2BKAA

Cc3(tip30)crystal structure
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
231
structure length
231
Chain Sequence
b'EALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAT-INTERACTING PROTEIN TIP30
molecule tags Transcription
source organism Homo sapiens
publication title Crystal Structure of Cc3 (Tip30): Implications for its Role as a Tumor Suppressor
pubmed doi rcsb
total genus 81
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bkaA00
3BTSA 1B8PA 1LA2A 4LMRA 4MO2A 4AJHA 5CPFA 5A3VA 5GZ6A 5ILOA 4JP2A 4MPDA 4GQAA 5BSEA 4PLWA 4A7PA 4X54A 4YJFA 3WOHA 4GLOA 4CM8B 1U8FO 3AY7A 3GEGA 5ICMA 5THKA 3PYLA 4KUEA 2DU8A 4OKNA 3MTJA 3NAQA 1EQ2A 2B4QA 2HMSA 2PTGA 3U4CA 3RVDA 1O8CA 1DC4A 3ZU4A 3N7UA 5EQDA 3RC7A 4AJLA 2C59A 2I6TA 3KV3O 2GZ2A 4F6LA 4IDEA 1U2DA 3QVTA 5JDIA 1MA0A 2Y0DA 4OJNA 3WJ7A 1H6BA 1TT7A 5A9TA 4IDBA 4IM7A 2CY0A 1E3LA 1U4SA 4J9UE 5J23A 4PG4A 2JKVA 3NJ4A 1PTJA 1G1AA 1CYDA 4RQUA 2R6JA 1C0KA 3F6YA 4YT8A 3A06A 1T2EA 1QV7A 2ZYDA 2EF1A 4CLDA 2VRBA 3QJ5A 2D59A 3HDYA 3L07A 2HMVA 3AI1A 5G4KA 1TXGA 8LDHA 1I2CA 4ALNA 4TVOA 1GAEO 3LSYA 4FCCA 4HNHA 4U7WA 2JCVA 1RM4A 5AQ1A 5JPIA 5TS3A 1V3VA 5JO9A 3PJEA 3ZWCA 3LLSA 5I9LA 4CQMB 3ITKA 1NBOA 2DTEA 2GN4A 2CDBA 2O23A 1O89A 2VCYA 1ENPA 3BHMA 4IIVA 4PLPA 3NEPX 1HXHA 4Y6PA 1XIVA 5C7IO 1Z7EA 4PG5A 4CMJA 5A4DA 4CQLB 3AUSA 3JQ7A 3ZGYA 5A5FA 3C7AA 4B7CA 5JW6A 3GG2A 3LC2O 5L95A 3E48A 2EWMA 1BW9B 1QRRA 4FGSA 3T7EA 3AJRA 2YHIB 2AEJA 4NHEA 4RPLA 1JVBA 5F1KA 3QV1A 4RPKA 3DTYA 5HTOA 1U5AA 3Q2IA 4Z0PA 2GNAA 3EZYA 4NJMA 1NWCA 5KJEA 4R69A 2AG8A 3PQDA 2W98A 2JD2A 2W2LD 1PU2A 4HY3A 5I8ZA 1XG5A 2OP0A 1ZEMA 2VQ3A 3GG9A 4HFJA 4CM7A 1NVGA 4XYGA 1A71A 5LC1A 1MG5A 2RH8A 3KYBA 4FDAA 1TB4A 2OHXA 1DXYA 1JN0A 1EDZA 3Q6IA 4IBOA 2IRWA 3CH6A 3HDJA 5KJ1A 4NDNE 5EINA 5EIOA 4B79A 4EBFA 4D79A 3OMLA 4EEZA 1EVYA 2Y0CA 2DFDA 4XCVA 1WPQA 3GDFA 4AVYA 3DHNA 2I67A 4DUPA 1P1FA 5TJ9A 2V6BA 4OH1A 2GPTA 3CPSA 1ORRA 5B4VA 4W7IA 3C1OA 3JYQA 5JDCA 4R9RA 1HE2A 4XQCA 1EFKA 3K96A 4O59O 2D0IA 4WEQA 4U6SA 3DOJA 4O6VA 4E5PA 1R4NB 1DJNA 3GN2A 3O38A 1Q7BA 5BSGA 1JKIA 3ZNNA 4BO0A 1YBVA 2Q99A 3VZSA 4WASA 3H2SA 3IDSA 4U8GA 3SJ7A 2QG4A 3H4VA 1WLYA 4YDRA 1H6AA 1GPJA 2UDPA 2ZIZA 1MC4A 3QVSA 5F1OA 5K6AA 4CLXA 5ITVA 3AOEC 2VUSA 1LUAA 1T4DA 1L7DA 1F8GA 2OMEA 5BSFA 3ONEA 4ZRNA 1E6WA 1LDEA 2GZ1A 4URFA 4IY1A 4NZ9A 5T8KA 4D3FA 3DB2A 4N5LA 2W2KA 3MOIA 2X22A 1D7OA 3LLVA 4WECA 3DMYA 4WJZA 1ULUA 3VZPA 2X7HA 3VOSA 2X5KO 1DPGA 2WTBA 4BL5A 4WNIA 5DDIP 3V5NA 3INGA 2YQ5A 2NNLD 4Z0HO 4KDEA 2NQ8A 4D41A 1M2WA 2Y1DA 1K2WA 4IQ8A 4D3SA 4R5HA 3GGGA 1NWHA 3FWNA 3D4PA 3HWRA 1Z75A 5B1YA 1T1RA 2R2GA 1B26A 3WGTA 1UDBA 2B4TO 3H5NA 3PHHA 5JO0A 2IZ1A 3U5TA 2CDAA 4RVGA 1HYHA 2VYNA 2RHCA 4YT4A 1Z82A 3DOCA 1RM0A 4EDFA 1HDRA 4A5OA 1PR9A 2ZCUA 3L6OO 4BGIA 4CM9A 3ETDA 4O1MA 1DIGA 2OORA 4CQLA 5A5EA 4NG5A 2P2SA 1UXHA 4E33A 1PS8A 3U49A 2LDXA 3WMXA 2HJSA 4WCFC 1DOHA 2HAEA 1GU7A 4WOJA 4QSMA 5G0SA 2GRAA 4LW8A 2Y99A 1E7MA 1BW9A 1R0LA 4KWHA 1LQTA 4Y9DA 1ADBA 1E7YA 4L74A 2Y67A 3ADOA 3QIVA 5AXDA 2Q50A 2ZTMA 3DBVO 4YPOA 1OC2A 1E5QA 1UJMA 1YDWA 5DBGA 4WPGA 4Z3KA 5IZCC 5DZSA 4E0BA 4WOKA 2V65A 1TT5B 3D5TA 3KO8A 4HX5A 2ZJ1A 4PRKA 4R1TA 4XYMA 4GX2A 4IUYA 1NQOA 4N18A 1ZK3A 3IIEA 3PHJA 4QXMA 2O4UX 2FRDA 4IINA 3AUUA 4OXYA 4ALIA 4MIYA 3SLGA 2AQHA 2WE7A 2O3JA 3H9QA 2D3TA 3WFJA 4CMEC 1I3LA 3G0OA 3D5QA 4EUEA 4XB2A 4U0KA 3W4IA 2X5OA 1B7GO 4B4VA 3AU8A 3LK7A 4ILKA 2DUWA 1IB6A 3CEAA 1E7WA 3H9JA 5A03A 2EEZA 2XAAA 4L0QA 3GUCA 4U6QA 2NU6A 2VHXA 1ISIA 1ENOA 1CWUA 4BNMA 1R66A 1E6UA 3JQ6A 1KY5A 1O9BA 2WM3A 3PZBA 4R4JA 3AOGA 3CTMA 1E3IA 4TZKA 1LDYA 2QX7A 4KUHA 3U9LA 3ZWNA 1LBEA 4RVDA 3T7CA 2OBNA 1IUKA 4UVHA 3TZ6A 5GY7A 3DBHB 3E6AA 4XQGA 5HRUA 2QQ5A 3NUGA 3ABIA 4FOOA 1HTBA 1I2BA 2ZB8A 4YAKA 1NQ5A 4DLBA 5CAEA 4P4NA 3MTGA 1GR0A 1KVQA 5KNLA 5L45A 2FPIA 3TOXA 1X15A 1RM5A 3FBTA 3FNFA 2POQX 3GN1A 4ZRMA 4BO5A 2G1UA 2C20A 1BDBA 3I83A 4JXKA 2EXXA 1EEHA 2I9PA 3L6DA 4IDCA 4KTVE 4E12A 4YXFA 1JAXA 4NPCA 3RC1A 4XZ3A 2OOSA 3LF1A 4PLTA 1KYQA 4DXHA 2DBRA 1NPTO 2C7GA 1FDWA 2QIOA 1CETA 3PZRA 1K89A 1VSUA 5AXBA 1PR3A 4CM3A 3O8QA 5B37A 1R4MA 3AY3A 3DZIA 1GEEA 3JD0A 1A9YA 2A94A 5I7SA 4DC0A 3FTPA 1XQ1A 1WMAA 2G5CA 5TGDA 4JBIA 2VHVA 4PVDA 5JCXA 1WVGA 3CE6A 1VC2A 4CUKA 1NAHA 2ZB3A 4II2A 4YYZA 4CM6A 2VRCA 4I5FA 2X9GA 1UDCA 3QE3A 3QHAA 1V35A 2GLXA 1NQAO 5A9SB 3PWKA 2X4GA 4XQEA 3ZDFA 3WGIA 1EMDA 4RLSA 4Q39A 1JA9A 3TNLA 2YYYA 3E18A 5IG2A 1PGOA 4CQMA 2H63A 4B8ZA 4DVJA 3DR3A 1PL7A 4NNJA 4ALJA 1ZEJA 4IGFA 4TWRA 1W73A 3NDRA 2WD8A 4TROA 5EMHA 1AE1A 2D5AA 1GY8A 4I08A 1R0SA 1WP4A 3I1JA 3IQDB 4OMUA 4F45A 3W1VA 3QWIA 1SNYA 2CZCA 2RH4A 1ZXBA 3FPCA 1WDLA 2C2YA 4FOSA 2HKIA 4ZQFA 1MGOA 3NRCA 1YDEA 3WBBA 3I6QA 2R00A 1PGNA 1PJBA 4GVXA 3L6EA 4GX1A 4BO8A 4E21A 1PJCA 3I9JA 4N54A 5C5IA 4UEKA 3ITDA 3E1KA 1E92A 1D8AA 3E5MA 1F0YA 3IP3A 4MP3A 2DBVO 3VH4A 2Z95A 3UGKA 4XDZA 1ONOA 4RV9A 2ZYGA 4CMCA 4YBZA 2ZYAA 1DAOA 4RPGA 2Q2WA 3PFFA 5CDYA 3CIFA 4NMHA 2BI8A 2PKQP 3JQGA 4A10A 2PA3A 2O3RA 1U5CA 2BRUA 2YZ7A 3GVHA 1HYGA 1DIBA 1PL8A 3FBGA 2ZKLA 3GEDA 3PWSA 2UAGA 4PLGA 3WS7A 4EITA 3UFXA 1VKNA 4YACA 1YB1A 4MVJM 1CERA 3RUAA 3WR5A 3WWYA 1XSEA 1NVMB 5IJZA 1XLTA 1LQUA 3E5RA 2PR2A 2V7PA 3F9IA 4Z6KA 1IZ9A 4RGBA 2NUAA 1E77A 3SX2A 2J5QA 1YOVB 1JAYA 1YJ8A 3PIDA 3RUEA 1UP7A 5KOIA 3PLRA 1T2CA 1QKIA 1HWYA 2C7VA 3W4KA 2CUKA 3UCFA 3GRKA 4I8XA 1N7HA 1UDAA 2P4HX 3DWFA 2JAPA 3F46A 2NVUA 1YVEI 5IN5A 2EKPA 4DRYA 2IDZA 3LQFA 1EZ4A 3FRJA 3OP4A 2X9VA 3OM9A 2Q4EA 2XXBA 4BUCA 5U9CA 1UAGA 4CM9D 4OIMA 1EQUA 3K92A 3MJSA 4XEHA 5K6AC 1BWSA 2VOJA 1VLLA 5I7FA 2W2LA 3KYCB 4MVJH 3CXRA 1K6JA 2BF7A 1ZH8A 4UAGA 3ZNOA 1GQ2A 5KWEA 2AE2A 1HDXA 4YJHB 1MG0A 4KQXA 3QVXA 4NIMA 4IIUA 4NBRA 1PQWA 3HDQA 3PQFA 9LDTA 2AQIA 2PGLA 1IULA 4I5GA 4RVSA 4B4UA 4EUFA 5IDWA 3I6IA 4JJGA 3VPFA 3WICA 2BHLA 4J1QA 1E1LA 3K31A 2X86A 4KWIA 5C37A 4IMRA 4DQUA 4D0SA 2Y1EA 4DQVA 4E30A 3GFGA 2BGMA 1W8DA 2GD1O 2EIHA 1HLPA 1T2DA 3UCXA 4IXWA 2GUGA 3P2OA 4LSWA 3IJPA 1ADFA 2I3AA 3OJOA 3UVEA 4NU5A 1RJWA 3G1UA 4YB8A 1MFPA 4WNCA 1PQUA 5HS6A 2AMFA 3H8VA 4M55A 5TQVA 3ROKA 1HSZA 2EJVA 2ZTVA 4EZBA 1B3RA 5F3RA 4GL4A 1TT5A 3WFIA 3GC6A 2JD1A 2YFHA 4BNTA 2DC1A 3INTA 1B16A 1XU7A 4RVHA 2FSSA 1P33A 1JDJA 3W6UA 3PHGA 3VZRA 1RYEA 4A26A 3UICA 4XDYA 2YHIA 1HDZA 3EHEA 3ICCA 2JHGA 1X1TA 4BKUA 3A4VA 4J4HA 5JY6A 1NR1A 3WYBA 4QECA 3I9LA 2X8LA 3U09A 3DDNA 4UVIA 4MIEA 4P4LA 2AW5A 3WWZA 1I24A 1T26A 1WZIA 4I1IA 5JLAA 2WSBA 5TIIA 4TVBA 2VWQA 4IPTA 2CD9A 4MP8A 1ID1A 1EUZA 2Q45A 3QWHA 5FFFA 4CR6A 2YQ4A 4YT5A 1SC6A 3RBXA 3GHYA 5AXAA 1Z45A 2IEBA 2O3TA 1C14A 4MINA 2NU9A 1LU9A 6LDHA 3ZV3A 4ZU3A 4E6PA 2DT5A 3RUHA 2YHUA 3KYCA 1MX3A 3HQ4O 2PNFA 2DKNA 2EKLA 2OXIA 3PVZA 2IXAA 1LRKA 3R3SA 3TZHA 2O3SA 1C0IA 4K1LA 1Y8RB 1EVJA 4B4OA 3GPIA 4BO6A 5U1PA 1QYDA 2CDCA 1GUZA 2DTDA 2ZB4A 4QO7A 2PZKA 3O4RA 2DTXA 2WYWA 4NBTA 3BMCA 4WGGA 3FR8A 3W8EA 2PK3A 4PVCA 1AXGA 2C29D 3OECA 2D2IA 4CMKA 2O3UA 3PJFA 2NWQA 3I3OA 4XIYA 1Y9AA 5TRTA 5GZ1A 1E3EA 4MDHA 1N2SA 3IMFA 1I36A 2DQ4A 4PG6A 2QRKA 3I4FA 1VJTA 2IZ0A 2WDZA 5DBFA 4BO9A 2LDBA 3DEYX 1EE9A 4BNUA 3QLJA 1T2AA 3PHLA 4ITUA 4CLRA 5JE8A 2PZMA 4G81A 1MV8A 3C24A 4YJFB 5KVSA 4D44A 4TRJA 4K9DA 4CLRB 1F12A 2W90A 2BFOA 5U4QA 2X0IA 1HLDA 2J3HA 1W0CA 3Q1LA 1VL6A 4AJJA 3WGOA 1SOWA 5EESA 3RFVA 5B4TA 1U3UA 1IY8A 4F46A 1NNUA 1O95A 2CSUA 3EDMA 3H7AA 1DFIA 4M87A 1H0KA 3D64A 3SXPA 3NGXA 5I8WA 3CSDA 4ND3A 5KKCA 3E9NA 4BS9A 4Q3DA 4XD2A 4D46A 2EGGA 1X13A 3B1FA 4XYLA 4DLLA 4O5OA 1H94A 4RZIA 5HWSA 1UXJA 4DMMA 3GUYA 5CFZA 4QEDA 4DREA 4PLZA 1DLIA 1CIVA 4LRTB 1KETA 3PJDA 4TKLA 1I3KA 5JNLA 1PZFA 1MC5A 4ND4A 3DMTA 1U7HA 5LDGA 5IXYA 1A4UA 3M2PA 3EUWA 5T8KC 3JYPA 4IZIA 4AJPA 4Y67A 2CNBA 3ZHBA 3RKUA 4ZVVA 5T6BA 3ENNA 1FDVA 3GVCA 3F5SA 1PS0A 1I32A 2PWZA 4GAEA 4M1QA 4XQ9A 4U5QA 3A1NA 1WZEA 5BR7A 1WXDA 3H3FA 3JD3A 4KUGA 4K6FA 1ONNA 2CVOA 5F1PA 1GCUA 4YT2A 3WX0A 1K6XA 3EYWA 2XXJA 4QO8A 2VZ8A 3JSAA 1GFSA 1D1SA 4FFMA 1SEVA 4O0LA 1E0DA 5DN9A 4E4YA 4FFPA 4R41A 3I9NA 1QLHA 1VL0A 3KLPX 4MVJP 5TF4A 1ZZEA 3IJRA 5TSDA 5DULA 1DRWA 2JCXA 5TT0A 5JC1A 2VRCD 1I3NA 1A5ZA 3QQPA 2F00A 1NYTA 3R3JA 1VSVA 1LSJA 1UXKA 5K0ZA 3G3EA 4J7XA 5G0VA 3H5AA 5JMPA 2B5WA 3FI9A 3MJVA 4JK3A 2D5CA 4QQRA 3ZWWA 1IYZA 3U62A 4JJFA 2DPGA 2IXBA 1YQGA 3PLNA 4R54A 5ER6A 1LNQA 1LLCA 3SEFA 5CDGA 3KBOA 1DC6A 5I7VA 3V2GA 3OJLA 1NM5A 3KHUA 4BNZA 1ZK2A 2QW8A 4D7AA 1CEQA 4EGFA 3S2FA 1EDOA 3MWEB 3EAGA 3NTQA 4EUHA 5A9RA 4MVJI 5HM8A 1OOEA 3PDJA 2CFCA 4BB6A 3PWZA 2DLDA 1H2HA 3GDGA 1NP3A 2HSDA 4OAQA 1YL7A 3ZN2A 1WDMA 1H5QA 1GPDG 4ONEA 5IZCA 4K26A 3ZWPA 2VYND 4J91A 4CM4B 4PLCA 1GZ6A 1NVTA 2Z5LA 4NH4A 4XIJA 2P9GA 1LC3A 2PY6A 3K2BA 5JYDA 5C3MA 2P4QA 1I33A 1NFFA 1Y8QA 4ZGWA 2HUNA 5F21A 2FP4A 3RI3A 1PJSA 4JJIA 5JAIA 4Q3CA 3HSKA 5JFOA 4WLOA 2QYSA 3GZNA 1EK5A 2X0RA 4WLUA 3QRWA 1MXFA 1V8BA 2YV2A 3U4HA 4RJTA 4BKRA 4J90A 1FDTA 2IYPA 3KB6A 2E37A 3E9QA 3JQAB 1MB4A 2C0CA 3RBZA 2ZK7A 4B7XA 3ZI0A 5HBRA 5IDXA 3ANNA 4PN3A 7ADHA 3SLKA 1PJ2A 1U3WA 4WLVA 3RAJA 3E8XA 1ZJYA 5IXSA 3ONFA 5BNTA 4J2OA 3VVCA 4W4TA 1BXGB 4LCEA 4TRRA 1PEDA 2VHZA 1ZK4A 4FS3A 4GGOA 1EUCA 4DPLA 3W8DA 3RUFA 2PZLA 4TRNA 2VTDA 1V3UA 1Z73A 2O7QA 2GF2A 4PZEA 3BMNA 3KEOA 1KVSA 4FJ0A 3ZV5A 2G17A 3L9WA 4CM4A 2WD7A 3D4OA 4D3DA 3V1YA 1ZO8A 4KP7A 4BHTA 1HZJA 1JKFA 3OFSA 4IQ0A 5JCJD 3F3SA 4BO1A 5DBIA 1LSSA 3DFUA 4L73A 1BVRA 3ROPA 3I9OA 1LDNA 4WK6A 1PZHA 3HB5X 5TJHA 4D42A 2C5EA 5KIAA 1EVZA 3KVOA 1SMKA 3HADA 1SOVA 2I66A 4DIBA 3OIDA 1SB9A 1WNTA 3DOOA 3QVOA 4TKMA 2GYYA 1GQQA 1LSOA 1DLJA 3MZ0A 4BNNA 1NASA 1Q1NA 4IDDA 4CV1A 3DZGA 1B0AA 1Y5RA 3H6KA 3W6ZA 4BB5A 2Q2QA 2DM6A 2JFHA 3K6JA 2YJZA 4AJEA 1FMCA 5TT1A 2FR1A 3D3WA 1NPYA 3GVXA 1V3TA 1VL8A 1YWGO 2OO5A 3IOYA 4K28A 2VWPA 3X2FA 1A7KA 3L4BA 1KEWA 3FF4A 4JROA 2VOEA 3ASVA 2YV3A 1MXHA 2C54A 2JD0A 4OQYA 4R3WA 3NTRA 4CMIB 3BA1A 3ZHXA 3O26A 4L4RA 3EY4A 3INRA 5JAMA 3DHYA 3H2ZA 2Q3EA 3HN7A 3JQ7B 3KZVA 4FQ8A 4B7UA 1GZ3A 1SCUA 3SC4A 1YL6A 4DIFA 1FDSA 2HRZA 4CQMD 4CV0A 3ENKA 1OI7A 4QT0A 2EW8A 3HJAA 4RF2A 4LN1A 3DBLB 2PZJA 3PEFA 2BFMA 5A3JA 3RIHA 3BMOA 1P31A 4EJ0A 5TLSA 5DOZA 4DGSA 4YRBA 2NTNA 3LF2A 1LDMA 4F3YA 3UF0A 4WLNA 5L9AA 4E32A 4FFRA 3JQAA 1EE2A 4JIGA 3UCEA 2TMDA 2A9FA 4M49A 1PS9A 3GMSA 5DNAA 1HE3A 2H1SA 1PGQA 1C1XB 2AEMA 3ZHYA 1H6CA 3N58A 3U0BA 3WYCA 4AJ4A 1GD1O 3BXXA 2GZ3A 1I2ZA 4BNKA 2B36A 1GEGA 4R1SA 3FHLA 4MVJG 3AFMA 2X5JO 1PIWA 3H3JA 1J4AA 1Q7CA 4XRRA 2VZ0A 1GZ4A 3KYDB 4JBGA 1A72A 2UVDA 2FZWA 4L4XA 4MIOA 1DFGA 3VC7A 5JSFA 4I5EA 1Y6JA 3COSA 2PGDA 2HJRA 1DO8A 3NTOA 4XA8A 5CEFA 2RHRA 1UP4A 2IYOA 1YE3A 3HB4X 5L4LA 5BNFA 2NLOA 5JXWA 2CF5A 2EW2A 3JQ9A 2Y1CA 2AHRA 1P0CA 3RD5A 5FI5A 3R6DA 3RU9A 2DFVA 4M8SA 5ENVA 4XX0A 4E3ZA 1N9GA 3FNHA 4D43A 1WW8A 4U0JA 3RJ9A 3RCBA 4M86A 4L9RA 4CPDA 5JAZA 5G2OA 2AQKA 4JCOA 2BELA 3GAFA 3DBRB 3OH8A 1G6KA 5TX7A 4LGVA 5KVCA 2VUTA 4CL8A 4D0RA 4Y6SA 3CZMA 2P91A 2W2KB 1K6IA 3RC2A 1Q2XA 4IJKA 3C3XA 5AVOA 1KVRA 1KBZA 3OJ0A 2B4RO 3ZU3A 1JKJA 3O03A 4RVUA 2YFQA 2O2SA 4IQGA 3PI7A 3P7MA 2PKRA 1H9BA 4E31A 3ONDA 1GYRA 1M6WA 4J49A 4CLOB 3MJCA 3ZV4A 1C1DB 2I5PO 3ON5A 3KTDA 1P0FA 4OYRA 1V9LA 1B3BA 4CMIA 3TZCA 3LVFO 5A1TA 2PH3A 5DCYA 1R37A 3AWDA 4YTEA 1DIHA 3FNGA 4H16A 3D1LA 3N74A 3MOGA 3NJ8A 1TI7A 4YJGA 2Y66A 3D3EA 4IJUA 3TJRA 1E7RA 3D0OA 2Q2VA 5ADHA 4CMBA 5DCUA 4CM1A 1MLDA 4IS3A 4PLYA 3K73O 2H5LA 4BO4A 3IKTA 2WYUA 3M6IA 4UUNA 3NDJA 4BKQA 5CDSA 2E48A 1GUFA 5DOVA 3Q3CA 4WLFA 4CUJA 4ZQHA 2QZZA 2ZTLA 3ZNQA 2UUPA 3B1JA 2OFPA 3I9MA 3F1KA 1J0XO 1C1DA 4KMSA 2B83A 4IZHA 1QYXA 3DAPA 4GLLA 4IJVA 2GR9A 3B20A 4IGEA 3AK4A 3W4JA 1XA0A 4YRDA 2PLAA 4TMFA 1ZSYA 3WQRA 4J7UA 1JLLA 4A03A 2VYVD 1CQIA 3JQBA 4RCVA 1PJ3A 3ETEA 4RF5A 2BGKA 4CM8A 4XYBA 4YAJA 1BTOA 4E2XA 4HV4A 1KY4A 5BSHA 4PCVA 2BGLA 3EW7A 5LDHA 3IS3A 1YQXA 4W82A 5KCZA 2X0JA 3F4LA 1DDOA 1HF3A 4OOEA 3IUPA 4MVJD 2IZZA 3WYEA 4AICA 3QP9A 3IUSA 1UAYA 3GH3A 1TEHA 2YDYA 3WGQA 1OAAA 3GQVA 4QFDA 4R3NA 4AJ1A 1LLUA 3ICPA 4P8RA 3ZW9A 2W4QA 4ROSA 4DQXA 1LJ8A 4S3MA 1CRWG 2O3QA 4YVFA 4RO0A 1VM6A 4Q3AA 3BMQB 2CF6A 3AM4A 3DO5A 1AUPA 4PGFA 2BFPA 1QORA 4RPJA 3TZKA 2ZJ0A 2W8ZA 3BMQA 3DZJA 3ORFA 4ZQBA 1A27A 4E13A 3EMKA 4J1TA 1GADO 3OEYA 4GH5A 3I52A 4YJDA 3TQHA 1N92A 4YAEA 4PRLA 1OZAA 3QWBA 2QRLA 4HFMA 1PJLA 2D4AA 3LC1O 3WLFA 1HE4A 3P5SA 2JCYA 3FCOA 3T4EA 1PZEA 4J2HA 4DYDA 3BYZA 4R1UA 5IDYA 3UW3A 4BNYA 1FF9A 2P5YA 4BQPA 4CUZA 1X7DA 1YBAA 2NM0A 4Q3EA 4Y8VA 2GDZA 3QWAA 4LCJA 5DF1A 1QSGA 4B8WA 5I9NA 5CPBA 3WG9A 4ZICA 5L3ZA 1VPDA 1JTVA 2WE8A 3OBBA 4A27A 1C0LA 1GDHA 2Q1TA 4YR9A 5BQFA 1ZSVA 4RPHA 5FYDA 3WNVA 1T1SA 2AE1A 4H7PA 1ZK0A 1QP8A 1X1EA 3SJUA 3DBLA 3NT4A 4MP6A 3LT2A 3TSCA 3S2EA 1NXQA 1ZW1A 1PQPA 4H15A 3UOGA 1E7QA 2JJYA 4HWKA 1B14A 3MEQA 1FXSA 5KJ6A 3ASUA 3OHSX 5EQFA 4GKVA 2FPGA 4R1NA 2C2XA 4Z9YA 1A4IA 1QLJA 1HE5A 3ANMA 4N5MA 3V2UA 4BMVA 1P3DA 3KUXA 3HZZA 5EERA 4L4SA 3DAFA 3DTTA 2UYYA 2Y0EA 1UZMA 1NFQA 4IJWA 1E3SA 1EBFA 1P74A 3TFOA 4EEXA 4FB5A 2HDHA 2CVQA 3FSRA 3LT0A 4CR7A 3ZHZA 3DMTC 4J7CA 4LVUA 3SBOA 1KC3A 3TL3A 1PL6A 1E6EA 3NT2A 5AXCA 5A05A 1IHXA 4QUKA 2P5UA 4JNKA 1UZLA 1XHLA 4E2ZA 3UHAA 1CQJA 1XQ6A 3FR7A 5THQA 2YV1A 1EBUA 4ND2A 4BKPA 3HHPA 4D45A 1U1IA 5CDTA 4GKBA 3STHA 4CMAA 1PZGA 3ZNPA 4MJLA 1CJCA 1YH3A 1Q0HA 2NVBA 3SVTA 1K5HA 2V6FA 5H82A 4E5YA 1DRVA 3DZBA 1XU9A 4AJOA 5ICSA 1YGYA 1P45A 4Y6RA 4A2CA 6ADHA 2Y1GA 4OSPA 3M1AA 3WNQA 4BNJA 4YQYA 1NFRA 4PLFA 3RFXA 2D8AA 2P9EA 2NVUB 3DZFA 4NJOA 1I5RA 1VRWA 3Q2KA 5IN4A 3K2EA 4AJ2A 5JYEA 3LT4A 2GGSA 3GAZA 2VYVA 1IL0A 1X7GA 2Q49A 1GUYA 3GNQA 5KJCA 1FK8A 2AA3A 4MOWA 5ES3A 1YB5A 2O48X 4NQZA 4BNGA 4J0EA 1FJHA 4J9VA 4A73A 5CEEA 3Q0EA 1LEHA 2I99A 5DCWA 1DJQA 4XKJA 3TOZA 1J6UA 4BMSA 4C7JA 3UXYA 1LLQA 2DPHA 4ZQGA 3NYWA 5L4NA 3RUIA 5KVVA 5DT9A 5G0UA 3JTMA 3GNSA 4W6ZA 2GO1A 2HMWA 4AJIA 1BDMA 3KEQA 5JY1A 3H65A 4WCFB 2G82A 3AFNA 3BAZA 3RJ5A 1UUFA 1QYVA 4FPXA 1BXKA 4H3VA 4HKTA 1HT0A 4TQGA 7MDHA 1MUUA 4DPMA 4MKRA 5I9MA 4MVJE 1C3VA 3AM3A 3PPIA 1VI2A 1Y5MA 4J4TA 3QW2A 3HN2A 1OMOA 1P77A 3KXDA 1BG6A 5B12A 2FR8A 3F5QA 2J5KA 3VKUA 2OP1A 2NU7A 1KEVA 1C0PA 4S1VA 3WXBA 1P44A 4OGWA 1Y9EA 1YRLA 2C5AA 1O5IA 3JQCA 3TN7A 3WQQA 3OETA 4BV8A 3NKLA 4J1SA 4CV3A 1NHWA 3RQSA 1BSVA 1PJ4A 1LRJA 1ZBQA 3DZHA 3H9EO 3H9GA 3JYNA 3JYOA 4CL3A 2DBQA 2ZB7A 2NSDA 1XGKA 5B4UA 2EV9A 3DQPA 2E4AA 1TLTA 4JBHA 3GK3A 2A4KA 3WGGA 1KVUA 2DUUA 1PSDA 1S6YA 1H6DA 3C8MA 1GV1A 4HP8A 1N1GA 4KZPA 3BZUA 4IDAA 4UULA 3ZWAA 1E7SA 1NX6A 5GMOA 1P1JA 3OIFA 4YEDA 1ENZA 3WSVA 4CLOA 1CDOA 1QMGA 2J3IA 4R5MA 3GZ4A 1LSUA 4K6CA 5T5QA 3UN1A 3WBFA 2NADA 1PJQA 1HDGO 2FN7A 3O9ZA 3VH2A 1GTMA 3K30A 4J43A 1ZVMA 3TZQA 4CLEA 2XOXA 5CDUA 3D3WB 4RZHA 3HFGA 1SBYA 4EI2A 4DLAA 3NT5A 3OICA 3HFSA 2IE0A 2FY8A 4CMHA 1MFZA 1BMDA 2GERA 4Q3BA 5JC8A 3KSZO 4NBUA 3IKVA 5I7EA 4G5HA 5AOVA 4UVDA 3W8FA 3Q9UA 4G2NA 1DBVO 3H9UA 4Q3NA 4B4WA 4A0SA 3KETA 4AG3A 5JMWA 2JFGA 2NACA 2O4CA 1KVTA 3PHIA 3OIGA 4XJTA 5L4SA 3TDKA 5COBA 5CHEA 5G4KB 1KS9A 1MP0A 4I9UA 4JP3A 4XRGA 1YKFA 4NI5A 3C1AA 4FFLA 4YAIA 3WTCA 4WKGA 1NHGA 3L4BC 3S8MA 4NK5A 2BD0A 4BOYA 4UUPA 4BNLA 1HRDA 2I3GA 1TA4A 3DBHA 4L8VA 1WMBA 2VWGA 3CKYA 4IMPA 5TNXA 2O50A 1I8TA 4OQZA 1VJ0A 3NGLA 4IDFA 3PP8A 5L51A 2Y05A 2B5VA 4BO3A 2VT2A 2NTJA 1HDOA 1IOLA 5KVQA 3ZWVA 2YW9A 1J49A 3WMWA 4GSKA 1LRLA 1YOVA 3TFQA 3VTZA 2HK7A 1BHSA 4MKZA 3EGOA 4N5NA 1BXGA 3ZWOA 3AUAA 4PG8A 1ZFNA 4IS2A 1ISFA 4NBWA 1QR6A 1IPEA 3JD4A 3BTOA 1YQDA 4E5MA 2Y1OA 1O6ZA 1RPNA 2FWMX 1H2BA 1I01A 1RM3A 5EN4A 2NTVA 3JCZA 1DRUA 2E6UX 3MWDB 4RL6A 3RROA 2PGJA 2J6IA 4M54A 5LCXA 3UUWA 2GSDA 3GA0A 2WEKA 1HEUA 3BHJA 3IAHA 3KLMX 2O7SA 1LC0A 5KJFA 3VPGA 4RF3A 3TWOA 4HBGA 3OQBA 3WGYA 1NTOA 1ADGA 3HNPA 2ZATA 4W99A 4YWJA 3NX4A 3PYMA 3KM0A 2Y68A 1HL3A 1O94A 1YO6A 3JD1A 2WMDA 1Y8RA 1F06A 2HQ1A 2PD6A 3LZ6A 3S2GA 3X2EA 3ETGA 1C1XA 3RFTA 4BGUA 2Q1UA 4N7RA 1SAYA 4FN4A 4CMGA 2BI7A 4MVJF 4FC6A 2Q46A 2VT3A 3JD2A 4ZA2A 3JQ9C 3QY9A 2VUUA 3ANLA 5IFLA 4NFYA 3WGHA 1E5LA 1PWZA 4P22A 4ZQEA 3L0DA 5ITWA 4ND1A 1SO8A 1ZK1A 5JCJA 1N1EA 4PG7A 1ZMOA 1UXIA 3ROQA 2HMUA 3ROMA 3RUDA 3DC2A 3ZCXA 1B2LA 1U9JA 2Z1MA 1JWAB 2NVWA 3PDUA 2ZQYA 1DIRA 4TZTA 1ISHA 2RCYA 4OM8A 4W9NC 1N5DA 1ADCA 2B69A 2PFGA 3CZRA 4BNHA 2NV6A 1E1MA 4GBJA 3PRJA 3ZWYA 1F17A 3HDHA 4W7HA 2ZQZA 1I3MA 4WLEA 3NDIA 1JU9A 4RDHA 1SZJG 3D4NA 5BT9A 5MDHA 2NQTA 4BO7A 5C7OO 2EP5A 2GCGA 3GY0A 3C1TA 1DEHA 5FWNA 5G0TA 3A28A 1AN9A 2UV8A 3ZV6A 3IL2A 3KOUA 3VDQA 1YONA 3KSDO 3JQFA 4AJKA 3FD8A 3L77A 1V0JA 1IPFA 3LYLA 2OZPA 3QWFA 4AL4A 3DHEA 1AXEA 1B15A 1HETA 2ET6A 3BTUA 4EYEA 3ZU5A 4MVJA 2OBYA 1NR7A 4J16A 3CMMA 2EGHA 2Z1NA 3WIDA 2RBEA 3UKOA 1Z6ZA 4BQRA 2J3JA 5L7WA 2QYTA 3WSWA 4F6CA 2FPPA 1ARZA 1R16A 1E1NA 4GPD1 3RUCA 2WWRA 4OOFA 4GSLA 5JDIC 1BVUA 4R51A 4ND5A 5DP2A 3LDHA 4BIIA 4YRAA 1OBFO 5KTKA 3K9QO 2SCUA 5COQA 4E5NA 3GF4A 2OL4A 1NAIA 2Y1FA 1H9AA 2A35A 3I9KA 1XYGA 3CINA 2WYVA 4ALKA 3A9WA 5EPOA 3JQDA 1JVSA 1AHIA 3EK2A 4R68A 5A02A 1LTHR 1G0OA 4DBVO 3ST7A 3JQBC 2P68A 4AFNA 4WCDA 1T24A 3JYLA 2VWHA 4BVAA 1KOLA 4PZCA 4FIZA 3GOHA 2VN8A 5T64A 3BIOA 3OSUA 1Z7BA 2JHFA 1ZKMA 4UUOA 3TRIA 2VNAA 1IHYA 4I9NA 4NR0A 4MKXA 2X0NA 1BXZA 1I0ZA 3ZU2A 1N9GB 2X9NA 5A04A 1U3TA 1VE9A 3F4BA 3WTBA 3DFZA 3MJTA 3G49A 3RC9A 1JQBA 5JAQA 4HNGA 1YS4A 4RDIA 1X0VA 4GWGA 3ZZNA 2EJWA 1ISMA 3G17A 4NFHA 4RF4A 5IZ4A 2X23A 1W4ZA 1U7TA 3PIIA 4B3IA 4BNWA 3L9XA 2X6TA 4FC7A 1SB8A 3SC6A 1D1TA 1DC5A 4LISA 3UH1A 1Q0LA 3VH3A 2HK9A 4YQZA 1GQYA 4QTZA 4YA6A 4BGVA 1Y8QB 1P1IA 4B3JA 1DIAA 8ADHA 4CV2A 1ZSNA 2HCTA 2AEFA 1XKQA 4P4GA 2FSVA 1GYQA 4XB1A 3OEWA 1JW9B 2QZ9A 3S2IA 4KDFA 4EJ6A 1VJ1A 1D4FA 1T4BA 1ULSA 2BH9A 5L53A 2I65A 3ZH2A 5BNIA 3GDOA 4OHUA 3AM5A 1H93A 2EHDA 5JDCC 4BNVA 4J1NA 4R16A 4BMNA 4E2WA 3U4DA 3BMOB 3MJEA 2B35A 3DONA 4GX0A 4NBVA 2WD7B 4BNIA 1KERA 3BMNB 3C85A 3NV9A 1EVIA 3KSUA 3CMCO 1PGJA 4B3HA 1YL5A 2VHYA 3EVNA 3JQEA 5T67A 1AHHA 3WGZA 3AOEA 3DAGA 5EL0A 1YJQA 3K5PA 4NJMB 5TC4A 3VH1A 2HLPA 4TSKA 4FJ1A 1KEUA 2OGUA 1NPDA 3E03A 1UZNA 2FOIA 3S1LA 1DAPA 2XPCA 1WWKA 4IDGA 2UUOA 3GEMA 3BHIA 3RWBA 4FW8A 2C82A 1G0NA 1Y1PA 1HDCA 3V1TC 1HZZA 5MGBA 4UEJA 2F1KA 1DHTA 1U3VA 1DC3A 3JV7A 2C07A 2E82A 1HYEA 4O63O 4OXKA 3P2YA 3WQSB 4FBGA 1EK6A 4GX5A 4OL9A 4XGIA 1E3WA 3PK0A 3VTFA 2Q1SA 4YJHA 3V2HA 4LSMA 1N7GA 3GFBA 5IF3A 4WEOA 5G4LA 1L1FA 4R9SA 2D1YA 3OF2A 3F1LA 1D3AA 4HXYA 4WUVA 4C7KA 2QHXA 2Y93A 3QA9A 1WDKA 4HFRA 4Z3DA 1PJTA 3S55A 1R6DA 3B1KA 5ER9A 4ALMA 3TF5A 2H6EA 1XCBA 2WJPA 4LVCA 3EVTA 4BO2A 3PJGA 4HFNA 5C7LO 3A14A 3OJEA 1M75A 4UVEA 3KYDA 3TL2A 4PLHA 4CJXA 3DL2A 2G76A 5JBIA 3GHHA 2IEDA 4YCAA 1IZ0A 5ENDA 1ENYA 1B8UA 1ZUD1 3D7LA 3FWZA 4ALLA 4ZN6A 2DAPA 3I23A 2A92A 4G65A 4UREA 4WCFA 4CLHA 2I76A 3LU1A 3EZLA 3M2TA 4RQTA 3OA2A 4I5DA 3IC5A 4OO3A 3VZQA 2O2YA 3C7DB 4Z9XA 3E82A 3FTNA 2VTEA 2ZTUA 4LMPA 4UVGA 1KEPA 2BKAA 4DIOA 3PQEA 2CMDA 5CEJA 4XR9A 3VPXA 1P1RA 3WJAA 1DHRA 4P38A 4GGPA 1QV6A 3UAGA 2B37A 1NQTA 4NK4A 1FDUA 3CUKA 3VAZA 3I5MA 1TVEA 3PYXA 3Q9NA 1XEAA 4J4BA 5COAA 1DSSG 1Y7TA 2FZEA 1QYCA 2Q1WA 3DZKA 5DP1A 4J0FA 4XGNA 4WE3A 1ZXLA 4CMEA 4DC1A 4JQCA 1HSOA 4J3FA 4HUJA 1T2FA 1PX0A 2FR0A 2BMAA 4L76A 2VHWA 3HG7A 3R0IA 3O8QB 1M76A 2JFFA 4JGBA 3AUTA 2G0TA 3B6ZA 2FMUA 4GVLA 4Q9NA 4XJSA 4DYVA 4I9HA 3GVPA 1M67A 2X1HA 3GMDA 4XWYA 1W6UA 2IODA 1DB3A 1CF2O 4ESOA 4OXNA 3RASA 2J8ZA 3JQAD 3WLEA 3R1IA 2OUIA 2V6GA 3GR6A 2HO5A 1LX6A 2PKQO 3OJFA 2Q4BA 4FSHA 1UXGA 1HDYA 4INAA 2HK8A 2HMTA 5G0WA 3DXFA 4RORA 3RU7A 1UR5A 1O0SA 1LLDA 3AY6A 2XF8A 4GI2A 3OQ6A 1ZJZA 2DBZA 4R01A 1XWFA 2GN8A 4DWVA 3JQ8B 5T57A 1PWXA 1GV0A 3U3XA 1Q0QA 4LRSB 4JLWA 4YAGA 1GYPA 9LDBA 1A9ZA 1LDGA 1X14A 1YXMA 2J3KA 1SPXA 4FD3A 4GMFA 5EJ2A 1R4MB 3AI2A 4FR5A 1V6AA 4OKIA 5ILGA 4DTIA 3T4XA 5CP8A 4BNFA 1LDBA 1X0XA 4DL9A 4ZJUA 3M1LA 1F8FA 3WDSA 1K3TA 1P1HA 1UP6A 4QFCA 1P1KA 3EC7A 3GT0A 1QG6A 5H83A 1XDWA 3VHRA 5GZ3A 3MJ4A 3ZWBA 2YDXA 1RYDA 4EJMA 2E49A 1HKUA 3ZW8A 4JX8A 1M6HA 4DPKA 5F5NA 2JL1A 5L7YA 1ML3A 3PGJA 3RKRA 1EUDA 1R12A 4FJ2A 1U4OA 4BV9A 1J5PA 4GWKA 3BMCB 1RWBA 3C7CB 3RSHA 1KC1A 1LI4A 3ULKA 1BGVA 4PZDA 5L7TA 4ZHSA 1YB4A 1E1KA 1WAMA 4QX6A 2JAHA 3DBRA 3JQGB 2HRBA 2PV7A 3PGXA 3FNEA 2RAFA 4CODB 4NFSA 2ILTA 1K0UA 3LT1A 3GNTA 4IXTA 2AQ8A 1YBMA 3GZNB 4RLHA 2NU8A 2TMGA 1QYWA 1AGNA 5FI3A 1BRMA 2RIRA 4PFJA 5IAAA 2EP7A 2AG5A 1VKOA 2V6MA 3HE3A 4C4OA 2HU2A 3LC7O 1E3WB 1M66A 1QXSA 3AI3A 1R4NA 2PH5A 1R0KA 2X58A 5IDQA 2QRJA 1Q7GA 3GGPA 1ISGA 2PD3A 3JQ8A 4Z0TA 2YY7A 3FN4A 3OA0A 3OQ1A 4Z9FA 3KRTA 1OC4A 4FGWA 4UEOA 1ISJA 4DA9A 1Y81A 2GASA 3G79A 3VKVA 4AJNA 4CR8A 3WB9A 3QSGA 3MCVA 3GVIA 4KQWA 3GGOA 4PLVA 1GL3A 3VPHA 4RVFA 1E3JA 2R00C 3VDRA 2BFAA 2BLLA 3PFWO 3VPSA 3RBVA 1B8VA 5HS4A 3GPDG 2CVZA 3VVBA 3V1UA 4E2YA 4KOAA 3GRPA 1DFHA 1L7EA 3B70A 4M89A 4II3A 1ZIDA 1EFLA 1A7AA 3G1TA 5AYVA 5CG1A 1S7CA 4ID9A 1GCOA 4LK3A 1ZCJA 3U4IA 5HA5A 1I10A 4BKOA 5A06A 4HADA 1ZMTA 4UUMA 4L75A 3ZWXA 1ONPA 3H5RA 3K8ZA 1OFGA 4GMGA 5JS6A 2GN9A 4KTTE 1U2GA 1UH5A 4DMLA 1XR3A 1KIFA 5F5LA 3V8BA 1JWBB 3ZWMA 3PTZA 4XR4A 4EW6A 3P19A 1PGPA 3E9MA 4NU6A 4YJGB 4DBZA 5CG2A 5K9ZA 3F47A 1I30A 3TPCA 3IP1A 1R15A 4J6FA 2GN6A 1IE3A 5FEUA 4BGEA 5FF9A 4XGKA 1U8XX 4W9NA 5A9SA 1P9LA 1F14A 3ADPA 1LXCA 2J5RA 3FPLA 5L40A 4CM5A 1Z74A 4TRMA 3HUDA 4XYEA 3AW9A 3GLQA 1T25A 2AXQA 3L4SO 1ZNQO 3AU9A 2FHSA 2VZ9A 1U28A 4OSOA 4FFOA 4JN6B 5H81A 3WIEA 2YUTA 2EG9A 2H9IA 3PXXA 1SEPA 4Y98A 4BNXA 1X7HA 2EERA 1RKXA 2B0JA 2ZCVA 3Q11A 4PIVA 2PD4A 2DVMA 4E5KA 4ZD6A 2EKQA 2P9CA 1XELA 2VNSA 3BTVA 3JQFC 5KKAA 3QVWA 4FFNA 1N8KA 3I4CA
chains in the Genus database with same CATH superfamily
4LEIA 1B8PA 2FGJA 5A3VA 4QJ5A 1L5MA 1GUBA 1FDIA 1ODLA 4GQAA 4MPDA 5BSEA 2XSZD 2O8BB 4A7PA 3RIYA 5AW8A 2AKYA 1SHKA 3A4YA 4A3SA 3WOHA 3FKJA 4Q7JB 1VYHA 5KPDA 5LMZA 1RJDA 1N2ZA 2IQIA 2DU8A 3BILA 5GM2A 3LZCA 3NAQA 2PTGA 3ZXIA 4JENA 1ZGGA 2H8GA 3VU0A 4KXUA 821PA 3S8YA 1NA5A 4HYTA 3RVDA 4LVOA 2CV1A 3SSAA 4RQBA 3H2KA 1XPRA 2CVFA 1UBUS 5SV2A 4O08A 1RQPA 4IDEA 5J43A 2Y0DA 2FGKA 3WJ7A 3IKMB 4K6KA 3B1YA 3G13A 1C7FA 4MULA 3D3NA 1H3NA 4IDBA 5DVZA 1TCCA 2B6NA 1U4SA 5J23A 2FMFA 5DNEA 3ZQUA 2FZ5A 2ON6A 1BWRA 2HIMA 3IJ5A 4JUBA 1W44A 3DC7A 4QDXA 5JRZA 2O52A 2BM8A 2JKVA 1CB0A 3C87A 2I3BA 1PTJA 1S01A 4QPNA 4CDNA 1RVDA 5KQGA 4P0PB 3KFVA 4YV1A 3F6YA 4FT2A 4BLSA 4ETWA 2RHWA 4Z2YA 3TS1A 2VYFA 1QV7A 2ZYDA 4U8HA 2EF1A 3NAMA 4JODA 3CXUA 1H2WA 1OAKA 4LOIA 4P3OA 4PGGA 4EHBA 2YFYA 3HDYA 3CGWA 3L07A 1E8DA 1C4KA 2HMVA 1GG9A 1TXGA 2XUKA 4JL6A 4OFBA 3UK1A 3HCNA 3P97A 2ZJFA 1RWMA 3WFZA 1JHAA 3HJGA 3LSYA 4FCCA 4I6JA 2XB2A 1RKVA 3KD2A 5TARA 2FQYA 4OBEA 5CVUA 2IA5A 1K4KA 4IXNA 4L2IA 3D0RA 3ITKA 4CQMB 3WIBA 2XDWA 3ZOKA 1KQFA 1NBOA 1ZD2P 1O89A 2VCYA 4HOYA 3MCTA 5IVKA 1HXHA 2L0XA 4Y6PA 2P11A 5C7IO 2IX9A 5A4DA 2O59A 1KJNA 2O2ZA 4CQLB 2NUAB 2G9ZA 5SYAA 2KHZA 4NYIR 3ZGYA 3HXKA 1RAEA 3C7AA 5KSPA 1ZCAA 1A7UA 1TYAE 3BS4A 4JQYA 3W2TA 3WP1B 5EIBD 1M6EX 3SFTA 4X45A 1E2KA 1UK7A 3BD7A 3PFNA 4ZYYA 3AJRA 2YHIB 2AEJA 5IT9A 1ZD3A 3WLLA 2HTEA 1G98A 2X2OA 4G07A 2NVOA 1GNQA 2BMJA 2D4HA 4RMHA 4RPLA 3U48A 4AUKA 4OUDA 2E5WA 4WL0A 4CETA 3NC1C 1U5AA 4YQEA 1PFVA 3WLJA 4R69A 3C15C 4HAZA 3ROZA 3ZZTA 4K9LA 2JD2A 1PU2A 2JKZA 2OYCA 1G16A 3GG9A 2ZXUA 1GPBA 1ZEMA 1U5BB 3L8CA 1R7RA 1THTA 1ZC4A 4ZHQA 5CBKA 3F6EX 4XM1A 1ODTC 5AK5A 1L5YA 1MG5A 2VJLA 4NDZA 4OHBA 4QRHA 3VR6H 1RQGA 4HEHA 5H9VA 1DXYA 2Q62A 4KR2A 3E9YA 4IBOA 2IRWA 3R4VA 1FNSA 5IW8A 2BEVB 5CB8A 4AWBA 2XJ9A 3EF1A 4H59A 4QNMA 4B79A 4FP9A 1E2DA 1ZOSA 3DULA 3OMLA 1LS6A 4QRDA 1I51A 1U2TA 1QHHA 3LX6A 2Z43A 4IH4A 4XCVA 3K70D 4DCJA 1JH8A 1PQ4A 2D3WA 2XD9A 3B51X 5KPJA 3DHNA 1NUAA 2I67A 1O0CA 5TJ9A 1VE1A 1IY0A 1VTKA 3RVOA 1E4OA 2PZAA 5LWHA 5A0FA 4KSBA 1TZJA 5JZBA 1ORRA 4W7IA 3C1OA 2Z8XA 3EGDA 1U02A 2JEOA 4CKCA 1YUMA 3JYQA 1EFHA 4PAOA 2EARA 1NVXQ 2WLSA 3K0EA 1R6XA 5JDCA 1HE2A 4XQCA 1WOMA 3PGA1 1T5LA 3DT8A 3K96A 5DNWA 2R85A 4U6SA 3SS7X 3DOJA 4BWYA 5AFSA 1PG0A 3OZGA 1NJ5A 2O1XA 2XWBF 3T9FA 3LL7A 3IQHX 5EIXA 5HILA 5BSGA 5CW2A 1W5FA 1VCOA 1YBVA 4DY6A 3FYUC 1X2EA 4PINA 5GQSA 2NU8B 4DKJA 1WMFA 1FP7A 4MCIA 5JYDA 3DE5X 4I50F 2QG4A 3PPWA 1GJRA 4Y1GA 4LSGA 4QUGA 1GPJA 1P4HA 4FOLA 1PVOA 4QPJC 1ZHOA 2FTKE 3I01M 1FQJA 3DV2A 3IPCA 4BP1A 2W6PA 2WYHA 2B3TA 3UWKA 5BR4A 4FQ7A 2VUSA 1MO6A 3DHVA 3UHOA 2K7ZA 2OMEA 1F8GA 4AKGA 4YCDA 4C5AA 1LDEA 3OCXA 3EH2A 3F8TA 1UIMA 1LF0A 4IY1A 4WZBB 2YJTD 2Z4TA 1ICIA 4N5LA 2W2KA 1GILA 3IAXA 4GPIB 4LXGA 3ZTWA 4TTPA 4WJZA 3WLIA 4Z7JA 4PCLA 3VZPA 3OQVA 3GD7A 2H0RA 1G5TA 2X5KO 3A58B 3V4OA 1DPGA 3BFPA 2X3FA 4HYEA 4KIJA 1OKKD 4WNIA 4QVGA 4DRXB 5CLGA 4EOGA 3V5NA 4C5BA 3DOFA 2DBYA 2R5FA 3D7NA 3G8BA 4P83A 3IQXA 4D41A 1M2WA 1JFFA 3GGCA 4WT7A 4DNQA 1U1FA 3GGGA 1R0RE 1O3YA 1SG6A 1NWHA 2C1ZA 4HMQA 3VJLA 5CB6A 5K0SA 2IYVA 1RP7A 1Z75A 1YA4A 4J7AA 3UJ6A 3QEBZ 2RAVA 2R2GA 3QE4A 2B7BA 1UDBA 5JO0A 1WRBA 2IZ1A 1EP1B 4BYMA 3U5TA 3K09C 1ZW6A 3ZBUA 4JOBA 2YYAA 4G8DA 2XMSA 3M4ZA 4QJ3A 1XZGA 3DUFB 3FYTA 3KB2A 2YYZA 5GP1A 3WL8A 3DOCA 2BP7A 4EDFA 1KU6A 4JY7A 1IOWA 5H3HA 1M54A 4YNBA 4IAOA 1YQ9A 1CUFA 3SHOA 3RVPA 3ETDA 1J0BA 3UJHA 4WKOA 1DIGA 1CP2A 3IUEA 4NG5A 2OFFA 4YO7A 3BF7A 1UXHA 3L49A 4BRUA 1PS8A 5F12A 2JI7A 1RRFA 2ALJA 2HJSA 1FUKA 3J7TA 2ZM5A 1YBHA 1NM5C 1R74A 1NGSA 1F7VA 1VLHA 4DEYA 3R09A 4MJ3A 4I3FA 2HAEA 4CT4B 1TCBA 2WSIA 3JWEA 3F2IA 1X8JA 3MWEA 3S2YA 4DYHA 1XT6A 1GPAA 1R0LA 5CFNA 3P1JA 2E5LB 1ADBA 3TDNA 1RI1A 1Q0UA 1VLVA 3AG5A 1CY4A 1XDZA 2Y67A 3BE5A 1V4BA 5AXDA 2JIZD 2QNRA 3DBVO 4I81A 2OFWA 1NIJA 4KPUB 5FA6A 3TE6A 1CR6A 3VNVA 1Q6ZA 1QK5A 3EN0A 1OC2A 2G71A 4KC0A 4CIAA 4Z53A 2BFDA 4AMZA 4WPGA 1RLIA 2W0MA 3PT5A 5IZCC 1Z06A 3C1UA 3LYUA 5DZSA 5EP4A 1XTTA 4NCHA 4QU9A 3QBVA 3JYHA 3AF0A 2ZJ1A 3OLZA 4PRKA 5FA8A 5T7BA 3ZDEA 1BNCA 1FP4B 1HORA 4V24A 3KUUA 1T36A 4FMDF 2W2NA 4QXMA 3TAXA 5AW4A 3R3VA 3ZK7A 1V71A 3AUUA 3ABSB 3KYIB 4OXYA 4EJSA 5JAUA 3LPMA 4IWNA 1EK1A 2WICA 1H65A 4MIYA 3SLGA 2AQHA 2WE7A 3MK31 3ISJA 3EF3A 4YFVA 4ZOCA 1JHDA 5BMVF 2GI4A 4KSYA 4CMEC 1I3LA 4ECEA 3EXHB 4KXNA 1ADJA 4RY9A 5AIBA 2J32A 3W4IA 3IKJA 1D6MA 3KELA 1B7GO 2EJCA 4GOND 3AU8A 3R40A 3BCSA 4TOIA 1G9SA 1FTYA 2ZI4A 4M9UA 4ZAYA 3T7DA 3CH5A 3CUTA 2PLNA 3AR3A 3PB3A 2F2TA 1F9AA 3CEAA 4ZAGA 3JATB 2KYRA 5EXTA 1B41A 1S02A 5LNK6 5K0NA 1P6XA 2XZTA 1SQ5A 2PJDA 3CUUA 5GAJA 1BZYA 1TO6A 1ENOA 1QAOA 4RDCA 2HWXA 4YMVA 2WQ7A 2P3OA 4UUBA 3PZBA 3I4LA 4Q9AA 2HHJA 4R4JA 4MGIR 4X8LA 3FRIA 4GF5A 1RXCA 4LPSA 1E3IA 2QYOA 4IIYA 3D6VA 4NL4H 4V0QA 4YGYA 4ZTZB 2IH2A 1Q91A 1SKUA 3GAAA 3U9LA 3IHKA 1NNEA 3K6SB 1P7PA 2H7XA 5GY7A 4EI9A 5CITA 3M4JA 4QYMA 2CHVA 1WPRA 5HRUA 5CX1B 4QEZA 4FOOA 2ZB8A 3KEFA 4YAKA 4G1UC 3WMFA 5IKMA 4PNEA 2XQGA 1QGUB 4KR0A 4ME6A 1KVQA 2OV1A 1I6LA 4B2YA 3EEBA 4RGYA 3EH1A 3HY4A 1WBBA 5K0FA 1AH2A 3ZE9A 4EA8A 4HGQA 5TVGA 2QTZA 3TJZA 3FNFA 3I39X 3E15A 2CNWA 1N8SA 2G1UA 3FRHA 3OOHA 2EXXA 4KTVE 1UKZA 2PMFA 4OA5A 4MI6A 1L3CA 2XKKA 4NPCA 4LF4B 3H5VA 3FETA 3BSSA 4EA7A 1YASA 4HH3C 3A2MA 2FMIA 4DARA 1KPHA 1VXRA 3TVTA 5DYGA 2PJUA 2HPVA 3P0HA 3PZRA 4MGEA 1Z0DA 5AXBA 4WA8A 5DLPA 1W1WA 1HGXA 2XLCA 3OIYA 4UPVA 3JD0A 3KJXA 2J9YB 4UTOA 2A94A 2FUKA 1FLVA 2WHPA 4LZPA 1WMAA 2D2XA 2G5CA 2ROQA 1SUAA 5TGDA 1KRHA 1XBTA 2IYTA 3D7SA 1K4YA 3QOWA 4K03A 1QP0A 5JCXA 3ZWAA 4GI7A 1OW3B 3CFYA 1SIBE 2WIGA 3DWEX 2GHIA 4O1HA 1BO6A 3CZCA 1WABA 1TW2A 3RT7A 2ZB3A 5CUQA 4I36A 4YYZA 4JHXA 4IEIA 3WYFA 2VRCA 4TN1A 5JLJA 2X9GA 3G2MA 4ESVA 4MV9A 3ZXXA 1E89A 3A9SA 1V35A 3KLOA 3OIVA 3GT7A 4FKBA 1D5CA 3CLSD 3ZDFA 3WGIA 1S2IA 3AFOA 3ZGZA 4YCCA 4RLSA 1MO3A 4OYLA 2YUIA 2QOEA 3HBMA 3F90A 4E03A 4FMCB 5GONF 2PNJA 2YYYA 1BKYA 4CQMA 1YRBA 5BO5A 1NBMD 5L3SB 3M81A 3L4JA 1QU3A 4FMCF 5GONB 5SICE 3P8ZA 4LGMA 3ZY3A 2WYOA 1RAFA 1Z4KA 3GNLA 1TLFA 4TWRA 4ACAA 3OLYA 1VQ1A 2WD8A 3I8XA 5I4KA 3QHPA 1IEVA 1GY8A 2D5AA 1R0SA 4FZ3A 4FZRA 1T4MA 3IQDB 4I08A 4JQOA 4MUGA 3QWIA 4F45A 1KOGA 1JFSA 1ZXBA 3PR1A 1WDLA 1Z28A 2R4TA 3KOYA 2X3YA 1GA6A 2HKIA 3K0AB 3LM8A 4QAJA 4F60A 2GUWA 5ICFA 3VAAA 1PGNA 4MVXA 4GVXA 1QX4A 4NU8X 3LY8A 4JA2A 4KXFB 4N54A 1N6RA 3L93A 3UJPA 4MCAA 4QVKA 3SYTA 2XWJI 4PZYA 4UEKA 3ITDA 3Q8KA 3RANA 1SIWA 2M98A 3PQ2A 3JALA 3OCJA 1Q3KA 3BL5A 3EEOA 1XTKA 4P5DA 1YZTA 4XCQA 3VH4A 1P5ZB 1RYZA 5FJJA 1EZZA 3BJZA 4NC9A 3SYRA 2A1UB 1ONOA 2GBIA 4QNNA 5F77A 2JFXA 2VP4A 1K63A 1DAOA 2ZYAA 3A25A 4RPGA 1A97A 5ESXA 2J41A 2QPTA 2PKQP 3CIFA 3JQGA 2MR6A 4TXLA 4AF7A 4PR0A 1U5CA 1SELA 2R8ZA 3KNZA 3T7AA 4YMGA 1HYGA 4PLGA 3PWSA 4QHSA 1Q84A 4EITA 2UZ1A 3QOXA 1U65A 1VKNA 2CLHB 2F9FA 4YWHA 1AKMA 2H17A 4MVJM 2M6KA 2CDNA 2AN9A 1XSEA 3R20A 3Q8XB 2IY9A 3CX7A 3O7WA 1B93A 2AB0A 3I9V1 4JOQA 5CRIA 3KZKA 1LPBB 2QL9A 4NXNB 3UNXA 2NUAA 2NT4A 3AIIA 2J5QA 4EY8A 1WJGA 1YOVB 1QOQB 2GETA 2WR8A 2MR5A 5CCDA 3PPYA 1FA9A 1I0IA 2WDPA 4TLAA 2WF5A 4MV4A 3HH8A 2CUKA 2II6A 3KKPA 2CXHA 4JI4B 1QBGA 1PW7A 2OKGA 1N7HA 3LQ4A 2P4HX 2CC2A 2XOEA 4I8XA 2JAPA 2Q3FA 1AKEA 2I3ZA 4URUR 4C1BA 1KJQA 2YVQA 1II0A 3B7WA 3OOJA 1YTUA 1KRXA 2G83A 2UXCB 4TXHA 3DDSA 1Z63A 4CNQA 2X9VA 2XA2A 3OM9A 1GTRA 4NCNA 4CM9D 5LQDA 1XTRA 2R8PA 3PCTA 4J0IA 4TUYA 3K92A 4XEHA 1SCKA 2AUNA 3KKQA 4K9SA 3SXUB 5I7FA 3MB5A 4Q66C 1KRWA 2HNKA 3KYCB 3TXAA 3NKVA 1V11A 2ZZNA 4GFDA 4X95A 1L4NA 1PBTA 1XAHA 2VRWA 1K6JA 3AVQA 4DCTA 5C1PA 4UAGA 3AM1A 1YUBA 2FI1A 1QK4A 3B85A 1HFJA 4X91A 3PC8C 3BQMB 2BN4A 1PQWA 4NBRA 5FWXA 1ZNWA 1NMYA 1KF0A 4QPCA 2AQIA 2PGLA 3BEDA 4M7PA 5TEWA 9LDTA 3KKMA 4MR8A 4MCJA 5GWXA 1SUEA 4X60A 1R64A 3K31A 4EY5A 5C37A 2R8XA 1C8KA 1Y42X 4IMRA 4JAVC 4DQUA 1W48A 1XCGB 5D2CA 3BF8A 1E3DA 3GFGA 4OEHA 5JTTA 2C57A 4KLZA 3EB9A 1FX0B 1W8DA 3UCXA 1RXUA 3HBFA 2GUGA 4R83A 4W1RA 2YVLA 3IO5A 3IAS1 4KU4A 5EMNA 3V8MA 3HL4A 3IJPA 4ZVSA 2YWEA 4I8DA 2XITA 3OFJA 4G09A 5EGNA 1FJ2A 4CHTA 1LWNA 4B6RA 5HS6A 2QZ4A 4Y1RA 4C06A 5K4HA 1FIUA 1TM2A 4N03A 4H3HB 1XMJA 2FK8A 1HSZA 2EJVA 4RTOA 3AVWA 3GFQA 4WZAB 2E1PA 2I4NA 3Q12A 3R6LA 8ATCA 4BNTA 2BGJA 3MD9A 3P71T 10MHA 3IULA 1JDJA 3P26A 4F3KA 3W6UA 3PHGA 4KR3A 2AOUB 1A8SA 3MMXA 3PD1A 1J5XA 5I48A 4Q9DA 3GLIA 3EUEA 4RULA 4XFKA 2XB9A 3DAOA 4X64B 1W25A 1YE5A 4C2UA 4XDYA 1J7KA 2YJ5A 4KXMA 4RXMA 1U0LA 3E1GA 2B3DA 4ENVA 2HRRA 4UTNA 1Y1TA 1CZLA 1KIMA 1NR1A 1UJ2A 2NZJA 3JZDA 4REMA 3RSGA 1KARA 3ZKAA 3EZNA 1SOMA 2J9ZB 3ZTYA 3HXOA 1BN6A 2X8LA 1PCXA 1Z5PA 1ZD8A 2GRJA 4URZR 4DNFA 3WLAA 4D3XA 1WZIA 1BMFD 1JG4A 1H0RA 3NOXA 4I1IA 4IF6A 4KL8S 5CJ2A 4YRNA 1ZRSA 1G20E 4F4HA 5LP6C 5TVKA 4MYCA 1JQ5A 1GDTA 1E0AA 1Y4AE 5KNDD 1P1BA 3FZGA 3I0NA 3QWHA 5FFFA 2YQ4A 2H08A 3JPYA 1E0JA 1C50A 2E55A 4K6OA 4ZT5A 5AXAA 2ACKA 3PE4A 4BFSA 1C14A 1GAWA 2YQZA 3Q7IA 1QGAA 5E9WA 4QA9A 2RHMA 2D1SA 4KJZA 5JWOA 1K8RA 1TD1A 5BN3B 2Y2UA 4ZANA 3GRCA 2DKNA 3ODGA 4FONA 2R68A 4COKA 4IIHA 3W9SA 1WETA 3JVEA 5JROA 1ONBA 2CMKA 2P9QA 1NJ8A 2EG5A 4B4OA 3CR7A 4KQKA 4Q7MB 5PGMA 2VNJA 1MJHA 3E9DA 3PI6A 1KAOA 2EZUA 4MGKR 3NBYC 2HSEA 4WGGA 3A05A 1AXGA 2C4VA 1USKA 2ZS8A 1A9PA 1FUUA 1E1QD 4CMKA 4EL0A 1V16A 4NOLA 1DDGA 1C29B 4GI5A 2G9RA 3G0CA 4X41A 2FLVA 2J6BA 3REGA 5JVDF 1E3EA 3OOSA 1NBWB 3NBMA 2SKCA 2EJTA 1H0HA 4MPTA 5FPTA 3VDMA 4EVQA 1BOOA 1I36A 2DQ4A 4PG6A 3IB6A 3UZUA 4D74A 2HPZA 2IZ0A 5DBFA 2OHFA 3QXJA 4BO9A 2LDBA 2DQKA 1IN4A 1F8UA 1W88A 2OE2A 2RG7A 4ZI7A 2BEUA 4CLRA 1MX5A 4WZAE 5KVSA 3KCNA 4HR7A 3TZBA 1Z3IX 2QW1A 1SD1A 3L7LA 1LJLA 1HLDA 3IEKA 5M2QA 1GITA 3RVLA 4GXNA 1FDOA 3ER6A 1SOWA 3WGOA 5B4TA 1T8PA 3OZSA 1ZA1A 2V8OA 4DV4B 1R6UA 4M9CA 4PXYA 4L16A 1NNUA 3EDMA 2CSUA 3CV3A 3H7AA 1DFIA 1T9DA 2R3SA 2VPIA 4JEUA 3SXPA 4P3PA 3MVEA 3OOEA 2HBYA 1KI1A 2ZJ2A 4XD2A 1P2UA 4IHJF 4UBNA 1X13A 2QDXA 4XYLA 5KYUB 1H94A 1C1YA 1M1ZA 4OMCA 1B0UA 1UXJA 2YRXA 3ZJYA 5KOJB 4I4NA 1JDPA 1WY7A 1U9CA 2WAAA 4LHZA 4QEDA 5FUYA 1E5DA 3IEXA 5KBYA 5BVHB 1KETA 4PFQA 4XJVA 4NCJA 4JV5B 2ZWPA 2VL7A 1GNTA 5ADVA 4IMJB 4ND4A 2I2DA 2M6SA 5LDGA 2X15A 5AVVA 4J0HA 4UNSA 3M2PA 5AI4A 2BKUA 1L4KA 4BLUA 4DB4A 3JYPA 4IZIA 4AJPA 2WJ3A 2CNBA 1SY7A 2R1VA 3LPAA 2OM2A 4WOPA 3RKUA 3VZCA 4EG4A 4BLWA 3CO5A 2F9LA 1FDVA 3GVCA 3FJ1A 4M1QA 4B85A 4XQ9A 2RGRA 2FUG1 2V98A 4RIFA 3G0DA 4U5QA 1WZEA 3GI1A 5BR7A 1SUBA 3H3FA 2HEGA 4MNTA 4YMWA 3VPCA 4EY3A 1SR8A 2XIQA 3AT1A 4K6FA 4TXMA 2F6RA 3PQ8A 2C97A 2CEAA 3KOXA 4QXAA 1YZVA 4B33A 4UFPA 4AYWA 1B00A 2ENUA 4DHWA 1D1SA 4FFMA 3TFWA 1B6TA 4O0LA 5TEVA 1E0DA 2W70A 5E1DA 4FFPA 1TAGA 3T9DA 1SOAA 2ZSUA 2QR3A 4MQBA 4OHPA 3WYDA 5AO9A 4N40A 5TT0A 4QZVA 2RGUA 4PSDA 5JC1A 5HF9A 1U1EA 2QN8A 3DMPA 3SHWA 5AVYA 1NYTA 3UB4A 1VHWA 1PEYA 1ETHA 3ELYA 1OWNA 4ZEMA 3NHPA 2PBZA 5HYVA 4IZ6A 4QQRA 4UHJA 3ZWWA 4RHXA 5E1MA 1OHHA 4JJFA 3U62A 2OORC 1EHIA 2DPGA 3IEUA 5C4MA 1BX1A 1KSJA 4J75A 3UPDA 5ETJA 5A3RA 2JGDA 3SQNA 1U2PA 2XTZA 3EWAA 3FDXA 4M0DA 2FZGA 3V2GA 2N1MA 4HLUC 5DCLA 4BNZA 1PKXA 2FVXA 1S8OA 3LPCA 3PFCA 3HWWA 5HF8A 2OENG 4WN9B 3F6SA 3OE7A 2XRZA 3THXB 1CUVA 5JJLA 3CF6R 4EJFA 1JJFA 1KPIA 2FUEA 3KHTA 1QCYA 4UNNA 4EW3A 4DMRA 3NTQA 4ZOAA 3EAGA 4WIAA 5HM8A 1UEIA 2FW6A 1UBOS 5F7JA 5K1ZA 2X14A 4PFKA 1EFPB 2BMVA 2YX1A 1NP3A 3GDGA 3PPXA 4HH0A 4RIHA 2BGGA 1WUHS 1YL7A 1VCNA 3H11B 4DNPA 1BWQA 1RLTA 2BZ1A 4MKHA 4ZC8A 3ZWPA 3ZQ4A 4PNHA 2C3MA 4CM4B 5JRJA 1TKRA 1GZ6A 1NVTA 2N47A 2ZYSA 4I4LA 4XIJA 5FO1A 3V6LA 1GL9B 721PA 3DNMA 4BAZA 1Z7GA 5ESWA 1I33A 1NFFA 2VP6A 5ALQA 2P8JA 3GD5A 5DTRA 1X8XA 1CUBA 1NE7A 2NYVA 3IAUA 3OOYA 3JRXA 2QYSA 2R44A 5JSQA 2IUFA 3THOA 5LP6B 2OV2A 1YK1A 4W8HA 1N0WA 1V8BA 4E15A 2YV2A 3C6ZA 4B7ZA 1Z29A 4BKRA 1NMQA 4J90A 4GYJA 1N25A 3VMFA 5J4HA 1O54A 4P6VF 4Z54A 2E37A 4ZI5A 2WWVD 3FPFA 4XM0A 3HGMA 3ZJ4A 4XPIB 2CDRA 1XXLA 3BRWA 3NDPA 3P9XA 4IIGA 4AF8A 5IDXA 1C30A 4YK7A 1N2CE 2ID4A 4NZOA 3IR6A 5H9WA 3DT6A 7ADHA 3SLKA 4AK9A 1PJ2A 3IA7A 1EB8A 3EGCA 4UD6A 3F3MA 3REQB 3UB3A 4ZK6A 3I61A 3E8XA 4X1YA 3SF8A 3OTIA 3UUGA 5BNTA 4G5XA 3VVCA 2HB6A 4TZ6A 1XA4A 3BDVA 4QUJA 4RMGA 1G8SA 3T3NA 2VHZA 3COYA 4KO2S 3MXOA 3ISTA 4GGOA 1K8XB 1W4AA 4H3KB 3W8DA 1UADA 3ZEIA 2PZLA 2RB5A 3KAKA 4TRNA 3BWVA 4H6XA 4HQRA 1E2QA 1F1BA 1KVSA 3GFRA 1HM5A 1JAIA 5K3FB 4D26A 1EP2B 4R2HA 3HKEB 2ZVDA 4GVPA 2R86A 2WD7A 3D4OA 3FFBA 3F5MA 2MU1A 2WTEA 2LD4A 5BR8B 2RGAA 2DP4E 3RARA 1JG3A 3S70A 1MF7A 1HZJA 1GSHA 1JKFA 1N5KA 1TQ6A 2WU8A 3NTLA 3V4SA 4C4TA 1BIFA 2OQVA 2C7PA 3KJGA 4WKPA 4EKYA 2A30A 1BROA 5JS7A 3F3SA 4PAMA 1EQAA 3MMZA 3DFUA 1IHDA 4WK6A 1Z9BA 4ZPJA 1YC2A 1SHZA 4BZQA 4CWAA 3C2QA 3ZKWA 3L0YA 2YZMA 1ZRNA 4M0UA 2ZBPA 2I66A 3OM8A 5H7XA 2W8BA 2QM8A 3Q5DA 4DIBA 4DLYA 1UPBA 2O54A 2H9YA 2DHRA 3QVLA 1XRSB 1UPUA 1WNTA 3QVOA 2GYYA 1LSOA 2W2OA 1ZN8A 5FWYA 1W47A 2GEJA 1J70A 1RFGE 3DZGA 3F6RA 3FUVA 4BB5A 2H52A 2FLWA 3A9TA 4P08A 1J0DA 2AFIE 3NZEA 3NPAA 4U39A 4FXOA 3TRHA 1QG4A 3K6JA 4DTCA 5JD3A 1IZ7A 2YJZA 2FZLA 3HKBA 5KX5A 4L08A 5M3BA 1Y4DE 3L4KA 1LX7A 3VNRA 2FR1A 2GM4A 3KU1A 1V3TA 4Y2HA 4F0JA 1FTNA 2VWPA 1A9TA 2VAPA 3EFOB 1A7KA 1RHQA 1IM2A 3AV0B 3OZRA 5DX8A 2PQ2A 1QONA 2YV3A 4HLCA 2JD0A 3EYAA 3JASB 5D85A 1PE0A 3OF5A 4R3WA 5LZ4A 1QCDA 2NPFA 3PEYA 2B25A 4IVPA 5EJ7A 1OB2A 4MR9A 4L4RA 1VJGA 3INRA 3H2ZA 2J59A 4FQ8A 4B7UA 1DQSA 4V0ME 1YVRA 1FDSA 1Y1RA 4LE0A 4QT0A 3CR3C 3ZZ1A 3CNHA 3I1YA 1XLWA 2HJWA 3PEFA 3FFTA 5FUQA 2DQZA 2HA7A 4MUAA 3BMOA 4WY8A 5TLSA 1KR2A 1S3GA 2NTNA 5CYPA 4F97A 3L18A 3LF2A 2QUHA 3V33A 1YJBA 1F38A 1E6KA 4F3YA 3FNIA 1NXSA 1IXKA 1C81A 3PNLA 5L9AA 4DCNA 4E32A 2XCTB 3JQAA 3TVYA 2PX8A 2CHUA 4L4YA 1UMCA 2JPDA 3KK0A 2OG2A 4GT1A 4BQOA 4DIUA 2PA0A 2A9FA 4M49A 2H8KA 4NV0A 3UENA 2H1SA 1PGQA 1GVNB 5E38A 4AZ0B 1X1DA 3EOAI 3ZHYA 2QN6A 1VDZA 3KJIA 2FFBA 3J80A 5FWXB 3U0BA 5TPZA 3CSUA 4AJ4A 4PCAA 2GZ3A 1L5NA 4BNKA 3A1CA 1GEGA 2JLYA 4G1VA 1D04A 5DHAA 2YN2A 3FHLA 3AFMA 1GKIA 3LZDA 3GUZA 4CU2A 3H3JA 2VJBA 1J4AA 1KBOA 1M7HA 4NCKA 1JEDA 5AM4A 3T15A 3WK8A 5ADUS 2AKEA 4BUZA 1H2AS 2PZEA 4BP8A 2UVDA 3ASZA 2GJ9A 4GPTA 1DFGA 1X1AA 5A2QA 1CV2A 2YOGA 5DO9A 3KQKA 1D2EA 2IE8A 5BR1A 2XE8A 1U9IC 4UAVA 2QTLA 2KBEA 4OLFA 5K3EA 3NTOA 3IXMA 3EZXA 2BRUC 1YE3A 5IBQA 2PRJA 2BDTA 1K1EA 3H84A 2EW2A 4Q16A 3FOAA 4WNAB 1X77A 2G5PA 1MQ9A 2O7VA 3DO8A 3ESBA 3HB9A 4DUYB 1EJBA 3OC6A 3HKDB 4QOIA 2W00A 4C21A 2V1XA 4ZI3A 1L7NA 1LPAB 1R5JA 1YI8A 2KLHA 5AW1A 4N76A 4L9RA 4D5EA 3RSSA 5IARA 1CT9A 2WP8J 2ZRCA 1OWLA 5B3KA 1BDHA 2GPBA 3GAFA 4D9NA 1H8EA 4DSUA 5TX7A 4LGVA 2BR5A 4CL8A 4D0RA 3JX9A 2PFKA 4LIPD 2JJ8A 3LBNA 2P91A 3B2NA 5CIYA 4ZOQI 3W77A 1EFRD 4L50A 1PLLA 2OHVA 1SZPA 1KBZA 5CT4A 3HKCB 3AR4A 5F3DA 4YROA 2ACVA 3QXCA 3B1WA 2B4AA 5DLQC 3QM1A 4TPKA 4DV2B 1L5OA 2NO5A 2OAGA 3LQKA 2PRZA 4OQPA 1H9BA 5LIPA 1DPFA 1K06A 1OFIA 3DE6X 3WWPA 3W1WA 1ZM7A 2REQB 1E2EA 2J9RA 3N39C 2OXRA 3PPVA 1GYRA 4D9EA 1G8PA 4NZPA 4KGDA 1A2BA 5C7YA 4QM7A 4CTJA 5JMOA 1WCIA 5ELXA 4G4GA 3L6CA 3MJCA 1U63A 1C1DB 2PVPA 1P0FA 2NX2A 2QENA 2A67A 1B3BA 4TSFA 4UNQA 3TZCA 2WAXA 5HP4A 5HHTA 1RIFA 4C1NA 4YTEA 4JWKA 2C0PA 2GHQA 2BE7A 3PU6A 3GLIE 2J3DA 3D3EA 2CLKB 2WTAA 2P2DA 3I76A 2FF5A 5AJTA 4ZV9A 4BP3A 3BZBA 2GNOA 1AMNA 4CM1A 3PXDA 2P65A 3FDZA 4PLYA 3QY0A 2IQ5A 3LGXA 1NN3A 4OHFA 1PJ8A 4DMHA 3AFHA 4BO4A 2DKOA 5EHNA 2JLWA 4MUEA 5G1PA 3NDJA 2H2GA 3CNEA 2J67A 4EG6A 5DYTA 3D8UA 5JSUA 1JF8A 1P5FA 1KIAA 1Q1GA 3CGGA 1J42A 2ID9A 3LUHA 4FEEA 4L5JA 1EDDA 5F73A 2ZTLA 2UUPA 4RJLA 1Q1BA 1KEEA 2ZZKA 4URHA 3B1JA 3GLGA 3CJRA 4F85A 2WUDA 5F7XA 2IU0A 4A23A 3DAPA 1F6BA 4IJVA 2E89A 2GR9A 1N6KA 2XX3A 3B20A 4IGEA 4P0QB 2PMWB 4XX1A 3AX6A 2WJWA 5BVHA 4BX8A 1QFJA 1NV9A 1XA0A 3Q8WA 4PR3A 4G86A 4TMFA 1L7OA 4J0JA 4FZ5A 3BM5A 3TLCA 3ZCUA 4ESHA 3UOWA 4M8IA 1W46A 3AG6A 3C97A 3CX3A 4NZNA 3JQBA 3WDLA 5KYTA 3R7LA 1PJ3A 3ETEA 5DTJA 1YMQA 2D1QA 3B5JA 3DDZX 2CL6X 4D4MA 1GZDA 4HV4A 1KY4A 3T41A 5KDOA 1QFXA 2BGLA 1H22A 3B89A 1Y82A 4F5EA 3QUTA 3W3AA 2Q3BA 1JDBC 1RPZA 1SG9A 2X0JA 3O2NA 4L0CA 5D00A 2F59A 3F4LA 3VRHA 5KOHB 1EXDA 4OOEA 4MVJD 2RGEA 2YXLA 4AICA 1G21E 3CPHA 4MUNA 4X97A 1UAYA 1JLSA 2DB3A 3I2GA 2PX5A 3QNUA 3FUTA 1ATZA 3GQVA 4AJ1A 1LLUA 2P4UA 3TM4A 1O6CA 5LQSA 1SVUA 3ZW9A 1L3IA 3PDCA 5T4HA 4DQXA 4F3CA 1PEAA 3T3HA 2QTCA 2WG0A 2N1BA 3KL4A 1HLGA 3HWSA 4H08A 1K5GA 2OK8A 1L8OA 2CF6A 3BMQB 3O73A 3LOQA 1AUPA 4PGFA 2WJHA 3O4GA 5HMMA 1QORA 4D8XA 3TZKA 1O8BA 1XEXB 2JHPA 3TMAA 3DZJA 3E27A 3ORFA 3BD9A 4K6GA 1GRCA 1A1SA 1A27A 3MCAA 2VKTA 7REQA 3AMVA 1CUHA 1KP2A 3EZFA 1N92A 3IJEB 2X76A 4YAEA 1V16B 1OZAA 3QWBA 4FINA 3TQHA 1PJLA 2D4AA 1R8SA 4WESB 2Y1WA 1HE4A 4I1YA 3FCOA 2AOXA 2OD9A 2NQ2C 4DYDA 2PUWA 2E9SA 3BYZA 4R1UA 2YJ6A 3UW3A 3V80A 4LFAB 4JU9A 3TW8B 5FAKA 3O8RA 1X7DA 1YBAA 5AKJA 4OMFG 4Q3EA 2DQSA 1PF7E 1V8DA 2GVZC 2HF8A 2WZCA 2YJ4A 3KT0A 1JB9A 3LQQA 4KO4S 4B8WA 3O75A 3THRA 5DBEX 2QY6A 2HO4A 1L4GA 4ZICA 4LOKA 3BWCA 5L3ZA 3JS5A 2PSSA 1JTVA 2BSAA 3OBBA 1N6HA 3I2HA 1SQ6A 3B7GA 5REQB 2AI2A 4KWTA 4Y2RA 1Z4JA 1NXXA 5A3SA 3TCXB 3AVOA 3QG5A 4YCBA 3QITA 4OB6A 2FRVA 1BXRA 2O1WA 2RKBA 3BXEA 3D8NA 3N28A 1ZK0A 3DBLA 3AETB 4JC0A 1FMTA 3ELBA 3S2EA 1I5OA 1NXQA 1ZW1A 4HDKA 1E6MA 3AH8A 3ZGOA 4BLVA 2OQ2A 1GGMA 3G8DA 1Z5GA 3PR2B 2FRXA 4O2AB 3L1HA 5KJ6A 1Z5OA 2AF4C 4GKVA 2D8MA 2LUOA 1UFRA 4MRVA 4QE3A 1XVLA 1CR4A 3FSGA 3LXRA 1A4IA 3R3YA 4S24A 5C8ZA 4N5MA 1E3MA 4LVNA 1S1MA 1MVOA 1Y3CE 1J1ZA 2FA9A 1V5GA 3DAFA 1FBTA 1G6OA 3DTTA 2Y0EA 1UBNA 1K7SN 2NZ8A 4B4KA 2IPLA 4MEJA 5GINE 3TFOA 1P74A 4N7JA 5MN5A 3BC1A 3QF4B 4QBHA 1N3LA 1OFTA 2GCIA 3L0CA 4EHNA 1W2WB 1O4VA 5ALHA 2A33A 3TIVA 1PK7A 1Q74A 3GP5A 4FNMA 1QAMA 4FZVA 2GK4A 4MRAA 2F8LA 4AMVA 4ENSA 3NT2A 4LBYA 3HPRA 5A05A 2WVJA 4DNOA 1IHXA 4QUKA 3FLAA 4KH1A 5IH7A 2BZGA 5JWHA 4JNKA 1P3JA 4F9GA 5K0GA 3LGAA 2CB9A 4L3WA 4MWOA 3UK6A 3OAAD 1GCAA 5DMHA 5FPKA 3E58A 5BWBA 3Q10A 1XJCA 2PSHA 2VHQA 1EBUA 1NI4A 2C95A 2YV1A 2XZOA 4RSRA 1JJVA 1E79A 2O1EA 3TK1A 1ORVA 2VI5A 3HHPA 1DKOA 3K0AA 4RYDA 3TRKA 4MYTA 3VPBA 3DEKA 3CUWA 2ODNA 4M3NA 3U61B 3NHSA 2XGSA 4CEHB 1PZGA 3LD9A 4RK4A 4D57A 2QEQA 4MJLA 1YH3A 2HU5A 4ZMBA 1DUVG 1WB4A 2VSFA 3C3BA 4RTJA 3AI7A 5H82A 1E79D 4E5YA 1PLJA 1DRVA 1JECA 3DZBA 3S2UA 6ADHA 2HXYA 4OSPA 2AYZA 1S8FA 2P3LA 4TYPA 3BXHA 1NFRA 4PLFA 5AK0A 2ZETA 3RHTA 3TCNA 1UDXA 3PKZA 1EIWA 4BKMA 3DZFA 1I5RA 2A57A 3GLUA 1O97C 1OTYA 2J6HA 4MGZR 2DLCX 1BFDA 1UC8A 2QLFA 3HUTA 1KK2A 2QTTA 4UBLA 2I8LA 5GPBA 2Q5JA 1JEYA 2ZRMA 4HDCA 4F38A 4PRYA 1NKVA 2C31A 3IPRA 1YB6A 5FTWA 5KOHA 1XAGA 2CHEA 2CFOA 2P35A 4JJ8A 2NP6A 1MEJA 1YB5A 1Z8HA 2GN2A 2PGXA 2RC5A 3A6FA 4WKNA 3AP3A 1FJHA 4J9VA 5I9TA 3UMGA 5KSYA 3GJ4A 3L1JA 2GARA 2TYSB 3Q0EA 1IOVA 1Z4PX 1GKYA 4X1IB 2C4NA 3GLRA 1TA9A 1ODCA 1EXWA 1J6UA 1ZCFA 3KUCA 2C92A 2VDLB 4P81A 1DOAA 1OPXA 1R50A 4ROTA 2PQ0A 4ZQGA 5JMTA 4Z8XA 3RUIA 4YUWA 5L4NA 5C52B 1J39A 3CONA 3LCUA 4LJLA 3C3MA 1OHHD 5FUBA 3VBCA 5B3LA 3WY9A 2FZ4A 3B52X 4R98A 4W6ZA 3FMOB 1OWOA 1HDEA 2QORA 5K0CA 3O2SB 3OVMA 3H65A 3QTBA 2AZTA 2F8MA 4ER5A 1UUFA 3KQVA 1FP4A 2UZIR 3HCWA 4FPXA 4HPXB 5HGXA 2R66A 3QU7A 3WMRA 3DDUA 1UT5A 4WESA 4S12A 3Q7EA 5I9MA 3RRZA 3LKVA 4V0NA 1LZLA 2VA9A 3KIPA 1Y5MA 3ZS9A 3I6MA 5AKEA 3HYCA 4KBFA 3H8SA 4PZ0A 4N3GA 1G7TA 3M6UA 3EFHA 3UWSA 3L1UA 1WDWB 1KEVA 3R6GA 3VKUA 2HGSA 4FSXA 1P44A 4OGWA 1AQIA 1RE1A 3AHDA 4KSCA 4TLLB 3JQCA 2JDID 1G7RA 2IHJA 2E1RA 3OEEA 2MDTA 1KMCA 1EM8B 2O7RA 3NKLA 1BX0A 4J1SA 4CV3A 5E7JA 1G7SA 3BORA 2CNOA 2DEUA 3N2IA 3DZHA 1LRJA 1OH8A 3JYNA 3R5HA 4NATA 2NSDA 3CN9A 3DQPA