2BJIA

High resolution structure of myo-inositol monophosphatase, the target of lithium therapy
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
274
structure length
274
Chain Sequence
DPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTGGPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structure of myo-inositol monophosphatase, the putative target of lithium therapy.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords INOSITOL-1(OR 4)-MONOPHOSPHATASE
total genus 89
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2bjiA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2bjiA02
1AWBA 1LBYA 1FJ6A 5ET7A 1EYJA 1FPJA 1VDWA 5EQ7A 2CZHA 4GX6A 1DCUA 4MJOA 5ET8A 1IMBA 1IMAA 2HHMA 3RYDA 1NV7A 1IMEA 4QXDA 5EQ9A 3RPLA 2Y5KA 2FBPA 1NV1A 5F24A 1K9YA 3LUZA 4N81A 5EQ8A 1FJ9A 4GWYA 3T0JA 2FIEA 1LBZA 5ET5A 3QMFA 5LDZA 2QVUA 3FBPA 4I40A 1KZ8A 1LBVA 1INPA 4AS4A 5EYGA 1FPBA 1D9QA 2WEFA 1NUWA 1YZ0A 1G0HA 2BJIA 4GX3A 5ESYA 4H45A 5EYHA 1FPGA 2P3VA 3BIGA 4GBWA 1RDYA 1SPIA 1FPFA 5ET6A 1FBEA 1IMFA 5DW8A 2QVRA 5FBPA 1FPKA 5A5LA 1FBPA 1NUXA 4H46A 1EYKA 5EQAA 1XI6A 1FSAA 4I3EA 1FTAA 1NUZA 2FIXA 5IZ1A 1BK4A 2OWZA 1DK4A 4GWWA 2Q8MA 1JP4A 3KBZA 1YXIA 1NV2A 1DBZA 3IFAA 3RPLB 1KA0A 3B8BA 1FBDA 1RDZA 4O7IA 2F3BA 2Y5LA 4KXPA 1FBGA 1G0IA 1LEVA 3D1RA 5T3JA 1KA1A 2FVZA 2OX3A 2CZIA 1FPDA 5J16A 1RDXA 3LV0A 4GBVA 4HXVA 5I3SA 1FBFA 4GX4A 5IZ3A 1IMDA 1NV6A 1NUYA 3BIHA 2GQ1A 1NV4A 4HE1A 1EYIA 3KC0A 4GWSA 3IFCA 1Q9DA 2CZKA 3KC1A 1FPEA 2QFLA 4GWUA 4G61A 2VT5A 1FPIA 2F3DA 1FRPA 1CNQA 1NV0A 2DDKA 4HE0A 1FPLA 1LBWA 2QVVA 4FBPA 1YYZA 1NI9A 2JJKA 1FBHA 1K9ZA 2WBDA 3A29A 2R8TA 1FBCA 4GWXA 4PTKA 4GWZA 5IZ3B 2Q74A 4I3YA 1NV5A 4HE2A 2FHYA 2PCRA 4AS5A 2WBBA 1IMCA 1LBXA 1NV3A 3ROJA 2P3NA 1QGXA 4IR8A
chains in the Genus database with same CATH superfamily
3OO8A 2UVJA 2ANJA 1Z7ME 5I56A 4ZE9A 4JWYA 4NMYA 3T1BA 4ISUA 1B4HA 1ZKBA 4P0IA 4PF8A 3RPLA 3EN3A 2RF1A 2VD2A 3BFUA 5EQ8A 4F19A 3FV2A 1UTBA 1OQHA 2QVUA 3H7MA 3VXCA 2QL3A 1D4NA 2D3IA 1KWHA 4RNSA 4F29A 3SESA 3ODBA 1FTOA 1RDYA 4PGPA 1JQFA 4NQ8A 5ET6A 1Y4TA 3H6UA 4DI3D 2QPQA 3MW0A 4GRKA 1LAHE 4I3EA 4WKMA 5DT6A 4MEVA 5TU0A 4OXVA 1UIVA 1BKAA 1A40A 1DOTA 4O3AA 3D1RA 3K6XA 5CI5A 3E4RA 1MH3A 3IR1A 1FPDA 4QFLA 4KQPA 4FATA 3JZJA 3LC8A 4PF6A 3IOUA 3U1OA 2DXYA 1NNKA 4GWSA 4O7MA 3I3VA 1VFDA 3HPIA 4G61A 1I6BA 4OEVA 2HEUA 4JVCA 1XVXA 4OVRA 1QKAA 1R9QA 5H8FA 4GOTA 3LUYA 4LQ2A 3T66A 1ATGA 3ZSFA 4AS5A 1D3KA 4ND9A 1XHYA 1CB6A 4PFWA 1FQCA 3K02A 1ZJLA 3PMXA 5AA2D 3IOTA 1XS5A 4YICA 3MZBA 3FD3A 4G4PA 1EZ9A 3PPOA 1N3WA 2P2AA 5K2YA 5EQ9A 3VVEA 3N94A 5L9OA 3C31A 3FGSA 4JSOA 3T0JA 3K6VA 3QMFA 1I6QA 1O64A 3CR9A 2H99A 4OVQA 4MNIA 2OPDA 2ZZWA 4F1UA 3R7XA 1YZ0A 3SDFA 5CRYA 4HTGA 4ELPA 2F5XA 4M1VA 2XD2A 4YKIA 4NGUA 4NE4A 4WEDA 3ILUB 3L6GA 3O9PA 4OVPA 5I58B 4LA9A 2YLNA 1D9YA 5I2NB 1OQGA 3HFUA 5ELVA 2REGA 2NVUB 3FZVA 3CI8A 4KFQA 3LSWA 5H8QA 4JXIA 3FXQA 3S9LC 2MKZA 2I4CA 1B32A 3IB2A 5EHMA 4GX4A 4ZEKA 1IMDA 1NUYA 3KZGA 4R9FA 4UACA 1XOCA 3T9HB 1PC3A 3KC1A 4X1DA 2DE4A 4TLLB 2F3DA 4IO4A 2QS3A 3S2VA 4QRZA 4DE8A 4TLMB 4GL8A 4GD5A 2XXVA 3H6TA 2H4IA 4G77A 4FIMA 1VFEA 2DWHA 4DZ1A 2B65A 4QF9A 1SW4A 1JEUA 3OXNA 4QSCA 2WYKA 1AOVA 3UGWA 2Q2CA 1MG1A 1QJMA 1POY1 1AWBA 1BLFA 2A5TA 3MPLA 1QVSA 4MIJA 5EHSA 3PUWE 3FIRA 2HZKA 4MJOA 4U1OA 1VSOA 2RKMA 4N17A 5TPAB 4HS7A 2UYFA 1LBZA 1MY1A 2OJTA 4KYDA 4I40A 2RC8A 4AS4A 1FPBA 2GRVA 1QUKA 4FAJA 1NUWA 5ESYA 1DTGA 5CC2A 3VFJA 1B51A 2O7UA 2FNCA 2AL5A 4H6DA 1NNFA 2XXUA 4RXLA 4OA4A 2ZNUA 1DK4A 3KBZA 1AH5A 2OLBA 3DELB 5A5XA 3O97A 4MH5A 3ILTB 1IEJA 4N8YA 3B8BA 2UVGA 1B05A 4GXSB 4C1TA 3KBRA 4G68B 1FBGA 5L9MA 3KN7A 4OERA 4XXUA 3GZGA 5I59B 2GHBA 1UTHB 2PBWA 1P1WA 3IFCA 2QFLA 1MY4A 3N5LA 1S7YA 4KPTA 3MVZA 3EF7A 3LSLA 5AA2A 4UA8A 3OO9A 4POXA 3A29A 4X1BA 4EUOA 2G93A 4JVIA 2F78A 1MPBA 2PCRA 5I2KB 2ONSA 3DP4A 3CRBA 2FA7A 3EKIA 1MXZA 1OMPA 1FPJA 2F35A 4PP0A 3KG2A 4OWDA 3F11A 2QS2A 2YJPA 5TP9B 4H5FA 4ZECA 2VHAA 4NN3A 2QJEA 1EZPA 3MQ9A 2OWSA 3A09A 3UN6A 5L9SA 4KR5A 2H5YA 4MCOA 2F6PA 1B52A 2F7AA 1B6HA 3MAMA 3RN8A 4LONB 2KR0A 4H8JA 2A5TB 3CFXA 1MQHA 4F1YA 1FSAA 2GH9A 4NHBA 4JSDA 1IUDA 3FV1A 4RPOA 5TPAA 4IB2A 5IM2A 1IXCA 4H67A 1US4A 3PUYE 2I4BA 3TKDA 3HHGA 1N7XA 4PQJA 3Q27A 1N0TA 5FHNA 2Y7WA 2XXIA 4OFOA 4H8IA 1NV6A 2GQ1A 3RTWB 2PYYA 3VVDA 4LZ8A 1Q9DA 3RGYA 3B6TA 4JVDA 4EQBA 4P0GA 2P0SA 2DE2A 3OEMA 4HE0A 4MFIA 1BP5A 1LFGA 4LN5A 5CMCA 1URGA 4PFYA 2UVIA 3HHFA 4X48A 3K1NA 2H98A 4G68A 1SW1A 3E78A 5CMMA 4OETA 4P56A 2OWTA 5ICQA 3VE1B 3PV0E 3TCGA 3PU5A 1NV7A 1IQ7A 2V3QA 3O2AA 1K9YA 2DSFA 5CBSA 3FVGA 1SI0A 4WEPA 3K1PA 4LZ7A 1Y1ZA 2WEFA 3B6WA 2BJIA 3ECRA 3KJTA 3KN8A 4QFKA 3UP9A 5KDTB 4QHQA 4GBWA 2VP1A 3OMBA 2PMSA 2ZZVA 3TAJA 2XHDA 3PMVA 4YAHX 2DOJA 3VXBA 3MC2A 4LATA 1USYH 1LBCA 1URSA 1MY3A 3C32A 2V3TA 1PB8A 4F22A 1MXUA 5AA4A 4NF5B 1YXIA 4HW8A 5JTYA 4QFOA 5AE4A 1EU8A 4R6KA 4HCYA 4U4XA 1FBDA 4JBZA 4RY1A 4G8NA 1RDXA 1FBFA 2ZNSA 3BIHA 3IAZA 4DCXA 5IGAA 4N4UA 2Y84A 1H44A 1FTKA 4NTLA 5I7IA 3HCQA 1ZBMA 5FHMA 2GFEA 4JWXA 4OVSA 2RCBA 3VVFA 3TTKA 1A8FA 1HSEA 2XXWA 4N13A 4ZZAA 1P1NA 2PVUA 3QYTA 4ELQA 1J1NA 1UTBB 3THIA 3EHSA 2ZZXA 1FJ6A 3K01A 5ET8A 4R2FA 3PUXE 4NG7A 2XA5A 1Y9UA 5H8HB 3I5OA 3CIJA 2DWJA 2FIEA 1DPPA 3H03A 3PUZE 3TELA 3QK6A 2O84X 1MS7A 1FQFA 3TTRA 3IB0A 2P3VA 2B3FA 1LAGE 1SPIA 3B6QA 5FBPA 2QMWA 2R71A 3UA8A 1FBPA 1IIWA 2XXQA 1FTJA 1AL3A 1N84A 4U1ZA 2FYIA 4NEDA 1BK4A 1XT8A 1JP4A 2DXRA 4PBHA 5IKBA 3RPWA 1SDXA 4LUBA 3USDA 1B5JA 1ZLQA 4DIGA 3OENA 4YZZA 3MWBA 2P1SA 2F6GA 3HO7A 1B7HA 2HAUA 4PC9A 5KDTA 4POWA 3PD8A 3M8UA 4GWUA 1B1HA 3P7IA 1FPIA 4ELRA 1FRPA 4NF8B 1O63A 4DXUA 3SETA 2DDKA 4H0WA 2JJKA 4KCCA 1AMFA 2I48A 1B9JA 5IAIA 3O66A 4ZZEA 3MP8A 4U21A 2RC7A 4MMPA 1MY0A 5ICTA 3M3LA 4ZEFA 1DSNA 2R9JA 4NF6A 4FE8A 4N6DA 1T0KA 2O1MA 5EQ7A 2AL4A 3OD7A 2XXRA 4BDRA 4U2RA 3QAXA 3BFTA 2UXAA 2Q9TA 4R2BA 1GVCA 1Q35A 2Q89A 2V3UA 1OVBA 1LBVA 4GL0A 3QSLA 3G3KA 3K2DA 5DVJA 2PX1A 4GX3A 3G3IA 5I57A 2IEEA 1DTZA 4MBPA 1TXFA 3GBBA 5A5LA 4PE5B 4FEDA 4LQ5A 5IZZA 1YPNA 3DLNA 1RYXA 1M5FA 3G7WA 1FTAA 3IO4A 2OWZA 4Q8RA 3A3CA 2NUVA 2DVCA 3ZS6A 4FJPA 1D9VA 3D4CA 3GLBA 1ELJA 5H8NA 4RA1A 2QS1A 1A55A 4LVQA 2CZIA 4PBQA 4BDOA 5IZ3A 3U93A 1WODA 3SKPA 3E13X 2V84A 2HPGA 2CZKA 1SVXB 5CMBA 4KD5A 4N15A 3VLWA 3Q29A 3IOWA 4IO5A 4P3LA 2DWIA 1HSJA 3FVOA 1FBCA 1R9LA 3PD9A 3V5AA 2Q74A 4ZE8A 1ZTYA 3SERA 4P1LA 2E1SA 2L5VA 1FQAA 1LAFE 1LB8A 1ZMGA 2XXXA 1N3XA 1H76A 5I3SA 2WKYA 3FXBA 3MVXA 4H5GA 1RYOA 2M8CA 2CZHA 4R74A 4GX6A 1IMBA 2XX7A 3VDFA 1NNTA 2HQ0A 3AXFA 3C9HA 1LFHA 3CG1A 1FW0A 4YB6A 1B3EA 2XXHA 5EYGA 4R6HA 1D9QA 4EQ7A 4NAPA 1G0HA 3MZ1A 1FPGA 1SYIA 4QBAA 4LP2B 4ZDMA 5DW8A 4HCWA 5LTCA 3MSTA 4NF6B 3RT6B 2OZZA 1UIUA 1XI6A 2G29A 3G3FA 1MQDA 1JW5A 2ZMBA 2DQVA 3BKIB 4OZ9A 4RYAA 5HBCA 2CMOA 4PGNA 2YPNA 1KA1A 3L6HA 3U94A 3S9NC 3EHTA 3LSXA 3FVNA 2OCUA 4PAIA 3TUSA 1Y3QA 3KC0A 4EQ9A 5I2KA 4NF5A 1LB9A 1MQGA 2OPEA 3EQ1A 4FBPA 1N7WA 4F3PA 1IXIA 1JEVA 1MXYA 4EXLA 1OVTA 3SEWA 2KQZA 3Q26A 4ESWA 4MLQA 4OVTA 5TP9A 1YCJA 4Q0CA 3C33A 4U22A 1GR2A 4MNPA 5DVFA 5ET7A 2O68A 4NF4B 4MLVA 1PBQA 1Y4CA 3UORA 4XFEA 3N26A 1B7ZA 3RYDA 4G2ZA 1IITA 1B40A 1IMEA 4O94A 2KLFA 3Q25A 2W7YA 4OESA 4P9KA 1FJ9A 2H25A 1VE4A 4RPNA 3FBPA 3C36A 3VLUA 2HXWA 5DTBA 2NOOA 1M5EA 4MNCA 3VLVA 2UYEA 1LAXA 3TCFA 3IO6A 4Z7EA 4PE3A 1FTLA 3TYHA 4L17A 1EYKA 3QUFA 2ONRA 4PETA 1NFTA 4R73A 1I69A 5T3JA 3T9VA 2FVZA 3LV0A 4OEUA 3PUVE 2Z8DA 4PFUA 4BLAA 4X9TA 5ITPA 3U92A 1PEBA 1TFDA 2VD3A 4EXKA 1MH4A 1M5BA 3PPNA 4I1DA 4GWOA 1LBWA 4N8GA 4NWDA 2DYXA 3CSGA 2FHYA 2GHAA 4BDNA 1SD3A 1GTKA 2DWAA 4H1XA 3EHUA 4NF8A 3MZ9A 3IK6B 3T93B 4ELOA 1DCUA 1N04A 4YB7A 1POTA 3LUZA 3QUJA 5AA3A 3LBSA 4RK2A 2ZYKA 3OO6A 1M5DA 1OLCA 1P99A 2HCAA 2I3VA 3ZKKA 4DCYA 3O28A 1MDQA 4FECA 3I6VA 3W9VA 1PB9A 3WAFA 2Z8EA 1FPKA 4IY5A 4MHFA 4DDDA 4GVOA 1O7TA 4PFBA 4AB6A 1XVYA 1MXVA 3KEIA 3OELA 1NUZA 5IZ1A 2A5SA 3W15C 1P1UA 5AA1A 3IFAA 3RPLB 2V25A 2QRYA 2HZLA 1IZ1A 3U65A 1NNPA 1QUIA 3ONMA 4BDMA 1B58A 3LSFB 3ZKLA 3G3HA 2O1LA 4XKNA 3QXMA 1NV4A 5HPQA 2Z22A 3TODA 2RCAA 5M2VA 2XXYA 3Q28A 3H06B 1Y20A 3V89B 1NV0A 1PDAA 5KZTA 2DS9A 4LZ5A 2F7CA 4G8MA 2AIXA 5IZ3B 3K1MA 3H6WA 1SI1A 4WXJA 4UABA 1R1NA 2XWIA 4QFNA 1QGXA 2VPNA 2DE3A 5CBRA 2H9BA 4OFLA 2QS4A 4XTCQ 3MPKA 1I6AA 3SEVA 1YAEA 1MM6A 5I84A 2FBPA 3KGCA 4N81A 3D4GA 5DVIA 4MF3A 1DMBA 3E79A 1KZ8A 1LBBA 3UIFA 3PTYA 3N6UA 1H45A 4EDPA 1II5A 4IY6A 1A7LA 2F36A 3G3JA 1NH8A 2VGQA 5JK4A 3RLFE 1IMFA 2QVRA 2D5WA 1SW2A 1B3GA 3FXRA 1B0LA 3CSBA 3O29A 1Y1MA 4F18A 2Q8MA 4JB7A 1KA0A 4PFIA 3TTLA 3PGFA 4KXPA 1G0IA 1LEVA 4YU0A 4GF8A 3MJNA 4F3BA 5ISUA 1YTVA 1IXGA 4IO2A 3IOVA 1XC1A 1P1QA 4F2QA 4TQUQ 4PAKA 3VV5A 4N07A 2XWOA 3KOTA 3GBAA 2ZYNA 2XXPA 2I0BA 2O69A 1FQEA 2CEYA 4AQ4A 1NI9A 3K4UA 5I2NA 1OIBA 4I3YA 1NV5A 2I0CA 2BJJX 2X26A 3FJGA 3HSTA 5F7VA 2WBBA 1IMCA 1LLSA 3CFLA 2REJA 1PBPA 5H8QB 3KJ7A 2RC9A 1QKBA 2Y7KA 1RKMA 3OSQA 3B7DA 2ESNA 1IMAA 2HHMA 4GXAA 4F1VA 2RINA 4DXCA 4XEQA 2PT1A 3HN0A 5K2XA 1SQYA 1JVXA 4ZS9A 2CEXA 3FJMA 1NH7A 2WX9A 3RUMA 4U23A 2AYSA 4E0XA 1GV8A 3BIGA 4E0WA 4OMBA 3CG3A 4DXBA 3JYRA 1NUXA 4H46A 3IORA 2FIXA 4X8RA 1TT1A 4P8BA 1JETA 2HFBA 3DM0A 2Y7PA 3H6VA 5H8SA 2X7PA 3TPAA 3MVWA 1ZIUA 3V8XB 1NMUA 5FTHA 4YKJA 3WAEA 4IGRA 3GXAA 1EYIA 3H4ZA 3C4MA 1A99A 5DYHA 3TMGA 2WYPA 4KYEA 4KCDA 4N91A 2I6EA 4F2OA 4KI0E 2XWVA 4G8HA 4ESXA 1B2HA 4GWZA 2I58A 4MAGA 4THIA 2ZNTA 2O51A 1QUJA 1B3FA 1B3LA 1WDNA 4DI4B 1L5TA 4Z0IA 4ONYA 2B3BA 3FATA 4N6KA 1UTHA 4EF1A 3FASA 1SBPA 2Q2AA 3MBPA 3OO7A 1SYHA 2IA4A 3K6WA 2QMXA 1Y3PA 5AA2B 2F8DA 1INPA 2THIA 1MPDA 3OEKA 1B46A 1B4ZA 5EYHA 5BUUA 1B3HA 3JV9A 3OOAA 1FQBA 2HXRA 4F31B 1FPFA 3K0VA 2DVZA 1ZU0A 4IGTA 3PPPA 1Q1KA 3M3FA 4OTEA 4IO6A 4GIZA 1S9TA 1JW4A 4RJZA 4BDLA 3PPRA 3C35A 3TCHA 2CZLA 5FTIA 4KYSA 3KSJA 4C0RA 5JEIA 3PPQA 4DLDA 3PMWA 2VOZA 4BDQA 2VT5A 4ZEIA 2V93A 4R9GA 4I9DA 5HM4B 3S9MC 2F34A 1YYZA 2WBDA 1K9ZA 4P1EA 1EZOA 1GGGA 3N6TA 1JNFA 5KCJA 4HE2A 1VR5A 2B4MA 3KSXA 3O6GA 1LGBC 2I3WA 3SEUA 4AB5A 3C34A 3T22A 2ZYMA 3KN3A 3DP6A 1B7UA 4I8CA 3O6IA 4K3FA 4I62A 1VDWA 1TWYA 3RT8A 3RQTA 4YMBA 2X7QA 2PT2A 1SW5A 4QXDA 4GQOA 4XIGQ 1NV1A 5F24A 2PFYA 5H8NB 5LDZA 3T96B 1Z7NE 4QFPA 4O3CA 2HAVA 2R6GE 4PDDA 3TDJA 3OSRA 2OBGA 3ISPA 3MYUA 3T9UA 4GLIA 2O7IA 3KFMA 3LR1A 3G3GA 2Z8FA 1MQIA 4JDFA 2NWJA 1UQWA 3NOHA 5DEXA 4GWWA 3TEPA 1ANFA 1NV2A 4PFTA 3IJOB 3HV1A 3BBRA 2F3BA 1F9BA 1NL5A 2OX3A 5H8FB 3CVGA 2QSXA 3R6UA 3KOSA 5B7DA 4XKQA 3E9XA 4G68C 3CHGA 1JW1A 3SEYA 4OHNA 1FPEA 4QSEA 2V4CA 5A5XB 4XF5A 3TTMA 4NF0A 2XWKA 2XX9A 2F97A 3B50A 2QVVA 5LOMA 4HXVA 1BIYA 5CM6A 2R8TA 2XX8A 3TQWA 2ONKE 3FXUA 1H3DA 4N6PA 5AA4B 4NX1A 5JTYB 2VPOA 1P1OA 1EH3A 1LBXA 4ZEBA 1FCKA 1MM7A 1A54A 4KHZE 2E0SA 3MP1A 1S50A 1CE2A 3IX1A 5ITOA 3TFLA 5I5PA 3UK4A 1LFIA 2B4LA 3MVYA 4RK9A 4PAFA 3U8QA 4P11A 2I49A 2Y5KA 2Y7IA 1M5CA 2XD3A 3TZAA 2LAOA 5EYFA 5J1DA 5I58A 1MXXA 4YKPA 5F1QA 4OENA 5KCJB 4FORA 1IXHA 1URDA 4H45A 1MDP1 2XXKA 4X04A 4PCDA 2DP8A 1FBEA 1MPCA 3TQLA 4OQOA 4NWCA 1Y3NA 5EQAA 5B70A 2UVHA 4YB5A 3FJ7A 4YKKA 4XKPA 1H43A 5BWJA 4PDHA 2NXOA 4XKRA 5H8HA 3W9WA 2PFZA 2Y5LA 4R6YA 4F3GA 1MRPA 1WVJA 3K00A 4NF4A 4GBVA 2F7BA 2O6AA 3A3UA 5I56B 1MXWA 1US5A 1B0HA 2ZYOA 5L8DA 1N76A 1LCFA 4FEBA 4IO3A 1HSLA 1NKXA 1AIVA 3T9XB 1TFAA 4QSDA 3H3GA 1FPLA 1FBHA 4U4SA 4GWXA 5DEXB 3MUQA 4H65A 1B5IA 4C1UA 1USYE 3SEXA 2ABHA 2Q88A 5CMKA 1DPEA 4EF2A 4R75A 4O3BA 1LBYA 3IB1A 1EYJA 4Q30B 3SZPA 1LCTA 2Q8JA 3RTFB 1OLAA 1QULA 3K6UA 3O6HA 4M4GA 4OFJA 4GWYA 1MQJA 4Q5TA 2ALUA 4OYVA 3MP6A 4IO7A 3E3KA 1FQDA 4OANA 1FTMA 3DP8A 3S4UA 4F3SA 5FHOA 4GFRA 3FVKA 1MY2A 3FUZA 3U72A 4ECFA 3R26A 1B1XA 3M3KA 4PFRA 3GYYA 1A8EA 5I59A 3IJXB 4F39A 4MX6A 3S9EA 3EPEA 1DBZA 4TOZA 1LSTA 4O7IA 1RDZA 4YMAA 3TTNA 2ZXTA 1JVYA 5J16A 3RNNA 2D21A 2Z23A 4HE1A 3CFZA 4O8MA 3RY3A 3V83A 4OVJA 5I57B 4P47A 4R72A 2Y7RA 2XXTA 1CNQA 3QIMA 1PB7A 1QW0A 5ET5A 4PTKA 1BTJA 3IL1B 1B5HA 4JWOA 1R6ZA 1NV3A 2OK2A 4ZEDA 3ROJA 2P3NA 4IR8A
chains in the Genus database with same CATH topology
1AWBA 2DE3A 1LBYA 4MNPA 4DI4B 4YICA 2ZZXA 1FJ6A 4P56A 5ET7A 1EYJA 4MIJA 1FPJA 1VDWA 4N6DA 5EQ7A 5I5PA 2CZHA 3SZPA 4GX6A 2HZKA 1DCUA 4MJOA 5ET8A 4N6KA 2B4LA 1IMBA 4XFEA 3T1BA 1IMAA 2HHMA 4N17A 4PAFA 3RYDA 4F1VA 1NV7A 2Q9TA 1IMEA 4O94A 4QXDA 4PF8A 5EQ9A 3RPLA 4NG7A 2Y5KA 2FBPA 2V3QA 1NV1A 5F24A 2XA5A 1K9YA 2PFYA 4XEQA 3LUZA 4P9KA 4N81A 4F19A 5EQ8A 1FJ9A 4GWYA 3T0JA 2FIEA 1LBZA 5ET5A 3FXBA 4NN3A 5J1DA 3QMFA 3E79A 5LDZA 2CEXA 2QVUA 3FBPA 4I40A 1KZ8A 4OVQA 1LBVA 1INPA 4AS4A 3PTYA 5EYGA 4MNIA 1FPBA 2WX9A 1D9QA 2ZZWA 4F1UA 2WEFA 1NUWA 4OANA 1YZ0A 4MNCA 4NAPA 1G0HA 2BJIA 4GX3A 4PDDA 5ESYA 4H45A 5EYHA 1FPGA 2P3VA 3BIGA 3ISPA 4MCOA 2XXKA 4GBWA 2HXRA 3MYUA 4PE3A 4QBAA 5JK4A 1RDYA 2F5XA 4PGPA 4X04A 1SPIA 4M1VA 4PCDA 1FPFA 4NGUA 4NQ8A 5ET6A 3W9VA 2ZZVA 1FBEA 1IMFA 5DW8A 2DVZA 2QVRA 2KR0A 5FBPA 4HCWA 1FPKA 5LTCA 5A5LA 4MHFA 3MSTA 4DI3D 2QPQA 1FBPA 1NUXA 4H46A 4PFBA 1EYKA 4OVPA 4PFRA 5IZZA 3GYYA 5EQAA 1XI6A 1FSAA 4I3EA 3NOHA 4NHBA 1FTAA 1NUZA 2FIXA 5IZ1A 1BK4A 2OWZA 4X8RA 4MEVA 4OA4A 4P8BA 1DK4A 4GWWA 2Q8MA 1JP4A 3HFUA 4PBHA 4F18A 4MX6A 3KBZA 1YXIA 1NV2A 4PDHA 1DBZA 3IFAA 5IM2A 3RPLB 1KA0A 4PFIA 4N8YA 4HCYA 3B8BA 4PETA 1FBDA 1RDZA 4O7IA 2HZLA 3W9WA 2F3BA 2PFZA 2Y5LA 4KXPA 4PGNA 1FBGA 1G0IA 1LEVA 3D1RA 5T3JA 3E78A 3U65A 1KA1A 2FVZA 2OX3A 2CZIA 4YZZA 1FPDA 2MKZA 4PBQA 5J16A 1RDXA 3LV0A 4GBVA 4HXVA 5I3SA 1FBFA 4GX4A 5IZ3A 4PF6A 1IMDA 1NV6A 1NUYA 3BIHA 2GQ1A 3CHGA 1NV4A 4HE1A 2HPGA 4PAIA 1EYIA 3KC0A 4O8MA 4GWSA 3IFCA 4O7MA 1Q9DA 2CZKA 3KC1A 4PC9A 1FPEA 2QFLA 5IGAA 4GWUA 4PAKA 4G61A 2DE4A 2V4CA 2VT5A 4N4UA 1FPIA 2F3DA 4P47A 2XWOA 4JVCA 4N15A 2WYPA 4XF5A 1FRPA 4JVDA 4NF0A 4OVRA 4X9TA 1CNQA 1NV0A 4N91A 2DDKA 5I7IA 2XWKA 4P3LA 2XWVA 2DE2A 3B50A 2CEYA 4HE0A 1FPLA 1LBWA 2QVVA 4FBPA 1YYZA 1NI9A 2JJKA 1FBHA 1K9ZA 2WBDA 3A29A 2R8TA 1FBCA 4GWXA 4PTKA 4P1EA 4GWZA 5CM6A 5IZ3B 2Q74A 4I3YA 4MAGA 4JVIA 1NV5A 4OVSA 4HE2A 4LN5A 4P1LA 2FHYA 2KQZA 2PCRA 4AS5A 4OVTA 2B4MA 4NX1A 4UABA 2L5VA 2WBBA 2VPOA 2WYKA 2XWIA 4MMPA 1IMCA 4N8GA 1LBXA 1NV3A 3ROJA 2P3NA 1QGXA 4IR8A 2VPNA 3EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWB A;  1LBY A;  1FJ6 A;  5ET7 A;  1EYJ A;  1FPJ A;  1VDW A;  5EQ7 A;  2CZH A;  4GX6 A;  1DCU A;  4MJO A;  5ET8 A;  1IMB A;  1IMA A;  2HHM A;  3RYD A;  1NV7 A;  1IME A;  4QXD A;  5EQ9 A;  3RPL A;  2Y5K A;  2FBP A;  1NV1 A;  5F24 A;  1K9Y A;  3LUZ A;  4N81 A;  5EQ8 A;  1FJ9 A;  4GWY A;  3T0J A;  2FIE A;  1LBZ A;  5ET5 A;  3QMF A;  5LDZ A;  2QVU A;  3FBP A;  4I40 A;  1KZ8 A;  1LBV A;  1INP A;  4AS4 A;  5EYG A;  1FPB A;  1D9Q A;  2WEF A;  1NUW A;  1YZ0 A;  1G0H A;  2BJI A;  4GX3 A;  5ESY A;  4H45 A;  5EYH A;  1FPG A;  2P3V A;  3BIG A;  4GBW A;  1RDY A;  1SPI A;  1FPF A;  5ET6 A;  1FBE A;  1IMF A;  5DW8 A;  2QVR A;  5FBP A;  1FPK A;  5A5L A;  1FBP A;  1NUX A;  4H46 A;  1EYK A;  5EQA A;  1XI6 A;  1FSA A;  4I3E A;  1FTA A;  1NUZ A;  2FIX A;  5IZ1 A;  1BK4 A;  2OWZ A;  1DK4 A;  4GWW A;  2Q8M A;  1JP4 A;  3KBZ A;  1YXI A;  1NV2 A;  1DBZ A;  3IFA A;  3RPL B;  1KA0 A;  3B8B A;  1FBD A;  1RDZ A;  4O7I A;  2F3B A;  2Y5L A;  4KXP A;  1FBG A;  1G0I A;  1LEV A;  3D1R A;  5T3J A;  1KA1 A;  2FVZ A;  2OX3 A;  2CZI A;  1FPD A;  5J16 A;  1RDX A;  3LV0 A;  4GBV A;  4HXV A;  5I3S A;  1FBF A;  4GX4 A;  5IZ3 A;  1IMD A;  1NV6 A;  1NUY A;  3BIH A;  2GQ1 A;  1NV4 A;  4HE1 A;  1EYI A;  3KC0 A;  4GWS A;  3IFC A;  1Q9D A;  2CZK A;  3KC1 A;  1FPE A;  2QFL A;  4GWU A;  4G61 A;  2VT5 A;  1FPI A;  2F3D A;  1FRP A;  1CNQ A;  1NV0 A;  2DDK A;  4HE0 A;  1FPL A;  1LBW A;  2QVV A;  4FBP A;  1YYZ A;  1NI9 A;  2JJK A;  1FBH A;  1K9Z A;  2WBD A;  3A29 A;  2R8T A;  1FBC A;  4GWX A;  4PTK A;  4GWZ A;  5IZ3 B;  2Q74 A;  4I3Y A;  1NV5 A;  4HE2 A;  2FHY A;  2PCR A;  4AS5 A;  2WBB A;  1IMC A;  1LBX A;  1NV3 A;  3ROJ A;  2P3N A;  1QGX A;  4IR8 A; 
#chains in the Genus database with same CATH topology
 3OO8 A;  2UVJ A;  2ANJ A;  1Z7M E;  5I56 A;  4ZE9 A;  4JWY A;  4NMY A;  3T1B A;  4ISU A;  1B4H A;  1ZKB A;  4P0I A;  4PF8 A;  3RPL A;  3EN3 A;  2RF1 A;  2VD2 A;  3BFU A;  5EQ8 A;  4F19 A;  3FV2 A;  1UTB A;  1OQH A;  2QVU A;  3H7M A;  3VXC A;  2QL3 A;  1D4N A;  2D3I A;  1KWH A;  4RNS A;  4F29 A;  3SES A;  3ODB A;  1FTO A;  1RDY A;  4PGP A;  1JQF A;  4NQ8 A;  5ET6 A;  1Y4T A;  3H6U A;  4DI3 D;  2QPQ A;  3MW0 A;  4GRK A;  1LAH E;  4I3E A;  4WKM A;  5DT6 A;  4MEV A;  5TU0 A;  4OXV A;  1UIV A;  1BKA A;  1A40 A;  1DOT A;  4O3A A;  3D1R A;  3K6X A;  5CI5 A;  3E4R A;  1MH3 A;  3IR1 A;  1FPD A;  4QFL A;  4KQP A;  4FAT A;  3JZJ A;  3LC8 A;  4PF6 A;  3IOU A;  3U1O A;  2DXY A;  1NNK A;  4GWS A;  4O7M A;  3I3V A;  1VFD A;  3HPI A;  4G61 A;  1I6B A;  4OEV A;  2HEU A;  4JVC A;  1XVX A;  4OVR A;  1QKA A;  1R9Q A;  5H8F A;  4GOT A;  3LUY A;  4LQ2 A;  3T66 A;  1ATG A;  3ZSF A;  4AS5 A;  1D3K A;  4ND9 A;  1XHY A;  1CB6 A;  4PFW A;  1FQC A;  3K02 A;  1ZJL A;  3PMX A;  5AA2 D;  3IOT A;  1XS5 A;  4YIC A;  3MZB A;  3FD3 A;  4G4P A;  1EZ9 A;  3PPO A;  1N3W A;  2P2A A;  5K2Y A;  5EQ9 A;  3VVE A;  3N94 A;  5L9O A;  3C31 A;  3FGS A;  4JSO A;  3T0J A;  3K6V A;  3QMF A;  1I6Q A;  1O64 A;  3CR9 A;  2H99 A;  4OVQ A;  4MNI A;  2OPD A;  2ZZW A;  4F1U A;  3R7X A;  1YZ0 A;  3SDF A;  5CRY A;  4HTG A;  4ELP A;  2F5X A;  4M1V A;  2XD2 A;  4YKI A;  4NGU A;  4NE4 A;  4WED A;  3ILU B;  3L6G A;  3O9P A;  4OVP A;  5I58 B;  4LA9 A;  2YLN A;  1D9Y A;  5I2N B;  1OQG A;  3HFU A;  5ELV A;  2REG A;  2NVU B;  3FZV A;  3CI8 A;  4KFQ A;  3LSW A;  5H8Q A;  4JXI A;  3FXQ A;  3S9L C;  2MKZ A;  2I4C A;  1B32 A;  3IB2 A;  5EHM A;  4GX4 A;  4ZEK A;  1IMD A;  1NUY A;  3KZG A;  4R9F A;  4UAC A;  1XOC A;  3T9H B;  1PC3 A;  3KC1 A;  4X1D A;  2DE4 A;  4TLL B;  2F3D A;  4IO4 A;  2QS3 A;  3S2V A;  4QRZ A;  4DE8 A;  4TLM B;  4GL8 A;  4GD5 A;  2XXV A;  3H6T A;  2H4I A;  4G77 A;  4FIM A;  1VFE A;  2DWH A;  4DZ1 A;  2B65 A;  4QF9 A;  1SW4 A;  1JEU A;  3OXN A;  4QSC A;  2WYK A;  1AOV A;  3UGW A;  2Q2C A;  1MG1 A;  1QJM A;  1POY 1;  1AWB A;  1BLF A;  2A5T A;  3MPL A;  1QVS A;  4MIJ A;  5EHS A;  3PUW E;  3FIR A;  2HZK A;  4MJO A;  4U1O A;  1VSO A;  2RKM A;  4N17 A;  5TPA B;  4HS7 A;  2UYF A;  1LBZ A;  1MY1 A;  2OJT A;  4KYD A;  4I40 A;  2RC8 A;  4AS4 A;  1FPB A;  2GRV A;  1QUK A;  4FAJ A;  1NUW A;  5ESY A;  1DTG A;  5CC2 A;  3VFJ A;  1B51 A;  2O7U A;  2FNC A;  2AL5 A;  4H6D A;  1NNF A;  2XXU A;  4RXL A;  4OA4 A;  2ZNU A;  1DK4 A;  3KBZ A;  1AH5 A;  2OLB A;  3DEL B;  5A5X A;  3O97 A;  4MH5 A;  3ILT B;  1IEJ A;  4N8Y A;  3B8B A;  2UVG A;  1B05 A;  4GXS B;  4C1T A;  3KBR A;  4G68 B;  1FBG A;  5L9M A;  3KN7 A;  4OER A;  4XXU A;  3GZG A;  5I59 B;  2GHB A;  1UTH B;  2PBW A;  1P1W A;  3IFC A;  2QFL A;  1MY4 A;  3N5L A;  1S7Y A;  4KPT A;  3MVZ A;  3EF7 A;  3LSL A;  5AA2 A;  4UA8 A;  3OO9 A;  4POX A;  3A29 A;  4X1B A;  4EUO A;  2G93 A;  4JVI A;  2F78 A;  1MPB A;  2PCR A;  5I2K B;  2ONS A;  3DP4 A;  3CRB A;  2FA7 A;  3EKI A;  1MXZ A;  1OMP A;  1FPJ A;  2F35 A;  4PP0 A;  3KG2 A;  4OWD A;  3F11 A;  2QS2 A;  2YJP A;  5TP9 B;  4H5F A;  4ZEC A;  2VHA A;  4NN3 A;  2QJE A;  1EZP A;  3MQ9 A;  2OWS A;  3A09 A;  3UN6 A;  5L9S A;  4KR5 A;  2H5Y A;  4MCO A;  2F6P A;  1B52 A;  2F7A A;  1B6H A;  3MAM A;  3RN8 A;  4LON B;  2KR0 A;  4H8J A;  2A5T B;  3CFX A;  1MQH A;  4F1Y A;  1FSA A;  2GH9 A;  4NHB A;  4JSD A;  1IUD A;  3FV1 A;  4RPO A;  5TPA A;  4IB2 A;  5IM2 A;  1IXC A;  4H67 A;  1US4 A;  3PUY E;  2I4B A;  3TKD A;  3HHG A;  1N7X A;  4PQJ A;  3Q27 A;  1N0T A;  5FHN A;  2Y7W A;  2XXI A;  4OFO A;  4H8I A;  1NV6 A;  2GQ1 A;  3RTW B;  2PYY A;  3VVD A;  4LZ8 A;  1Q9D A;  3RGY A;  3B6T A;  4JVD A;  4EQB A;  4P0G A;  2P0S A;  2DE2 A;  3OEM A;  4HE0 A;  4MFI A;  1BP5 A;  1LFG A;  4LN5 A;  5CMC A;  1URG A;  4PFY A;  2UVI A;  3HHF A;  4X48 A;  3K1N A;  2H98 A;  4G68 A;  1SW1 A;  3E78 A;  5CMM A;  4OET A;  4P56 A;  2OWT A;  5ICQ A;  3VE1 B;  3PV0 E;  3TCG A;  3PU5 A;  1NV7 A;  1IQ7 A;  2V3Q A;  3O2A A;  1K9Y A;  2DSF A;  5CBS A;  3FVG A;  1SI0 A;  4WEP A;  3K1P A;  4LZ7 A;  1Y1Z A;  2WEF A;  3B6W A;  2BJI A;  3ECR A;  3KJT A;  3KN8 A;  4QFK A;  3UP9 A;  5KDT B;  4QHQ A;  4GBW A;  2VP1 A;  3OMB A;  2PMS A;  2ZZV A;  3TAJ A;  2XHD A;  3PMV A;  4YAH X;  2DOJ A;  3VXB A;  3MC2 A;  4LAT A;  1USY H;  1LBC A;  1URS A;  1MY3 A;  3C32 A;  2V3T A;  1PB8 A;  4F22 A;  1MXU A;  5AA4 A;  4NF5 B;  1YXI A;  4HW8 A;  5JTY A;  4QFO A;  5AE4 A;  1EU8 A;  4R6K A;  4HCY A;  4U4X A;  1FBD A;  4JBZ A;  4RY1 A;  4G8N A;  1RDX A;  1FBF A;  2ZNS A;  3BIH A;  3IAZ A;  4DCX A;  5IGA A;  4N4U A;  2Y84 A;  1H44 A;  1FTK A;  4NTL A;  5I7I A;  3HCQ A;  1ZBM A;  5FHM A;  2GFE A;  4JWX A;  4OVS A;  2RCB A;  3VVF A;  3TTK A;  1A8F A;  1HSE A;  2XXW A;  4N13 A;  4ZZA A;  1P1N A;  2PVU A;  3QYT A;  4ELQ A;  1J1N A;  1UTB B;  3THI A;  3EHS A;  2ZZX A;  1FJ6 A;  3K01 A;  5ET8 A;  4R2F A;  3PUX E;  4NG7 A;  2XA5 A;  1Y9U A;  5H8H B;  3I5O A;  3CIJ A;  2DWJ A;  2FIE A;  1DPP A;  3H03 A;  3PUZ E;  3TEL A;  3QK6 A;  2O84 X;  1MS7 A;  1FQF A;  3TTR A;  3IB0 A;  2P3V A;  2B3F A;  1LAG E;  1SPI A;  3B6Q A;  5FBP A;  2QMW A;  2R71 A;  3UA8 A;  1FBP A;  1IIW A;  2XXQ A;  1FTJ A;  1AL3 A;  1N84 A;  4U1Z A;  2FYI A;  4NED A;  1BK4 A;  1XT8 A;  1JP4 A;  2DXR A;  4PBH A;  5IKB A;  3RPW A;  1SDX A;  4LUB A;  3USD A;  1B5J A;  1ZLQ A;  4DIG A;  3OEN A;  4YZZ A;  3MWB A;  2P1S A;  2F6G A;  3HO7 A;  1B7H A;  2HAU A;  4PC9 A;  5KDT A;  4POW A;  3PD8 A;  3M8U A;  4GWU A;  1B1H A;  3P7I A;  1FPI A;  4ELR A;  1FRP A;  4NF8 B;  1O63 A;  4DXU A;  3SET A;  2DDK A;  4H0W A;  2JJK A;  4KCC A;  1AMF A;  2I48 A;  1B9J A;  5IAI A;  3O66 A;  4ZZE A;  3MP8 A;  4U21 A;  2RC7 A;  4MMP A;  1MY0 A;  5ICT A;  3M3L A;  4ZEF A;  1DSN A;  2R9J A;  4NF6 A;  4FE8 A;  4N6D A;  1T0K A;  2O1M A;  5EQ7 A;  2AL4 A;  3OD7 A;  2XXR A;  4BDR A;  4U2R A;  3QAX A;  3BFT A;  2UXA A;  2Q9T A;  4R2B A;  1GVC A;  1Q35 A;  2Q89 A;  2V3U A;  1OVB A;  1LBV A;  4GL0 A;  3QSL A;  3G3K A;  3K2D A;  5DVJ A;  2PX1 A;  4GX3 A;  3G3I A;  5I57 A;  2IEE A;  1DTZ A;  4MBP A;  1TXF A;  3GBB A;  5A5L A;  4PE5 B;  4FED A;  4LQ5 A;  5IZZ A;  1YPN A;  3DLN A;  1RYX A;  1M5F A;  3G7W A;  1FTA A;  3IO4 A;  2OWZ A;  4Q8R A;  3A3C A;  2NUV A;  2DVC A;  3ZS6 A;  4FJP A;  1D9V A;  3D4C A;  3GLB A;  1ELJ A;  5H8N A;  4RA1 A;  2QS1 A;  1A55 A;  4LVQ A;  2CZI A;  4PBQ A;  4BDO A;  5IZ3 A;  3U93 A;  1WOD A;  3SKP A;  3E13 X;  2V84 A;  2HPG A;  2CZK A;  1SVX B;  5CMB A;  4KD5 A;  4N15 A;  3VLW A;  3Q29 A;  3IOW A;  4IO5 A;  4P3L A;  2DWI A;  1HSJ A;  3FVO A;  1FBC A;  1R9L A;  3PD9 A;  3V5A A;  2Q74 A;  4ZE8 A;  1ZTY A;  3SER A;  4P1L A;  2E1S A;  2L5V A;  1FQA A;  1LAF E;  1LB8 A;  1ZMG A;  2XXX A;  1N3X A;  1H76 A;  5I3S A;  2WKY A;  3FXB A;  3MVX A;  4H5G A;  1RYO A;  2M8C A;  2CZH A;  4R74 A;  4GX6 A;  1IMB A;  2XX7 A;  3VDF A;  1NNT A;  2HQ0 A;  3AXF A;  3C9H A;  1LFH A;  3CG1 A;  1FW0 A;  4YB6 A;  1B3E A;  2XXH A;  5EYG A;  4R6H A;  1D9Q A;  4EQ7 A;  4NAP A;  1G0H A;  3MZ1 A;  1FPG A;  1SYI A;  4QBA A;  4LP2 B;  4ZDM A;  5DW8 A;  4HCW A;  5LTC A;  3MST A;  4NF6 B;  3RT6 B;  2OZZ A;  1UIU A;  1XI6 A;  2G29 A;  3G3F A;  1MQD A;  1JW5 A;  2ZMB A;  2DQV A;  3BKI B;  4OZ9 A;  4RYA A;  5HBC A;  2CMO A;  4PGN A;  2YPN A;  1KA1 A;  3L6H A;  3U94 A;  3S9N C;  3EHT A;  3LSX A;  3FVN A;  2OCU A;  4PAI A;  3TUS A;  1Y3Q A;  3KC0 A;  4EQ9 A;  5I2K A;  4NF5 A;  1LB9 A;  1MQG A;  2OPE A;  3EQ1 A;  4FBP A;  1N7W A;  4F3P A;  1IXI A;  1JEV A;  1MXY A;  4EXL A;  1OVT A;  3SEW A;  2KQZ A;  3Q26 A;  4ESW A;  4MLQ A;  4OVT A;  5TP9 A;  1YCJ A;  4Q0C A;  3C33 A;  4U22 A;  1GR2 A;  4MNP A;  5DVF A;  5ET7 A;  2O68 A;  4NF4 B;  4MLV A;  1PBQ A;  1Y4C A;  3UOR A;  4XFE A;  3N26 A;  1B7Z A;  3RYD A;  4G2Z A;  1IIT A;  1B40 A;  1IME A;  4O94 A;  2KLF A;  3Q25 A;  2W7Y A;  4OES A;  4P9K A;  1FJ9 A;  2H25 A;  1VE4 A;  4RPN A;  3FBP A;  3C36 A;  3VLU A;  2HXW A;  5DTB A;  2NOO A;  1M5E A;  4MNC A;  3VLV A;  2UYE A;  1LAX A;  3TCF A;  3IO6 A;  4Z7E A;  4PE3 A;  1FTL A;  3TYH A;  4L17 A;  1EYK A;  3QUF A;  2ONR A;  4PET A;  1NFT A;  4R73 A;  1I69 A;  5T3J A;  3T9V A;  2FVZ A;  3LV0 A;  4OEU A;  3PUV E;  2Z8D A;  4PFU A;  4BLA A;  4X9T A;  5ITP A;  3U92 A;  1PEB A;  1TFD A;  2VD3 A;  4EXK A;  1MH4 A;  1M5B A;  3PPN A;  4I1D A;  4GWO A;  1LBW A;  4N8G A;  4NWD A;  2DYX A;  3CSG A;  2FHY A;  2GHA A;  4BDN A;  1SD3 A;  1GTK A;  2DWA A;  4H1X A;  3EHU A;  4NF8 A;  3MZ9 A;  3IK6 B;  3T93 B;  4ELO A;  1DCU A;  1N04 A;  4YB7 A;  1POT A;  3LUZ A;  3QUJ A;  5AA3 A;  3LBS A;  4RK2 A;  2ZYK A;  3OO6 A;  1M5D A;  1OLC A;  1P99 A;  2HCA A;  2I3V A;  3ZKK A;  4DCY A;  3O28 A;  1MDQ A;  4FEC A;  3I6V A;  3W9V A;  1PB9 A;  3WAF A;  2Z8E A;  1FPK A;  4IY5 A;  4MHF A;  4DDD A;  4GVO A;  1O7T A;  4PFB A;  4AB6 A;  1XVY A;  1MXV A;  3KEI A;  3OEL A;  1NUZ A;  5IZ1 A;  2A5S A;  3W15 C;  1P1U A;  5AA1 A;  3IFA A;  3RPL B;  2V25 A;  2QRY A;  2HZL A;  1IZ1 A;  3U65 A;  1NNP A;  1QUI A;  3ONM A;  4BDM A;  1B58 A;  3LSF B;  3ZKL A;  3G3H A;  2O1L A;  4XKN A;  3QXM A;  1NV4 A;  5HPQ A;  2Z22 A;  3TOD A;  2RCA A;  5M2V A;  2XXY A;  3Q28 A;  3H06 B;  1Y20 A;  3V89 B;  1NV0 A;  1PDA A;  5KZT A;  2DS9 A;  4LZ5 A;  2F7C A;  4G8M A;  2AIX A;  5IZ3 B;  3K1M A;  3H6W A;  1SI1 A;  4WXJ A;  4UAB A;  1R1N A;  2XWI A;  4QFN A;  1QGX A;  2VPN A;  2DE3 A;  5CBR A;  2H9B A;  4OFL A;  2QS4 A;  4XTC Q;  3MPK A;  1I6A A;  3SEV A;  1YAE A;  1MM6 A;  5I84 A;  2FBP A;  3KGC A;  4N81 A;  3D4G A;  5DVI A;  4MF3 A;  1DMB A;  3E79 A;  1KZ8 A;  1LBB A;  3UIF A;  3PTY A;  3N6U A;  1H45 A;  4EDP A;  1II5 A;  4IY6 A;  1A7L A;  2F36 A;  3G3J A;  1NH8 A;  2VGQ A;  5JK4 A;  3RLF E;  1IMF A;  2QVR A;  2D5W A;  1SW2 A;  1B3G A;  3FXR A;  1B0L A;  3CSB A;  3O29 A;  1Y1M A;  4F18 A;  2Q8M A;  4JB7 A;  1KA0 A;  4PFI A;  3TTL A;  3PGF A;  4KXP A;  1G0I A;  1LEV A;  4YU0 A;  4GF8 A;  3MJN A;  4F3B A;  5ISU A;  1YTV A;  1IXG A;  4IO2 A;  3IOV A;  1XC1 A;  1P1Q A;  4F2Q A;  4TQU Q;  4PAK A;  3VV5 A;  4N07 A;  2XWO A;  3KOT A;  3GBA A;  2ZYN A;  2XXP A;  2I0B A;  2O69 A;  1FQE A;  2CEY A;  4AQ4 A;  1NI9 A;  3K4U A;  5I2N A;  1OIB A;  4I3Y A;  1NV5 A;  2I0C A;  2BJJ X;  2X26 A;  3FJG A;  3HST A;  5F7V A;  2WBB A;  1IMC A;  1LLS A;  3CFL A;  2REJ A;  1PBP A;  5H8Q B;  3KJ7 A;  2RC9 A;  1QKB A;  2Y7K A;  1RKM A;  3OSQ A;  3B7D A;  2ESN A;  1IMA A;  2HHM A;  4GXA A;  4F1V A;  2RIN A;  4DXC A;  4XEQ A;  2PT1 A;  3HN0 A;  5K2X A;  1SQY A;  1JVX A;  4ZS9 A;  2CEX A;  3FJM A;  1NH7 A;  2WX9 A;  3RUM A;  4U23 A;  2AYS A;  4E0X A;  1GV8 A;  3BIG A;  4E0W A;  4OMB A;  3CG3 A;  4DXB A;  3JYR A;  1NUX A;  4H46 A;  3IOR A;  2FIX A;  4X8R A;  1TT1 A;  4P8B A;  1JET A;  2HFB A;  3DM0 A;  2Y7P A;  3H6V A;  5H8S A;  2X7P A;  3TPA A;  3MVW A;  1ZIU A;  3V8X B;  1NMU A;  5FTH A;  4YKJ A;  3WAE A;  4IGR A;  3GXA A;  1EYI A;  3H4Z A;  3C4M A;  1A99 A;  5DYH A;  3TMG A;  2WYP A;  4KYE A;  4KCD A;  4N91 A;  2I6E A;  4F2O A;  4KI0 E;  2XWV A;  4G8H A;  4ESX A;  1B2H A;  4GWZ A;  2I58 A;  4MAG A;  4THI A;  2ZNT A;  2O51 A;  1QUJ A;  1B3F A;  1B3L A;  1WDN A;  4DI4 B;  1L5T A;  4Z0I A;  4ONY A;  2B3B A;  3FAT A;  4N6K A;  1UTH A;  4EF1 A;  3FAS A;  1SBP A;  2Q2A A;  3MBP A;  3OO7 A;  1SYH A;  2IA4 A;  3K6W A;  2QMX A;  1Y3P A;  5AA2 B;  2F8D A;  1INP A;  2THI A;  1MPD A;  3OEK A;  1B46 A;  1B4Z A;  5EYH A;  5BUU A;  1B3H A;  3JV9 A;  3OOA A;  1FQB A;  2HXR A;  4F31 B;  1FPF A;  3K0V A;  2DVZ A;  1ZU0 A;  4IGT A;  3PPP A;  1Q1K A;  3M3F A;  4OTE A;  4IO6 A;  4GIZ A;  1S9T A;  1JW4 A;  4RJZ A;  4BDL A;  3PPR A;  3C35 A;  3TCH A;  2CZL A;  5FTI A;  4KYS A;  3KSJ A;  4C0R A;  5JEI A;  3PPQ A;  4DLD A;  3PMW A;  2VOZ A;  4BDQ A;  2VT5 A;  4ZEI A;  2V93 A;  4R9G A;  4I9D A;  5HM4 B;  3S9M C;  2F34 A;  1YYZ A;  2WBD A;  1K9Z A;  4P1E A;  1EZO A;  1GGG A;  3N6T A;  1JNF A;  5KCJ A;  4HE2 A;  1VR5 A;  2B4M A;  3KSX A;  3O6G A;  1LGB C;  2I3W A;  3SEU A;  4AB5 A;  3C34 A;  3T22 A;  2ZYM A;  3KN3 A;  3DP6 A;  1B7U A;  4I8C A;  3O6I A;  4K3F A;  4I62 A;  1VDW A;  1TWY A;  3RT8 A;  3RQT A;  4YMB A;  2X7Q A;  2PT2 A;  1SW5 A;  4QXD A;  4GQO A;  4XIG Q;  1NV1 A;  5F24 A;  2PFY A;  5H8N B;  5LDZ A;  3T96 B;  1Z7N E;  4QFP A;  4O3C A;  2HAV A;  2R6G E;  4PDD A;  3TDJ A;  3OSR A;  2OBG A;  3ISP A;  3MYU A;  3T9U A;  4GLI A;  2O7I A;  3KFM A;  3LR1 A;  3G3G A;  2Z8F A;  1MQI A;  4JDF A;  2NWJ A;  1UQW A;  3NOH A;  5DEX A;  4GWW A;  3TEP A;  1ANF A;  1NV2 A;  4PFT A;  3IJO B;  3HV1 A;  3BBR A;  2F3B A;  1F9B A;  1NL5 A;  2OX3 A;  5H8F B;  3CVG A;  2QSX A;  3R6U A;  3KOS A;  5B7D A;  4XKQ A;  3E9X A;  4G68 C;  3CHG A;  1JW1 A;  3SEY A;  4OHN A;  1FPE A;  4QSE A;  2V4C A;  5A5X B;  4XF5 A;  3TTM A;  4NF0 A;  2XWK A;  2XX9 A;  2F97 A;  3B50 A;  2QVV A;  5LOM A;  4HXV A;  1BIY A;  5CM6 A;  2R8T A;  2XX8 A;  3TQW A;  2ONK E;  3FXU A;  1H3D A;  4N6P A;  5AA4 B;  4NX1 A;  5JTY B;  2VPO A;  1P1O A;  1EH3 A;  1LBX A;  4ZEB A;  1FCK A;  1MM7 A;  1A54 A;  4KHZ E;  2E0S A;  3MP1 A;  1S50 A;  1CE2 A;  3IX1 A;  5ITO A;  3TFL A;  5I5P A;  3UK4 A;  1LFI A;  2B4L A;  3MVY A;  4RK9 A;  4PAF A;  3U8Q A;  4P11 A;  2I49 A;  2Y5K A;  2Y7I A;  1M5C A;  2XD3 A;  3TZA A;  2LAO A;  5EYF A;  5J1D A;  5I58 A;  1MXX A;  4YKP A;  5F1Q A;  4OEN A;  5KCJ B;  4FOR A;  1IXH A;  1URD A;  4H45 A;  1MDP 1;  2XXK A;  4X04 A;  4PCD A;  2DP8 A;  1FBE A;  1MPC A;  3TQL A;  4OQO A;  4NWC A;  1Y3N A;  5EQA A;  5B70 A;  2UVH A;  4YB5 A;  3FJ7 A;  4YKK A;  4XKP A;  1H43 A;  5BWJ A;  4PDH A;  2NXO A;  4XKR A;  5H8H A;  3W9W A;  2PFZ A;  2Y5L A;  4R6Y A;  4F3G A;  1MRP A;  1WVJ A;  3K00 A;  4NF4 A;  4GBV A;  2F7B A;  2O6A A;  3A3U A;  5I56 B;  1MXW A;  1US5 A;  1B0H A;  2ZYO A;  5L8D A;  1N76 A;  1LCF A;  4FEB A;  4IO3 A;  1HSL A;  1NKX A;  1AIV A;  3T9X B;  1TFA A;  4QSD A;  3H3G A;  1FPL A;  1FBH A;  4U4S A;  4GWX A;  5DEX B;  3MUQ A;  4H65 A;  1B5I A;  4C1U A;  1USY E;  3SEX A;  2ABH A;  2Q88 A;  5CMK A;  1DPE A;  4EF2 A;  4R75 A;  4O3B A;  1LBY A;  3IB1 A;  1EYJ A;  4Q30 B;  3SZP A;  1LCT A;  2Q8J A;  3RTF B;  1OLA A;  1QUL A;  3K6U A;  3O6H A;  4M4G A;  4OFJ A;  4GWY A;  1MQJ A;  4Q5T A;  2ALU A;  4OYV A;  3MP6 A;  4IO7 A;  3E3K A;  1FQD A;  4OAN A;  1FTM A;  3DP8 A;  3S4U A;  4F3S A;  5FHO A;  4GFR A;  3FVK A;  1MY2 A;  3FUZ A;  3U72 A;  4ECF A;  3R26 A;  1B1X A;  3M3K A;  4PFR A;  3GYY A;  1A8E A;  5I59 A;  3IJX B;  4F39 A;  4MX6 A;  3S9E A;  3EPE A;  1DBZ A;  4TOZ A;  1LST A;  4O7I A;  1RDZ A;  4YMA A;  3TTN A;  2ZXT A;  1JVY A;  5J16 A;  3RNN A;  2D21 A;  2Z23 A;  4HE1 A;  3CFZ A;  4O8M A;  3RY3 A;  3V83 A;  4OVJ A;  5I57 B;  4P47 A;  4R72 A;  2Y7R A;  2XXT A;  1CNQ A;  3QIM A;  1PB7 A;  1QW0 A;  5ET5 A;  4PTK A;  1BTJ A;  3IL1 B;  1B5H A;  4JWO A;  1R6Z A;  1NV3 A;  2OK2 A;  4ZED A;  3ROJ A;  2P3N A;  4IR8 A; 
#chains in the Genus database with same CATH homology
 1AWB A;  2DE3 A;  1LBY A;  4MNP A;  4DI4 B;  4YIC A;  2ZZX A;  1FJ6 A;  4P56 A;  5ET7 A;  1EYJ A;  4MIJ A;  1FPJ A;  1VDW A;  4N6D A;  5EQ7 A;  5I5P A;  2CZH A;  3SZP A;  4GX6 A;  2HZK A;  1DCU A;  4MJO A;  5ET8 A;  4N6K A;  2B4L A;  1IMB A;  4XFE A;  3T1B A;  1IMA A;  2HHM A;  4N17 A;  4PAF A;  3RYD A;  4F1V A;  1NV7 A;  2Q9T A;  1IME A;  4O94 A;  4QXD A;  4PF8 A;  5EQ9 A;  3RPL A;  4NG7 A;  2Y5K A;  2FBP A;  2V3Q A;  1NV1 A;  5F24 A;  2XA5 A;  1K9Y A;  2PFY A;  4XEQ A;  3LUZ A;  4P9K A;  4N81 A;  4F19 A;  5EQ8 A;  1FJ9 A;  4GWY A;  3T0J A;  2FIE A;  1LBZ A;  5ET5 A;  3FXB A;  4NN3 A;  5J1D A;  3QMF A;  3E79 A;  5LDZ A;  2CEX A;  2QVU A;  3FBP A;  4I40 A;  1KZ8 A;  4OVQ A;  1LBV A;  1INP A;  4AS4 A;  3PTY A;  5EYG A;  4MNI A;  1FPB A;  2WX9 A;  1D9Q A;  2ZZW A;  4F1U A;  2WEF A;  1NUW A;  4OAN A;  1YZ0 A;  4MNC A;  4NAP A;  1G0H A;  2BJI A;  4GX3 A;  4PDD A;  5ESY A;  4H45 A;  5EYH A;  1FPG A;  2P3V A;  3BIG A;  3ISP A;  4MCO A;  2XXK A;  4GBW A;  2HXR A;  3MYU A;  4PE3 A;  4QBA A;  5JK4 A;  1RDY A;  2F5X A;  4PGP A;  4X04 A;  1SPI A;  4M1V A;  4PCD A;  1FPF A;  4NGU A;  4NQ8 A;  5ET6 A;  3W9V A;  2ZZV A;  1FBE A;  1IMF A;  5DW8 A;  2DVZ A;  2QVR A;  2KR0 A;  5FBP A;  4HCW A;  1FPK A;  5LTC A;  5A5L A;  4MHF A;  3MST A;  4DI3 D;  2QPQ A;  1FBP A;  1NUX A;  4H46 A;  4PFB A;  1EYK A;  4OVP A;  4PFR A;  5IZZ A;  3GYY A;  5EQA A;  1XI6 A;  1FSA A;  4I3E A;  3NOH A;  4NHB A;  1FTA A;  1NUZ A;  2FIX A;  5IZ1 A;  1BK4 A;  2OWZ A;  4X8R A;  4MEV A;  4OA4 A;  4P8B A;  1DK4 A;  4GWW A;  2Q8M A;  1JP4 A;  3HFU A;  4PBH A;  4F18 A;  4MX6 A;  3KBZ A;  1YXI A;  1NV2 A;  4PDH A;  1DBZ A;  3IFA A;  5IM2 A;  3RPL B;  1KA0 A;  4PFI A;  4N8Y A;  4HCY A;  3B8B A;  4PET A;  1FBD A;  1RDZ A;  4O7I A;  2HZL A;  3W9W A;  2F3B A;  2PFZ A;  2Y5L A;  4KXP A;  4PGN A;  1FBG A;  1G0I A;  1LEV A;  3D1R A;  5T3J A;  3E78 A;  3U65 A;  1KA1 A;  2FVZ A;  2OX3 A;  2CZI A;  4YZZ A;  1FPD A;  2MKZ A;  4PBQ A;  5J16 A;  1RDX A;  3LV0 A;  4GBV A;  4HXV A;  5I3S A;  1FBF A;  4GX4 A;  5IZ3 A;  4PF6 A;  1IMD A;  1NV6 A;  1NUY A;  3BIH A;  2GQ1 A;  3CHG A;  1NV4 A;  4HE1 A;  2HPG A;  4PAI A;  1EYI A;  3KC0 A;  4O8M A;  4GWS A;  3IFC A;  4O7M A;  1Q9D A;  2CZK A;  3KC1 A;  4PC9 A;  1FPE A;  2QFL A;  5IGA A;  4GWU A;  4PAK A;  4G61 A;  2DE4 A;  2V4C A;  2VT5 A;  4N4U A;  1FPI A;  2F3D A;  4P47 A;  2XWO A;  4JVC A;  4N15 A;  2WYP A;  4XF5 A;  1FRP A;  4JVD A;  4NF0 A;  4OVR A;  4X9T A;  1CNQ A;  1NV0 A;  4N91 A;  2DDK A;  5I7I A;  2XWK A;  4P3L A;  2XWV A;  2DE2 A;  3B50 A;  2CEY A;  4HE0 A;  1FPL A;  1LBW A;  2QVV A;  4FBP A;  1YYZ A;  1NI9 A;  2JJK A;  1FBH A;  1K9Z A;  2WBD A;  3A29 A;  2R8T A;  1FBC A;  4GWX A;  4PTK A;  4P1E A;  4GWZ A;  5CM6 A;  5IZ3 B;  2Q74 A;  4I3Y A;  4MAG A;  4JVI A;  1NV5 A;  4OVS A;  4HE2 A;  4LN5 A;  4P1L A;  2FHY A;  2KQZ A;  2PCR A;  4AS5 A;  4OVT A;  2B4M A;  4NX1 A;  4UAB A;  2L5V A;  2WBB A;  2VPO A;  2WYK A;  2XWI A;  4MMP A;  1IMC A;  4N8G A;  1LBX A;  1NV3 A;  3ROJ A;  2P3N A;  1QGX A;  4IR8 A;  2VPN A;  3EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...