2BJEA

Acylphosphatase from sulfolobus solfataricus. monclinic p21 space group
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE
publication title Structure, Conformational Stability, and Enzymatic Properties of Acylphosphatase from the Hyperthermophile Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 23
structure length 90
sequence length 90
chains with identical sequence C, E, G
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bjeA00
1IUJA 1FEEA 2ZDPA 3LGMA 4HH1A 1SQEA 1CPZA 4Y2MA 2XMUA 3FRYA 1YJTA 2K2PA 4FNIA 3TOQA 2ROPA 4NPOA 1FE4A 5K9FA 1S6OA 1XBWA 1KQKA 4QOTA 3CJKA 4DPOA 2KT2A 5KAKA 1WD6A 4OJHA 1P6TA 3BGUA 3KG1A 3MCSA 2VH7A 1YJRA 3LGNA 2OP5A 2FHMA 1LQ9A 2XMMA 3LO3A 2QYCA 4Y2IA 2RSQA 2RMLA 4A48A 5B09A 2QLXA 1RJJA 5B0BA 2CRLA 1TL5A 3DXSX 3FGVA 4OJGA 2LXFA 4OJ3A 2HFNA 1ULRA 1YRXA 4DN9A 1KVIA 1APSA 1FE0A 2W4CA 4HH0A 1TUVA 2AJ1A 3KG0A 4Y2KA 1SI9A 3HHLD 2IYGA 3BN7A 4OIXA 1AFJA 1R6YA 2OMOA 3HX9A 4NL5A 1YJUA 1Q8LA 3VTIA 1JK9B 1V3ZA 1VQSA 2HQIA 4U9RA 1OQ3A 4OJ1A 1Y3KA 3MZIA 2VV5A 2W4PA 2FIUA 2Q3PA 4FNHA 2RU9A 3T9NA 4HL9A 2HFOA 1OQ6A 2AJ0A 1TR0A 2GFFA 2OAUA 2ZDOA 4YDXA 1FD8A 4A4JA 1YJVA 3BB5A 1OPZA 2PD1A 4Q2MA 1N5SA 2IFXA 1Y9OA 2IYIA 1GXTA 2GGPB 2AW0A 2GGPA 3F44A 5B0GA 3E8OA 2W4DA 2OFHX 2K1RB 3HDSA 2GO8A 1JWWA 2K1RA 5F0UA 3FMBA 2LQBA 2OFGX 3HF5A 1N5VA 2N4DA 2ASYA 2K7JA 1KVJA 1VQYA 1GXUA 1Y0HA 2OD4A 2ROGA 4ZA1A 2HLUA 5A6PA 1MWZA 5B0CA 3HHLB 2FB0A 1Q8BA 1FVQA 3K7RA 5B0EA 4DL0C 5B08A 2XMTA 3KKFA 3BM7A 1URRA 2BUNA 2KKHA 2QLWA 3GZ7A 1FVSA 2KT3A 1AFIA 3QMQA 5A6WA 2AP6A 1X0PA 2FTRA 3WDOA 1U7LA 5B0DA 5B0AA 1P8GA 2N4CA 2OKQA 3I9ZA 3TNVA 1Y3JA 2ACYA 1TL4A 2XMVA 2K7KA 4YEAA 5B0FA 1SB6A 4ZOSA 1Q4RA 2HLTA 1N5QA 1Q53A 2QIFA 3DCAA 1TZ0A 1K0VA 1QUPA 1CC8A 3BR8A 1CC7A 3CJKB 2XMKA 2GA7A 3BF4A 1AW0A 2XMJA 1N5TA 2HIQA 2LQ9A 2ROEA 4EFAC 2PGCA 1MWYA 5IXUA 1YG0A 2BYCA 2OD6A 4HI1A 2RILA 2GV1A 2EW9A 3HFKA 5T7LB 2LDIA 4A47A 5F0WA 2KYZA 5T7LA 1S6UA 2BJEA 2JDJA 3HHLA 4A46A 2G9OA 4Q2LA 3TRGA 2BJDA 2L3MA 2N7YA 2BBEA 3IWXA 3QGPA 1OSDA 4F67A 1X7VA 2GCFA 3KNGA 1FESA 1W2IA 1X8DA 3BDEA 2XMWA 4HI2A 3IWLA 3UDCA 3HHLC
chains in the Genus database with same CATH superfamily
3CDAA 5MLCV 1GT8A 3C46A 3K0JA 5C2CA 4UUXA 4XDCA 2ZWPA 1VOMA 3HSDA 5IT0A 1ZH5A 3MUMP 2CPFA 3KG1A 1RTJB 3HKWA 5KFZA 3F0NA 2NXCA 2BACA 2CZ9A 3M8RA 1S12A 2AGQA 1FE0A 3IP0A 4MK7A 2HHHF 1T3OA 4L72B 2H4WB 2HQ3A 2FY8A 4J90A 4USVA 4OJ1A 1VK3A 4KAIA 5DM7Q 3C2PA 5ADZA 3W2VB 2OLWA 1FRJA 2YTCA 3MPYA 4UF4A 3E8OA 3T41A 5AJ3J 4NLPA 3T5HA 5I3UA 1BWEA 3DLLQ 4XO0A 1T05A 3CJ2A 1QTNB 3C15B 3HULA 2AGOA 4J9KA 3BPSP 2BUNA 4USUA 3O3LA 3PXGa 1QTMA 4DR4F 1K0VA 3NOCA 3E01A 2WSCC 1KNZA 1KFSA 4Y0FA 3CCLS 1RGVA 1V5IB 4C98A 3GIJA 5CCMA 3PYEA 1LKZA 2C3UA 4QZVB 4UOGA 1K1SA 2PA8D 1IKWA 4JOUA 4DLGA 5K8MA 4JBCA 3DNCA 4OZ0A 4OJHA 3JTPA 4J37A 9ATCB 1FHTA 3CC2S 2LKZA 2HSEB 4CLTA 2MEWA 1NAQA 1JJHA 3LUYA 3DLGA 4TXSA 2LCWA 5ITHA 4ZMMA 3FVYA 1JK9B 3E3XA 3ILIA 3TX0A 2MZ1A 4B3RJ 3BO3A 1MNEA 3NP5A 4LFCF 3BQ1A 3DLHA 1NSPA 3G6ES 3GIRA 3ZZYA 1GXTA 3W65A 4NLRA 2RS8A 5ETKA 5KG2A 3D9BA 1HI1A 2FHJA 2ZM6F 4P9SA 2QMUB 4DHVA 2CQ0A 5LMNJ 4RNFA 2HQCA 2PN6A 2HMIB 3EZ5A 4IH7A 3MM8B 3ZFVA 4EZ9A 2DXEA 1VHFA 3G96A 3O8WA 1EQ0A 1N34F 1UAWA 3NEKA 2NXJA 1HQUA 3NGDA 2ZH5A 2KU7A 2DRDA 2NXUA 1RWMB 2XCPA 3AOAA 2LECA 4I56A 2A18A 4AL5A 3W5YA 2Y8YA 3TR5A 5D6GA 4NLQA 3QQCD 5JXSA 3KLEA 2W2OP 3DHXA 3Q0AA 3R2DJ 1GAOA 4DPTA 2BANA 3UCZP 3H5XA 2EK1A 4P2XA 4CLPA 3U1LA 3HHLD 4I68A 2KYXA 1SC1B 1RKIA 4K7QA 4ECWA 4ZP9A 3IMQJ 3ZC4A 3B8HA 2FJBB 2J9DE 1RBAA 4K4UA 4I0WA 3W61A 5AXKA 2BE2B 4NRTA 1BC6A 1U09A 5I3QA 2XWXA 5IM0B 3NGKA 4WU2A 2C2DA 4CYUA 5HJYA 3MXHP 2MPUA 1AUDA 5KG3A 5C25A 1CSJA 2KI2A 5KFXA 4PPDA 3HPOA 3NGRA 2HLTA 1CC8A 4K59A 2XMKA 1Q82T 2XMJA 1H7XA 2R7XA 2G2OA 5D0HA 4DV3F 2UV8A 2E1AA 3DM2A 2HS0A 2HURA 5F8MA 1U1LA 4CWBA 3RRKA 3PZPA 3V81A 3HHDA 2DB1A 1KHWA 3GSIA 4CH0S 4X4TA 2CJ9A 2IC3B 5HSPA 4UY8T 4YB1P 1WHWA 3W9IA 2C2RA 3T6JA 2LXIA 1RJJA 4KRWA 3MM9A 1JLBA 2CPYA 3GB0A 2ZWOA 4ECXA 4OYXA 3I4PA 2MLXA 6FDRA 2ZC3A 1HR0J 3T5KA 3US5A 1JNRB 4EYIB 2KB2A 2DR7A 3SZ2A 3K5OA 1S7IA 3GFXA 1J5OA 1VJQA 4Q43A 1RAIB 2JH3A 2GVDA 1RT5A 1VR6A 1Q5YA 2HZVA 3H2LA 3BF4A 4DV0J 1YSJA 3MAAB 4I2PA 3OVBA 5KFCA 2OUGA 4NXNF 3RR8A 1XMQJ 2EKYA 2MSTA 1RWPB 4IYQA 4RNMA 2IVFB 4B3TJ 1C0UA 3CDWA 4F0KA 1N33J 1B70B 4IOCQ 5KG4A 1JLCA 3AB4B 1Q8IA 5FIIA 3CJ3A 4QIGA 1YZ6A 1BQNB 3UN3A 3C6TB 1JMTA 4K2JA 2PSZA 1YRXA 4C8LA 4JI7J 4KE5A 1TUVA 1Y5LB 2UP1A 1VRQC 3IM8A 2V63A 4X4UA 4KKOB 1V9OA 3CJ0A 2VBZA 4MAKA 3NG8A 3K57A 3RW6A 5A8WA 1GTHA 1WC4A 1S9FA 2L08A 3NS7B 3DI6B 6FD1A 1J5EJ 2CVIA 3RB3A 1ZM3A 3IR6B 4S0MA 3R97A 1FERA 2CUYA 3OQ2A 3JXOA 3H5SA 5CYQB 2C1EB 3DYAA 1Y3JA 2HVZA 5KG6A 4CH7A 3NXZA 3NMAA 3ENWA 2DVIA 4DV2J 4OYZA 4QYZJ 2HGMA 3FZ2A 4AT1B 1BUXA 1Q79A 3GJTB 3GWCA 5T7LB 5ETRA 3I82A 3UR0A 2DR5A 5J2MB 4ECSA 1WG1A 3LALA 1C4CA 5HANA 2NXEA 4FYXB 2ALZA 4ZN3A 1IKVB 1IKXB 4C0HA 2BOPA 4UY85 4P73A 3UDVA 4LF7J 3KJFB 3MHYA 4ZCLA 3KJVB 1KP6A 2IYGA 1H2UX 3MR5A 4R5PA 2M9KA 4ELVA 1HWUA 2W4PA 3MAHA 2Y9HA 1EJ7L 4OZNA 3AJ2A 2YVSA 1IR2A 4UZBA 1JLAA 1OPZA 2JEIA 5J1EA 3MECA 3MPUB 2F8HA 3F44A 1VRTB 1GK8A 3VGUA 1S1XB 1MWZA 2ADBA 2ZKTA 4ED1A 2L41A 1WC5A 2FVRA 3AAWB 2AYBA 2F65A 3ZO7A 3JSYA 2CNNB 3MPVA 3HHEA 4DQIA 3FBBA 2J6UA 4H4KA 2MGZA 4CZCA 3TUJC 1N32J 2BV3A 2XC9A 3Q8QB 1VI7A 1ZAXA 3K8WA 3CEDA 3PO4A 2CJQA 1R0AA 3W2WB 4TLRA 2OIHA 4WPAA 3TX8A 3S7RA 4I4BA 4KHPJ 2JVRA 5I4MA 2DRBA 1SJ3P 1IBKF 4DV7F 2QEXS 3A8EA 2VUGA 1LWCB 4FN5A 2HQIA 3WX8A 3BJYA 4X65J 2W9CB 4FYDA 3A13A 3X3UA 3PFOA 3DLKA 3NAHA 3HVTA 2V0NA 5F41A 4PG5A 1SKRA 1WC0A 2B51A 2DNQA 5EWGA 1UFLA 3TYTA 5J2PB 1HQEA 2XGPA 3MTJA 4ERDA 3SCJE 2AP6A 2KM8C 1R6VA 1BQMB 1TL4A 2ILYA 2W2PP 2R7RA 3IGVA 4X4RA 2A6MA 1NLKL 4KV8B 3LP0A 1V6HA 3EUNA 2HHPA 1HYSB 1SV5B 3OW2R 2QSFA 1S10A 3PRBA 3TVYA 1BLUA 2AU0A 2JLFA 5KT6A 3MEDA 3NKYA 1VQKS 1HPZA 4WU3A 3R6LB 5GVQA 2RKIA 1FRKA 3L95X 1LXJA 4PQUA 4DV6J 2DYAA 4DV5F 2UUBF 4M5MA 4OX9J 1UJ6A 4DR5F 4GO7X 3RJMB 5MAOA 4C7QA 2CNOB 2E44A 4UQTA 1N36J 2L9WA 2D9OA 1WI8A 4OHVA 4F0HA 1NKCA 3M2RB 4HDGA 2GO9A 5F8IA 1NSQA 2Y0SD 3LQVA 3DRSB 1NH8A 2R7SA 1UFKA 3H59A 2KO1A 2NR0A 5KFUA 4GC7A 3TZZA 4A8FA 1Y0HA 2XSJA 4HHUA 5BYQA 3M8WA 1KHVA 3RTVA 2YNFB 5D0EA 2H51B 3GJQB 3EE3A 1PAUB 4CLUA 2LP4A 2QFJA 1KVKA 4RW8A 3S01A 2R9LA 4L73A 4ECTA 2YKPA 3G82B 1SUQB 1HNXJ 2G0IA 2NUHA 3PDNA 4W98A 2BQRA 2UV8G 2U1AA 2WCXA 5AT1B 3VQTA 2VODA 2W2NP 2LQ8A 4PXDA 3AHPA 4PXEA 1YJTA 1RHRB 4P72A 1HBOB 3CWJA 2DNGA 1U2FA 3J7A1 2ZBQA 1WC6A 3M8YA 2DTJA 3U1MA 3C6UB 4F50A 1FJGJ 3QO9B 3Q2TC 2F5GA 3W60A 2ZE2A 4PXCA 3HD2A 3D1HA 3D54A 2XTJP 4ES1A 4B9TA 4DF8A 1I1GA 2F1FA 2DHHA 2GMLA 3PX0A 4H4MA 3IR7B 1WHVA 3P4UB 4IRKA 2Z0GA 2ZJQQ 1RABB 1RACB 2QN6B 3IRXA 5T14A 4ZA1A 4NYOA 3R7SB 4DL0C 2X3DA 4EBEA 2KHCA 3VCDA 1DARA 5H9FJ 3CE8A 4OLPA 3IR5B 4D3GA 1VQOS 3QJLA 3I5AA 1RT6B 2XMVA 3H5UA 3VR1A 4I6AA 2HW3A 1ZA2B 3KFWX 1FNXH 5D15A 2XYHB 3F56A 1MN9A 4PCQA 2J0WA 2ZDPA 4DBQA 1HHTP 4ZPCA 3VGVA 3FBEA 2MKJA 3M8PB 2Q1LA 2UUTA 5C5JA 3DU5A 4KT0C 3W1YC 4KO0B 3PIPQ 2E5GA 4FXWA 1PGZA 3E51A 3PW5A 4BS2A 2CQ2A 3SDEB 2M52A 1SIWB 2CXEA 1L5UA 2GAHC 5JMNA 1HBUA 4ZVUB 2ZNZA 2OFGX 1UEUA 5KG5A 4LF4F 4QIFA 4YB5A 1GMWD 2RNEA 1S6PB 2V2KA 4AQYF 1B0PA 1FX4A 3AFGA 3TA1A 4DUYJ 4EUVA 2RRBA 2MQOA 3T1YF 5GAEI 4RJVA 5CH7B 5GAGI 2C28A 3MMAB 1X7VA 2QA2A 3OV7A 2C3YA 1HNZF 1FRMA 2HHTA 4LRBA 1ITPA 3RW7A 2DHGA 4WFAQ 3I0RA 4IDKB 4USKA 1X4DA 3D3BJ 1RTJA 1RTIA 3UN5A 1RWXB 2DEIA 2J5AA 3FFIB 2ATCB 5C24A 2XS7A 3QBCA 4LF6J 3HHKA 1NO8A 2G1DA 5EHHA 3FCWA 5U47A 4A8XA 1RT4B 2GW8A 3W2VA 3LAMA 5KFVA 3QRRA 1DQAA 5KFJA 4RBTA 2RJZA 2RQMA 1T9TA 1HWLA 3CJ8A 4WK1A 1JLQA 3C15A 4GKKJ 3GPAA 3BM7A 4DR2J 3V4MA 3T5LA 2N4CA 3AQPA 4LQ9A 2ZD1B 1VS3A 4RWXA 1BGXT 5BR8J 2H65B 3KMSA 1N4LA 3T1AA 4Q2LA 4QW9A 3MR6A 4L74A 1XNQF 2CQ3A 3H20A 2AWZA 3HJFA 2YKOA 4LFBJ 1YKWA 4LREA 2VFRA 2DH7A 3EGZA 5LJ3Y 4K0KJ 2PFDA 3DLEB 3QIPA 3EVWA 1AUSL 3FGVA 4OV6A 2NLWA 4CNYA 3BGLA 3B78A 2QFIA 5D78A 3ADAC 2ZBRA 1NZ8A 5FDLB 1RTHB 1VQPS 4PG4A 3WHIA 3KG4A 1VBKA 3PG9A 4U7CA 5GAEU 3L7PA 2HS3A 4FF3A 3L9ZA 5GAGU 3U1NA 3V2UC 3CXCR 3E2EA 1WKLA 5AE2A 2HMIA 3MM8A 1IBMF 2OEMA 2NSCA 2WAQD 3NWGA 3H4DA 4PZVA 3NNHA 1NJXA 1BD6A 4P6QA 3IWLA 2PMZD 2JNJA 2DO0A 4I7FB 4AD6A 3PM9A 4O0NA 1H38A 1TFYA 5HVHA 3LANA 2XZDB 3RG6A 4ZHRB 2VG5B 3FCHA 3OT9A 1XQIA 3VF0B 3JB9k 3FRZA 4FYWB 1M5HA 2I5JA 1X5OA 1QVFR 5KT4A 3EZUA 2E1RA 2UVRA 1H3DA 4RWWA 4DL6A 1H74A 2OHDA 4CH1A 2HNZB 1RLDA 2IMWP 3ZZPA 1IM4A 2RU3A 1UWBA 2VDIA 3CCQS 2BE2A 4RU2A 1U6ZA 3FDSA 1O8BA 3CGIA 5CA5A 5IM0A 2KDOA 2UXBF 4Y2AA 1U1KA 1GH8A 4JI0J 2Z30B 1RU1A 4O3SA 3NLCA 3UN2A 4F04B 2E5LF 2DHAA 2HIQA 2D3ZA 2YKAA 1OS5A 2V94A 4OX6A 5LJ5Y 4YOEA 2E29A 2ZJPQ 2GCFA 3S8SA 2LEBA 2PDAA 3FMWA 1PAEX 4HH1A 2F8MA 1KC8T 4C4WA 2KFNA 1P1TA 1S49A 4LMZA 4DV4J 2YWHA 3OXFA 2QMWA 1XTZA 4JI8J 3GG0A 5THWA 2G13A 2R8JA 3FEZA 2QA4S 1K44A 1ZPVA 1FRHA 2K8GA 4LT6A 3CMAS 1H2VZ 4ZVTB 3LPYA 1VQ4S 4IQXA 3NNAA 4IUFA 2XG8A 2KM8B 3TAMB 1I94J 5SZTA 3R5CA 4P75A 3OTOJ 4GVBB 4KQZA 1RA7A 3W8GA 3N5FA 1YRUA 1N56A 3HF5A 3KMQA 1CJKB 1UTAA 2PA3A 3AB2B 5F8JA 2CWXA 1YDLA 4F36A 3UE2A 1SC3B 4V1Ak 3DXBA 3SEOA 4CT9A 4YEAA 4RBUA 2YPZA 1HR0F 5IXUA 2E7WA 3KLVA 5EWFA 1DQ8A 2A2DA 2F4VJ 4CQ1A 4DF4A 4LF1A 1FNOA 1T7PA 4RW7A 4DG1A 2IM0A 3MM6B 5HI7A 8RUCA 2XWYA 4ZPVR 2KFZA 1T03A 1BQNA 3C6TA 3PR5B 2OTJS 3K58A 2X1GA 3BYRA 1NB2A 2H5JB 4KKOA 3K5NA 4DFKA 2OPQB 1RHQB 3MCMA 1X31C 3CDEA 3OVSA 3NCRA 4M5KA 3GQCA 1CG2A 5DDQC 3DI6A 4NLDA 1RHKB 3U7JA 3RYLA 3CT9A 4JI7F 3TAQA 5F3ZA 5B08A 1M1KT 1UL3A 2IAJA 1MROA 1G7CB 2CDQA 5CZVA 1EETB 1UP1A 2CG4A 3M6UA 2ZVSA 2H4YB 4DI6A 5T7LA 1SXLA 1Q78A 4N76A 3C19A 1XJWB 3SQGB 5J2MA 2XMWA 2VB6A 4LRCA 4ZVPB 4E0DA 3F73A 1KQKA 5KFQA 4TQSA 3EVOA 1WD6A 4NX9A 4DV2F 1LQ9A 1CS4B 2XS2A 1K47A 1Q1KA 5E3RA 1KVIA 3QWUA 4ED6A 2AJ1A 3KJVA 1TV6B 4C0BA 1YQHA 2ZOGA 3J81j 4H4OA 3KLHB 3I5BA 5D4PA 1RHUB 4ED2A 1HBMB 3MI7X 1TKZB 4JV5F 1RAAB 4EK2A 3HDSA 1MMNA 3G87A 1S1TB 4DSEA 3AA8A 2OPRB 3BQ2A 1P8GA 1LK5A 2MQMA 1F9EB 2K06A 4OQJA 4OZ5A 3R27A 4H4KC 5HAOA 3LW5C 1OSDA 2XHWA 2CQCA 2W8LA 2GJFA 2W2MP 5KAKA 5CABA 4PG6A 3ZZUA 4ZIWA 2AYEA 4QQBA 2MB0B 3TEGA 2LXFA 3Q24A 5HQLA 3V6JA 2K3IA 1B7YB 4PWWA 1D09B 5IOLA 1LWCA 3LWMA 1UKUA 1WG4A 2M5YA 2YWFA 1Y3KA 3I5CA 2DNMA 2WVCA 4Y2CA 5DZ6A 2W9CA 1LWEB 2P2CB 2L9DA 3QAUA 3GJSB 2W4DA 4USMA 2HBQB 2ZVIA 5E3CA 3ZZTA 1XEZA 1XC9A 3DGPB 3BV8A 4FVMA 2FYXA 4J9LA 2ZHOA 1CJVA 2DH8A 4QR1A 1RADB 3KWMA 4N77A 2L9NA 2E7XA 4XTTA 1XMBA 1X5SA 1OY9A 1MLAA 4KV8A 1MSWD 2N3LA 2HGLA 4CLFA 4C3MA 3R7BB 2J76E 2BBEA 4OZJA 3CULA 2FC9A 1SJ4P 2R2UA 5L1KA 4U95A 3CJKA 2J7WA 3GFYA 5ETQA 4OYIA 2DNKA 4NA2A 2I6WA 1NJZA 2C42A 4W4MA 1N8RT 4TU7A 5IWAJ 1P1LA 3HP6A 3CC7S 1KR4A 3ETOA 3M2RA 2V8DA 3IO1A 1DURA 1GX6A 4A8QA 4TNOA 3GYGA 4X84A 3ISND 2H1YA 3DRSA 1IBCB 3OHAA 2EC2A 4P2MA 4X2BA 2PEBA 1FNMA 4OFZA 4ES2A 4WFYA 1NHUA 4MIBA 1N36F 3UO0A 2JJ4D 1IKWB 2R2RA 1S77D 1PIEA 1U6FA 2QRRA 1KEKA 4RW6A 3G82A 2IBOA 2LDIA 4WFNQ 1U1PA 2GZOA 1OYEA 2H48B 1RWUA 2N7YA 2MLZA 2YBVA 1HA1A 3QT8A 3C3LA 2M2BA 1F5BA 3BH7B 3DLGB 2FLPA 5KT5A 1H7WA 5A0YA 1T9WA 3A4TA 3C66A 3A1YG 2C2EA 1HBOA 4RR5A 4BWJA 5ETTA 3AY0A 4E2FB 2EBGA 2DGXA 4A8OA 3D7SB 2MZTA 4DS5A 3THTA 4HH0A 3C6UA 2CNLB 3QT7A 3A12A 3QO9A 1G3OA 4NMLA 4NLYA 1TR0A 1FJEB 5LOQA 1FF2A 3GG1A 3NCQA 2IFXA 3U02A 3FMBA 5FLXU 4G65A 1W2BR 4HACA 2OEKA 5B0EA 2A6OA 3UCGA 1LK7A 1T11A 3IM9A 3SSRA 1RT6A 3BH6B 4YHHF 3FQKA 2VA3A 2DD8S 2HHXA 2ZFHA 4NEYA 1ZTTA 3IWXA 4R25A 3BB5A 1N0UA 1ZTWA 3MPDA 3M30B 5LSRA 2BXJA 1T94A 3C14B 4B9NA 3TJ9A 5L8RC 2R2SA 2B4OA 4HTIA 3VAHA 4FF1A 1UZDA 4KO0A 3KHLA 2CPIA 2WVFA 3TQEA 4C97A 4M1KA 4D3HA 4KH1B 1PJ7A 1EX8A 2ERRA 2EFNA 4CP5A 5D77A 1OMSA 2GO8A 4F4KA 2FD2A 3OUYB 2MJNA 3DM2B 3PCOB 2O5DA 1S6PA 3R3TA 1T8EA 1FT8A 4KPCA 2EKNA 2MQNA 2CAJA 4HHHA 4LF2A 2AIRB 1KOOA 3A8IA 4NXMJ 2FJDB 1Y10A 3ILJA 2W9BB 3MM9B 4LF8F 1OJ4A 2CPJA 2HNDB 4KBIA 3BREA 2KT2A 2ZHBA 1T9YA 4IDKA 4HKQA 1PCAA 3CJTA 1QSLA 3DFEA 2M8HA 5D8HB 3FFIA 1LFWA 2DITA 1IBLJ 2OMOA 1PILA 2F9DA 4ETZA 3NMRA 4Y28C 2VU5A 3THVA 4ALZA 1J5OB 1RT4A 4FBTA 1OQ6A 1IQTA 1U8WA 3ZNUA 1VMBA 1RT5B 4RUBA 1QAJA 2YWKA 2UUCJ 2CJBA 3D1QA 3JAMY 1C4AA 4I2PB 1XIQA 3R9LA 1PJ6A 3EGWB 5K8PA 3OTDA 2MQLA 4AL6A 1TVRB 1C0UB 5L9NA 3ILLA 4NLUA 1LEOA 4ECUA 2ZD1A 1CC7A 1JLCB 4DDFA 2R7UA 1PO6A 2UVWA 3M8QB 3Q23A 2EFOA 3DMJB 4HI2A 3ULHA 2ADCA 2XB2D 2Y3YA 2IA0A 2E7VA 1VCTA 1H0HB 1R8BA 5KFPA 2DNHA 1K0TA 2QC3A 4OX7A 3TAPA 2BQUA 3LO3A 1IKYB 2RMLA 1UPPA 5A8WB 5B09A 2DGUA 3R2CJ 5HMXA 3K8VA 3UQSA 1EB0A 3EGVA 5G0RB 4ZITA 4LFBF 2O66A 2LLZA 5EX3A 5FDLA 2CA9A 4N5SA 4DS4A 1AA1B 2B4UA 1F5AA 2YQ0A 1DQ9A 1SKWA 4UQGA 3P3DA 4X62J 4DFMA 3QYYA 3KKFA 4C8ZA 2KT3A 1IWGA 5BJRA 2HBYB 5ETLA 1U45A 5L1IA 3H5YA 1N5TA 3Q83A 4DSKA 1VQ5S 2CPXA 3VHQA 2VQEJ 4OV1A 4CO3A 3OBIA 2E9RX 3B4MA 4M5IA 3M2VA 2W7PA 4I7FA 4OLOA 1IR0A 5GADI 4R5PB 4ZHRA 2VG5A 2QLBB 1FA0A 5A8KB 2B4PA 2CQPA 4FF4A 4HT5A 2XM3A 1Q8KA 3MECB 1QE1B 3L09A 3NCPA 4Y6IA 1R7IA 1U2RA 2DKOB 3CJ4A 2BR0A 4JI6F 2HNZA 5DO2A 2B56A 3QSYB 4JYAJ 5ETOA 4QIWD 4WK3A 1C1CA 5HQMA 3CPWR 1JXEA 4XPEA 1KKHA 4O4RA 3A8JA 1XMOJ 3IC1A 4ZVFA 2MGZB 4X4PA 4ZVGA 4O0IA 3FQLA 2J8SA 1WJ9A 1AFIA 1XERA 1R0AB 4KHMA 1TL1B 2V4QA 1Y5NB 3J80U 1SB6A 2KRRA 1MU2B 1GTEA 1QUVA 1RA6A 3MMBA 1JLGB 1AW0A 3R5JB 3OFGA 4DOZA 3O44A 4F8RA 5D4OA 2HVDA 5IC6B 1QAXA 2DR9A 4J9UE 7FD1A 3FBFA 4TU8A 1LNQA 4NPOA 4YR2A 3J7AN 3QT5A 5IQ6A 1PYSB 1NSKL 2R4FA 2VPZB 3CDUA 3TW0A 2FZCB 3ICLA 4DV1J 1UETA 2QLXA 1M5KC 3DLKB 2KRBA 2Q43A 3JSBA 5IT9Y 1GNKA 5LMUJ 4DUZJ 1S99A 5KFGA 4C3KA 3KJNB 1RWOB 3O6QA 4DV4F 1MMLA 3TAMA 4IG3B 1FFSB 1P9QC 3HT0A 2WTFA 2BMBA 4DX5A 2RQKA 3ZZ0A 2KHDA 3P8BB 3UVJA 4X4NA 1KONA 1AROP 4DR7F 2OD4A 3QPIA 3QZ8A 1EARA 2XMTA 1SJ1A 1N5YB 1URRA 5DM6Q 2DR8A 2V67A 2V2QA 1B99A 4DLEA 3LA0A 2RKIB 3KLFA 1UJ4A 3K5PA 2WBRA 4OI6A 3UPFA 3PHEA 1S0VA 1X8DA 2FJVA 3IGNA 3N79A 3PY8A 2IM2A 4LRAA 4J9NA 1VBXA 4DR6J 3Q2SC 3VAFA 3MM6A 2B9XA 1Q0NA 4IQMA 4B17A 2CYYA 1TMMA 3J7YI 2Y1RI 4MKAA 3PACA 1HI0P 1N88A 3FJ2A 4EEYA 3V6DA 3M8ZA 2KJWA 1X5PA 3TUPA 1RWWB 2BKNA 5AE1A 4O4GB 2PD1A 4RW8B 3R5DA 4DUTA 1Y9OA 1I5OB 4KTQA 3DLBA 1GXUA 3A3PB 3A3NB 2HHWA 2CNKB 2C3OA 4ZLPA 2AYMA 1XNRF 4LQ3A 2KG1A 5C42B 2XO7A 2E66A 4X4QA 3DCAA 2YQ1A 1EETA 2CQBA 3KLIB 4PG7A 3HHLA 2H5EA 4WZMA 2RS2A 4MKVA 2UU9J 3L7OA 3FCVA 3TWZA 2J6TA 3KK3B 2ZE2B 5L1JA 1HHQA 1HMVB 1H73A 1NB7A 3DLJA 1X4AA 1S76D 2PC6A 3OJSA 1RAJA 3N5BA 3GLJA 1CS4A 5JVHQ 1HHSA 4H4MB 2YWWA 4NLTA 3B6BA 5CCLA 4YB6A 5CD4A 1PYOB 3IRXB 2AEJA 4DZ6A 1TKTB 1FXRA 4RBVA 3KTQA 3DC2A 1IM6A 1JKHB 5HL7Q 4IH5A 2N7CA 3U27A 1WEXA 2YKMB 3EDRB 5BYRA 3D6MB 1WSRA 1UZHA 2IIHA 2N4DA 2ASYA 1M1GA 3AT1B 1HFEL 4QU7A 2HHSA 3HI9A 1S1TA 1IJFB 4A8SA 2OPRA 1U1QA 4F3OA 4LF9F 4TY8B 4TU9A 2MKYA 2B8QA 2HHVA 3HLUA 2R2TA 3RRHA 1ROFA 3SI8A 1Y4ZB 3P5TL 4IKAA 2E1MC 2HBRB 3J7YU 4YMEA 5A76A 1FEEA 5HLFA 4PYAA 2AT1B 1M5PC 2PT0A 1B3TA 2BRLA 2ZH3A 4QWDA 3I9V9 3TUIC 4LRDA 4B3SF 1F9FA 1KQSR 1O5JA 2RSQA 5HMZA 4LJMA 4Q7AA 3QIDA 1HBUB 4GO5X 4F4AA 2NXNA 3T1HJ 2PIIA 1TP7A 2QT7A 3MMJA 1AZSA 4TLQA 3TANA 1VQSA 2XBPA 4HDHA 3MZIA 3ET6B 1VQNS 2JVOA 3PRVA 3M8SA 2XY5A 1FTCA 2D3OR 1LWEA 2NYHA 4ZPBA 4OI1A 1WKKA 1W26A 2AW0A 3K5LA 3KJQB 1WEYA 4HEA9 1PG5B 4JI2F 1FDNA 2P5VA 3DGPA 4DX8H 4QJVA 3WZ0A 2CG8A 5GAHI 2FTRA 3GIIA 4QBUA 4QWBA 2VKRA 3SV3A 4ANEA 3I0RB 3SXLA 2MKSA 3G86A 4EFAC 2KTQA 3T5JA 1RTIB 3H98A 4I69A 3KXDA 3TRGA 3KDNA 3IRWP 1RWKB 1W2IA 5M2PA 5C24B 5KFYA 2OPPA 1CPZA 4ZVRB 2R8HA 1UVNA 1QJHA 3EZOA 3BGUA 3S1TA 1FFWB 2F9JA 2C2ZB 2VBXA 3FSIA 4CRJA 2MMYA 2HFNA 4DSIA 1A7GE 3O5TB 1R6YA 1YJUA 1WKJA 1JLQB 4EO8A 4U9RA 3KUHA 1L3KA 4KR0B 1CQMA 5J2NA 4FF2A 5KFKA 4RKUC 2CQHA 3SCKE 3RBXA 1X4BA 3CCMS 4LBHA 1VBZA 2MKKA 4K5SA 1Q5VA 2W7AA 1CEZA 4DR4J 2GAGC 1X0PA 1PSDA 1ZYQA 3I9ZA 3KK1B 4QPTA 1U25A 8ATCB 4I2QA 3DRPB 1MWYA 4DQSA 4KGKA 1FI4A 1SH0A 2YNHB 5IV3A 2BKOA 1KTQA 3QIPB 3HSZA 4W90B 1YJ9S 4CM0A 1U26A 2DR6A 2EVZA 3CVKA 2V4JA 2A1BA 1RISA 1KBRA 5A8RA 1YTYA 3HM9A 1D0EA 3RRGA 3T6BA 1ZZNA 1KLNA 3X1LB 3W66A 4X66F 4USIA 2KH9A 1LW2A 1DY3A 2Q6CA 4LFCJ 4JI4F 3K89A 4NLWA 4UUWA 1WOSA 2PFFB 5GAHU 4DR1J 4U6PA 2HFUA 4J9SA 3GYXB 2QMXA 1NHVA 2ZM6J 4DU7A 2HWTA 4BBYA 1SJQA 1G4CA 3PIOQ 3MR2A 1YBTA 1B0TA 3HZEA 2CFXA 1S7HA 1YITS 3NOGA 1ACMB 1N34J 5K20B 3UFCX 2CQGA 2PGCA 3Q8SB 4CLZA 2KYZA 2JX2A 2E9TA 2I5JB 2M8DB 1RAOA 2VC0A 3BDEA 1UJ5A 4ZP7A 1FTRA 3I0SB 2D1CA 4FVCA 3M30A 1AT1B 4M5DB 3TZXA 1Z2ZA 3DN9A 2J0SD 4AUKA 3CSKA 3C14A 3AJ1A 2XNQA 4OYAA 2J9CA 4PEOA 2JEGA 1UWBB 2RHSB 1VHIA 3MF5A 1URNA 2I2YA 2HVHA 3AH6A 4M63A 4ID5B 5EX0A 4QU6A 4RUHA 3UWTA 2B5JA 4C8MA 4FP9A 4EWTA 3QFWA 2JL9A 2MZQA 3WQPA 3OUYA 2ROGA 2YNIB 2W01A 2FJXA 1DTTB 2HWHA 3SCLE 1HWJA 1D8ZA 5GMDA 2VICA 2C3MA 1A9NB 3QFHA 3WIUA 2PMHA 3EYZA 4DV3J 4LR9A 2XI2A 3QNWB 3MD3A 4B02A 1YG0A 2EW9A 2RDDA 4TKTA 3MEGB 2G9OA 2W9BA 3CD6S 2QO3A 2QLFB 2A3JA 2HK2A 4ED0A 2V2VA 2HNDA 2BW7A 4BC9A 3JTOA 1WDTA 3PX4A 1CBKA 5KFDA 2RUSA 1B64A 1NHKL 2P9GA 2C3PA 3KLGB 2W25A 2V9KA 5I42A 2P8IA 5E7OB 2V4RA 2BX6A 3FEXB 2UUAJ 3H7HB 3GYNA 1OQ3A 1EHWA 5H9EK 4X64F 1WC3A 4FKXA 2BJ9A 3GONA 3I6PA 1V3SA 3QGGA 4JB8B 2V69A 2DGSA 3BGRA 3J81Y 1TVRA 2P6TA 1ZAVA 2YKQA 1U7LA 4OYWA 4RW7B 4DG1B 3TARA 4NXNJ 2ZH9A 4Q44A 3H4BA 2B8PA 4F7VA 4O3OA 3BO4A 3H42A 1TKDA 4OZ3A 4ECVA 2YY3A 3M8QA 1Z4UA 1T03B 2E5HA 4K4XA 3DMJA 2LEPA 3R1HA 3LGMA 1WNEA 4HR2A 3FRYA 2HAIA 2HQGA 2JSXA 4EI2A 3PVXA 2XO6A 2MKHA 1TL7B 2XMMA 3SYZA 2MSSA 4A8WA 2LQJA 1IKYA 2ZZNA 5D0RA 5HQ8A 2FY1A 2VL1A 5G0RA 2K3KA 3F41A 4DX7A 2N3OA 2FGOA 3MAQA 5D0GA 4O3RA 4FS1A 2IAJB 3CD5A 1MROB 1PYTA 1RBOB 4ZJQA 2L48A 4IRCA 5KFBA 1Y00A 1KVJA 1ELOA 1NDLA 4UTGA 2V68A 3DKDA 3S6EA 4JV0A 1CVJA 2ALYB 4RO0A 2NPIA 2P9EA 1J27A 2C2OB 2ZZTA 3QGIA 4QYRA 2KVQE 4WWSA 2GV1A 3UD4P 1HWIA 2X51A 1BQXA 3PJWA 1YRTA 2RDIA 2AJ2A 2BE9B 2MY8A 4WYWA 2I0XA 5AXNA 4H4OB 4N7TA 1VQLS 2YKNB 5A8KA 5EN1A 5E2QA 2CZ4A 2UXCJ 1GMWA 1XWLA 4PUOB 3BR9A 1QE1A 1F0XA 3MGJA 4QCLA 3ZTQA 1SVDA 2F7VA 3CCES 2G2ZA 4QIEA 1MMDA 4ZIVA 2IVMA 2OAUA 2BKPA 3LAKA 1KWMA 1E6YA 4GKJF 1RAHB 3D0GE 3IFEA 4RW9B 5AE3A 3IAM9 3BBFA 4J91A 4R8UA 1KDNA 1H2TZ 1S1VA 2IA6A 4ZLNA 5D4NA 3CDBA 4U7UD 5IC4B 3D2WA 4OI3A 3KUGA 3SMZA 2F63A 3MEKA 2I8EA 5LM7E 1TL1A 4O3PA 2RT3A 1MU2A 2NQPA 1IXKA 1JLGA 2ABYA 2AV5A 4J9MA 3NNCA 4NEZA 2KN4A 2HPUA 2EWHA 4N41A 3DOKB 3UW1A 4M5LA 1RT3A 1WI6A 1DJ0A 1LXNA 1NK8A 3IS9B 4TYAA 2XYPB 4KJIA 3QJJA 1LW0A 4ZVQB 5GMKa 2UXDF 4YR0A 1D3WA 3OHBA 4NA3A 3CO0P 2XYGB 4C8KA 1G2EA 4XDDA 4DCPB 1TTHB 5FD1A 4XIUA 2KXFA 3OLBA 1KD1T 1UVIA 1CJVB 4MYTA 1RSCA 3EGNA 2A0FB 4WE1A 5K14A 4IG3A 3FC9A 4B9MA 2ZITA 1VQ6S 1JLFB 1WEZA 4U8YA 2FVPA 2V9WA 2VPWB 2R3VA 1N5YA 4ZP6A 2ZH7A 1DLOB 3D67A 4QWEA 5B0FA 1WF1A 3M2UA 2QIFA 3CJKB 2IM3A 3M7VA 2RILA 1VIXA 2BJEA 5JVGQ 4U67Q 4ZK7M 3HSGA 3UDEA 3BZQA 5KFIA 1M1HA 3OLAA 1C0TB 3WBZA 3KHGA 1U0HB 4MFBB 4DV5J 1NPRA 2UUBJ 2VOPA 3IN5A 1RXOB 5IT4A 1U1RA 2O1PA 3EX7B 1Q7YT 3QLHB 1H98A 2HYIB 2HRYA 2LU2A 4TN2A 1UA0A 1IJEB 4JI3F 4OYOA 5DDOC 2CKWA 4MK9A 1S72S 4PG8A 2HNYB 5ETMA 3DRRB 3TQ1A 2VG7A 1QSYA 1F9HA 1Q7LB 2KVIA 1S9EA 4O4GA 4L75A 2Z56B 2AEFA 4B9UA 1PC4A 2JWNA 4JI1F 4RW6B 1KN6A 1TAQA 2DGWA 3SSSA 5F9LA 2KZMA 5C42A 4K50A 5A0YB 4GMKA 1D9DA 5L39A 1CQNA 3HFKA 3KLIA 3BDPA 1T0TV 4X4OA 1AB8A 2HS4A 5CHCB 3HHLC 3M6VA 3PO5A 4LFAJ 2AX0A 3LGHA 3TOQA 3MPWA 5KT2A 1FKPA 3KK3A 5E3QA 1HD0A 3TA2A 1M5OC 1HMVA 2KL8A 1L3TA 1P6TA 3HVAA 2ZH1A 1WHYA 3D6FB 4F2SA 4WFZA 4YN3B 1W25A 4ITSA 2VA2A 2MXYA 4JI5F 2DH9A 2BRKA 4ZPDA 3OPKA 4HACB 3PW2A 1TKTA 4G1QB 2Z2YB 1GFWB 4OZ1A 3R8YA 4HL9A 1X9WA 1JKHA 1X9MA 4A4JA 1FD8A 3NAIA 1U8SA 1MN7A 3MUVP 4IRDA 2MQ8A 2YKMA 4JP8A 5GMEA 3SV4A 2R8GA 2J9EA 1RQ0A 1T9XA 3BO2A 4DR3F 4QR2A 3K7RA 3TP2A 1VDHA 1FRIA 2W1BA 2MLYA 3AQOA 2AYGA 3TVZA 2MZRA 3IWNC 2Q6BA 1IVZA 3Q86A 4TY8A 5C7PA 1S48A 1S4FA 1QSSA 3TO8A 1IR1A 2ROEA 3D3CJ 4MIAA 1NPKA 1TFWA 2WVEA 1FESA 4C6AA 3OR1B 3K17A 3MMCA 1R8HA 2MHNA 4CO5A 3V5RA 2FVQA 4GRSA 3OD2A 2HHUA 4IG0A 4CCHA 2XSFA 2FUG9 2IY5B 3TJAA 3RGIA 2OEJA 3VAIA 3PYFA 4RUAA 2DIVA 3D28A 3PNIA 2HVEA 2OPSB 1NKBA 5KFLA 4HHJA 2WVBA 1HNIA 1R27B 5IFMA 3T3FA 4F3MA 1EAYC 3ET6A 4NA1A 1YZ7A 1U1MA 3K5MA 4KC5A 4FZVA 2FDNA 4LF4J 1HNWF 3QT6A 4MH8A 1NKEA 1FDAA 4AQYJ 2AJ4A 4RLEA 1O0PA 2RAQA 1UCNA 4C8NA 4C2MA 1WOOA 2HBZB 1WG5A 2WONB 4Y3CA 3IG1A 4L3NA 1D9FA 3NY0A 3T1YJ 3NWRA 3CD7A 2X7IA 3G8QA 1SL0A 3JSMA 3PRDA 4A47A 1A0OB 1HNZJ 4J9RA 3PYGA 4CDIA 2J0XA 4C8YA 1T9VA 1HARA 1C1BA 4M5HA 4UOCA 5DQHA 4ZVSB 2VJUA 3CCVS 5RUBA 2IJRA 1FO1A 1XN9A 4ILRA 4OMFG 5B0BA 3NGUA 5KT7A 3JQKA 3D6TB 5KT3A 1QD1A 5HMYA 3G9CA 2WB4A 4NLOA 2HFOA 3Q8VA 4MTPA 1IQZA 1FWLA 3MDFA 4Y00A 1LWFB 5J1NA 2NZ4A 4O3QA 1LV5A 2DCLA 2HLUA 3C16A 4ED5A 3C8YA 5AJ3F 4ZLLA 2YNGA 4RPFA 3IBWA 3KK1A 4OYPA 4PPZA 3UR3C 3DRPA 2D74B 1XNQJ 3NRBA 1SH2A 4WIIA 2YNHA 4IO1A 2CQIA 1RHMB 4RNNA 3MURP 3CCZA 4QW8A 2QV6A 4QWCA 2ROPA 4CO4A 4QOTA 2WW8A 2ZUGA 5KG1A 3RB0A 2IJFA 1YK9A 2JC1A 3WC0A 2GVZA 1Y11A 5E33A 5A2QY 1VK8A 1VGYA 1SI9A 1YGYA 3VQSA 3MTKA 2XLJA 2RH3A 2DGVA 1TL3B 4OL8A 1T95A 3Q8PB 2E9ZA 4NASA 3B54A 4OHZA 4BLGA 2ZH8A 1WF2A 4NCBA 4IR1A 4B3RF 5CXTA 1VRUA 1FKAF 1REGX 2IDLA 2WVDA 2J6SA 2K1RB 2DGOA 4EZ6A 4O44A 1X9SA 2D7SA 5HO4A 5F8LA 1Q8BA 4DMZA 5JJBA 4AXJA 2QLWA 4O3NA 1YI2S 1RTZA 4P7TA 3UDLA 4J9VA 3M2VB 1IBMJ 3BBBA 5B0DA 1PC5A 5LMNF 2GC8A 1HWKA 4F4ZA 1KQGB 4DR1F 1VBYA 3NBPB 2QYGA 1HLWA 4NLSA 2JDJA 1CLFA 2BJDA 4DPWA 1K9MT 2ASLA 1U49A 4M94A 3I0SA 3QATA 4DFJA 2JRSA 4J9QA 4M5DA 4TVAB 2HZAA 1KRPA 2LMIA 2CQ4A 4P7VA 3FUYA 1WDDA 1CJUB 1C1CB 4MKYA 4DCOB 5L9XA 2I9SA 2XZTB 2W4CA 1AFJA 2XLIA 3HX9A 3J7ZT 3GV5B 2DNYA 3M05A 3UD3P 3A8KA 4ID5A 4F4WA 4YDXA 2DNOA 3I32A 4NI2A 2DPJA 2AX1A 1ZETA 2UXBJ 2V5HG 2XY6A 3IBFB 3MMBB 5HN0A 4X4VA 3PX6A 4DJBA 4RU9A 2CVEA 2GMJA 1XK8A 2QA4G 2ACMA 2YNIA 2Y8WA 1DTTA 1UVKA 1NK5A 2E5LJ 1RZMA 1BHNA 4DCJB 1X4FA 2OKQA 3TNVA 2KG0A 3CC4S 2VZ9A 3GCWP 4K2XA 2LQ9A 1RTDB 1Q95G 2Z2LA 3MEGA 5KG0A 4LR8A 2XHCA 3PJXA 4CI0B 3D0IE 1EKRA 1EP4B 1SQEA 3BSAA 1ZM9A 4QR0A 2XMUA 4G1IA 1OY6A 2F3JA 1RE1B 4ELTA 4WP9A 3D4JA 2DK2A 5L38A 1WUUA 3SBMA 5J2QA 2D9PA 3CCRS 3OVAA 5F9NA 3KLGA 3UVJB 3KG0A 3JYTB 3ITHA 4EU0A 3OR2B 5B7WA 4YFUA 4EGLA 2ZC4A 1M5SA 3DRXA 3W64A 1NU4A 2VDHA 2YH0A 3T9NA 1JXLA 5DETA 3R1LA 1SIZA 3BKUA 5ETSA 4IR9A 1JLEB 3R5GA 5DGAA 3R5BA 2JLGA 1PJ5A 4Q0BA 4C3LA 2B6AB 4P10A 4LBIA 1DBDA 2VKZG 4NLGA 3G2XA 3KLFB 3BGFA 1UVLA 2DO4A 2W2QP 3SFUA 2UUAF 2V50A 2N82B 2BOAA 3HJVA 3TUZC 1UVJA 3CJQA 4OHYA 1N5QA 4JUZA 4IOAQ 2X3GA 2RRAA 4J5OA 2E1PA 2FHOB 2JC0A 1K8AT 4DV0F 2OTLS 4F67A 4U7UK 4IOBA 1XMQF 1HKAA 4NCGB 2AHOB 1YWXA 4Y2MA 4B3TF 3V6DB 2AD9A 1N0VC 2ILZA 1FEHA 4O23A 1R8CA 3FBCA 3MCSA 5K8NA 1N33F 1TL7A 2VPXB 4ANDA 5J1PA 4KFBA 1RB0A 3GSDA 4DU8A 1CJTA 4Q8EA 4C48A 4ATNA 2AJFE 2HGNA 2LYVA 4FPIA 1HBNB 2LU1A 3MCNA 1GEHA 1VLOA 3J7Z5 3O1LA 2PI5A 3TVKA 1MW7A 2AKWB 1JXVA 1TUWA 4B9LA 1NEEA 2D3UA 2Z8QA 1DZ5A 1J5EF 5A6PA 3HHLB 3HFZB 4PYDA 4WYLA 2FVCA 2ZH4A 1SJFA 4TY9A 4MIWA 2YPYA 5B0AA 4LSLB 4MKBA 3VVTA 2ZBPA 3QRPA 4W92B 4V19X 4KYZA 2CQDA 3V4IA 1S97A 4Z2XA 1U02A 2J7KA 1SQGA 3M6XA 2DJWA 1VQ7S 2CWKA 1WACA 2YXLA 2RQCA 1FE4A 2FHKA 5DRKA 5E3PA 2NUUG 2YKNA 4DQPA 3HKZD 4PABA 1RYRA 4P52A 4HLBA 3G6YA 3MCOA 4OJ3A 3QSIA 3LTOA 3M1VB 3I56S 4LF7F 4PUOA 3V6HA 2DCUB 4C8OA 3TZWA 3LP1B 2LQ5A 4FPRA 2EPIA 4R0EA 5AXMA 4AE5A 1X5TA 1X4GA 3M9OB 2SXLA 2RE1A 5H9EJ 4OZ2A 1WSVA 4JV5J 3ZZRA 3L3CA 1FK9B 2Z2MA 4TYBA 4RW9A 2UXCF 3ETMA 5D3GA 2Z57B 4WCEQ 1MG7A 4DL2A 4RZRA 3DDKA 2X1FA 5HLFB 2AJQA 4CLWA 1O51A 4LUBA 2NSBA 1Q4RA 5HROA 1SCJB 2Z4PA 1RT7A 2IBKA 5KG7A 3ONQA 4H54A 2HAFA 1DFDA 4FXDA 3DOKA 2DEJA 3KNGA 2U2FA 1Q86T 1N32F 2FHJD 1JB0C 5HBMA 3W5ZA 3EXYA 2K2PA 3IS9A 2X1BA 4I64A 3CCWA 1AZSB 4CLYA 4FKYA 2VD3A 2RIJA 4HT7A 3OL8A 5DQGA 1E6VA 4CTAA 1NUEA 2J7UA 2APOA 1I6JA 5AXLA 1N52B 1LFPA 3DU6A 1FXLA 4KHPF 1FJCA 4RW4A 2RF2B 5A2QU 2V8VA 4WKRA 1M0SA 1NK0A 5EUHA 3HHNB 4KGVB 3AODA 5KFTA 2QZ8A 3N0VA 4XAKA 1BE4A 3I4HX 3H40A 2Z2ZA 3CCSS 4X65F 2YWEA 3DRYA 1JLFA 5IV4A 1YJNS 4P2FA 4K8RA 4DPXA 3NGSA 1S9GB 2OPPB 1DLOA 4YY3J 3OFEA 2QX0A 4ED4A 1HNVA 1RP5A 2XNRA 1R8AA 1EZZB 2V8HA 1ZPWX 2O01C 3G6VA 3PW4A 1NXIA 1C0TA 2IJNA 2ZKUA 1U0HA 4MFBA 1RHJB 1S0MA 2NPFA 3LGNA 2FQQB 2WSFC 5J2NB 4BHQA 2POKA 3QLHA 1GX5A 2JLEA 4DV6F 1DTQA 4OX9F 4NL5A 2WOMA 1KFDA 2FZGB 3EXCX 3HVRA 2VG6B 4NMXA 2HHQA 3NS6A 1TK8A 3HO1A 2HNYA 2Q3PA 3W7BA 5DQIA 3N9UC 3DRRA 4KGZB 3EWGA 2ASDA 4Q45A 2V6AA 2IYIA 4I2QB 2R7QA 4F4YA 2GHWA 5F0UA 2HQDA 2BZ2A 1RKJA 4LSNB 2CJYB 1T02A 1VYAA 5IQQA 3K59A 1KOHA 1FDDA 5F3TA 5LSLA 4NYPA 1F60B 1RT2B 2V4JB 3M6WA 5A8RB 1X60A 4Y34A 5KOWA 1UW9A 1HNXF 4K4SA 5EWEA 5H1SV 2E5IA 1LW2B 3G8SA 3BGOP 4MJKA 2AMCB 5CQGA 2IHR1 3ILOA 2XY7A 1UEVA 5KFOA 2CIMA 3PW0A 4ILMA 1W7WA 4XK8C 1N48A 1Y5IB 3OFHA 2JOQA 2FLNA 3QZ7A 5KFSA 4LFAF 2AQ4A 1FJGF 1FRXA 1AXQA 2HG4A 3KUEA 4G1QA 1NDCA 3VAMA 3I87A 1HIYA 1G6BA 3MR3A 3MOZA 1BY9A 4Q5VA 1SQFA 4LF5J 3VZIA 2OFHX 2B4VA 2DGTA 1NBEB 1WOPA 2UUWA 2EK6A 1HD1A 4YHHJ 2X1AA 2DNZA 1RAFB 4J9PA 1RWVB 1OWXA 4GC6A 4G1PA 1S5ZA 2IM1A 4NYZA 4ZVHA 1Q16B 3HXMA 1S1WB 2GQ2A 2CJKA 3OR1A 2MY7A 1VISA 5K9FA 2ZEJA 3HZGA 3H2UB 2B7BB 1NSAA 1UVMA 3RB4A 1U0SA 4HTJA 5KFNA 1VQMS 4LIRA 4X4SA 2CRLA 2RQ4A 2B5JB 4OI0A 1S6QB 1SC6A 2OPSA 4Y2KA 3M9MB 4PWDB 3FSYA 4LIWA 2R7TA 2QTWA 4LR7A 1UEKA 3MFHA 1KTVA 2GNKA 2A10A 2BJ3A 2KXNB 3JQJA 3WX4A 2GGPB 2LA4A 4NZ6A 3D66A 3JS9A 1B0VA 2GIRA 4I6YA 4B9SA 4C0OC 4C9DA 4IFYB 3TZYA 1CULA 2WONA 3M9NB 5HMWA 3W5XA 1TZ0A 2NS1B 1S1UB 2J0QD 3AOBA 4DUYF 1TAUA 4LF8J 4BDPA 4B3OB 2RDJA 2R7WA 2JFKA 4BCAA 3ZTRA 3LF0A 5I42B 2LEAA 4ID8A 1VC5A 3P6YC 2ZHAA 2VF3A 4NWBA 3LPEA 2QGFB 4ZDNA 3ZNJ1 1YJRA 1OY8A 4PR6A 3HK2A 4DSJA 2LFVA 4A48A 4WBFA 3P49B 4G6VB 3W9JA 4EO6A 1APSA 2DHXA 4R0JA 4M8LA 2M7SA 2COLA 3RU0A 1FDBA 2CPZA 1K73T 1L3UA 4LF6F 3BGRB 2GFFA 1SH3A 1YBAA 2DNRA 2YX4A 2WW4A 3OSPA 1LWFA 1JJ4A 4ECZA 1X4CA 5KFWA 1SL1A 2I1RA 3LH2S 5B0CA 2O67A 1D9AA 3BQ0A 3VV2B 2H54B 1QVGR 1HL6A 4UOHA 4OHWA 4ELUA 4GKKF 2ACYA 4DR2F 3O2IA 4L3KA 3GR0A 4KSEB 4CLLA 2QJ3A 4K4ZA 4J7CA 4F2RA 3BN4A 2OH2A 4DL5A 4RNHA 2G2YA 5BR8F 3UDCA 1T9UA 2AGPA 4ER8A 2LVWA 1VC6A 4WKYA 1DAXA 2NCKL 1FXDA 5HK4A 3CO9A 1NH7A 1U1NA 3Q8YA 3ENQA 1ULRA 2JHEA 2E1CA 4K0KF 4M5NA 4FS2A 2DPIA 4QPXA 3JQMA 1TL3A 2ZOMA 4ZPAA 3M32B 1U47A 4N8NA 2BM1A 2VFUA 2OSRA 1RU2A 1SBRA 5LL6d 4YUDA 2K1RA 5HVGA 1TELA 6AT1B 5LSOA 1QDUB 3POTB 3SFGA 2BJ1A 3GZ7A 1M5VC 5KFEA 4USJC 1YX2A 2D3O1 1WORA 3G8TA 1XR7A 2XLKA 5DJBA 3NBPA 4DL3A 2FC8A 4A46A 1S4EA 1ZAWA 4ZPWR 5EGYA 5DS7A 1KQFB 3CB4A 4IH6A 3GE9A 2B7CB 4EBDA 3D1OA 1Z1ZA 2BM0A 2MZJA 1VLYA 3PEJA 2R42A 3KDOA 1E6YB 1CJUA 3BSCA 3KK2B 2EFVA 1ZBTA 4JI6J 2MKCA 3IBCB 3CTRA 3ZXWA 3CCUS 4R8UB 1S1VB 3OXLA 4NOHA 1VFJA 3KYLA 3UNGC 3DDIA 1JWWA 2C2NA 1NDPA 4IO9Q 1RCOB 1YBUA 1VQYA 2I38A 4ECRA 2WHOA 2HK3A 1RT3B 1SPBP 4CT8A 1NCLA 3QGHA 2VASA 4JI0F 3FSXA 3HCXA 1LW0B 2B9WA 2AF6A 1WWHA 4HI1A 1RTDA 3MEEB 1N6QB 4K4TA 1UW4A 2F8EX 1F2GA 2ATLA 1RYSA 1EP4A 3H2VE 1EKSA 3AD7C 2FPHX 4B3MJ 1H6KX 1UA1A 4DSFA 3ISNC 4EMDA 1SL2A 5M2RA 2H3EB 4WE1B 5K14B 4BWMA 3N6NA 5DLGA 1FCAA 4JI8F 1FJ7A 3RAQA 4KH0B 3RBEA 3JYTA 1JNZB 3GR1A 3VTIA 3OR2A 4ICLB 1T3NA 2GJ2A 3DOMB 2IC3A 2IVYA 3MR7A 4JV2A 2XZWA 1JLEA 5GADU 4DR7J 4N47A 2B6AA 3BBCA 3M2UB 4URQU 1BMQB 2VQFJ 3QWPA 5B0GA 4DQRA 1I94F 5DDRC 1L3VA 4DQQA 1NK7A 1RI7A 5E0OA 3OTOF 2C2KB 1SKSA 3ISZA 1FWPA 4ZCMA 1FVSA 1TU0B 2RUGA 4A8YA 5FLXY 3MM5B 2HFVA 5KFFA 4IFVB 2GA7A 2ZH2A 3SSQA 3ZTSA 1NZAA 4C11B 2P9CA 3RZAA 4CLKA 3CNQP 3H90A 2BA9A 2NZCA 4U96A 4NCGA 5HP1B 2F4VF 4K4WA 1F6TA 1U4BA 1GQEA 3OTBA 3MAAA 5BYSA 5DGBA 2VH7A 4M5GA 2QL5B 4AXIA 2VG7B 4LVOP 2QYCA 2Y1LB 3GIMA 1S9EB 5LT5A 1V3RA 2GHVC 2WRMA 4M5JA 4ZP8A 1HBNA 4CM2A 4F0MA 3BKTA 3D68A 1FKOB 1PBUA 3PW7A 1YJVA 4ZKAA 2KJVA 3BSOA 4WXWA 2AEMA 2VHGA 2DXFA 2CJXB 1XNRJ 4PXBA 5CYMB 3BKFA 3H25A 4ZS6A 2ZNYA 4MMOA 4G3IA 2LA6A 4AYBD 4ZN1A 2RD5C 4LSLA 2K7KA 2EI5A 2HKEA 1RUSA 1NJIT 2FVSA 1FKPB 5E41A 2WB1D 1H72C 5CZXA 4USHA 4DZDA 1YLXA 4NE9C 3HFVA 1RT1B 3ZZZA 1RAGB 5CYQA 4F3QA 3Q89A 3R6GB 1XBWA 3W9HA 2J9DA 2CJAA 2ZBCA 3RAXA 4Y65A 2AZ3A 2RB7A 2B9EA 2RVJA 2VFSA 2IMOA 1PBAA 3M1VA 1U1OA 2DNLA 3LP1A 3BSNA 4OYMA 1QLNA 1IKVA 3LP2B 2DNNA 2NYIA 1IKXA 1KLMB 2VV5A 4Z7YA 2MYFA 2VFTA 3JAMU 3CIZA 1OO0B 4L76A 4WP3A 1AYEA 2CPHA 1F3VA 2YX1A 1FK9A 1RBLA 3ZTOA 4P74A 4N56A 4OHXA 3T9ZA 3NS5A 3H8YA 2W24A 3DGVA 1TKXB 2D69A 3GV8B 4QIVA 4LF9J 2HFZA 2B43A 1YJ7A 3OTEA 2RRNA 3MMCB 3RR7A 4HYKA 4USTA 1VRTA 1S1XA 4IG0B 1FD2A 3D6HB 3CD0A 4DXLA 5C2GA 3OL9A 3MM7B 2IRUA 4B3SJ 4PAAA 1RWNB 1HNIB 5DG9A 3W63A 2VFVA 4B08A 1EQMA 4YDDB 3HVWA 2R7VA 3TA0A 1YJWS 3MFIA 3RBZA 4ES3A 4OJGA 3PR4A 1NNDA 4E98A 3W2WA 2RF2A 1S57A 3VAKA 3BN7A 2EC0A 3WIVA 4WJBA 2G4BA 3VGSA 3HMJG 1I51B 3QAEA 4FNHA 3VAJA 3MOJB 3IG1B 4OX8A 2JEFA 3DHWC 4ZVEA 5ETPA 4JI2J 4AFFA 5BXIA 4N8OA 1O6XA 4PQAA 4B9VA 3JSMB 1REVB 4I1TA 2FB0A 3DOLB 1S9GA 2OO4A 1C1BB 3ENVA 3FNNA 2OGUA 2VOOA 2DT9A 3PEHA 4WZQA 3JTNA 1S59A 4PWUA 2EFGA 5J2PA 4TQRA 2MDAA 3CMQA 3HD1A 2HHHJ 3AOCA 3UI3A 3GU0A 1J2VA 3B82A 5G4DA 3PHTA 4WTYA 1BQMA 3N28A 2MZSA 3KNAA 4YY3F 2CZVC 3OL7A 1DRZA 1HYSA 3PFEA 1SV5A 4XPCA 2GMHA 3VGTA 2HZCA 4K5RA 4DL7A 1RCXB 4OIXA 2IRXA 3C16B 4GVLA 2VG6A 2Y0BB 5LXYA 4Z37A 4MK8A 5IWAF 2YNGB 2ZDOA 1NK6A 3ZZOA 1DHMA 4ED7A 3BYPA 5I3UB 2PI4A 4RX6A 1T05B 2MJUA 2KFYA 1NK9A 1LWXA 4LSNA 1NMEB 1P9YA 5CAAA 3IXQA 4CIOA 5A6WA 3OJUA 2NREA 2DRAA 4PRFA 5EDWA 3SIPB 2M3DA 3PYDA 1RT2A 3IAS9 2FLOA 3NL0A 3E01B 5ETNA 1NJWA 2GVZB 3J80Y 2YNFA 3GP9A 3IA0A 2GIFA 4HVZA 1U2CA 2GQCA 1B7FA 2IDEA 5IT9U 2FZKB 4X66J 1FFGB 1SUQA 1NK4A 3LWLA 2G1HA 1VRUB 2EFQA 2OI2A 5KOXA 1F3FA 4JI4J 1RDRA 1B4SA 4FYYB 1A6LA 4O44B 2DY9A 3SCIE 5KFHA 1K1QA 3RB6A 3CCTA 4LSZB 3EPIA 1NPPA 1ICEB 1NDKA 4NZ0A 2EG2A 4Q2MA 1BWVA 4YR3A 4KB7A 1NRKA 4WF9Q 2VC1A 3GMGA 4FXVA 3A3OB 1WHXA 3I96A 2XQCA 4JV1A 4ZJOA 2B9YA 3PKMA 1I3OB 4V19J 5DG8A 1R8PA 1R3NA 1IWAA 1TQLA 1R43A 4QWAA 4LF5F 1VQ9S 2CADA 3QGPA 2BABA 1S1WA 1HQUB 1VJWA 3D5MA 4UOFA 4A8MP 4I67A 2YQ3A 3VALA 4LVNP 1P27B 4WTOB 4DSLA 3DDNA 3KLEB 2XGQA 4NI2B 5DDPC 2BANB 2BQ3A 2M0GB 3AD8C 1SJRA 3PJ9A 2FJWA 2BJ8A 4Q8FA 1S6QA 1R0BG 2R8KA 4PWDA 1Q81T 3AXMA 1VQ8S 1GMVA 1OIAA 4DX6A 3M8PA 2AZ1A 4UZCA 1GMUA 1L3SA 4DPYA 3R5AA 4YB7A 2PMWA 5L46A 1R0CB 2GGPA 1U6BA 2EXUA 1XR5A 2QL9B 4CYUB 2F4FA 2XS5A 1JIHA 5DZ7A 2B0GA 3SDEA 4IFYA 1F1BB 4USWA 5C25B 2E5JA 4P2SA 4ANCA 7AT1B 2FJEB 3EMTA 3H0PA 3UNYA 3TJ8A 3CW2C 4QYZK 1S1UA 2BYCA 4FYVB 3GIKA 5J2QB 4NLVA 4B3OA 4YP3A 2HRTA 4NXMF 5E3AA 3V81B 2ZH6A 3ITHB 1HI8A 3V6KA 8AT1B 2QLJB 4MT1A 2KZZA 2UZAA 3MMAA 4Q0BB 2G0CA 1JLBB 1YIJS 4CO1A 1QM9A 2Z58B 3GCXP 3CJRA 5F8HA 5F8NA 4Z7CA 1QAYA 1Q8LA 4X64J 1JJCB 1VIOA 4RUCA 1IBLF 3HT3A 2FIUA 4F25A 2MHEA 3T19A 2LXUA 2UUCF 2CPEA 1TK0A 3GTYX 2VONA 2A2CA 1U24A 2DXDA 2GVDB 4WFXA 3MD1A 2UVUA 4ETXA 5HJXA 2R8IA 3OTCA 4KFBB 1X4HA 2WSEC 1CJTB 2L3MA 3QMQA 2XI3A 1QAIA 2ZBIA 2WK4A 4ED8A 1U48A 3W62A 1S6OA 3G71S 2R7OA 2F40A 2BJ7A 2V2ZA 3MUTP 7FDRA 2XEXA 5F8GA 3G6XA 2D41A 3OFFA 4A8KA 2JFDA 2V8GA 4ED3A 3PV8A 3FEYB 3LOUA 2FJAB 5CYJA 3KOAA 3L4BC 1YHQS 3M32A 2GJIA 3R7NB 4J9OA 3DLEA 2DIUA 4OZLA 3Q22A 1XR6A 5HVFA 2FLLA 2GX8A 3SQOP 3CIMA 1OSCA 3V4IB 3THPA 4YS2A 4X62F 4ZPTR 3POTA 2QE5A 3KHHA 3DYAB 1RTHA 5KFMA 1TK5A 4ZOSA 1LOUA 3BR8A 1JX4A 5IZHA 3QJPA 5KTQA 1D8YA 1ZM4A 1S6UA 2OSQA 4MYUA 4DEZA 2B3TB 3AA9A 1JQGA 4F02A 4WXOA 2VQEF 1IUJA 2HQFA 5D4LA 3BEGB 4NRUA 4E8UA 4KGXB 2W7OA 1WTBA 2KXHA 2GIQA 2ZOFA 2MKIA 3ENAA 4FDFA 2ASJA 3NGTA 4RNOA 2LDYA 3M4XA 3KK2A 4DN9A 2MQPA 5D3GB 2DISA 3N6MA 2YX7A 4OI2A 4GKJJ 2BW2A 3CF5Q 2EFPA 2RU9A 4KIAA 3W3SA 4F4XA 1JLAB 2M4MA 1YVFA 1Z2LA 5J1EB 5HROB 2IPOB 4JYAF 1N54B 1RT7B 4LRFA 2LQBA 4F26A 1OYDA 2V8PA 1XMOF 1FVQA 1UFWA 2DNPA 2KKHA 2V34A 2GHPA 3UD5A 1ZS6A 5HBMB 4U8VA 1Y7PA 2BVZA 3VWSA 5K8OA 1HQ2A 1QUPA 2KT5A 2MTLA 4NZ7A 2QSWA 1E6VB 4CTAB 4DPUA 3MEEA 1N6QA 1IBKJ 4DV7J 2GQQA 3GILA 4RW4B 2O3DA 4FNIA 4KY3A 4AL7A 1PKUA 4ENOA 3BPDA 4DPOA 5L1LA 1F5CA 3GFZA 2UXDJ 2EG1A 3N6LA 2FHMA 4K4VA 5KFRA 1TL5A 4KPYA 4DV1F 1HW8A 3AXKA 4UT4A 5FJ4A 2VPYB 2YWGA 5M2UA 3UCUP 5LXRA 4ICLA 5LMUF 3ELHA 1S79A 4DUZF 3DOMA 2YH1A 1D1UA 4B3MF 2PE8A 1M90T 3QRQA 3HVTB 1IN0A 2PO4A 1UMJA 2QA1A 3AD9C 1HNVB 1SC4B 2H5IB 5ETVA 5K5MA 1HQEB 2EEYA 4EBCA 5CD4H 5H9FK 3FKBA 3WDOA 1MWQA 4BC7A 3ZTPA 1NM2A 3MM5A 2BEFA 4GVBA 4IFVA 2CQ1A 3OL6A 2HEKA 3LP0B 4ZJLA 4LBPA 2RHQB 4C11A 1CJKA 2MQQA 3GV7B 2VQFF 4DR5J 1G1XA 1RLCL 2G0JA 3MEDB 4WP8A 2ZUAA 5SUHA 1JJ2R 5HP1A 1HPZB 1DTQB 4CNZA 1ZOTA 2DHSA 2CPDA 2WOMB 2Y1IA 4ECYA 2C2MB 1RAEB 4DL4A 4DR6F 4YQWA 4PQUB 2GS8A 1EIYB 1C2PA 3Q8RB 1WC1A 2DGQA 4JI3J 3P45B 4K4YA 2QG9B 4DN0A 1HW9A 3OXGA 5I3PA 5JUMA 1FKOA 5IS2A 1UWAA 2CDRB 1WF0A 4WFBQ 2WBMA 4ZVOB 4DWIA 4JI1J 4DFPA 2J8AA 3RAMA 2XCAA 4PKDB 3P96A 4ZCIA 2QL7B 4OYBA 3EDQB 2JZ5A 3EJMA 2XSJB 1V5VA 2P6SA 3EICA 3RBDA 5CYMA 9RUBA 2HFSA 2OPQA 3RUBL 3TI0A 2OJ3A 1FRLA 1FWKA 1S0OA 3I31A 4L6V3 3FK4A 1RK8A 3BS9A 3GJRB 1R31A 2VJVA 5DG7A 5F0WA 1RT1A 2XMAA 2VBYA 3MWBA 1GXLA 1FX2A 4CO0A 3CUNA 1S0NA 2UU9F 4URSA 5HATA 2OP5A 2ZJRQ 4JI5J 3Q8UA 3FZBA 3SQGA 4KGMA 2HRUA 5DLFA 2FGCA 1V3ZA 3AJDA 3LP2A 4ECQA 1KLMA 1BXNA 4M95A 2BE7D 1KS2A 3EPGA 1X0FA 4FBUA 1TMJA 2C22A 4DR3J 3J81U 3CJ5A 4ZCKA 3G4SS 2UVVA 1QY7A 3VAGA 4NCAA 1N5VA 2K7JA 1TV6A 2OELA 4P71A 3I55S 4URGA 4OI4A 3VVUA 3CCJS 1TKXA 3KLHA 1NJYA 3CJSA 4RL1A 3TEHB 1HBMA 2VIHA 2W9AA 2Y1JA 3EM1A 1Q53A 1TKZA 2Q66A 3N01A 2H9ZA 2M70A 4ILLA 4UW2A 5E5NA 2OMLA 3PKYA 3VZHA 3L7UA 1SKUB 3EVMA 1X4EA 3B4DA 1WTFA 3MM7A 4CLSA 3N4WA 3OSNA 2W8KA 2WZ1A 3GFHA 2HWIA 1TUGB 1WELA 4KHRA 4Y2IA 4NLXA 2M88A 3DXSX 4CO2A 1OPIA 2XULA 1F2HA 1KSPA 3PTWA 1ZZFA 3KHRA 2JEJA 3HSJA 2HVIA 1UPMB 1ZM2A 3T1HF 4WIQA 1HNWJ 4I6WA 1CULB 2AJ0A 1N5SA 2PEHA 2IRYA 2Q79A 2VBWA 1REVA 3W8PA 3DOLA 3D0HE 2EBEA 2BDPA 1R89A 3CMES 3WC2A 1VC0A 5T41A 3K2YA 2ZZMA 2OD6A 1ZA1B 3JSRA 2HIYA 3P5BP 4EYHB 2DBBA 2DY1A 5KFAA 4ZLJA
chains in the Genus database with same CATH topology
2MY8A 3CDAA 2CQCA 5MLCV 1GT8A 3C46A 3K0JA 2W8LA 4UUXA 2AGPA 4XDCA 2LVWA 4WYWA 1VOMA 2I0XA 5IT0A 5AXNA 4WKYA 1VC6A 1ZH5A 5KAKA 4H4OB 2CPFA 1DAXA 3MUMP 1VQLS 2YKNB 5A8KA 1FXDA 3KG1A 1RTJB 3CO9A 1NH7A 5EN1A 4PG6A 3HKWA 5E2QA 3ZZUA 2CZ4A 2AYEA 4QQBA 5KFZA 2MB0B 1U1NA 2BACA 2LXFA 3ENQA 1ULRA 3M8RA 3Q24A 2AGQA 3V6JA 2K3IA 1XWLA 2JHEA 1FE0A 4PUOB 3BR9A 1QE1A 4MK7A 2E1CA 4K0KF 2HHHF 4FS2A 1F0XA 3MGJA 1T3OA 4QCLA 4L72B 2DPIA 2HQ3A 1LWCA 4QPXA 3LWMA 1UKUA 2F7VA 1WG4A 3CCES 1TL3A 2ZOMA 2M5YA 4OJ1A 4ZPAA 2YWFA 3M32B 1Y3KA 1U47A 4N8NA 4QIEA 1MMDA 1VK3A 4KAIA 5DM7Q 3C2PA 3I5CA 2IVMA 2DNMA 2OAUA 5ADZA 3W2VB 2BM1A 3LAKA 2VFUA 2OLWA 4Y2CA 1E6YA 2OSRA 2W9CA 4GKJF 1FRJA 1LWEB 2YTCA 3MPYA 3D0GE 3IFEA 2L9DA 3QAUA 1SBRA 5LL6d 3E8OA 2W4DA 4RW9B 5AE3A 4NLPA 2K1RA 4YUDA 3IAM9 3T5HA 5I3UA 1BWEA 3DLLQ 4XO0A 1T05A 5E3CA 3CJ2A 4R8UA 3ZZTA 1XEZA 1H2TZ 1S1VA 1XC9A 2AGOA 2IA6A 4FVMA 5LSOA 4J9KA 3POTB 3SFGA 4J9LA 5D4NA 2ZHOA 3CDBA 2BUNA 3GZ7A 3O3LA 1M5VC 2DH8A 4QR1A 3D2WA 4OI3A 3PXGa 3SMZA 3MEKA 2I8EA 3KWMA 5KFEA 1QTMA 1TL1A 4USJC 4N77A 2L9NA 4O3PA 4DR4F 1K0VA 2RT3A 2E7XA 1MU2A 2NQPA 1XMBA 1X5SA 3G8TA 1XR7A 1IXKA 3E01A 1JLGA 2XLKA 2WSCC 2ABYA 4KV8A 2AV5A 4J9MA 5DJBA 2N3LA 1KFSA 1KNZA 3NNCA 1MSWD 2KN4A 3NBPA 4DL3A 2FC8A 2HPUA 2HGLA 2EWHA 4Y0FA 3CCLS 4N41A 1RGVA 4C3MA 4A46A 2J76E 4C98A 3DOKB 3UW1A 2BBEA 3GIJA 5CCMA 4OZJA 1ZAWA 1RT3A 1LKZA 2C3UA 3CULA 2FC9A 4QZVB 4ZPWR 5EGYA 1SJ4P 1WI6A 1DJ0A 1LXNA 1K1SA 5DS7A 2PA8D 1KQFB 3CB4A 4IH6A 3GE9A 2R2UA 5L1KA 1NK8A 1IKWA 3IS9B 2B7CB 4JOUA 4TYAA 4DLGA 5K8MA 4KJIA 4EBDA 3D1OA 4JBCA 1Z1ZA 3CJKA 3QJJA 2BM0A 1LW0A 3DNCA 4OZ0A 2MZJA 4OJHA 2J7WA 3JTPA 3GFYA 4J37A 1VLYA 3PEJA 1FHTA 3CC2S 5GMKa 2LKZA 1E6YB 2UXDF 2DNKA 4NA2A 4YR0A 3BSCA 3KK2B 1D3WA 2EFVA 3OHBA 1NJZA 2C42A 1NAQA 4NA3A 1JJHA 1ZBTA 3LUYA 1N8RT 4C8KA 4XDDA 1G2EA 3DLGA 4TXSA 4TU7A 5FD1A 2MKCA 2LCWA 5ITHA 4XIUA 3CTRA 2KXFA 1P1LA 4ZMMA 3HP6A 3CCUS 3FVYA 4R8UB 3OLBA 1JK9B 3CC7S 1S1VB 3E3XA 1KR4A 3ETOA 3OXLA 2MZ1A 3M2RA 2V8DA 3BO3A 3IO1A 1DURA 1KD1T 1MNEA 3NP5A 1UVIA 1GX6A 4A8QA 4LFCF 4MYTA 4NOHA 1VFJA 3EGNA 4TNOA 4X84A 3KYLA 3ISND 4WE1A 3BQ1A 3DLHA 3UNGC 3DRSA 5K14A 3G6ES 4IG3A 3ZZYA 3OHAA 4X2BA 1GXTA 4B9MA 2ZITA 4NLRA 2RS8A 5KG2A 1JWWA 1VQ6S 1JLFB 1FNMA 1HI1A 2FHJA 4OFZA 4IO9Q 1VQYA 1WEZA 2I38A 2ZM6F 4ECRA 2FVPA 4DHVA 2V9WA 2VPWB 4ES2A 2CQ0A 4WFYA 2WHOA 1N5YA 4RNFA 1RT3B 1NHUA 4MIBA 1N36F 4ZP6A 4CT8A 2ZH7A 2PN6A 2JJ4D 1DLOB 3QGHA 2VASA 1IKWB 3FSXA 4IH7A 5B0FA 4JI0F 4QWEA 3EZ5A 1WF1A 3M2UA 2HMIB 2QIFA 3MM8B 3ZFVA 3CJKB 1LW0B 2B9WA 2R2RA 2AF6A 4EZ9A 1S77D 1U6FA 2QRRA 2IM3A 1KEKA 4RW6A 1VHFA 1WWHA 4HI1A 2RILA 2IBOA 1VIXA 3G96A 2LDIA 4WFNQ 3MEEB 3O8WA 1N6QB 1U1PA 1RTDA 2BJEA 5JVGQ 4K4TA 4U67Q 1RWUA 1N34F 1UAWA 2N7YA 1UW4A 2F8EX 1F2GA 4ZK7M 2ATLA 1HA1A 1HQUA 3C3LA 3NGDA 3BZQA 2ZH5A 1RYSA 2M2BA 1F5BA 1EP4A 2KU7A 3H2VE 5KFIA 2NXUA 3OLAA 3DLGB 2FLPA 5KT5A 1C0TB 2XCPA 1H7WA 5A0YA 3WBZA 4I56A 2LECA 2A18A 2FPHX 3KHGA 4AL5A 3C66A 3TR5A 5D6GA 4MFBB 3A1YG 4NLQA 1H6KX 1HBOA 2C2EA 1UA1A 4DSFA 2VOPA 4BWJA 3ISNC 3IN5A 5JXSA 1SL2A 5M2RA 5IT4A 1U1RA 4WE1B 2O1PA 5K14B 3KLEA 3DHXA 3AY0A 3N6NA 4BWMA 5DLGA 1FCAA 1GAOA 3EX7B 4JI8F 3Q0AA 2BANA 1Q7YT 3QLHB 3UCZP 1H98A 2EBGA 2DGXA 2HRYA 2LU2A 4TN2A 4A8OA 3RAQA 1UA0A 2HYIB 3H5XA 1FJ7A 2MZTA 2EK1A 4DS5A 3THTA 4HH0A 3U1LA 3C6UA 3RBEA 1IJEB 3HHLD 3JYTA 4JI3F 3QO9A 4I68A 1JNZB 5DDOC 2KYXA 2CKWA 3GR1A 1RKIA 3VTIA 4ECWA 1G3OA 3OR2A 4ICLB 4MK9A 4NMLA 4ZP9A 2GJ2A 1T3NA 2IC3A 3ZC4A 3B8HA 1S72S 4PG8A 2FJBB 2HNYB 4NLYA 2J9DE 4K4UA 2IVYA 3DRRB 3TQ1A 1TR0A 2VG7A 4I0WA 1FJEB 1QSYA 4JV2A 5AXKA 1FF2A 3GG1A 2XZWA 1JLEA 1Q7LB 2KVIA 1S9EA 3NCQA 4O4GA 5GADU 4N47A 2B6AA 3M2UB 2IFXA 2BE2B 4NRTA 4URQU 1BC6A 3QWPA 1U09A 5B0GA 4DQRA 1PC4A 2JWNA 1I94F 4B9UA 5DDRC 1L3VA 3U02A 5I3QA 3FMBA 4RW6B 4JI1F 2XWXA 1W2BR 5IM0B 3NGKA 4WU2A 4DQQA 1NK7A 1RI7A 5E0OA 3OTOF 2C2DA 1KN6A 5B0EA 1TAQA 2DGWA 1SKSA 3ISZA 3SSSA 5F9LA 4ZCMA 3UCGA 3MXHP 2MPUA 2KZMA 1LK7A 1FVSA 2RUGA 1AUDA 3SSRA 5KG3A 5C25A 4A8YA 5FLXY 5C42A 4K50A 1CSJA 3MM5B 1RT6A 2KI2A 5KFXA 4PPDA 5A0YB 4GMKA 3HPOA 2HLTA 5KFFA 4IFVB 4YHHF 1D9DA 1CC8A 4K59A 2XMKA 2GA7A 2ZH2A 3SSQA 1Q82T 2XMJA 5L39A 1H7XA 2R7XA 1NZAA 3FQKA 2VA3A 4C11B 2P9CA 2DD8S 3RZAA 1CQNA 3HFKA 3KLIA 3BDPA 4DV3F 2UV8A 2HHXA 2E1AA 2ZFHA 3DM2A 2HS0A 1ZTTA 4X4OA 3IWXA 2BA9A 2HS4A 4R25A 3BB5A 5CHCB 3HHLC 1N0UA 1ZTWA 3M6VA 5F8MA 1U1LA 3PO5A 3M30B 4NCGA 5HP1B 2F4VF 3RRKA 2AX0A 3PZPA 3V81A 3HHDA 3TOQA 3MPWA 5LSRA 4K4WA 2BXJA 5KT2A 1FKPA 3KK3A 2DB1A 1KHWA 5E3QA 4CH0S 1HD0A 1T94A 2CJ9A 3TA2A 4X4TA 1U4BA 1HMVA 1M5OC 1GQEA 1L3TA 2IC3B 1P6TA 3OTBA 3HVAA 4UY8T 5BYSA 4YB1P 2ZH1A 5DGBA 2VH7A 1WHWA 4B9NA 2C2RA 1WHYA 4AXIA 2VG7B 3T6JA 4LVOP 4F2SA 2QYCA 5L8RC 2R2SA 2B4OA 2LXIA 4WFZA 1RJJA 3GIMA 4KRWA 1S9EB 3MM9A 5LT5A 4HTIA 3VAHA 1W25A 4ITSA 1JLBA 2VA2A 2CPYA 3GB0A 1V3RA 2GHVC 2WRMA 4FF1A 4KO0A 2MXYA 4JI5F 2DH9A 2BRKA 2CPIA 4ZPDA 3KHLA 4ZP8A 3OPKA 1HBNA 4C97A 3PW2A 4ECXA 1TKTA 1FKOB 4M1KA 4G1QB 3I4PA 4D3HA 4OZ1A 6FDRA 2ZC3A 4HL9A 1X9WA 1JKHA 3PW7A 1X9MA 4A4JA 1FD8A 3NAIA 1YJVA 3T5KA 1U8SA 3US5A 2ERRA 1JNRB 2EFNA 4EYIB 4ZKAA 2KB2A 2KJVA 4WXWA 3MUVP 3BSOA 4IRDA 2DR7A 2YKMA 3SZ2A 3K5OA 5D77A 3SV4A 2GO8A 2R8GA 2J9EA 4F4KA 1RQ0A 2FD2A 3OUYB 3BO2A 4DR3F 2MJNA 4QR2A 3K7RA 3DM2B 3TP2A 2O5DA 3GFXA 4PXBA 1FRIA 5CYMB 1S6PA 3AQOA 1J5OA 3R3TA 3H25A 1T8EA 4ZS6A 2ZNYA 1FT8A 3TVZA 2AYGA 4MMOA 2MZRA 4G3IA 3IWNC 2Q6BA 2LA6A 4Q43A 2JH3A 4AYBD 2MQNA 2RD5C 4LSLA 2K7KA 1RT5A 2EI5A 4TY8A 1S48A 1S4FA 1NJIT 2FVSA 1FKPB 5E41A 1QSSA 3H2LA 3TO8A 2WB1D 3BF4A 1YSJA 5CZXA 4USHA 2ROEA 1KOOA 4I2PA 5KFCA 1RT1B 4MIAA 4NXNF 3OVBA 3RR8A 2FJDB 2EKYA 2MSTA 4IYQA 4RNMA 1TFWA 2IVFB 1FESA 2W9BB 3MM9B 3ZZZA 1C0UA 3OR1B 3MMCA 1R8HA 4LF8F 5CYQA 4F3QA 2MHNA 4CO5A 3CDWA 2CPJA 2HNDB 3V5RA 1XBWA 2FVQA 4KBIA 4IOCQ 3BREA 5KG4A 1JLCA 2KT2A 2J9DA 2ZHBA 3AB4B 2HHUA 4IDKA 2CJAA 4HKQA 4IG0A 1Q8IA 4CCHA 2ZBCA 2XSFA 5FIIA 2FUG9 3CJ3A 4QIGA 3RAXA 4Y65A 1QSLA 4B3OB 3VAIA 3DFEA 2M8HA 2RB7A 5D8HB 4RUAA 1BQNB 2DIVA 3D28A 3C6TB 3PNIA 2RVJA 1JMTA 2VFSA 3FFIA 2PSZA 1YRXA 2IMOA 4C8LA 4KE5A 2OPSB 1TUVA 3M1VA 1NKBA 1LFWA 2DITA 1Y5LB 5KFLA 2UP1A 1U1OA 2OMOA 4HHJA 2DNLA 3LP1A 3BSNA 1HNIA 1PILA 1R27B 2F9DA 4ETZA 3NMRA 4X4UA 4KKOB 4Y28C 1QLNA 1V9OA 5IFMA 1IKVA 3CJ0A 2DNNA 2NYIA 1IKXA 1KLMB 2VV5A 3LP2B 4F3MA 3T3FA 4ALZA 3THVA 1J5OB 2MYFA 2VFTA 1RT4A 4NA1A 1OQ6A 2VBZA 3CIZA 4FBTA 4MAKA 3NG8A 1OO0B 1IQTA 1U1MA 3K57A 3K5MA 3RW6A 5A8WA 1GTHA 1VMBA 1RT5B 2CPHA 4KC5A 2YWKA 2L08A 2YX1A 2FDNA 3DI6B 4FZVA 1S9FA 1QAJA 1HNWF 1FK9A 6FD1A 2CJBA 3D1QA 2CVIA 4N56A 4MH8A 4OHXA 3T9ZA 1FDAA 3NS5A 1ZM3A 3IR6B 3RB3A 3JAMY 1C4AA 1NKEA 2AJ4A 3H8YA 2W24A 4I2PB 4RLEA 1O0PA 1TKXB 1FERA 3GV8B 4C8NA 4QIVA 4C2MA 3EGWB 5K8PA 2HFZA 2B43A 2MQLA 3OTDA 4AL6A 1TVRB 1C0UB 1WG5A 3OQ2A 3OTEA 2WONB 2RRNA 3MMCB 4Y3CA 3H5SA 3IG1A 3DYAA 4L3NA 5CYQB 5L9NA 1D9FA 3RR7A 4NLUA 4HYKA 4ECUA 1Y3JA 2HVZA 5KG6A 4CH7A 3NMAA 3ENWA 3CD7A 2DVIA 4QYZJ 2ZD1A 1CC7A 1JLCB 3G8QA 1VRTA 4DDFA 2HGMA 3FZ2A 1SL0A 1S1XA 2R7U