K0VA 2KT2A 1N5TA 2OMOA 1LQ9A 1U7LA 3QGPA 5K9FA 1OQ6A 3MCSA 3BGUA
chains in the Genus database with same CATH superfamily
1RKJA 2GQCA 2EW9A 2ZBCA 3HHLC 3HVAA 5IM0A 4RZRA 4TQRA 4OL8A 1K8AT 2KXFA 1EP4B 3CCZA 2W2MP 2HS0A 3ILLA 4ZVUB 4BC7A 5KFMA 3NL0A 1RCXB 5FLXU 4QWDA 4ZPAA 4NASA 4LF2A 2KXHA 3ZZUA 1Y4ZB 3LO3A 2BJ8A 5KT7A 1D9DA 3BSOA 3M8QA 4K59A 3HM9A 5L38A 3I56S 3RU0A 2K3KA 1PO6A 1RWMB 3W63A 2IM2A 2MQNA 1FJGJ 2BBEA 3ZZTA 4HH0A 5HAOA 2KVQE 5L9NA 2XGPA 4LFBJ 2CJXB 1S6QA 1O51A 1WG1A 4AXJA 3OVAA 2YNFB 3KMQA 2ZNYA 4CO0A 4MFBA 2HVIA 4O23A 2QA4S 2QO3A 3PRBA 3LA0A 4HDHA 4USHA 1K73T 2W9AA 3MMBB 2PD1A 4DUZJ 4JI8F 4F3OA 3W8GA 3WX8A 4A4JA 4AL7A 1DJ0A 3ETMA 5B0AA 1DAXA 3OL7A 1RTDB 5K14A 1S1WA 2W9CA 2IIHA 1RBOB 2VH7A 4JYAF 4RW6A 3G8QA 3H59A 3NEKA 1HQEA 5KFKA 1NK9A 1RA6A 1I51B 1TFYA 2VFSA 1SKRA 5LT5A 5C25A 3D66A 3J80Y 3SBMA 1VQPS 2JVRA 1SC4B 5JVGQ 1S6OA 7AT1B 1JJCB 2YNIB 1K47A 3MF5A 3K5LA 4I2QA 1N5QA 3HKZD 4DF8A 5D0GA 1HHSA 3OVBA 4QYZJ 2PIIA 1LFPA 1RT1B 4RLEA 5HP1B 3C46A 5A8RA 1NJZA 1RHJB 3NLCA 4TN2A 3PIPQ 1TAUA 2QA4G 2L9DA 4NX9A 4I56A 2MLZA 2X1BA 3D1HA 4ZCMA 1S9GB 2R8HA 4A8KA 1NJYA 1PAUB 1DBDA 4HHUA 1TKZA 2WCXA 1NH8A 4NZ0A 4CTAB 5J2MA 3Q0AA 2J0QD 4X4QA 2VOOA 3EGZA 4ID5B 2BZ2A 3TUIC 4YOEA 3CE8A 2ZJPQ 2LEBA 4ED5A 5D3GB 4HHJA 1DQ9A 1ZOTA 2ZBQA 4WBFA 4NLTA 3ENAA 2GVZB 3AJ2A 4ED4A 2VODA 1CLFA 2DGSA 1A0OB 3A8KA 4HVZA 4LF7J 4ZLLA 1S1XB 1Z2ZA 1RWVB 2CJBA 1V5IB 4HLBA 3EYZA 4DUYJ 2W9BA 2H1YA 3RGIA 3RW6A 3DGPA 4JB8B 4R0EA 4P2XA 3IC1A 4CLPA 4JI5F 4WIQA 4F0KA 1HMVB 2VPXB 5HMXA 1HBOB 4KKOA 1WF1A 5E3PA 4A8QA 1R0AB 3IMQJ 4Y2MA 4YUDA 3CO0P 1F5CA 3BPSP 1MN9A 5HLFB 3A3OB 3QFWA 3FUYA 1SJRA 3IBWA 2UXDF 1RACB 1NK7A 2QL7B 1T02A 4TYBA 1K1QA 3CUNA 4IR1A 1S1VA 4L74A 4WIIA 3O3LA 4DV0J 2DITA 4B3TJ 5KFRA 3C14A 4QPTA 3L3CA 1G6BA 5CZXA 4J9OA 2FVPA 2ACMA 4TU8A 1N36J 2FZKB 2OHDA 4ZVOB 4B9UA 4C9DA 2WSFC 1M90T 2H5EA 3SQOP 5F3TA 2HLTA 2V8HA 4H4MB 4AD6A 4DMZA 2CZ9A 2IJNA 4X62J 1NJXA 2XMWA 3VGTA 3UDLA 2ZHOA 5DG9A 2XLJA 2UXBJ 4C3KA 1ZAWA 1ELOA 4ZDNA 1RT3B 1D09B 1T05A 3Q8QB 2N3LA 1R7IA 1SBRA 2KDOA 2WAQD 3MOJB 2VC1A 1JLFB 2AJ2A 2K1RA 2JL9A 3GG1A 4URGA 4LFCJ 1N0UA 2V94A 1SJ1A 1IR0A 3DOMA 4ILRA 2P9EA 3U1MA 4F2RA 1Q78A 1H98A 2AWZA 2YWKA 3NCQA 1UMJA 5C2CA 4JP8A 4ZPBA 2LECA 1Q5YA 4M94A 3AA8A 4RNMA 2RNEA 3BGRB 3DFEA 1U6FA 1U2FA 2ILYA 3H7HB 1M0SA 1T9VA 1UCNA 2LXIA 3FCVA 5B0DA 3RRHA 1FDNA 2HFSA 4OX8A 4KGVB 1KLNA 1BXNA 3VF0B 3TR5A 1RT3A 2J8SA 4F4KA 3MXHP 1Y10A 5T7LB 2RDDA 3CDAA 4QR0A 2RF2A 5B0GA 1YJRA 1QAJA 4I4BA 1B64A 2XS2A 4ZOSA 2H9ZA 2IFXA 2CPEA 1RGVA 1W2IA 5A6PA 4K4ZA 1IWAA 1RSCA 2FLOA 1A6LA 4WFZA 4ZHRA 2R2RA 2ZH1A 4RW9A 2PT0A 4CLYA 1PGZA 1R6VA 3BDEA 5EWFA 2KFNA 1JXVA 1HNVB 1YTYA 4YHHJ 4C0OC 1M1KT 2PDAA 1S5ZA 2QFIA 5LL6d 4EBDA 3MFHA 5KFGA 1U2RA 1FNXH 1X4BA 2XMVA 2K7JA 4LUBA 1X4HA 4X84A 3I55S 5KG0A 1VK3A 2DNPA 4LSLB 4C11B 4HTJA 4C6AA 4XAKA 2Q43A 1SH0A 1CULB 2B7CB 2LXFA 2CXEA 3CW2C 5BR8F 1VC6A 1U25A 3NCPA 2XEXA 4DZDA 4UQTA 5J2PB 2V4RA 2EVZA 2VBXA 2KJVA 2QIFA 4K2JA 3BO4A 5D4NA 3O8WA 4KT0C 1X5PA 2F65A 1MROA 3MMJA 4G65A 1MN7A 4M5IA 1QAIA 2E9RX 3HK2A 2MPUA 1EKSA 3N9UC 1NBEB 3R5BA 2PI4A 5DLGA 2Q66A 3ZTQA 3CCLS 2DK2A 1I3OB 1VK8A 2GHVC 4OZNA 1UETA 4IFYA 5IXUA 2VL1A 3NXZA 4QU6A 1EETA 2BRLA 1QAYA 2Q3PA 1R8HA 4P10A 4U8YA 2MHNA 2RDIA 2FIUA 4F4AA 2HHHJ 3OXGA 1VR6A 3MMAA 2UUWA 3W9HA 1ZZFA 2EFQA 1U0HA 3JTOA 4P2MA 2BA9A 2RQCA 2C2KB 1B0VA 1REVB 2BQUA 3I5AA 2ZDPA 1WG5A 1IM4A 3E8OA 2CVIA 2WSCC 3MM5B 2DHSA 1WC3A 2XI2A 3NWRA 9ATCB 3MM5A 5KT5A 2XY5A 3K17A 3M6XA 2UU9F 4DXLA 2RU3A 4B9TA 1AZSB 3LH2S 3CC7S 3T9NA 2MDAA 2NLWA 1RLCL 4B3RF 1JWWA 5DDPC 1JJHA 3S6EA 4OI6A 4TLRA 2R2UA 5JXSA 2OFHX 4KFBA 3VQTA 5MLCV 1OPZA 3NP5A 3EDQB 4EBEA 4W90B 3GLJA 2BOAA 3R6GB 4O3QA 4DX5A 3H90A 5F8MA 5KOXA 2VDIA 2NZCA 4EK2A 3K59A 4CNZA 3L4BC 2QFJA 2HK3A 4J9PA 1X4EA 2XS7A 3BGLA 4NMLA 2X1FA 4FPRA 1LW2B 4PUOB 3CT9A 1JLAB 4QWCA 1FHTA 4IRKA 1YBAA 1R89A 2D3UA 2C3UA 3PX0A 2H4YB 2UUAJ 4CQ1A 4FBTA 4M1KA 1QM9A 2OMOA 1T8EA 4LFAF 3TJ8A 4FKYA 4RUCA 4TQSA 5LMNJ 1KFSA 5L8RC 5SUHA 4HT5A 1EKRA 3QJLA 1SJ3P 3TWZA 2BQRA 4X4NA 2ZM6J 4P2FA 5LMUF 3P5TL 2AW0A 1FRHA 2F4FA 2B7BB 3PJXA 1Q8BA 3GB0A 4ZPTR 4C11A 1XJWB 4OZ3A 4OI1A 1QE1A 1RAOA 2GIFA 2XYGB 2YQ1A 2CPJA 5F3ZA 4WU2A 3SQGB 3HXMA 2KJWA 2B4UA 1CS4B 1FO1A 4OYOA 4YB6A 5CD4A 4YR3A 3ENWA 1B99A 4ZVQB 1KHVA 2Z30B 4FYVB 4B3SF 4DFJA 5CZVA 4DU8A 3FQKA 3I5BA 3MMCA 1NLKL 1KOHA 1FWKA 1TL1A 3N28A 4H4KA 4K5SA 4P74A 2W2NP 4DV3F 2J8AA 3BEGB 2E1MC 2VICA 1LW0A 1BMQB 2OAUA 4DEZA 3UD3P 4U96A 4C0HA 3FEZA 1VQ5S 1ZAXA 2ROGA 1N34F 1QUPA 2RILA 2ZZMA 2CPXA 4M8LA 1IQZA 2HBYB 1Q8IA 1TMJA 4O44A 1NRKA 1RLDA 2F1FA 1TUVA 3I96A 2I2YA 4R5PB 2OPSA 2VOPA 2FB0A 3KUEA 1HI8A 2Q6BA 1HKAA 5ETQA 3GPAA 4EYIB 3KXDA 3Q2SC 1M5PC 3OTOF 3M2RB 5HQ8A 4IUFA 2KYZA 1H6KX 2YWWA 3KLIB 5HSPA 5J1EB 1VLOA 1VC0A 5F8JA 3PX6A 1C2PA 4F3QA 3LGMA 3UO0A 5GMKa 3LWMA 2MTLA 1B70B 2XULA 2V50A 3DNCA 1FVQA 4CYUB 2RIJA 3DMJB 4DR2J 3V4IA 2APOA 2QLJB 3I9V9 4EO8A 1TFWA 1U2CA 1UKUA 2B8PA 4XDDA 2XLIA 4ZVPB 4K4VA 1GXTA 4C48A 1TQLA 2WBMA 2CZVC 1H2VZ 4TYAA 3KLHA 4F0HA 4LF6F 2HZCA 4ECWA 1IXKA 3FBCA 3IM8A 4G1PA 4DX6A 2ZJQQ 3QPIA 3F41A 2HHPA 3IWLA 4O4GB 4F7VA 4OHYA 1I6JA 3FMWA 2HPUA 2BANA 4TY8A 3K0JA 2IHR1 4Q5VA 5DO2A 5DZ7A 1OSDA 1DQAA 3MURP 1L3TA 1SKUB 1U48A 1XNQF 2RQKA 4RW8B 2DR7A 3TAPA 1UVJA 2M3DA 2O1PA 2G0IA 2AJ1A 1CJTA 2QJ3A 3MPWA 4ETZA 1AA1B 5CYMB 2HLUA 5HBMB 4WP9A 2YY3A 2MZ1A 1KLMB 3N6NA 5E3AA 5KFCA 1NHVA 3CC2S 5FJ4A 1PG5B 1WOOA 4MYUA 2FHKA 1XMBA 3PJWA 3LGNA 1MU2A 2CIMA 2R2TA 4KH1B 3BO3A 1HBUA 4JI0J 5KFVA 2YH1A 4B3MF 5M2PA 3DGPB 1HARA 3AJDA 4WJBA 4DV3J 4ERDA 2DXDA 4E2FB 1M5HA 2F8MA 1JQGA 2XI3A 4ZP9A 4ZS6A 2LU2A 3MUTP 3QWUA 5F9LA 5H9FK 1YRXA 3UFCX 2D9PA 2B3TB 5GAEI 1JNZB 3TQEA 2IM1A 1CG2A 3W3SA 1G1XA 2DHGA 3R9LA 1U49A 2ZD1B 4ZJQA 1YG0A 4MKBA 3OW2R 1VC5A 1TK0A 3NNHA 1FK9A 1TKZB 4CTAA 2UV8G 3HVRA 1UWAA 4RL1A 4LF9J 2MQQA 2KN4A 2W8KA 4RUBA 2OELA 2MXYA 1IJFB 3W1YC 2WB1D 3OL6A 2VQFF 1CPZA 2FC8A 3RB0A 4JBCA 1HBNB 1S9EA 3RTVA 5AXNA 1S4EA 2VC0A 2YNIA 4IG3A 2XQCA 1TK5A 2AZ3A 1N6QB 3M05A 2J7KA 1E6YA 4Y65A 3DI6A 4IH5A 4ZVRB 2YPZA 2F63A 2CQBA 1WKJA 2DNQA 2KI2A 3LP0A 1IJEB 3M2VB 4OYAA 3VHQA 4CLSA 5EDWA 3M9NB 2BE7D 3GG0A 4EO6A 1SUQB 4NLXA 2DRAA 3DHXA 3NBPA 5K14B 1HD0A 1ZM3A 5GADU 1RTDA 5D8HB 1JK9B 3O2IA 3IRWP 1X31C 2BJ3A 1IKXA 4MMOA 3U02A 1P1LA 2DGWA 1N34J 4JYAJ 2EKNA 5AJ3J 4NA1A 1RTHB 2M8HA 3MR6A 1JLEA 2GO9A 3C2PA 1J5OB 2YKAA 1LWFB 3SEOA 5DG8A 3P6YC 4I69A 5LJ3Y 3N79A 4OYZA 2DNYA 1HQUA 3GV7B 3PKMA 2AGQA 1NUEA 2CPDA 1WEZA 1HQUB 2DR6A 3A3NB 2IVYA 1XMOF 1M5SA 3KLGB 3K5MA 3X3UA 2N4DA 4IG0A 2P2CB 3DRSB 3L09A 4Y3CA 3CMAS 2MZSA 1WWHA 1YKWA 4DBQA 3JB9k 4RNNA 4QYZK 1JKHA 1R0BG 2DHXA 2J6TA 2WSEC 4OI4A 1ZH5A 5F41A 2OH2A 1OY6A 2F9JA 4LRFA 2VF3A 4PABA 2ZM6F 5LMUJ 4F36A 3OXFA 3EMTA 4P6QA 4URQU 4JV0A 3VQSA 3BDPA 4IFVB 2LP4A 3NNAA 3LP0B 3M2VA 2YKNB 1DHMA 2O66A 5I42B 3DI6B 1VQ4S 1CBKA 3ADAC 3PW0A 5CXTA 2HFUA 3G8SA 2Q1LA 4ZCIA 2HKEA 2AF6A 2L9NA 3I87A 2OEJA 3ETOA 1Q7YT 4PXDA 4WKRA 2G2OA 2MKJA 3KG1A 3L7UA 2EFPA 2BKPA 2CNOB 2H51B 3B4MA 2HRUA 5E0OA 3PXGa 3V6HA 3GIMA 2VJVA 3NAIA 1K44A 1X4CA 3LALA 1ROFA 3HDSA 3PNIA 2UXCJ 1GK8A 3M30A 2J76E 3KJVB 2JEFA 4DR7F 4ILLA 2DCLA 2FHJA 1IN0A 2FVCA 2RHQB 4AE5A 4X65J 2DD8S 2JEJA 1S0MA 3M30B 3KJVA 2POKA 4I2PB 1AROP 4JI3F 4GMKA 4NCGB 2HWTA 4CRJA 4DL2A 2FDNA 3TO8A 1ZZNA 2DNZA 3MCNA 4QIFA 3KKFA 5AE2A 1SH3A 5I3UB 3N5FA 4YR0A 4O0NA 1MU2B 2IBOA 4XPEA 1BQNA 1PIEA 2KT3A 4I0WA 4OYPA 4W4MA 2C2DA 4DSIA 4Q0BA 1TKXA 3LP2A 4V1Ak 4PRFA 2DPIA 4DLGA 4E0DA 3KG4A 1KLMA 2NXNA 1KBRA 1HPZB 5CYMA 2XB2D 1RZMA 2CQIA 4HT7A 1UW9A 3KFWX 4LVNP 1VIOA 4M95A 3NS7B 3HHKA 2GVDB 1SL2A 4EGLA 3TZYA 2DR5A 4YHHF 2OTLS 2P9GA 3CJRA 5H9EJ 3QGGA 3ZTSA 2UUTA 3R1LA 1B3TA 1JLBB 4FVMA 4KJIA 4J7CA 2IM0A 2DVIA 4J91A 5KOWA 1PBUA 2IVMA 3C3LA 3TAMB 1IWGA 2IDLA 1WOPA 1YVFA 3KLFB 3AOCA 3FZ2A 3I0SB 4JUZA 4J9NA 5E33A 3OFFA 2A2DA 2V8VA 3MECB 3OFGA 3OTEA 3V4IB 3DMJA 4LMZA 1NKCA 2QG9B 4RW4B 2J7UA 1N5TA 1WI8A 1LQ9A 2A3JA 2E5JA 4WP3A 3LTOA 4ZN1A 4X4RA 3C16A 4DX7A 1WF0A 2XM3A 4A8WA 3EWGA 2MB0B 4FF3A 2CWXA 4PPDA 1CEZA 4IG3B 3AQOA 3GJQB 2QMWA 3GYNA 1FDAA 2JOQA 1N5SA 3H8YA 1VQ6S 4A8SA 3H42A 3JSYA 4LT6A 1T11A 3NNCA 4B3OB 2MY8A 3IXQA 3HD1A 2ALZA 3SXLA 3CMES 4USWA 3OLBA 4ZJOA 1SIZA 1FK9B 2R7WA 2VHGA 3DLKA 1E6VA 2JH3A 3UVJA 4R25A 3D54A 3KLEA 2RKIA 4WYLA 1FERA 3QGIA 1DTTA 2Y1RI 2CRLA 2YWFA 3CGIA 3TUZC 1J5EF 1D3WA 4NPOA 4B3TF 2BV3A 1FF2A 3Q89A 2PEHA 2MLXA 3GFZA 4KHPJ 4CM2A 2Y0SD 1X60A 3HSGA 3IR5B 2D3OR 1HBUB 4NEYA 2KRRA 3UI3A 2CJKA 4I6YA 2NXEA 3IM9A 3FEXB 3L9ZA 4RW7B 4ECQA 3CD5A 3OTDA 5HROB 1WACA 4DUYF 3TNVA 4KYZA 2QSFA 4CCHA 2Y9HA 4C3MA 2FC9A 1NSAA 2MZRA 2XYPB 4RWWA 4ER8A 2R7VA 2MSTA 2R7OA 3QT8A 1NMEB 1AB8A 2BW7A 5CCLA 5ETPA 2HNZA 3C15B 3IAS9 1FX2A 3MR3A 3H5SA 2UVWA 4O3RA 1ULRA 2BANB 2BYCA 2HHQA 1PC5A 4PEOA 4BWJA 2V9WA 2NXJA 4LR7A 3TJ9A 3FJ2A 3BKTA 1RABB 3K5PA 4NLWA 2FJAB 4OX9J 3BM7A 3FCHA 2IC3B 3DRRA 3W61A 3KHGA 4LREA 1RAAB 4RBTA 1NPKA 2EFVA 1VQOS 2HWHA 3WC0A 4XO0A 1PKUA 3IWXA 4IDKA 2IYIA 4DR7J 5CH7B 4N7TA 2NS1B 3BH6B 2XGQA 2R2SA 5HMZA 4DV0F 4IOBA 1DTQA 3R5DA 2MKHA 3QSIA 5CYQA 5KT4A 2V2VA 3AD8C 2VFUA 1ZPWX 2DH7A 1XC9A 4DX8H 1HI0P 3ZXWA 1RHKB 2HFZA 3KLIA 4R8UA 5H9FJ 4KGKA 1IKVB 4USTA 1NZAA 2COLA 1ZM4A 2L3MA 4U9RA 2AZ1A 3MPVA 1T0TV 3W2VB 1VFJA 1H2TZ 1UA1A 1YJVA 2F3JA 2XLKA 2E9ZA 3AB2B 3MM6B 4NA2A 3HVWA 5I3QA 2R8KA 4DSKA 2R7TA 2ZNZA 5I3PA 1WHYA 5DDOC 4X4SA 1SV5A 3SYZA 2EXUA 4A8MP 4KGXB 4Q45A 4HYKA 2LFVA 2O5DA 1VBKA 3MMAB 3VAHA 1T3OA 5G0RB 2KXNB 1KVIA 5K5MA 4JI6F 3VTIA 2MGZA 2CADA 1XR6A 3K57A 4NLPA 2E7WA 3FVYA 1JLQA 1RWUA 2Z2YB 4EZ9A 4PUOA 4IFYB 2A6MA 4ZIVA 2UVUA 1YLXA 4G1QB 1EIYB 4USMA 2OD4A 1UVNA 1RYRA 4L72B 1S72S 1TKTA 2MSSA 2CJQA 4NRUA 2HQ3A 2RQMA 5KG1A 1LOUA 2VIHA 4DSJA 2M5YA 4NXMJ 4ZPVR 4MH8A 2YH0A 5DM7Q 5K9FA 3H2VE 4HDGA 2HYIB 1TAQA 2HW3A 2LQJA 1WI6A 3B82A 4WTYA 3J7YI 2KG1A 4F4YA 4ELTA 1SQEA 5KG5A 8AT1B 3P45B 1GNKA 2ZKTA 1Y9OA 2AJ4A 5L39A 1MLAA 2GJ2A 3AFGA 3TAQA 2G0JA 2KFYA 2EC2A 1N4LA 1T03A 2JFKA 2YWHA 4CO1A 4U7CA 1NB7A 1HBMB 3KNAA 4CT8A 1NKBA 1JJ4A 3FKBA 5MAOA 5KFPA 2AV5A 2G13A 1L3SA 2CG8A 3IBCB 4ECRA 2IJFA 2YBVA 1KS2A 1VCTA 1P27B 3NY0A 3T1YF 2AEJA 2V4QA 3HD2A 2AD9A 1J2VA 2FUG9 2D1CA 4XDCA 1SV5B 2CAJA 2N4CA 2HFVA 3HPOA 4DLEA 3HHEA 2KO1A 5ETRA 2CVEA 3Q8UA 2E1RA 3RBEA 4KQZA 5KFZA 5CHCB 2AYEA 2DIUA 2E5IA 2IPOB 3US5A 2AGPA 1RB0A 5THWA 1RTZA 2VJUA 4B3MJ 3PR4A 4Z37A 3THVA 1IKVA 1KR4A 1VBXA 5ETVA 2AU0A 2HVHA 4DZ6A 4JI4F 2AX1A 2RRNA 1S77D 1BHNA 3JQJA 2B9YA 1V9OA 2ASDA 2B0GA 2HBQB 3M9MB 4PQUA 4ZVGA 2IM3A 2DGTA 2EG2A 2P9CA 2W8LA 3GU0A 1H38A 3MDFA 5G4DA 1EQMA 3KTQA 4OZ5A 5M2UA 4USIA 3HZGA 4K4SA 4MKVA 3AQPA 4KB7A 1EZZB 1F2GA 2XC9A 2UVRA 5GAEU 1S57A 2W4DA 1GMWA 2MKIA 1UEKA 2G2YA 1X4AA 4UW2A 3N6MA 1YQHA 3GSDA 3E01A 4MKYA 3A13A 4YB7A 3D0GE 1MROB 3NRBA 1F6TA 4HTIA 4DG1B 3PW7A 4UUWA 1U1KA 4UY85 4CNYA 4GKJJ 1C4CA 4Y2IA 2MZQA 3KK2B 2CQ1A 2LQ5A 4PG7A 4I64A 1WORA 2OUGA 4EWTA 3GFXA 3ZZRA 4DQPA 1S1UA 2QGFB 3M6UA 4I1TA 3OFEA 4Z7YA 4JV5J 3CDEA 1KDNA 2EEYA 2OEKA 2CNNB 2ZWPA 4CLWA 2YXLA 4OFZA 3OSPA 3JS9A 3I5CA 3J81U 4KV8A 1N32J 1XERA 2MQMA 3TA2A 5M2RA 4P7VA 2PMHA 2FYXA 3QRPA 2FGCA 5ITHA 3RG6A 5DZ6A 2XMUA 3DRPB 4O3OA 5DGAA 1KHWA 1RTIB 4DG1A 1S99A 1JXLA 2H5IB 3R5AA 3RB3A 1N33F 1BE4A 2IVFB 1P8GA 2B9EA 2HQDA 1XNQJ 1AFJA 2M70A 3ZTRA 1VRQC 1WC6A 2PGCA 1RHUB 1WC0A 2FLPA 3P4UB 1QTNB 3KLEB 3R27A 3DLKB 2N7YA 4ID5A 3CJKA 2VBWA 1RT6A 1SQGA 2VG6B 4N47A 3D68A 3VGUA 5BXIA 3MM9B 2V68A 1D0EA 3BGOP 3NAHA 4DL6A 4WFXA 3TA1A 4RNOA 2H48B 5AXKA 2UUCJ 2B9XA 1YI2S 1UPMB 2YNHB 3MWBA 4OI3A 4GVLA 2WHOA 3T3FA 4NE9C 2VFTA 3BGRA 4UUXA 1HNXF 4PQUB 4GKKJ 1BQXA 1RU2A 3MHYA 4ECYA 4ETXA 3FQLA 2L41A 2WOMB 2RDJA 2EC0A 2GAGC 4ES2A 2DNKA 3C16B 4L6V3 3VAMA 3W65A 2E29A 4KHMA 2W7OA 4LF1A 2HAIA 3EXCX 4O3SA 1HLWA 3GWCA 2VUGA 3DOMB 3IGNA 4CH0S 2HQCA 2JVOA 2DY9A 3MM7A 4ZPWR 2X7IA 3SDEB 1P9QC 3CNQP 5HQLA 1CJVA 3NS6A 4G1IA 2BE2A 3RB4A 1HR0J 4WZMA 4DR3F 2HHTA 3LAKA 3SV4A 1NK8A 1SJ4P 2LU1A 3G82A 4QWBA 3KLFA 2HURA 1VQMS 1OPIA 3I0RB 1MW7A 3WIVA 4Z2XA 3EUNA 2ALYB 1FKPB 1VRUA 3A8IA 3V4MA 3FK4A 5HMWA 4Q43A 1M5VC 4Q7AA 1S4FA 2P6SA 1YJUA 5T14A 5IWAF 4URSA 2IAJB 4DPYA 2CJYB 3IWNC 3FSXA 1EQ0A 4DV7J 2FVRA 4X66J 1FFSB 1VHIA 4OZLA 1WHXA 3NGTA 3R2CJ 3JAMU 1BWEA 4LSZB 2WTFA 1CJKB 2XWXA 2Y8YA 2C42A 4UOHA 2Z8QA 2RVJA 3FMBA 2DY1A 4RJVA 2BOPA 1IR1A 3DLJA 2X1GA 1GX5A 1RUSA 3BH7B 3OXLA 2M88A 2HK2A 1Q95G 1R8PA 3OTBA 3UDEA 1HWKA 2MKKA 5L1KA 5C42A 2UUBJ 3F44A 4CT9A 3HT3A 5BYSA 5HO4A 1HBOA 2CQGA 3D3BJ 1RP5A 4KKOB 5KFAA 5IM0B 5I3UA 1FJ7A 2OSRA 4TKTA 5LSOA 4RPFA 3VAIA 2WW8A 1S0VA 5B08A 1S76D 2NREA 1DFDA 3EGNA 3OSNA 2VZ9A 5CA5A 3KLVA 2LMIA 2GVZA 3BZQA 2VB6A 5RUBA 4DQSA 4ELUA 2CPFA 3BN4A 1KQKA 4BBYA 2V2KA 2D9OA 3NGDA 3OJUA 2UVVA 1T9XA 1UPPA 2GGPB 1CQMA 1Q8KA 3I82A 5E3QA 1RWXB 4JI7J 1JLQB 1FEHA 1N8RT 2IMOA 4FXVA 5K20B 2HQFA 4PCQA 3T1AA 1RU1A 1T9YA 1YK9A 2H54B 1XMQF 1V3ZA 2HWIA 3Q8VA 3UQSA 1U1QA 1AFIA 5IT0A 2RSQA 1S7IA 1NSQA 5A8RB 3CD6S 2QE5A 3KJQB 3FC9A 5IS2A 1Y00A 4E98A 4JOUA 1YJ7A 1FRJA 2CA9A 4TNOA 2ZVIA 1R8CA 1TL4A 3KHLA 4IOCQ 1YWXA 4RX6A 2UUBF 2Z58B 3M2UB 3SSSA 1TL5A 3CTRA 5C5JA 1BGXT 1JJ2R 1HWJA 4OHZA 1HQEB 4NCAA 3EGVA 4I7FA 1HWLA 5KFOA 4CH7A 5GAGU 3A3PB 4J9SA 5CCMA 5JJBA 4ED7A 1Y0HA 5HL7Q 4NEZA 1XN9A 2DRBA 2JLGA 2KZMA 1HNWF 5EWEA 3L7PA 1NCLA 4ZLPA 1S7HA 1A7GE 2DO0A 4NWBA 3GTYX 2W2QP 5CYQB 1LWCB 1RHQB 1SIWB 4WCEQ 1Q86T 1UJ5A 1UEVA 2B51A 2KU7A 3HF5A 3VAKA 4W92B 1U47A 3C8YA 4PWDA 1S6QB 3CJSA 4YN3B 4O3PA 4B9LA 3N0VA 2A1BA 2ZC3A 4UOFA 3TP2A 1APSA 1RADB 1J5OA 5J2NB 2HIQA 3UWTA 4DV7F 1IBLJ 4Q2MA 5C24B 1TU0B 3BF4A 3M8QB 3SIPB 2CNLB 1NK4A 3P49B 5D0RA 1R3NA 4NLVA 1D8ZA 3HHDA 5A6WA 2VKRA 3BN7A 3D5MA 3SFUA 3KJFB 2LVWA 4LSNA 4DWIA 1IKWB 1ZA2B 2JLEA 3IA0A 4LF4J 4OX9F 3NGSA 3NBPB 5LSRA 3MAQA 5GMDA 3PACA 2BJ1A 3J80U 2RJZA 3GONA 2KG0A 1RHMB 3LW5C 3BPDA 3FBEA 1S1TB 3LP1A 3MCOA 4NYZA 4ZVSB 5IQ6A 2HHXA 1E6YB 4KAIA 5DRKA 2E7VA 3EVWA 3W66A 2VG7A 5KFWA 3H40A 3ILIA 4GRSA 3DOLA 4NYPA 3D67A 3FFIA 4YR2A 4DV2F 1N6QA 1V3SA 3ISZA 3PW5A 3PFEA 2E5HA 1UFLA 4RW7A 4OZJA 1FJCA 3EX7B 2XO7A 2L48A 4Q44A 2ZEJA 2YWEA 4MTPA 3DLEA 1X4DA 2VBZA 2WVBA 3QO9A 2KZZA 4X4VA 5A8KA 1U8WA 1WDDA 1I5OB 2I38A 2Z2LA 3TOQA 2GJFA 4QR1A 3R2DJ 3PY8A 2OLWA 3GR0A 4U95A 1S59A 3W64A 3MAHA 4RR5A 3R1HA 3DRYA 2E1AA 2RKIB 4IQXA 1RWOB 3UVJB 2NSBA 3LPYA 1WC1A 4L3NA 4OZ1A 3T9ZA 4EI2A 2HNDB 3QO9B 2LDYA 4K5RA 5EGYA 3KK3B 3C6UA 1W26A 3U1NA 4DSLA 4FYDA 3POTA 1JLGB 2RHSB 4DL7A 1G3OA 2BUNA 4B3OA 4PG4A 4RUHA 1YIJS 2RQ4A 6FD1A 1CSJA 4QIGA 1FWLA 4DV6J 4DR6F 1IKYA 2DRDA 1OYDA 6FDRA 3PW4A 3M32A 1WG4A 2MQ8A 1U1PA 4P9SA 5HANA 2VQEJ 3NGUA 5F8GA 2DB1A 2YPYA 1NSKL 2AEFA 3RUBL 4DL5A 4K0KF 5D15A 3OBIA 4K4WA 1VQ7S 4E8UA 2FY1A 2NZ4A 2C28A 2BX6A 4FPIA 3HT0A 1PBAA 2ZH3A 3R5GA 2AEMA 3D6MB 3I6PA 4OLPA 4TY8B 2KM8B 3K89A 4ZLNA 1FWPA 4WWSA 2HQIA 4O4GA 3DDNA 1F5AA 3I0SA 3PHTA 4UTGA 3WDOA 2C2MB 1FKOA 2FTRA 5C24A 1N54B 2VPWB 5DGBA 2AKWB 3UCZP 1EB0A 3HULA 2HGMA 3QT6A 4FYXB 4IQMA 5ADZA 4U8VA 5DDRC 1TV6B 3DM2A 4OZ2A 3HJFA 3QFHA 3W7BA 1O0PA 4AQYF 4L75A 4PWDB 3IR6B 2AP6A 4DR1J 4NOHA 1MWZA 2HEKA 3EE3A 3QYYA 3R7NB 3W5ZA 1JX4A 3OHAA 1AUSL 2ABYA 5LXYA 3T5KA 3OTOJ 1HWIA 3BJYA 3FNNA 1T7PA 3SCKE 1N36F 4FF1A 3I4PA 4X4OA 4OI0A 3UCUP 2IY5B 1IKYB 1C4AA 1FE0A 3CDUA 2PMZD 3ZZPA 1H0HB 1SXLA 3W62A 2Q6CA 4JI5J 3AJ1A 2DTJA 4I7FB 2IBKA 3B54A 4FNIA 2B6AA 1Q8LA 1UWBA 2H65B 3H20A 3JQKA 3LPEA 4N77A 3ZZ0A 2E5LF 1X4GA 4IO1A 3UN5A 1YHQS 1FRLA 4M5NA 5LXRA 4DV4J 1D9FA 3O44A 4GO5X 1HWUA 3E51A 4OYBA 5D78A 3Q24A 3PO4A 3PIOQ 1C1CB 2GV1A 3FDSA 3ET6A 3JSRA 4C8ZA 2W4PA 4JI1F 4NCGA 3FBBA 1UW4A 1LWEB 4Y2KA 4OZ0A 3JAMY 3MMCB 2OPQB 3D6FB 3CCWA 3T19A 3T1YJ 4KC5A 4LQ3A 5A2QU 2XSFA 5KFJA 4WFBQ 4CH1A 1FXLA 1NB2A 3ZTOA 1VQ8S 2RU9A 3QIDA 2CPHA 4WPAA 4Y6IA 1FE4A 2AJ0A 1QE1B 1K1SA 1VBYA 4DQIA 3PTWA 1ZS6A 2C2NA 3BBFA 1CC8A 2LQBA 2NUUG 2YX7A 5KTQA 2K7KA 5JUMA 4QIWD 3UPFA 4Y2CA 3DOLB 5LMNF 1N0VC 5D77A 3S8SA 3G6VA 5GAHI 1NKEA 1U7LA 2V9KA 3CB4A 1NK0A 5BYQA 2HHVA 1Q7LB 3MI7X 3PRDA 1TVRA 4LF8F 2EKYA 2RRBA 4HH1A 1YZ6A 2RS2A 3KUGA 5A8WB 3LAMA 2QZ8A 5C42B 2MJNA 4USKA 1S97A 2FVSA 3R97A 2ZZNA 3V6DA 3P5BP 4P75A 4O3NA 1Q0NA 3D1OA 3KWMA 2JC0A 1Q5VA 2PO4A 1DRZA 2ZHAA 1CJKA 2JHEA 2ZOGA 3EJMA 2LLZA 4O4RA 1NZ8A 3NMRA 4ICLB 1FDDA 3DRSA 4IG0B 3GYGA 4PZVA 2G4BA 3KLGA 4K50A 2P5VA 3CD7A 3HKWA 2Z57B 1KTVA 4P2SA 1ZTTA 4V19J 2R4FA 4ZA1A 5EHHA 4RKUC 3SSRA 1NH7A 1LWFA 3KHRA 2R8JA 3ISND 2DNNA 3KDNA 2HAFA 1VRUB 1RTHA 1XK8A 4BWMA 2ZH8A 5E2QA 5L46A 3PEHA 5GADI 2XY7A 5DQIA 3TZWA 2OPPA 3TZXA 1NNDA 2VG5A 4DPXA 3UCGA 4RUAA 1C0UA 1HNZF 4LF8J 3MM7B 1O6XA 2DGXA 3MD1A 4PYDA 1KQGB 4CLZA 3M2UA 4DL4A 5EX0A 3K8WA 2HG4A 2CQ2A 3QLHA 1HBNA 1K0TA 3ZNUA 3MAAA 4J9LA 1YJNS 2YNHA 1RQ0A 3M8PB 4M5KA 4DPUA 2ZUGA 3CCES 3VALA 4LF5F 1P9YA 2BJ9A 4QCLA 1T9UA 4Z7CA 5ETSA 1H2UX 4C8YA 2NCKL 2XMKA 3T5JA 2Y1IA 3OT9A 2VDHA 1EETB 2DKOB 2VG6A 5HATA 3SFGA 4JI6J 2DJWA 4ZPCA 1M1HA 2GGPA 2ZD1A 5IOLA 4C0BA 5HN0A 2ZHBA 5KG3A 2P6TA 2WBRA 3V81A 1B0TA 1FNOA 4A8YA 4LR8A 2W01A 4OV6A 2ATCB 4GVBA 3AXKA 4KHRA 1RTIA 1AXQA 1SC3B 4OJ1A 4HEA9 4CO4A 1T9WA 2DNHA 2BEFA 3BR8A 1TL7A 5KFDA 4KR0B 2R7RA 4RU9A 1KRPA 2QA2A 4KV8B 3VWSA 4N76A 1FTRA 1JLCB 3S01A 2BDPA 4DV4F 1S49A 4J37A 4TXSA 1CULA 1IUJA 2YNGA 3VAJA 2E5LJ 3DOKB 4LSLA 2QC3A 4OJ3A 3QT7A 3V6JA 1S9FA 2K06A 2XNQA 1SPBP 1T94A 2B4OA 2MMYA 2YKQA 3GJTB 1KN6A 4ED0A 4LRAA 1N88A 2V67A 3FCWA 1FEEA 4RW8A 3JSMB 2W24A 1LXNA 3CDWA 3HHLD 2JNJA 1U26A 2J0WA 4RW9B 2BM1A 1L3VA 2IJRA 1WHVA 4ZHRB 4C8LA 3GYXB 1HHTP 2B4VA 3OPKA 4CO3A 1UAWA 2L9WA 2BM0A 1FD2A 4DR1F 3I32A 4NLSA 2CPYA 3HFKA 1IR2A 4LRDA 3D0HE 3I0RA 2WB4A 4NCBA 2HIYA 2QL9B 3AHPA 1HHQA 3G82B 2W2OP 3BKFA 3QWPA 4DHVA 3P96A 2ZH7A 1X0FA 1FD8A 3H2LA 4PG6A 4CDIA 3FEYB 4B9MA 3BYPA 1ITPA 2DGUA 1Q81T 1N5VA 2FGOA 2V4JA 4YP3A 4K0KJ 1FFWB 1TZ0A 3SDEA 4A47A 4WFYA 3T5LA 4ID8A 1XNRF 3IFEA 1JXEA 1GXLA 1FJEB 1IBMJ 1ZA1B 1HL6A 2ZE2B 3IBFB 3BGUA 3OR2B 4ZVHA 2WOMA 4DR4J 5KG2A 3D3CJ 4H4OA 4FYYB 4P52A 1GXUA 1UVMA 1S6PA 1RWPB 2U1AA 4L76A 4YB5A 3UNGC 1N52B 3OR1A 4RNFA 2C2EA 2E1CA 2V63A 1V3RA 3HJVA 4F50A 1JLFA 2K1RB 1Q53A 3CJ4A 3LQVA 4UT4A 5F8LA 3RR8A 4ITSA 1RT6B 4OI2A 1SL0A 2HHWA 4MJKA 5A76A 1CVJA 2Z56B 3AY0A 3G87A 3RZAA 1B0PA 1FRKA 3LANA 4F4WA 1LW0B 1VRTB 4CLUA 4LIRA 5HQMA 5B0FA 2YX4A 3ILJA 1TL1B 4AXIA 3MEDB 2DH9A 1N33J 3HSDA 1LEOA 3MTKA 1S0OA 2MQLA 3A4TA 3T1HJ 1HBMA 3J7ZT 2O3DA 1MWYA 4X64J 3T6JA 3KNGA 3WQPA 1VQYA 1OY8A 4S0MA 2K3IA 3BB5A 1VDHA 3ICLA 1LV5A 2D41A 3K2YA 4QWAA 5KFSA 3Q8PB 3MEEB 4FF4A 2XBPA 3OUYB 1S1UB 1HA1A 4H4KC 3M8RA 5D4OA 5HVFA 2X51A 1RT2A 2XMMA 4YS2A 1F3FA 3EZUA 1TL7B 3MPYA 4DV2J 4NL5A 5IT4A 4DFPA 3CJQA 4CM0A 1D9AA 1W2BR 2G2ZA 2HBZB 1W25A 2HVZA 4RBVA 4KPCA 2ASLA 1XTZA 1XWLA 4Y2AA 3E01B 1KVJA 5AXMA 1S48A 3QZ8A 1JLAA 2CQ3A 1SQFA 2GJIA 5D3GA 2DGOA 3V81B 4G1QA 1RAIB 2MKSA 1UP1A 3EPIA 1UFKA 2QT7A 4JI3J 2GIRA 3MTJA 2UV8A 5J2MB 2X3GA 2HHSA 4HACA 2AMCB 1ZPVA 4ECSA 1Z1ZA 1F2HA 1KONA 4RBUA 5F8NA 1S9GA 4QBUA 2AYMA 2CQDA 2EI5A 1IM6A 2J9DE 4MYTA 1P1TA 4LBIA 2M52A 4M5HA 2BABA 2F8EX 2MKYA 4OYIA 5JVHQ 3VGSA 4MKAA 2BJEA 4I68A 4F26A 4ZN3A 2DNRA 2JWNA 2NUHA 3CJ5A 3QLHB 3LUYA 1HNWJ 1X0PA 4LRCA 5C25B 2NSCA 3CCSS 4QWEA 5IFMA 3UE2A 3W2VA 1UVIA 2DEIA 4HL9A 5KG4A 1QAXA 2DIVA 2HZVA 2N3OA 2VG5B 1U6BA 2BRKA 2EK6A 2W7PA 1RKIA 1S1WB 2H3EB 3HCXA 2W9CB 5L1IA 2OPPB 4DUZF 4TVAB 2CJ9A 5F0UA 3RAQA 3SCJE 1OWXA 4F67A 2ZWOA 2CUYA 4R8UB 4LBHA 1R27B 3RB6A 1NJWA 2QV6A 2F5GA 4F0MA 5ETTA 4ED1A 3DLLQ 1HW9A 1KVKA 1NHKL 1REVA 4QW9A 3G6XA 5KFXA 2JJ4D 3GIJA 1U0HB 1SKWA 4U7UK 2RS8A 2Q79A 1TUGB 4ZKAA 4UQGA 3ZFVA 4FNHA 3GIRA 1TL3B 4ECTA 1XMQJ 4WK1A 3AB4B 2QEXS 4X65F 1YRUA 2KFZA 4DV1J 2XYHB 4KRWA 2ZH6A 4ICLA 4USUA 2W25A 4HACB 3BSNA 4RU2A 4K2XA 2CPZA 1R31A 4XTTA 3OHBA 2FHJD 3IR7B 2YKPA 2F4VJ 3J7YU 4X4TA 5L1JA 4U67Q 3ONQA 5LM7E 5H1SV 5DQGA 3WBZA 3BQ2A 4K4XA 1FVSA 4I6WA 4ZMMA 1ZM2A 4WXOA 1TR0A 3TEHB 2HNZB 3C15A 1PSDA 3EXYA 2KB2A 2YKMB 4PG5A 2WONA 1XR7A 2ZVSA 5F8IA 2M2BA 2V69A 1TKDA 1KQSR 3I4HX 1ACMB 2AJFE 2D74B 2CWKA 2GS8A 2RE1A 4C4WA 4ED6A 4D3HA 2XS5A 3B4DA 1V5VA 3UN3A 4B02A 4QOTA 4Y34A 2A10A 1URNA 4ZPDA 3G8TA 3DYAB 4IYQA 1A9NB 3ITHB 2KH9A 5KFUA 2DHHA 2VQFJ 2XCAA 1PYOB 3QT5A 2KM8C 1D8YA 1HNVA 1ZAVA 3D4JA 4M5DB 3VCDA 4EMDA 4ES3A 5CAAA 3MD3A 2FLLA 1NDKA 3MEDA 2E1PA 4AL5A 2XNRA 1VS3A 6AT1B 2GMHA 2GIQA 5G0RA 5BYRA 4HR2A 1RYSA 1DTTB 2C3OA 4WU3A 2E9TA 5AJ3F 1PJ7A 2U2FA 4OMFG 2YKOA 3GV8B 2DT9A 2RB7A 4DSEA 1GMWD 4X66F 1L3KA 2AYGA 1OQ3A 3VVUA 4UF4A 3FSYA 4YQWA 1F0XA 4C3LA 1FI4A 3HZEA 2HS3A 2KYXA 2ZOFA 2V2QA 4JI0F 3OFHA 2X1AA 3D1QA 5CQGA 2ZBPA 4N5SA 3SV3A 1RXOB 3WHIA 2AYBA 3IP0A 1WUUA 4BDPA 4MIBA 4WXWA 3RBXA 3CCJS 3OR2A 2I6WA 2ZE2A 3H0PA 4NMXA 4EU0A 4JI2J 2OIHA 3BO2A 3CCRS 3LF0A 4RW4A 4NYOA 3PYEA 5B0EA 2A0FB 2QTWA 3A8EA 1KNZA 1MG7A 3IG1B 2ZFHA 4EEYA 4CP5A 2WVFA 5KAKA 2MYFA 4LF6J 4WFNQ 1XBWA 3O6QA 1C0TA 4CLFA 2V8GA 1X8DA 2IC3A 3DRRB 4M5GA 3J81Y 4LFCF 1CJUA 4OX7A 1NJIT 1D1UA 4NZ7A 5U47A 5D0HA 2HZAA 1WDTA 2W7AA 1BQMA 4WTOB 4LJMA 1KOOA 3EPGA 5EN1A 2XY6A 1H72C 1QDUB 3H5YA 2VQEF 1NDPA 1NU4A 1REGX 1RAHB 2C2OB 1YJ9S 4Q8EA 1RJJA 1ICEB 2EBEA 2HVDA 2I0XA 2EK1A 3C14B 2GMJA 3KUHA 3IGVA 3JSMA 2E5GA 1TUWA 2CNKB 2DNMA 1F3VA 3T41A 1HPZA 5HROA 3AAWB 2KT5A 2RH3A 2FVQA 2CDRB 2GHWA 3FBFA 2D3ZA 3VR1A 3ZC4A 5HLFA 2ASYA 3DOKA 3NKYA 4RO0A 2E66A 1TKXB 2R3VA 2YNGB 4K4TA 4JI4J 3W9JA 4DDFA 1UJ6A 2KHDA 4Q0BB 2IRUA 3MGJA 2C1EB 3QBCA 3JYTA 4FVCA 3D0IE 1BD6A 2HNDA 3B6BA 4PXCA 1SC1B 1UEUA 2HFOA 5JMNA 3M8SA 3R5JB 4TY9A 2W9BB 2PEBA 5HMYA 3CCMS 1X5TA 5HI7A 1MNEA 4LVOP 2FJXA 3HP6A 4MK8A 2FD2A 2KTQA 2QYCA 4LBPA 4YB1P 4DV5J 4B08A 5IZHA 5A2QY 2ZZTA 4ZP6A 3KDOA 1X7VA 1RBAA 2DH8A 4J9UE 4DF4A 4F25A 1HNIB 5KFHA 3ZTPA 1NHUA 1YJWS 4M5MA 2VPYB 3B78A 1OIAA 4PYAA 2QA1A 3EZ5A 1JIHA 4WYWA 4WK3A 3W2WA 4ES1A 2LDIA 2OFGX 3OD2A 3PHEA 4YDDB 4X4PA 3TRGA 2A18A 4ZP8A 5E3CA 3DDKA 3THTA 2XHWA 3PYDA 1XIQA 4D3GA 4PXEA 5DETA 5A0YB 2B5JB 4ZK7M 1DZ5A 1RBLA 2KT2A 4NXNF 3OV7A 3O1LA 2VG7B 4U6PA 2XHCA 4WP8A 3G6ES 2ZOMA 3SSQA 5IC6B 2F7VA 1MMNA 1S1TA 4BCAA 1VQSA 2EFNA 2YQ0A 5IT9U 2VONA 1LNQA 3DU6A 3UDVA 2GMLA 1GT8A 2HGNA 2A2CA 2I9SA 5DJBA 1FX4A 2HNYB 5E5NA 1B7FA 1DARA 1IKWA 4K4UA 1IBLF 5HVGA 3EDRB 3QRQA 2CYYA 1WC4A 4DV1F 3PJ9A 2AGOA 1TMMA 1JKHB 3S1TA 4ZLJA 3MUVP 2GA7A 4QR2A 3PYFA 1ZTWA 4AFFA 1RHRB 2ZKUA 4DJBA 2I5JB 5EWGA 4PG8A 4OX6A 1WTFA 2EBGA 2VD3A 4PQAA 4WF9Q 2BACA 1YDLA 2IRXA 4B3RJ 4WFAQ 1YBUA 2CDQA 2H5JB 2XZWA 3P8BB 4P71A 3KMSA 2DNGA 2R42A 2AHOB 3ZZOA 3MUMP 3PZPA 2O67A 3Q8YA 4M63A 1SJFA 1RK8A 1SH2A 1TP7A 4LRBA 1IKXB 2JFDA 2DHAA 2RT3A 4ZJLA 3J7Z5 3V6DB 2OO4A 5LSLA 2DGQA 4K8RA 2UP1A 3R5CA 5A8WA 8ATCB 4ZITA 4AYBD 4KH0B 1BQNB 4ALZA 1SL1A 3WC2A 4OQJA 5CYJA 1DLOB 2V8PA 4UOGA 3PG9A 1S6UA 2PMWA 4NLQA 2C2ZB 5J1PA 1XQIA 1S9EB 4O0IA 1H3DA 3DDIA 5IC4B 5A0YA 4OYWA 3OJSA 3TX0A 3CJ3A 3QMQA 2ADBA 4DSFA 4IH6A 2HMIA 2KVIA 3RJMB 4XIUA 1RI7A 2FY8A 3W2WB 4CO2A 2KKHA 2HHHF 2BKOA 4ED8A 1URRA 2FHMA 5KFFA 1O8BA 1F9EB 1OY9A 2HS4A 2OPQA 3AD7C 1U1NA 3KOAA 3CJ2A 1LWEA 5CD4H 3MR5A 1UZDA 5T41A 4XK8C 2JRSA 3RR7A 1VQNS 2CJAA 1FDBA 5KT3A 1VQLS 1KTQA 3EVOA 4TU9A 1WHWA 3U1LA 2R7QA 1BY9A 3QIPA 1UFWA 1XEZA 2QLWA 2OD6A 3E2EA 2FZGB 5F0WA 3BBBA 2GQ2A 4ANEA 1DLOA 1RWKB 2NPIA 1VHFA 1G4CA 2YKNA 3R7SB 3JYTB 4DR5J 5I42A 1VI7A 3ZZZA 3CPWR 1OMSA 3K7RA 4EUVA 3GV5B 3J81j 1FKAF 1QSSA 3KK1B 3Q83A 4L73A 4KO0A 1QSLA 2V8DA 2PFFB 4GC6A 4EZ6A 1CJTB 5HBMA 5KFNA 2IYGA 2LCWA 2PSZA 1LK7A 3X1LB 1T95A 3MM8B 3UNYA 4F4ZA 4NLOA 3QATA 1IBKJ 4MK9A 4IRDA 1RT7B 3CD0A 4YY3F 1VJQA 2FJBB 3ENVA 1KP6A 3R7BB 1YZ7A 2QL5B 3H4BA 2DNOA 4Y00A 2XTJP 3R3TA 2QLXA 3CWJA 3DM2B 1TV6A 2GAHC 4EFAC 5E41A 3D7SB 2UZAA 5K8PA 3ENQA 4ELVA 1MWQA 2Y1LB 3I9ZA 1KWMA 3CSKA 3M6WA 3I31A 3NOGA 4ZIWA 5FD1A 3KLHB 2XO6A 1Q79A 4C7QA 1RT5A 5KT6A 1U1MA 3UR0A 3B8HA 4QZVB 1R6YA 2DEJA 2MHEA 1J27A 2WK4A 3GCWP 1CJVB 1FCAA 1YGYA 1SUQA 1F5BA 2QYGA 4IRCA 1K0VA 3PM9A 1LFWA 3ZZYA 2ZBIA 3SCIE 1CQNA 3LWLA 3QGPA 4NI2B 5GAGI 1H7XA 2QMXA 2MKCA 2CFXA 1C1BB 2VBYA 2ZBRA 3MCSA 1WC5A 4CLKA 1LKZA 5KFLA 5KFTA 3GILA 1VGYA 5J1EA 2BQ3A 2B5JA 2QLFB 3NS5A 2EFGA 2ERRA 5CABA 2ZC4A 3QAUA 2RMLA 3T1HF 2J6SA 3BV8A 5ETLA 1B4SA 2JLFA 3DU5A 2ROEA 3GJRB 4R5PA 5J1NA 2Z2MA 3POTB 2BJDA 4DCJB 4DPOA 2FQQB 3N6LA 4DUTA 1AW0A 1AUDA 2CG4A 1Z2LA 2HSEB 1J5EJ 2PC6A 1EARA 8RUCA 2BKNA 2ZJRQ 1Q82T 5IQQA 2PE8A 3MZIA 4F2SA 4BLGA 5LJ5Y 1PYSB 3CJTA 4KHPF 2R7XA 3CIZA 1I1GA 1RTJA 3AODA 4X62F 2G9OA 7FDRA 2R8GA 1JNRB 2HGLA 2OJ3A 4DN9A 4QQBA 1U24A 3JTPA 4GO7X 3FGVA 1N5YB 3AOBA 1CS4A 1IBCB 3GZ7A 3ZNJ1 4B9NA 3ULHA 3GFHA 3G71S 1PC4A 1Q4RA 2WRMA 2Z4PA 3ITHA 3KYLA 3HVTB 3DYAA 1U8SA 3GIIA 2BE9B 2N7CA 2W2PP 2KHCA 1SKSA 2QRRA 3DN9A 2R8IA 2GHPA 4BC9A 4DR4F 2NQPA 1OJ4A 3L95X 1F60B 2OKQA 4LF7F 3BKUA 5ETKA 1XNRJ 2WVCA 1QTMA 3A12A 4PAAA 3SMZA 2MQOA 3DLHA 3PEJA 2LEPA 4TLQA 2WONB 2WW4A 5K8MA 4GC7A 1Y11A 3GIKA 3IRXB 3AH6A 4DL3A 1EJ7L 5DLFA 1FRMA 2UXBF 4LSNB 5LOQA 1BQMB 3OL9A 3GE9A 1VIXA 5E3RA 5K8NA 4V19X 4C8NA 4J9KA 4QW8A 1CJUB 1YJTA 2QSWA 5J2NA 3J7AN 3VV2B 2ZUAA 2RUSA 3DRXA 4HKQA 3SZ2A 4YY3J 2E7XA 2VFRA 3TZZA 2R9LA 1KC8T 3BS9A 2LYVA 3IG1A 1TL3A 3FRZA 4CYUA 1UTAA 3MOZA 5GAHU 2B8QA 3F0NA 1LWCA 3K5NA 4X4UA 2XG8A 2ZDOA 4PR6A 4DOZA 3RAXA 2HRTA 2ASJA 1HNZJ 1DQ8A 3H5XA 1ZBTA 3CCUS 1AZSA 4NLUA 4QIEA 1IBKF 2OP5A 3M2RA 2XZTB 1GX6A 2VU5A 3TYTA 3PKYA 4JI8J 3FRYA 4ZP7A 2FLNA 4NLGA 3BGFA 3EZOA 1PJ5A 3MPUB 4ECUA 5HJYA 1HI1A 1OS5A 3Q86A 4J9RA 3TA0A 3GJSB 2M0GB 1U02A 2L08A 3TX8A 5DS7A 2BR0A 3C6TA 4A8OA 5HVHA 2OPRA 4ATNA 1R0CB 4MT1A 3VAGA 4OYMA 4LFBF 3E3XA 2AJQA 4MAKA 4KSEB 3W60A 1U0SA 3CIMA 3UW1A 3JXOA 3C19A 3O5TB 4IO9Q 4RNHA 5FDLA 1WTBA 3MEKA 3HLUA 1R8AA 1H73A 4QJVA 3PX4A 1XMOJ 1M5OC 4K4YA 4C98A 5B09A 4A48A 3JSBA 4NA3A 1MSWD 4DQRA 1RWNB 2NXUA 1RAFB 3SQGA 1FJGF 1KFDA 2AIRB 3DCAA 1RAGB 2EWHA 1JB0C 4MIAA 2ZH9A 1T03B 4KPYA 3OQ2A 3NGKA 3IS9A 3W8PA 2B9WA 5B0BA 1VQKS 3CJ0A 3D6HB 1LWXA 4I6AA 4J90A 4ZVEA 2GC8A 2VASA 2FJVA 4NLYA 3UN2A 4DPTA 4FN5A 4A8XA 2E44A 1OQ6A 2NYHA 5J2PA 2EPIA 4DCOB 2YKMA 2FHOB 3OUYA 1TKTB 2DCUB 1HD1A 1Q16B 5KFBA 3IN5A 1VQ9S 1LW2A 3H25A 3GQCA 4FBUA 1NO8A 4DFMA 2WVEA 3AXMA 2VFVA 2XWYA 5K8OA 4PWUA 1QLNA 4UOCA 4DFKA 4YDXA 1WEYA 3GFYA 3J7A1 1L5UA 3TANA 1I94J 2K2PA 4QIVA 4C97A 1F9FA 2GZOA 4RWXA 2FPHX 2XMTA 2Z2ZA 4IH7A 3GP9A 2IAJA 4KFBB 2RD5C 4F4XA 4L3KA 4QU7A 2YX1A 5J2QB 4UY8T 2SXLA 2OPRB 2NYIA 2OEMA 2MLYA 2GW8A 2WVDA 4G3IA 4FXDA 1FKPA 4KBIA 2VV5A 2IA0A 5T7LA 1NXIA 1YRTA 2IRYA 4J9QA 4ECVA 2M8DB 4IR9A 3M6VA 1FXRA 3ZO7A 4AT1B 5D0EA 2XCPA 1G2EA 3G4SS 1NM2A 3RW7A 5IV4A 1WEXA 2BE2B 1ZETA 2DYAA 2J0XA 4OV1A 3OR1B 4C8KA 2QMUB 1S6PB 5KT2A 3RRKA 3PR5B 3NMAA 4DR3J 4Q8FA 3TEGA 4NLDA 4M5LA 2GQQA 1DTQB 4AQYJ 1RISA 5KFYA 2EFOA 1UJ4A 2JX2A 3BBCA 4FS2A 2R7SA 2EG1A 3DXSX 2DBBA 3QQCD 3Q8SB 3CCVS 5L1LA 1HQ2A 2J7WA 1U4BA 4IDKB 4ZCKA 5F8HA 2C2RA 4GKKF 4IOAQ 1TELA 2J0SD 3MM9A 3MPDA 2JC1A 3CDBA 1DURA 1U1OA 5D4PA 4F02A 3CJKB 5DDQC 2LQ8A 4JI1J 4WE1B 4OHVA 2MEWA 3Q23A 2RUGA 2G1HA 4LF9F 1RT4B 3S7RA 1NEEA 1EAYC 4H4MA 1HYSB 5SZTA 1YITS 1HYSA 2YTCA 2MY7A 2HQGA 1N48A 1X5OA 3HHLA 3DRPA 1WELA 1RE1B 1PYTA 5E7OB 4DV6F 1GEHA 2BW2A 4DR6J 1RT2B 2DNLA 2CPIA 1S1VB 1S10A 4JI7F 4JV1A 5IV3A 2DR9A 1NPPA 3MEEA 3WIUA 2LEAA 4Y0FA 3PRVA 2HHUA 1RA7A 2GO8A 1N32F 5GVQA 2GX8A 3VGVA 2PI5A 1P6TA 2IA6A 1QVFR 1JLCA 3KG0A 3IAM9 4M5JA 1HMVA 1PILA 2I8EA 1PCAA 1H74A 3AT1B 3DC2A 3KK2A 1N5YA 3HMJG 1X9MA 2VKZG 3TVYA 1BLUA 3HHLB 2DR8A 1RTJB 2NR0A 2ZITA 3ILOA 1VRTA 2J9EA 2V2ZA 4KGZB 3QZ7A 3SI8A 4ED2A 3QNWB 2J6UA 3BQ1A 2W1BA 3DLBA 4GKJF 1RT4A 4KE5A 4WE1A 2RF2B 1E6VB 1FTCA 1FRIA 1UL3A 1ZM9A 4BHQA 1RAEB 2RAQA 1GMUA 2DISA 2C3YA 3CMQA 3G6YA 4I67A 2Y8WA 4DR2F 1G7CB 1X9WA 4ANDA 2J9DA 2D69A 2ZH5A 2K8GA 4A46A 1Q1KA 3M8PA 2VA2A 1RT1A 4JI2F 5HP1A 3RAMA 3MAAB 2M9KA 5C7PA 1ZYQA 4I2QB 1BC6A 4H4OB 2XMAA 3MR7A 3TJAA 3R8YA 2G1DA 1GTHA 1C1BA 5DM6Q 1FESA 4NI2A 2P8IA 3HSZA 4JV2A 1IVZA 4OIXA 2HFNA 3GMGA 1FNMA 4F04B 2BJ7A 2CKWA 5B7WA 2QLBB 4LFAJ 2V4JB 3FSIA 2LQ9A 3MECA 4PPZA 3G96A 4BS2A 1WD6A 1AT1B 1TTHB 4J5OA 3RYLA 4CIOA 1Y3KA 4OJGA 3RRGA 1T05B 3M7VA 1X4FA 1LXJA 4OLOA 1GMVA 2RRAA 5IT9Y 3A8JA 1SCJB 4FKXA 3MMBA 3HSJA 2F4VF 1PAEX 2MZTA 1KQFB 3H4DA 1S0NA 1KD1T 1HIYA 5J2QA 2MZJA 2F8HA 1QVGR 1JLBA 4MFBB 3A1YG 5KFIA 2DO4A 1JMTA 2DGVA 3Q8RB 2J5AA 3K58A 4H54A 3T6BA 3N01A 1WNEA 1RT7A 2GVDA 3F56A 1QUVA 2V34A 3EGWB 4AL6A 2ZH2A 3V6KA 1I94F 1Y5LB 3D2WA 1SJQA 2VPZB 4N56A 4J9VA 3D9BA 4KO0B 2FJDB 1RCOB 1T9TA 1XR5A 2OSQA 3EICA 4DCPB 4YFUA 3LP2B 5ETMA 4C2MA 2MQPA 1UVLA 2UU9J 3CC4S 1F1BB 1BUXA 3TVKA 1R0AA 3DHWC 4IKAA 1NK6A 1M1GA 1TVRB 2QN6B 3HFZB 3G86A 1SC6A 3NGRA 4C8MA 5D6GA 3CEDA 5EX3A 3HFVA 2LXUA 3N4WA 1Z4UA 2B4PA 3BSAA 1WOSA 4USVA 5DG7A 2LA4A 2CQ0A 1S1XA 4TU7A 4LF4F 3VZIA 1V6HA 3M9OB 4GVBB 1WJ9A 1KSPA 4KY3A 2F9DA 3FZBA 2C3PA 3UR3C 3IS9B 3SCLE 2A6OA 3AD9C 3TVZA 3P3DA 3U7JA 2UUAF 4NXMF 3D28A 3LGHA 2BXJA 4FDFA 1X5SA 1Y3JA 3KHHA 3TARA 3QRRA 4X2BA 2XZDB 2I1RA 4N8NA 4ECZA 1L3UA 1YBTA 2Y1JA 3AOAA 7FD1A 4YMEA 2MGZB 3T5HA 2FJWA 1QSYA 2ATLA 4DL0C 3NOCA 4ECXA 3M8WA 5AE1A 4LQ9A 4OHXA 5FDLB 3PV8A 4CI0B 3CCQS 1NK5A 2HMIB 2C3MA 2ILZA 3NG8A 3BYRA 2PN6A 2ROPA 3C6TB 5FLXY 1VJWA 3MM6A 1T3NA 4EBCA 2B6AB 4P73A 1EX8A 4J9MA 3DLGB 1HW8A 5BJRA 1WKLA 3VZHA 4IFVA 4RW6B 1C0UB 1FXDA 3TW0A 5HK4A 2LKZA 2JZ5A 3L7OA 4CWBA 1K9MT 1SVDA 3CULA 2YQ3A 4B17A 2LA6A 3CCTA 3OLAA 1TK8A 1NAQA 4ZVFA 2XSJA 4WKYA 4A8FA 2D3O1 3WX4A 4FP9A 3WZ0A 3MFIA 4FXWA 2PA3A 1QJHA 1YSJA 5FIIA 3IO1A 1VMBA 1OYEA 5IWAJ 2ADCA 2AQ4A 1SB6A 1QD1A 4B9VA 2YNFA 3MEGB 2D7SA 3OL8A 1Y5NB 2I5JA 4PXBA 4FZVA 2B43A 1FT8A 5KFQA 1JLEB 4OJHA 3PVXA 2WZ1A 3GR1A 2YVSA 4USJC 2O01C 5C2GA 4DI6A 2CZ4A 3OTCA 2G0CA 5KFEA 1HR0F 3QAEA 4B9SA 1GAOA 3Q2TC 1OSCA 2J9CA 1Y7PA 3PCOB 2HNYA 4Q2LA 3IRXA 3C66A 5AXLA 1OO0B 1BWVA 3G2XA 2R7UA 1WKKA 2M4MA 1EP4A 1LK5A 4DU7A 3QJPA 2CQ4A 4ZVTB 1RAJA 3TUJC 2CQPA 4Y28C 4DPWA 2JDJA 2FJEB 4KGMA 5HJXA 2BMBA 1B7YB 1W7WA 2XMJA 2QX0A 1KEKA 3PYGA 1S12A 4HI2A 4QYRA 3F73A 3H2UB 4F8RA 3N5BA 3HVTA 1FRXA 3JTNA 5BR8J 4U7UD 1JLGA 4N8OA 3KJNB 3GSIA 4ED3A 3K8VA 1S79A 5AE3A 4CZCA 4DV5F 3DXBA 3BQ0A 4PKDB 1HNIA 1U6ZA 2GCFA 2H4WB 3CJ8A 3PDNA 4X64F 1VBZA 2HBRB 4NLRA 3PW2A 1RWWB 3BREA 3ET6B 4R0JA 4WZQA 1C1CA 3H98A 4CLTA 3UD5A 4DS4A 5EUHA 2OMLA 3LOUA 2PFDA 1R8BA 2NXCA 2DXFA 1O5JA 3HI9A 5A8KB 2F40A 3RBDA 4UZBA 4NXNJ 1UWBB 2AX0A 4FYWB 3THPA 3HO1A 1MMDA 1R43A 1HFEL 4ZCLA 3MR2A 3HX9A 3TI0A 3VVTA 5ETOA 2ACYA 1WF2A 3PFOA 4CO5A 4XPCA 1U1LA 1UVKA 1FFGB 1GH8A 3FFIB 4MK7A 5ETNA 4KTQA 3GCXP 3RBZA 1IBMF 2CQCA 3NWGA 4YEAA 2BVZA 4EYHB 2C22A 4DQQA 4OYXA 1HNXJ 2DPJA 4QPXA 2DXEA 3BSCA 3JQMA 1GTEA 2HRYA 1VOMA 2UUCF 1QY7A 1YX2A 3LP1B 4HHHA 4N41A 4DN0A 3M1VB 4CLLA 1Y5IB 1U1RA 1F9HA 2N82B 5F9NA 2Y3YA 1RT5B 1SI9A 3AA9A 3V2UC 3CXCR 2X3DA 3TUPA 3ISNC 1FKOB 3TAMA 5KG6A 1U09A 4G6VB 3QJJA 3M4XA 1UA0A 1U45A 3M8YA 1C0TB 2W4CA 2GFFA 5I4MA 3OVSA 3CF5Q 3MEGA 2KL8A 3V5RA 1EHWA 1UZHA 3K5OA 2V5HG 3DGVA 3M1VA 3W5XA 1VLYA 1NDCA 4ILMA 4W98A 1RDRA 3Q22A 1VYAA 3QSYB 3NCRA 4LF5J 3MM8A 1AYEA 1FA0A 1PJ6A 5B0CA 1N56A 2M7SA 2V0NA 3U27A 5AT1B 2UXDJ 5D4LA 2Y0BB 3M32B 2XSJB 2V6AA 4AUKA 2ZH4A 4JV5F 2IMWP 4NRTA 1NDLA 5GMEA 2NPFA 2VA3A 3KK1A 1DY3A 2PA8D 3W5YA 9RUBA 3VAFA 3MCMA 2JEIA 4KIAA 2AT1B 4HI1A 1GFWB 3UDCA 2OPSB 4NZ6A 2IDEA 1NPRA 3DLGA 3PO5A 3C6UB 4F3MA 2Z0GA 4P72A 3KK3A 3ELHA 4O44B 2HVEA 1M5KC 2MJUA 3M8ZA 2JEGA 1NSPA 3H5UA 3QIPB 1KKHA 3D6TB 2CQHA 4DR5F 1MMLA 3W9IA 2OI2A 1GQEA 3R6LB 5L9XA 4B3SJ 3HHNB 4K7QA 4FF2A 2OTJS 2B56A 4LR9A 4C8OA 4PWWA 4I2PA 4OHWA 1X9SA 4MIWA 3G9CA 2YWGA 4P7TA 5H9EK 4M5DA 1IQTA 3DKDA 2JSXA 3DLEB 2FZCB 1CC7A 3CO9A 1WSVA 4LIWA 4UZCA 4ENOA 1H7WA 4DS5A 2GNKA 1WSRA 2OGUA 4ANCA 5KG7A 4FS1A 3EM1A 3QGHA 5DQHA 1VISA 3BR9A 3TQ1A 2UXCF 3UD4P 3CVKA 3EVMA 2KRBA
chains in the Genus database with same CATH topology
1RKJA 2GQCA 2EW9A 2ZBCA 3HHLC 3HVAA 5IM0A 4RZRA 4TQRA 4OL8A 1K8AT 2KXFA 1EP4B 3CCZA 2HS0A 4BC7A 5KFMA 3NL0A 4QWDA 4ZPAA 2KXHA 3ZZUA 1Y4ZB 3LO3A 5KT7A 3BSOA 3M8QA 4K59A 3HM9A 5L38A 3I56S 3RU0A 2K3KA 1PO6A 2IM2A 2MQNA 2BBEA 3ZZTA 4HH0A 5L9NA 2XGPA 1S6QA 1O51A 1WG1A 4AXJA 3OVAA 2YNFB 3KMQA 2ZNYA 4CO0A 4MFBA 4O23A 2QA4S 2QO3A 3PRBA 4HDHA 4USHA 1K73T 2W9AA 3MMBB 2PD1A 4JI8F 4F3OA 4AL7A 4A4JA 1DJ0A 5B0AA 1DAXA 3OL7A 1RTDB 5K14A 1S1WA 2W9CA 4JYAF 2VH7A 4RW6A 3G8QA 3H59A 5KFKA 1HQEA 1TFYA 1NK9A 1RA6A 2VFSA 1SKRA 5LT5A 5C25A 3J80Y 1VQPS 2JVRA 5JVGQ 1S6OA 3MF5A 2YNIB 3K5LA 3OVBA 4I2QA 1N5QA 3HKZD 4DF8A 1HHSA 4QYZJ 2PIIA 1LFPA 1RT1B 4RLEA 5HP1B 3C46A 5A8RA 1NJZA 1TAUA 3NLCA 4TN2A 3PIPQ 2QA4G 2L9DA 4NX9A 4I56A 4ZCMA 2X1BA 3D1HA 2R8HA 1S9GB 4A8KA 1NJYA 1DBDA 1TKZA 2WCXA 1NH8A 4NZ0A 4CTAB 5J2MA 3Q0AA 2J0QD 4X4QA 2VOOA 3EGZA 4ID5B 2BZ2A 3TUIC 4YOEA 3CE8A 2ZJPQ 2LEBA 4ED5A 5D3GB 4HHJA 1DQ9A 1ZOTA 4NLTA 3AJ2A 2VODA 1CLFA 2DGSA 4HVZA 1S1XB 1Z2ZA 2CJBA 4HLBA 3EYZA 2W9BA 3RW6A 3DGPA 4R0EA 4JI5F 3IC1A 1HMVB 2VPXB 5HMXA 1HBOB 4KKOA 1WF1A 5E3PA 4A8QA 1R0AB 4Y2MA 4YUDA 1F5CA 5HLFB 2UXDF 1SJRA 3IBWA 1NK7A 4TYBA 1T02A 3CUNA 1K1QA 4IR1A 1S1VA 4WIIA 3O3LA 2DITA 5KFRA 4QPTA 3L3CA 1G6BA 5CZXA 4J9OA 2FVPA 4TU8A 4B9UA 4C9DA 2WSFC 1M90T 2H5EA 1HYSB 5F3TA 2HLTA 2V8HA 4H4MB 1NJXA 4DMZA 2IJNA 2XMWA 3UDLA 2ZHOA 5DG9A 2XLJA 4C3KA 1ZAWA 1ELOA 4ZDNA 1RT3B 1T05A 3Q8QB 2N3LA 1R7IA 1SBRA 2KDOA 2WAQD 3MOJB 2VC1A 1JLFB 2K1RA 2JL9A 3GG1A 4URGA 1N0UA 2V94A 1SJ1A 1IR0A 3DOMA 4ILRA 2P9EA 3U1MA 4F2RA 1Q78A 1H98A 2AWZA 2YWKA 3NCQA 1UMJA 4ZPBA 2LECA 4M94A 3AA8A 4RNMA 2RNEA 3BGRB 3DFEA 1U6FA 1U2FA 2ILYA 1M0SA 2LXIA 5B0DA 3RRHA 1FDNA 1KLNA 4OX8A 3VF0B 3TR5A 1RT3A 4F4KA 3MXHP 5T7LB 3CDAA 4QR0A 2RF2A 5B0GA 1YJRA 1QAJA 4I4BA 1B64A 2XS2A 4ZOSA 2H9ZA 2CPEA 2IFXA 1RGVA 1W2IA 5A6PA 4K4ZA 2FLOA 1A6LA 4WFZA 4ZHRA 2R2RA 2ZH1A 4RW9A 2PT0A 1PGZA 3BDEA 5EWFA 1HNVB 1YTYA 4C0OC 1M1KT 2PDAA 5LL6d 4EBDA 3MFHA 5KFGA 1U2RA 1FNXH 1X4BA 2XMVA 2K7JA 4LUBA 1X4HA 4X84A 3I55S 5KG0A 1VK3A 2DNPA 4LSLB 4C11B 4HTJA 4XAKA 2Q43A 1SH0A 2LXFA 2B7CB 5BR8F 1VC6A 1U25A 3NCPA 2XEXA 4UQTA 5J2PB 2V4RA 2EVZA 2VBXA 2KJVA 2QIFA 3BO4A 5D4NA 3O8WA 4KT0C 1X5PA 1MROA 3MMJA 1QAIA 3HK2A 2MPUA 3N9UC 3R5BA 2PI4A 5DLGA 2Q66A 3CCLS 2DK2A 1VK8A 2GHVC 4OZNA 1UETA 4IFYA 2VL1A 4QU6A 1EETA 2BRLA 1QAYA 2Q3PA 1R8HA 2MHNA 2RDIA 2FIUA 3OXGA 3MMAA 2UUWA 1ZZFA 2EFQA 3JTOA 2BA9A 2RQCA 1B0VA 1REVB 2BQUA 3I5AA 2ZDPA 1WG5A 1IM4A 3E8OA 2CVIA 2WSCC 3MM5B 2DHSA 2XI2A 3MM5A 5KT5A 2XY5A 3M6XA 2UU9F 2RU3A 4B9TA 3LH2S 3CC7S 3T9NA 2MDAA 2NLWA 4B3RF 1JWWA 5DDPC 1JJHA 3S6EA 4OI6A 4TLRA 2R2UA 5JXSA 2OFHX 4KFBA 3VQTA 5MLCV 1OPZA 3NP5A 4EBEA 4W90B 5F8MA 4O3QA 5KOXA 3K59A 4CNZA 2QFJA 4J9PA 1X4EA 2XS7A 3BGLA 4NMLA 2X1FA 4FPRA 1LW2B 3CT9A 1JLAB 4QWCA 1FHTA 4IRKA 1YBAA 1R89A 2D3UA 2C3UA 3PX0A 4FBTA 4CQ1A 4M1KA 1QM9A 2OMOA 1T8EA 4LFAF 4RUCA 4TQSA 1KFSA 5L8RC 5SUHA 4HT5A 3QJLA 1SJ3P 2BQRA 4X4NA 5LMUF 3P5TL 2AW0A 1FRHA 3PJXA 2B7BB 1Q8BA 3GB0A 4ZPTR 4C11A 4OI1A 1QE1A 5F3ZA 2CPJA 3HXMA 4WU2A 3SQGB 2KJWA 2B4UA 1FO1A 4YB6A 4YR3A 3ENWA 4B3SF 1KHVA 2XLKA 4DFJA 5CZVA 3FQKA 3I5BA 3MMCA 4K5SA 1KOHA 1TL1A 3N28A 4H4KA 4DV3F 2J8AA 3BEGB 2E1MC 1LW0A 4DEZA 2OAUA 3UD3P 4C0HA 3FEZA 1VQ5S 1ZAXA 2ROGA 1N34F 1QUPA 2RILA 2ZZMA 2CPXA 4M8LA 1IQZA 1Q8IA 4O44A 1NRKA 2F1FA 1TUVA 3I96A 2I2YA 4R5PB 2OPSA 2VOPA 2FB0A 1HI8A 2Q6BA 4EYIB 3Q2SC 1M5PC 3OTOF 3M2RB 5HQ8A 4IUFA 2KYZA 1H6KX 3KLIB 5J1EB 5F8JA 3PX6A 1C2PA 4F3QA 3LGMA 5GMKa 3LWMA 2XULA 3DNCA 1FVQA 2RIJA 3DMJB 3V4IA 2APOA 3I9V9 4EO8A 1TFWA 1UKUA 4XDDA 2XLIA 1GXTA 1TQLA 2WBMA 2CZVC 1H2VZ 4TYAA 3KLHA 4LF6F 2HZCA 4ECWA 1IXKA 4G1PA 2ZJQQ 3QPIA 3F41A 2HHPA 3IWLA 4O4GB 4OHYA 1I6JA 3FMWA 2HPUA 2BANA 4TY8A 3K0JA 2IHR1 4Q5VA 5DO2A 1OSDA 1DQAA 3MURP 1L3TA 1U48A 1XNQF 2RQKA 4RW8B 2DR7A 3TAPA 1UVJA 2M3DA 2O1PA 2AJ1A 4ETZA 5HBMB 3MPWA 5CYMB 2HLUA 2YY3A 2MZ1A 1KLMB 3N6NA 5E3AA 5KFCA 1NHVA 3CC2S 5FJ4A 4MYUA 2FHKA 1XMBA 3PJWA 3LGNA 1MU2A 2CIMA 2R2TA 3BO3A 1HBUA 5KFVA 2YH1A 4B3MF 5M2PA 1HARA 4WJBA 1M5HA 2F8MA 2XI3A 4ZP9A 4ZS6A 2LU2A 3MUTP 3QWUA 5F9LA 1YRXA 3UFCX 2D9PA 2B3TB 5GAEI 1JNZB 2IM1A 1CG2A 3W3SA 1G1XA 2DHGA 1U49A 2ZD1B 1YG0A 4MKBA 3OW2R 1VC5A 1TK0A 3NNHA 1FK9A 1TKZB 4CTAA 2UV8G 3HVRA 2MQQA 2KN4A 2W8KA 2VQFF 2MXYA 1IJFB 3OL6A 2WB1D 1CPZA 2FC8A 3RB0A 4JBCA 1HBNB 1S9EA 3RTVA 5AXNA 2VC0A 2YNIA 4IG3A 1TK5A 4K4VA 3M05A 2J7KA 1E6YA 4Y65A 3DI6A 4IH5A 3M2VB 2CQBA 2DNQA 2KI2A 3LP0A 5EWEA 1IJEB 5EDWA 3M9NB 3GG0A 2DRAA 4EO6A 1SUQB 4NLXA 3DHXA 3NBPA 5K14B 1HD0A 1ZM3A 5GADU 1RTDA 5D8HB 1JK9B 3O2IA 3IRWP 3U02A 1IKXA 4MMOA 1P1LA 2DGWA 3MR6A 4NA1A 1RTHB 2M8HA 1JLEA 2GO9A 3C2PA 1J5OB 2YKAA 1LWFB 3SEOA 5DG8A 3P6YC 4I69A 5LJ3Y 3N79A 3GV7B 2DNYA 1HQUA 3PKMA 2AGQA 2CPDA 1WEZA 1HQUB 1XMOF 2IVYA 1M5SA 3KLGB 3K5MA 3X3UA 2N4DA 4IG0A 3DRSB 3L09A 4Y3CA 3CMAS 2MZSA 1WWHA 4DBQA 3JB9k 4RNNA 1JKHA 2J6TA 2DHXA 2WSEC 4OI4A 1ZH5A 5F41A 2OH2A 2F9JA 2ZM6F 3OXFA 4P6QA 4URQU 4JV0A 3VQSA 3BDPA 4IFVB 3NNAA 3LP0B 3M2VA 2YKNB 1DHMA 2O66A 5I42B 3DI6B 1VQ4S 3PW0A 5CXTA 3G8SA 2Q1LA 4ZCIA 2AF6A 2L9NA 3I87A 3ETOA 1Q7YT 4PXDA 4WKRA 2MKJA 3KG1A 3PXGa 2EFPA 3B4MA 5E0OA 3V6HA 2HRUA 3GIMA 3NAIA 1X4CA 3LALA 1ROFA 3HDSA 3PNIA 3M30A 2J76E 3KJVB 2JEFA 4DR7F 4ILLA 2DCLA 2FHJA 1IN0A 2FVCA 4AE5A 2DD8S 2JEJA 1S0MA 3M30B 3KJVA 2POKA 4I2PB 1AROP 4JI3F 4GMKA 4NCGB 2HWTA 4DL2A 2FDNA 3TO8A 1ZZNA 2DNZA 4QIFA 3KKFA 5AE2A 1SH3A 5I3UB 3N5FA 4YR0A 1VC0A 1MU2B 2IBOA 4XPEA 1BQNA 2KT3A 4I0WA 4DSIA 4Q0BA 2C2DA 1TKXA 3LP2A 4PRFA 2DPIA 4DLGA 4E0DA 3KG4A 1KLMA 1HPZB 5CYMA 2XB2D 2CQIA 4HT7A 3KFWX 4LVNP 1VIOA 4M95A 3HHKA 1SL2A 4EGLA 2DR5A 4YHHF 2OTLS 2P9GA 5H9EJ 3QGGA 2UUTA 3R1LA 1JLBB 4FVMA 4KJIA 2IM0A 2DVIA 5KOWA 2IVMA 3C3LA 3TAMB 1YVFA 3KLFB 3FZ2A 3I0SB 4JUZA 4J9NA 5E33A 3OFFA 2A2DA 2V8VA 3MECB 3OFGA 3OTEA 3V4IB 3DMJA 4LMZA 1NKCA 4RW4B 2J7UA 1N5TA 1WI8A 1LQ9A 2A3JA 2E5JA 4X4RA 4FF3A 4A8WA 1CEZA 1WF0A 2MB0B 4PPDA 4IG3B 3AQOA 2QMWA 3GYNA 1FDAA 2JOQA 1N5SA 3H8YA 1VQ6S 4A8SA 3JSYA 4LT6A 3NNCA 4B3OB 2MY8A 3IXQA 2ALZA 3SXLA 3CMES 3OLBA 1SIZA 1FK9B 2R7WA 3DLKA 1E6VA 2JH3A 4R25A 3D54A 3KLEA 2RKIA 4WYLA 1FERA 3QGIA 1DTTA 2Y1RI 2CRLA 2YWFA 3CGIA 3TUZC 1J5EF 1D3WA 4NPOA 4B3TF 2BV3A 1FF2A 2PEHA 3GFZA 2Y0SD 3IR5B 2D3OR 1HBUB 3UI3A 2KRRA 2CJKA 4I6YA 3FEXB 4RW7B 4ECQA 3CD5A 3OTDA 5HROB 1WACA 4DUYF 3TNVA 2QSFA 4CCHA 4C3MA 2FC9A 2MZRA 4RWWA 2R7VA 2MSTA 2R7OA 5CCLA 3MR3A 2HNZA 3IAS9 3H5SA 2UVWA 4O3RA 1ULRA 2BANB 2BYCA 2HHQA 1PC5A 4BWJA 2V9WA 3FJ2A 3K5PA 4NLWA 2FJAB 3BM7A 3FCHA 2IC3B 3DRRA 3KHGA 1VQOS 4RBTA 2EFVA 2HWHA 3WC0A 4XO0A 3IWXA 4IDKA 2IYIA 5CH7B 2NS1B 2XGQA 2R2SA 5HMZA 4DV0F 4IOBA 1DTQA 3R5DA 2MKHA 5CYQA 5KT4A 2VFUA 1ZPWX 2DH7A 1XC9A 4DX8H 1HI0P 2HFZA 4R8UA 3KLIA 5H9FJ 4KGKA 1IKVB 1NZAA 2COLA 1ZM4A 2L3MA 4U9RA 3MPVA 3W2VB 1VFJA 1H2TZ 1UA1A 1YJVA 2F3JA 2E9ZA 3AB2B 3MM6B 4NA2A 3HVWA 5I3QA 2R8KA 4DSKA 2R7TA 2ZNZA 5I3PA 1WHYA 5DDOC 4X4SA 1SV5A 3SYZA 4A8MP 4HYKA 4Q45A 2O5DA 3MMAB 3VAHA 1T3OA 5G0RB 2KXNB 1KVIA 5K5MA 4JI6F 3VTIA 2MGZA 1XR6A 3K57A