2BKAA

Cc3(tip30)crystal structure
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
231
structure length
231
Chain Sequence
EALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cc3 (Tip30): Implications for its Role as a Tumor Suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TAT-INTERACTING PROTEIN TIP30
total genus 81
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bkaA00
4LW8A 3FR7A 2AQIA 4GX0A 3ZCXA 4D3FA 3PYLA 4CR8A 1WMAA 4NG5A 3W6ZA 1JAXA 3GMSA 1IZ9A 2Q1UA 1DIHA 4Z9XA 1OC2A 1PL6A 1YO6A 1VJTA 3WB9A 4DIOA 3DB2A 3FNHA 4N5NA 2Y1GA 4CMIB 4YJGA 3H9JA 1YOVA 1C1DB 1GU7A 2GGSA 1C1XB 3KSUA 4AJIA 4OGWA 5CDSA 5K6AC 4HY3A 1LDEA 2SCUA 5KJEA 1R4NB 1MLDA 1HSZA 2GDZA 3CZRA 4HXYA 3FBTA 1EQ2A 4N5LA 3WLFA 3CPSA 1ZJYA 2OMEA 5L7WA 3O8QA 3GHYA 1E7WA 3AU8A 2O48X 4LSWA 2VOJA 4NH4A 3G79A 4FFNA 5IFLA 2Q2WA 2CY0A 1WW8A 1BXZA 1R0KA 1RYEA 2JAHA 1QLJA 1I2BA 1BXGB 3DR3A 1TXGA 4R68A 3FNGA 3LT1A 2P5YA 5DOVA 1Q7GA 1BG6A 1ZH8A 2CDCA 1EK6A 3BIOA 1BDMA 1UXHA 1N1EA 5CFZA 4U5QA 4WNIA 3NX4A 3CUKA 4XGKA 4WLOA 1WZEA 4RLSA 1K6IA 2Q99A 4BO5A 4CR7A 4DQXA 3EW7A 2GZ2A 3IJPA 4N54A 4ZQGA 2JAPA 3DMTC 3LVFO 3SJ7A 1B8UA 1GY8A 3KLPX 1IPFA 4CM8A 1E92A 2P2SA 5JY6A 5K0ZA 1HWYA 2DKNA 1NR1A 2C5EA 2G76A 1M6WA 1MFZA 3UVEA 3WYCA 1ORRA 1HXHA 1I32A 3VC7A 3SVTA 4ALNA 2XXJA 3FWZA 1U3WA 1GFSA 4FW8A 3OETA 4OOFA 1ZVMA 1MP0A 4FFRA 3UHAA 4XYGA 4EGFA 4RPKA 4FC7A 3CKYA 4PLFA 1ULSA 2GN8A 3ETGA 1JWBB 3JQ9A 2GUGA 3GDFA 4K26A 3S2FA 2X9GA 2GN6A 1KBZA 2Y1DA 4MVJA 1AHHA 1ONNA 1E1MA 1TT5A 2EF1A 3O38A 3K73O 1SB8A 2PKQO 4YJDA 3IUSA 4B3JA 2VUSA 3IKTA 1SEVA 3OJ0A 4R5HA 4CMAA 4XD2A 3DMYA 3IJRA 3WGIA 4UVDA 5JMPA 2ZJ0A 3ZNPA 1Q1NA 5DCUA 1JN0A 5JAQA 1VKOA 4EUFA 5HWSA 2R00C 4NZ9A 4ND4A 2NACA 1ZNQO 4DMMA 2NVUB 3DOOA 3OA0A 2ZYGA 2H6EA 2VTEA 1ENOA 4XIYA 3TF5A 4ZU3A 1KVSA 1HE5A 3GDOA 1ZJZA 1F12A 3VOSA 4P4GA 5ADHA 2HDHA 3GRKA 5KCZA 2XAAA 5DN9A 5IZ4A 1DIAA 4DXHA 4WLUA 2HMWA 4RVFA 1VE9A 3GRPA 1OFGA 1Y1PA 2C7VA 4IDAA 4O0LA 5CG1A 3KM0A 1QYXA 1SEPA 4CLRB 3OF2A 3CINA 3Q9UA 2ZYAA 2YV3A 4FFPA 4J1TA 3GHHA 1EMDA 4OIMA 1PTJA 3PZBA 4JX8A 3P2OA 4HNHA 5EQFA 3LC1O 4MVJG 3U62A 3QRWA 2IZZA 1VJ1A 5CDGA 1JKFA 4IMPA 4FPXA 3H9UA 4P38A 4YAKA 5JYEA 3K9QO 4K1LA 2X0JA 2DFVA 4ND1A 3RUDA 4YRAA 3QWHA 2Q1SA 3PYXA 2DBQA 3WGZA 3EYWA 5LCXA 1UAYA 4JIGA 1UZMA 4IMRA 1Z6ZA 5THKA 4EI2A 1P1KA 3F4BA 4YT5A 4WNCA 3RBXA 2YUTA 1LA2A 5DBGA 4A26A 4A7PA 4WPGA 4FJ0A 4K9DA 5L51A 4RPLA 1NR7A 4ZQFA 4JXKA 1BVUA 4BB5A 3ZWVA 1OZAA 3I23A 3WMWA 4XWYA 5ER9A 3ZZNA 2UUPA 1LDYA 1VI2A 2VN8A 4KDFA 1V9LA 1E6WA 3KV3O 4M8SA 2HSDA 2ZIZA 4J6FA 5DBFA 3H5RA 3TZQA 2A92A 4TRMA 4YPOA 1X15A 4RPHA 4E2ZA 4ZRNA 2DFDA 4YDRA 4F3YA 1DPGA 2DT5A 4CM8B 3GVCA 1CEQA 2BFPA 4IDDA 3RC1A 3UAGA 2QHXA 3I9JA 1BVRA 1H6BA 5G4KA 2R00A 4E13A 1YB4A 4MP3A 2Y68A 1NHGA 2JFGA 1QMGA 3L9WA 3H9EO 3NYWA 1SAYA 3G49A 4ALIA 5A5FA 4AJJA 4P8RA 2VYNA 2O3TA 4YQYA 3KRTA 5JC1A 3ITKA 5JAZA 2Z1MA 5U4QA 4O5OA 4RPGA 4KTVE 4E5PA 3RU9A 5KVSA 4R51A 4Z0PA 3OFSA 3WIEA 2TMGA 3L0DA 1XU9A 1UAGA 1B26A 4Q3DA 5DNAA 2AG8A 3AFMA 1C0LA 2GZ1A 1GD1O 4MOWA 2D5CA 3ZU3A 4D0SA 5KIAA 3GGGA 4U8GA 3GEDA 4XQEA 3F46A 1W73A 2D3TA 5HA5A 4L73A 2OBYA 3NT5A 1NTOA 1LNQA 1PJ3A 3HFSA 1X1EA 4J9UE 1MG0A 4RGBA 3HJAA 3EZYA 3WNVA 3QQPA 1JQBA 3WGQA 3TOXA 5B1YA 1R6DA 2WDZA 1N1GA 2VYND 1YL7A 1LDBA 2BHLA 3JD4A 5K6AA 3LU1A 4NJMB 5TT0A 1V8BA 2ZQZA 3QY9A 1N8KA 2XXBA 4F46A 1R0LA 1EUDA 5FI3A 1T1SA 4IJVA 4RL6A 4CMKA 2HU2A 3AWDA 4ITUA 1P31A 4RORA 1E5QA 1DHTA 1E5LA 1AXGA 1FDVA 2HO5A 4BQPA 4BNWA 3BTOA 3K2BA 1DC4A 4MKRA 3OICA 2V65A 4J7XA 3BMNA 3ZWBA 3BTSA 5G0VA 1LDMA 4EITA 1K2WA 1T2AA 2GPTA 2IE0A 3GAFA 4BIIA 1IUKA 4FJ1A 4RDHA 4NU6A 4PFJA 4ND2A 3IS3A 4TROA 4J91A 3C3XA 2DPHA 5ITVA 4IXTA 3TPCA 1I33A 2QZZA 2V6BA 4M54A 1Y7TA 3WTCA 4DVJA 5H82A 4AJEA 4KQXA 2D4AA 4UEJA 3EHEA 3LF2A 5LDGA 4QUKA 1DLJA 1XSEA 2B4RO 3TZKA 4OHUA 4RCVA 3U5TA 1PJQA 4D42A 2FR8A 2JCVA 4BNXA 4PG7A 5EQDA 2I6TA 2OHXA 3GNSA 2VTDA 4CR6A 3O8QB 4FC6A 4CLDA 2DM6A 4Z9FA 2OO5A 1XKQA 5KVVA 4II3A 3LLSA 1I3LA 1JAYA 4HBGA 1U2DA 3TDKA 1GAEO 1LJ8A 2IODA 1E7YA 4TRRA 1LUAA 3GEMA 3Q0EA 4R16A 1RYDA 4BGEA 4XIJA 5TC4A 3GN2A 5KJCA 3JD1A 3DTYA 5KJFA 1E3LA 3INGA 3NRCA 1YQXA 5A9TA 4HV4A 1CIVA 2B4QA 2JL1A 3EMKA 5HM8A 4R3WA 5AXCA 4AJLA 3BHJA 3GN1A 1PEDA 1R0SA 2O3RA 5G0WA 2O4UX 3ZWYA 2PD3A 3L4BA 1GQYA 4IQGA 1EEHA 3JQAD 4NBTA 1DJNA 5HS4A 2AEMA 3JQ6A 3KLMX 2X5JO 1J4AA 2I65A 3GZNB 2FR1A 2BRUA 2Y1OA 1DAOA 1KIFA 5GZ1A 3GOHA 4FGWA 4R1NA 2ZTVA 5DT9A 1LLQA 3FTPA 5ITWA 4BO6A 2WJPA 2BFOA 1ZFNA 2FMUA 2RHCA 4BNUA 2Y1CA 5AOVA 3RBZA 1WPQA 4M1QA 2CUKA 5TJ9A 1AN9A 4TRJA 4XYEA 2EHDA 4EBFA 2Y0CA 1L1FA 3DZBA 1T4BA 2E82A 5EERA 3FTNA 1N7HA 4NBUA 4YAIA 5C7OO 1C0PA 1UZLA 3K31A 3ZNNA 4XQGA 2OFPA 4OKIA 5IDYA 1ISJA 5A3JA 4IBOA 3VVCA 3GFGA 4DBVO 3MOGA 3EGOA 2EGHA 1V3UA 5TNXA 1X0VA 4Y6RA 3QWBA 1C0KA 3ZW9A 5KKAA 4NJOA 1E6UA 1QSGA 4BO9A 4URFA 3UCEA 3GVHA 1PS0A 4M89A 2OORA 4PG8A 2V7PA 4XKJA 2HCTA 4E2WA 1WLYA 3PJFA 2FPPA 2W2LD 2WD8A 3WGOA 1V0JA 4JNKA 1U1IA 1B8VA 3INRA 1P44A 3OHSX 4MVJF 4OM8A 2DTXA 3EAGA 4GBJA 2F1KA 2Z5LA 3JQDA 4B3HA 5IN5A 4LMRA 4UAGA 5CDTA 1I3MA 3KVOA 3N74A 3E82A 4Q3AA 1H2HA 3EY4A 3R1IA 4R9RA 3WBBA 2CF6A 1V35A 3K92A 4IJUA 1NNUA 1Y8QA 3PRJA 3VZSA 5A02A 4RZIA 2VWQA 4LN1A 2AW5A 4DUPA 4MO2A 1FXSA 3BA1A 4Y6PA 3UICA 1UH5A 3E18A 4K28A 3KYDA 4PZDA 4R4JA 5BSEA 2IZ0A 3MTGA 1DDOA 1IZ0A 1HE4A 2Q3EA 3DAPA 2YDYA 4LISA 5JC8A 3ZW8A 4DPLA 4Z6KA 1KYQA 4UUPA 2O7QA 4J9VA 3H9GA 4CMEC 3AI2A 1DXYA 2PGJA 4XR9A 3KZVA 3WGYA 5K9ZA 2YQ4A 2W8ZA 3RROA 1WMBA 2TMDA 1XR3A 1ZZEA 2EP5A 2Q1TA 1U4OA 4WEQA 4OKNA 3BMQA 3PGXA 5G0UA 3TL3A 2YY7A 1EFLA 1PX0A 3B1FA 4OQYA 5BSHA 1EVZA 1P3DA 1WWKA 2GLXA 4FSHA 1OBFO 3B20A 1R4NA 1FDSA 5IDWA 3LT4A 3U4CA 2WYUA 1H0KA 1HYEA 1XLTA 4CMJA 5KJ6A 1DHRA 2HK8A 3A06A 3EZLA 4J4HA 4FFMA 4QT0A 4CL3A 1QYWA 5A03A 1PL7A 2WD7A 1DFGA 2VOEA 4BO1A 1J5PA 1HZZA 3OBBA 5I7VA 3N58A 5T6BA 3MOIA 1RM4A 3KO8A 4XA8A 3UW3A 4XQ9A 1PS8A 1WP4A 2E37A 3HG7A 4OMUA 3AJRA 5JE8A 1H6AA 1LQUA 6ADHA 3U49A 1TEHA 2ZATA 1M67A 5EINA 2R2GA 3PK0A 1HDOA 3HN7A 1VKNA 3QV1A 4KUHA 4PCVA 3JSAA 1JLLA 2A94A 2NUAA 4E5KA 5U1PA 2XOXA 1XELA 4RVHA 3KYCB 3C1AA 1ZO8A 4BO0A 2AMFA 4QFCA 5G4KB 4DIBA 3RKRA 5AXAA 3MJ4A 4B4WA 4XZ3A 5ICSA 1N92A 4AJKA 4G2NA 1A71A 1PR9A 2PH5A 4H15A 3R6DA 4E31A 1DC5A 2EW8A 3H2ZA 3IAHA 4UEOA 3ICPA 2Y0DA 1U9JA 4IDCA 2HMTA 3HDYA 1F0YA 4P4NA 1DRWA 3DONA 4BO7A 2AQ8A 1ZIDA 3DBLA 3JCZA 3NV9A 1PIWA 3VPGA 5JS6A 2EV9A 3HB4X 4MVJI 4DRYA 3ZHYA 1F8FA 2O2SA 4D0RA 2ZYDA 1GDHA 4D3SA 4BO2A 3NTQA 1UDAA 4XX0A 3UN1A 3P7MA 5IXYA 3KHUA 1LDGA 4EEXA 3E9NA 3Q9NA 4FQ8A 4E2YA 4DPMA 5JNLA 3GH3A 1XG5A 1T24A 5JDIA 1SO8A 1GL3A 3H3JA 1QYDA 1P77A 2BGKA 1NQTA 1CYDA 3E03A 4FD3A 2HK7A 3DDNA 1LRKA 1NWCA 1AE1A 1B3BA 3JYOA 4ND3A 3U4IA 3CXRA 2VYVA 4AJ4A 3OJEA 3UOGA 4R3NA 5LC1A 1MX3A 1PGJA 3BMOB 1Q0HA 1R4MB 3WICA 3SC4A 3VH2A 2VWPA 2ZB4A 5KJ1A 4IZIA 2X9VA 4PLWA 3CEAA 3KYDB 3BMNB 3RU7A 1IB6A 3FN4A 1YBAA 1ADCA 4F45A 3FWNA 3ZWPA 3F9IA 4RQUA 5DDIP 3S2GA 1PJSA 4CMBA 1IE3A 3OM9A 3D5QA 5IF3A 3JYPA 4PLVA 4DYVA 2WEKA 5J23A 3RIHA 1GQ2A 2X8LA 3RI3A 3IL2A 1P1FA 4TKLA 4C7KA 1EFKA 1VC2A 4YAGA 4BNMA 3FPCA 3PWSA 3IDSA 3F6YA 4R01A 4DC0A 1QG6A 3U4DA 4F6CA 1WAMA 4IGEA 4H7PA 1XQ6A 2C54A 1PGNA 3AFNA 4ONEA 4NHEA 3U4HA 4I1IA 4PLCA 3RUFA 3OJFA 4L8VA 1IHYA 4YTEA 2Q2QA 2UYYA 3I83A 3BHMA 3E5MA 2GD1O 5BT9A 1TA4A 1AUPA 3AM4A 3JQGA 1NPTO 3M2PA 1O94A 1Q0LA 4BNFA 2WE7A 5F5NA 4W99A 1T26A 1W4ZA 2PFGA 3KXDA 4OAQA 2P9GA 4W9NA 4RF2A 3EUWA 2X9NA 3Q2KA 2GZ3A 3OECA 2WM3A 2HMVA 2BMAA 4IXWA 4LMPA 5AXDA 2QYSA 3KYCA 4C7JA 1OOEA 4BQRA 4CM1A 2IEDA 3L4SO 3M6IA 1NFRA 1U28A 3QWAA 4PG6A 3HNPA 4OOEA 5EN4A 5GY7A 3SX2A 5JDIC 3INTA 3ADPA 3MZ0A 3AUSA 5JSFA 2J3HA 1LBEA 4QECA 1E3WA 3FD8A 3A28A 2CVQA 1XDWA 4PLGA 1YQGA 4YXFA 2J5RA 4XJTA 2H5LA 4ZA2A 4YT4A 3SLGA 5DBIA 3PPIA 2GR9A 1RM0A 4YVFA 4BNIA 5TRTA 1VM6A 4AJNA 1CWUA 3E5RA 1EK5A 4LK3A 3JD2A 2HJSA 4DPKA 2LDXA 1YDEA 4GMGA 1BDBA 3ICCA 4Y8VA 3PLRA 3RFXA 2EERA 1X7HA 4XGNA 1CDOA 3DBLB 4CLXA 2VRBA 2D8AA 3DBRA 4IDGA 2Y1EA 5DP1A 3UFXA 1LSUA 2DUUA 1VRWA 4L4SA 4EZBA 4GGPA 5AXBA 1UXGA 3VPFA 3DL2A 1A27A 3WLEA 1JA9A 1YWGO 2NTJA 1P0FA 2UDPA 4O63O 4WOKA 1EVIA 1RPNA 4PIVA 4DLLA 2A9FA 3HWRA 2ZQYA 2HRBA 2X22A 3IIEA 3QWFA 1HYGA 3WMXA 4J1SA 4S1VA 4MDHA 4QO8A 5EPOA 1Z7BA 3ETDA 1U7TA 1R66A 5ILGA 5L3ZA 5TX7A 4P22A 5CEEA 4GKVA 3MWDB 1DB3A 1Y6JA 5G4LA 4MVJH 4MVJE 3DEYX 5A06A 3QP9A 4EJ6A 1YL5A 4CM9D 2O3QA 3CSDA 3PLNA 4XYMA 5JCJA 4J1NA 2AG5A 4TQGA 2NQTA 4PG5A 1B0AA 3BXXA 4OSPA 1U5AA 4GLLA 3GPDG 2X6TA 3VZPA 4J43A 4FDAA 3EVTA 2BELA 1KEPA 1LC3A 2YW9A 3AM5A 1C3VA 2CSUA 4MVJM 9LDTA 3W1VA 4Q39A 1HYHA 1QRRA 2FRDA 1H6CA 3LDHA 2B37A 1ISIA 4CUJA 1P45A 3AM3A 3P5SA 3SXPA 3WSVA 3I6QA 5T5QA 2GSDA 2BFAA 4L4RA 4LRTB 4CLHA 5IDQA 4CV3A 4DL9A 2EWMA 5IZCC 5IG2A 4TWRA 4Z9YA 1JU9A 2GYYA 4NK5A 4FB5A 1NPDA 2B0JA 2O4CA 4HNGA 1A4IA 5DULA 3HDJA 1T2FA 3GPIA 1B15A 1E7RA 4Q9NA 2Y1FA 1Y9EA 2UUOA 1LRLA 1WVGA 2PKRA 1YKFA 3L6OO 4I9HA 1NFFA 3GT0A 4W6ZA 2OP0A 2QG4A 1ISHA 1FJHA 5G0TA 1X14A 3V2GA 5MGBA 2P68A 4II2A 4EEZA 3QHAA 4IDEA 3B1JA 3V1TC 1BSVA 1ISMA 1DBVO 1JW9B 4E2XA 2VNAA 1UP7A 1N7GA 5TS3A 3MJCA 5ILOA 1FDUA 3VH4A 1UP6A 5EIOA 4OYRA 4ZHSA 2J5QA 3UCFA 5TLSA 2IZ1A 1E3EA 3VAZA 4CMCA 1YDWA 4KOAA 2FSVA 1PSDA 2P9CA 4GH5A 2I99A 2G5CA 4IJKA 4YA6A 3LT0A 4R1SA 3I9LA 1W8DA 3M2TA 1GTMA 4EUHA 5L4LA 3PHIA 3QW2A 1K89A 3L9XA 5BNTA 2YZ7A 3GZNA 1XYGA 1YBMA 2GRAA 2PGDA 2A4KA 1XEAA 2LDBA 5CG2A 3W4IA 5B4VA 3D4PA 4KWIA 3PHGA 4ND5A 5FYDA 1NBOA 3D7LA 3LF1A 3TRIA 1SPXA 2I67A 5CHEA 4MP8A 5DP2A 1GUZA 5CEFA 1PWZA 1PJ4A 4ID9A 2VHZA 1BMDA 2Q4EA 2VRCD 2PH3A 4TMFA 1MGOA 3IUPA 4FGSA 4JBIA 2X0RA 1A7KA 2EG9A 4YWJA 2AQKA 4OH1A 4KP7A 3P19A 4LGVA 4ZD6A 2JHGA 5KKCA 1T2CA 1HDXA 2B69A 1I3NA 2BGLA 1RM5A 4RQTA 4QFDA 4R41A 1WDKA 4RLHA 5FI5A 4TZTA 3KBOA 1E1NA 1EUCA 1U2GA 2OL4A 3O9ZA 2PD4A 3NT4A 3H5AA 4YBZA 4OSOA 1GCOA 2C82A 4A5OA 2W2KA 2X0NA 4B7CA 1ISGA 4ILKA 1Z7EA 3D3EA 3LK7A 3C1OA 4KUEA 1OMOA 1I5RA 3UGKA 4KZPA 2C20A 3OP4A 4YAJA 2NQ8A 3BMOA 3RKUA 2PY6A 4J16A 5JO0A 4WLEA 4NBRA 5KVQA 1EE2A 5B4UA 4Z0HO 1A9ZA 1EDZA 3ZDFA 1LLDA 4CLOB 4IM7A 2ZTLA 1YB1A 3OH8A 3TZHA 2I3AA 3JQAA 2HAEA 3PDUA 3FCOA 1O95A 1E7SA 5I8ZA 3JQBA 3WQSB 4JJGA 2AEFA 4RVDA 3ZHZA 1Y8QB 1V3VA 3ORFA 1GPJA 4IUYA 5CAEA 1ZK2A 2FHSA 1LSOA 2O2YA 3RVDA 1LI4A 2Z95A 2NTNA 4PRLA 1YS4A 3QA9A 2E48A 1H5QA 3TWOA 2QIOA 2DBVO 3GNTA 4MVJP 4WCFA 1CQIA 5ES3A 4YJGB 1YOVB 2C2YA 3GG9A 3MJEA 5LDHA 4NQZA 4GSLA 3Q1LA 4GVLA 1ZXLA 3W6UA 1NXQA 4LCJA 3C1TA 1PJLA 1E77A 3QJ5A 1ONOA 4FOOA 1J6UA 5L7TA 5KWEA 3WR5A 2D5AA 2PWZA 1K0UA 3L6DA 1P1JA 1X7DA 4E32A 4L4XA 2YJZA 3RFTA 3TZCA 4E5MA 3H7AA 4JQCA 2X4GA 3PFFA 1P1IA 3GR6A 4DC1A 2VNSA 4YEDA 1HZJA 2NU8A 4IQ0A 4R9SA 2QQ5A 1T2EA 3VHRA 2VT2A 2GO1A 3BAZA 4E5NA 1TB4A 1T25A 3GUCA 1ZW1A 4MINA 1MC5A 2WD7B 1G1AA 4LVUA 5F21A 5T8KC 5A04A 1T4DA 2E6UX 4FS3A 2VQ3A 2HUNA 3M1LA 3FRJA 5KNLA 1P1HA 1KERA 3SBOA 4YJFA 3DAGA 4DTIA 5A5EA 2POQX 3LSYA 3HDQA 1RKXA 2BI7A 1HKUA 4WOJA 4Y9DA 1NVGA 1B14A 3E6AA 2B5WA 2VZ0A 4PRKA 2E49A 1CERA 3V5NA 3T7CA 1X0XA 2FY8A 3WXBA 1BXKA 3PXXA 4A73A 3OIDA 2UV8A 4RF3A 2DQ4A 1GV0A 1K5HA 4HX5A 1X7GA 4XYBA 2EEZA 4XYLA 5G0SA 3F4LA 3MJTA 3G1TA 1UDBA 4PLPA 2JJYA 1HSOA 1KVRA 1I24A 3Q6IA 2JKVA 3N7UA 3PQEA 3LZ6A 5H83A 4CUKA 1V3TA 3EVNA 1NHWA 1NM5A 2DU8A 5JBIA 2RAFA 1HDZA 5TSDA 4E33A 4U7WA 4YRDA 4IPTA 3QVOA 1M76A 2I3GA 4DQVA 1TT5B 1G0NA 2NU6A 1KC3A 2EW2A 3KUXA 3K5PA 3T4EA 1LEHA 3E48A 1X1TA 1LQTA 1WDLA 3CMCO 3DZHA 3BYZA 4IS2A 4R1UA 1QORA 5TT1A 4BKQA 3I9KA 1UJMA 4G81A 1N9GB 1GQQA 2C5AA 2OP1A 3B70A 2W2KB 1H6DA 1ZKMA 5TF4A 4DYDA 4WLVA 4IS3A 1UZNA 2QYTA 1NP3A 1WXDA 3TFOA 4IQ8A 7MDHA 1MC4A 1BW9B 1C0IA 2J3IA 1LLCA 3DHYA 4E6PA 3NGXA 4I9NA 1ZK3A 4HADA 1YJ8A 3LT2A 5JLAA 1YXMA 2XPCA 2WSBA 3K2EA 3HQ4O 2ZCVA 5AQ1A 1D1SA 1UR5A 3IQDB 1BHSA 5HBRA 3V1UA 5C7LO 2WYWA 3JQAB 4NDNE 2FP4A 3DBHA 5JXWA 4BV8A 3PGJA 1VPDA 2EJWA 2PGLA 5L53A 5I7SA 3DC2A 3T7EA 4AJOA 2ZB3A 2HKIA 5T67A 1G6KA 3SC6A 5C3MA 2AE2A 5ENDA 1I8TA 3RSHA 4RF5A 3EDMA 3IC5A 3QLJA 1HF3A 5L45A 1F17A 4BNNA 1K6JA 4GVXA 4CLEA 3VH3A 4UREA 4BUCA 2H9IA 1R37A 3WFJA 2G17A 1ENYA 3OQ1A 1NQOA 4MIOA 3C8MA 3C24A 4I9UA 3VPSA 3D0OA 4EUEA 3ZU5A 3QIVA 3JTMA 2J5KA 1PJTA 4PLHA 3FF4A 3S8MA 3ROPA 4F6LA 2AHRA 1XU7A 2WMDA 4FOSA 3WYBA 2W90A 1AXEA 3ON5A 3JYLA 4EW6A 2PZMA 5GMOA 2Q1WA 4L76A 1HLPA 2ZCUA 2VZ9A 3PJDA 4W4TA 4UUMA 4CV2A 8ADHA 4YQZA 2IXAA 2PZJA 4HWKA 1TVEA 1BRMA 2GNAA 3AU9A 3MTJA 3HE3A 1DIRA 3E8XA 1BGVA 1DFIA 1P9LA 1VL0A 2WTBA 4OQZA 1OAAA 3JQGB 2DTDA 4WLFA 1QYVA 3QWIA 4YJFB 3HFGA 3QVWA 3NKLA 3G1UA 1ULUA 1GPDG 3LYLA 4JP3A 3B1KA 1O89A 1F8GA 1ML3A 1MG5A 1Y5RA 4TZKA 3KEOA 4BKUA 2GCGA 4BNYA 1IL0A 4NR0A 1ADFA 3OQ6A 4A0SA 2EGGA 3OSUA 4WEOA 3R0IA 4EJMA 4WJZA 2B35A 4ZN6A 1I01A 2F00A 3GGPA 4I5EA 4NI5A 4CV0A 3COSA 1D4FA 1ZCJA 2O3UA 2AEJA 1MXFA 3EC7A 5IN4A 2HLPA 3PWZA 4BKRA 2DUWA 4RO0A 1LDNA 4HKTA 1LLUA 3TJRA 3CIFA 3PTZA 4O6VA 2RBEA 5BSGA 2JCYA 3DHEA 4AFNA 2EJVA 1H9BA 4HFMA 3VZRA 1HTBA 4ZQHA 2DLDA 3AOGA 3F5SA 1D1TA 3NEPX 3GNQA 1U3TA 2NV6A 3JD3A 3WS7A 4BO4A 1DO8A 2VT3A 3CZMA 3DBRB 3LQFA 4YACA 2EKLA 3H3FA 1E7QA 1ONPA 4BMSA 3MJVA 2X86A 3NDJA 3VDRA 3JQFA 4H3VA 4XR4A 2ZK7A 4WCDA 3ZV5A 1D3AA 4IY1A 1VJ0A 1S7CA 3WTBA 1YH3A 1BW9A 3QVSA 2HMUA 2FWMX 4BGIA 1TLTA 4L9RA 1L7EA 3UCXA 2C7GA 3ZI0A 1Y81A 4E30A 1NVMB 3X2EA 4CJXA 3S1LA 2YV2A 5FFFA 4PLYA 4ZVVA 2FPIA 3DBHB 3PHLA 3FHLA 1NVTA 3ABIA 3F1KA 5IJZA 3NJ8A 4J3FA 1EZ4A 4J4BA 1ENPA 4QX6A 2X5OA 5L4SA 1Y9AA 3VPHA 5BSFA 5I7FA 3ROMA 5A9SB 3C85A 3RC2A 3I52A 4Z3DA 4BNHA 2QW8A 1A5ZA 1LTHR 4B8ZA 4ESOA 1YE3A 4H16A 1M75A 2QX7A 4CM5A 1EDOA 5JCXA 3W8FA 1HDGO 4TRNA 3UH1A 3Q11A 3K6JA 3OEWA 4DA9A 3CTMA 1DRVA 4UULA 4WCFB 1PJ2A 4A03A 3IMFA 4TVOA 3L6EA 1PWXA 2JFFA 4GX1A 3JQ8B 1PS9A 2DPGA 4WKGA 2VYVD 1JVSA 2PZKA 2Z1NA 4OJNA 4UUOA 4J2HA 1ID1A 3ZN2A 3QSGA 4R1TA 4JROA 3JD0A 3MJSA 4S3MA 5L9AA 1PL8A 3HB5X 4ZQEA 1DRUA 1E6EA 4FN4A 1CJCA 1MXHA 4GGOA 1GYRA 2NU9A 1RJWA 3BHIA 1I36A 4BVAA 4QTZA 2CNBA 1O5IA 4FIZA 1M66A 4TVBA 4NIMA 3TZ6A 2FOIA 4E5YA 4KDEA 1Q0QA 3MEQA 1XHLA 4NFSA 1Z82A 4ZQBA 1TI7A 1YBVA 2PNFA 4YT2A 2QRJA 1HT0A 2NM0A 4RDIA 4ZGWA 5F1OA 1FDWA 5F5LA 4CM4A 3DTTA 4YRBA 3OIGA 1I2CA 1SNYA 3AY7A 4Y98A 1GZ4A 2IDZA 1S6YA 4IIUA 3TSCA 3E9QA 3PJGA 5JDCC 5JY1A 1Y5MA 3BTVA 5B12A 3PZRA 4WASA 1B3RA 3DZKA 4YB8A 3V1YA 4E3ZA 4G5HA 2PTGA 1KETA 3WX0A 2GF2A 1U3VA 2C2XA 3ENNA 2CDAA 2C07A 5T8KA 1IHXA 3AI3A 3SLKA 6LDHA 4UUNA 3S2IA 1PGQA 1AHIA 1T2DA 4BV9A 1NAIA 4HFNA 2PV7A 2YFHA 1ZMOA 3WNQA 3VZQA 3RUAA 3BTUA 1ZEJA 5FF9A 2BLLA 5BNFA 5HTOA 4WK6A 2D1YA 3W8DA 4FBGA 5DZSA 2FZEA 3KB6A 3HDHA 1I3KA 1SBYA 1PR3A 4MJLA 4XGIA 2ZTMA 5BQFA 3DZGA 1B7GO 3IP1A 3OJLA 1DOHA 3IOYA 4WCFC 3ROKA 1VSVA 1KY4A 3RUHA 3ZWCA 1I10A 1XWFA 4CUZA 1GZ6A 3GG2A 1O8CA 2H1SA 4W7HA 1K3TA 1ZXBA 1MUUA 1PZGA 2C29D 1NPYA 4NNJA 3VH1A 2ILTA 5I9NA 4CMGA 4CODB 1LXCA 4WE3A 4ALKA 1X13A 7ADHA 3RD5A 3BZUA 4CM7A 3PYMA 3GAZA 2RIRA 5DCWA 1JKIA 4RJTA 1B16A 3L77A 1QLHA 4FR5A 3VTZA 2NU7A 3K8ZA 4PVDA 4E12A 4CQMB 1L7DA 1PGPA 1MB4A 5ENVA 5BNIA 2P5UA 4UVHA 1CRWG 1RM3A 1HE2A 1YONA 4YT8A 3AY6A 4XB1A 4JBHA 3ZGYA 4J0EA 3RC7A 2WE8A 3I4FA 1NYTA 3JQ7B 4YJHA 1QV7A 2IRWA 3GZ4A 1CF2O 1LSJA 4GQAA 4B4OA 3ZWAA 4NBVA 2PR2A 4B8WA 4CLOA 2VCYA 4MIYA 2OXIA 2NSDA 1E7MA 2YQ5A 3NAQA 3JQCA 2BKAA 3GMDA 4RZHA 2O23A 2QZ9A 1QKIA 3B6ZA 2YHUA 2P91A 4BKOA 3TFQA 1GCUA 1NWHA 1VSUA 4QEDA 3S2EA 2FZWA 4A27A 4B3IA 3D3WA 1GEEA 3L4BC 3PFWO 4FJ2A 4EJ0A 5I8WA 2DTEA 2C0CA 1JWAB 1YB5A 3WWYA 3NTOA 2IXBA 3GA0A 3V2HA 4N5MA 3BMQB 4O59O 4IGFA 4RF4A 2EIHA 2AQHA 4WUVA 4IDBA 3GGOA 3AOEC 1KVTA 1N2SA 3A9WA 3KTDA 4ALLA 4I5FA 2G1UA 1OI7A 2RH8A 1EBUA 3AW9A 1CQJA 3H65A 9LDBA 4A10A 1CETA 3DAFA 5L40A 2I76A 4A2CA 1Z73A 1PQWA 1P1RA 1GUYA 2DBZA 4D79A 2V6MA 4MKZA 2ZJ1A 4DGSA 3JV7A 1ZK4A 4YAEA 2BF7A 2IYOA 3WJAA 3A1NA 2FR0A 1J49A 4YYZA 2X0IA 1Y8RA 3AUTA 5JAIA 4O1MA 5I9LA 1U8FO 5BR7A 4NMHA 3HUDA 4M55A 4PLZA 4CMEA 3IP3A 1WZIA 2Y0EA 2QRLA 2AE1A 2VHWA 4D41A 3DFZA 3ROQA 2VUUA 1DIBA 3MWEB 4JLWA 4GSKA 1VL8A 1O6ZA 3AY3A 1P33A 3STHA 4RV9A 2W2LA 3LLVA 3RCBA 1A72A 1H93A 3GVIA 3KOUA 3DWFA 3C7DB 4JJIA 1JKJA 3FI9A 4UVGA 1ZEMA 4GX2A 1MV8A 1U3UA 5GZ6A 1VL6A 4B79A 4GX5A 5L4NA 3GDGA 1PZFA 4XDYA 1Q2XA 1EQUA 3ST7A 5JAMA 2ZTUA 3R3JA 1IPEA 4HP8A 3OIFA 3I4CA 1KOLA 5KTKA 1ZSNA 4PVCA 3DXFA 2B5VA 3PJEA 3E1KA 4CL8A 1UXIA 1EVJA 5CPBA 2YDXA 5JW6A 3WOHA 5DF1A 3V2UA 4Q3NA 3UUWA 4B7XA 4D45A 5JFOA 1IYZA 4W9NC 3DFUA 2A35A 1DSSG 4D3DA 3PQDA 4YCAA 3CH6A 4UVEA 3U3XA 4DBZA 5I7EA 5A4DA 1N9GA 1NFQA 1FMCA 3GFBA 2RCYA 4KQWA 3KYBA 4CQMA 3GC6A 3JQFC 3ZV6A 1LSSA 2UAGA 4MIEA 1HE3A 4R69A 4J90A 3F3SA 2W98A 3VVBA 5JPIA 3RUCA 1R4MA 3NDIA 3H9QA 3PHHA 4JBGA 1W6UA 4LVCA 4BGVA 1WNTA 5T57A 1VLLA 5FEUA 3ZV4A 2NVBA 1F06A 1NQ5A 2JFHA 4RVUA 4XQCA 2Y05A 5F1PA 1SB9A 4KTTE 4NK4A 4BNGA 1ZSVA 2O7SA 4E4YA 2HRZA 5C7IO 1PQPA 4DQUA 1HDRA 3RASA 2CZCA 3ZNOA 4RVSA 4DMLA 3ENKA 4J1QA 2EP7A 4E0BA 1KEUA 3TQHA 4L0QA 2IYPA 1KVUA 2D59A 1HLDA 3NTRA 4P4LA 3FR8A 3DZFA 3LC2O 3DMTA 3GLQA 3VPXA 4CV1A 3ASVA 4PN3A 5THQA 3MCVA 1ZUD1 3D5TA 2VZ8A 4CMIA 4BNJA 3JYNA 5IDXA 3ASUA 3OJOA 1C1DA 2OBNA 3JQ8A 4BL5A 4D43A 2WWRA 1ZBQA 3I6IA 3QE3A 2Q49A 3TN7A 4BO3A 4BNTA 1V6AA 3BMCB 2G0TA 3CE6A 2GN9A 1R15A 4K6CA 4ZICA 3GEGA 2GASA 5JDCA 3E9MA 1ZK0A 3ZV3A 2HK9A 1YQDA 8LDHA 3NGLA 4FFLA 1I2ZA 1SC6A 2NTVA 3G0OA 1U8XX 5DCYA 3IKVA 4AL4A 2ET6A 4LCEA 1SZJG 2FSSA 3DQPA 4CM4B 1A9YA 2BH9A 3HADA 2V6FA 2J3KA 1YVEI 4JGBA 2AXQA 1E3IA 3HSKA 4HFJA 2O3SA 5TGDA 3RUEA 3KEQA 2BD0A 4NFHA 2QRKA 2Q50A 4YR9A 1DIGA 4AJ1A 1H9AA 3JQBC 4MP6A 2VHXA 1FF9A 4J4TA 3I3OA 1KY5A 4CM6A 4IINA 3PIIA 2DAPA 2CDBA 2Q4BA 5COBA 3DOCA 2J3JA 4INAA 1XA0A 2OGUA 1A7AA 3ZHXA 5C5IA 2VWHA 3D64A 4JJFA 5A3VA 5EL0A 2HMSA 4J7CA 5IXSA 2AA3A 1F14A 4Q3CA 4AJPA 1U4SA 4NBWA 1DFHA 1XIVA 4BB6A 3I9NA 3HZZA 4Z0TA 1GV1A 3UXYA 1UUFA 3W8EA 4FFOA 3JYQA 4OXYA 1RWBA 1E3SA 3LC7O 3VDQA 4UEKA 2YV1A 2PD6A 1QXSA 3TL2A 3UKOA 5CDYA 4XDZA 1Q7BA 4DWVA 1GYQA 3ONEA 5TJHA 1Q7CA 2OUIA 3F1LA 1PJCA 1SOWA 3O4RA 3H2SA 5IAAA 4I8XA 4BNLA 3D1LA 1Z45A 3W4JA 4NPCA 4OO3A 4I5GA 4D7AA 4IZHA 4IDFA 1NX6A 1PU2A 3ZWWA 4B4UA 3GVXA 5JMWA 2R6JA 3H8VA 5B37A 3JQ9C 2GERA 1ADBA 4AJ2A 5IZCA 3AUUA 3VTFA 4XCVA 1ZMTA 4QO7A 3PI7A 3QVTA 3FSRA 1UDCA 4NU5A 4D46A 2NNLD 4BS9A 2Y66A 2VHYA 3DHNA 3K30A 3T4XA 3OMLA 4KMSA 3GF4A 1DEHA 1HDYA 3ANMA 5COQA 2J6IA 5KOIA 4WLNA 3NJ4A 3WIDA 2G82A 2B4TO 1LC0A 4CPDA 4DLAA 5CEJA 4GMFA 1FK8A 3F47A 1LRJA 5EMHA 3PVZA 4FCCA 1UXJA 3ZU4A 1KC1A 5H81A 1GR0A 1R12A 5ER6A 5A9SA 4CLRA 4Q3EA 1HDCA 4BKPA 2VWGA 4QXMA 4R5MA 2W4QA 5CPFA 2YFQA 2Q46A 3G17A 5L7YA 3V8BA 2CD9A 5U9CA 1IOLA 3PWKA 3WGGA 4N18A 3ZNQA 1DLIA 3DZJA 2PKQP 2P4QA 2BFMA 1PQUA 4CM9A 3RUIA 5F1KA 5A9RA 1TT7A 1HEUA 2RH4A 1O0SA 3ZWXA 2CVZA 4Y67A 1C1XA 1KVQA 4AG3A 3NUGA 4M86A 3O03A 1DJQA 2HJRA 1M2WA 4CMHA 1I30A 3Q3CA 3M1AA 2CF5A 3KSZO 2O3JA 4XRRA 4RPJA 4PZCA 2VHVA 3FPLA 4U6QA 2I5PO 3OQBA 1GEGA 1KS9A 4J2OA 3OEYA 1PZHA 1E1LA 2EXXA 4L75A 4LSMA 4XJSA 3ZH2A 3HHPA 3HN2A 3ZWMA 5TQVA 1ENZA 4GPD1 4M49A 1E1KA 3WQQA 5CDUA 2YYYA 3C7AA 4WGGA 2VRCA 3DO5A 5A1TA 5MDHA 2UVDA 1PGOA 3P2YA 1XGKA 2DVMA 3S55A 3PHJA 1DC3A 1XCBA 1E0DA 3L07A 3RC9A 4X54A 2ZB8A 5JCJD 1W0CA 2BGMA 3DBVO 1E3WB 2ZKLA 2CVOA 3QVXA 3U0BA 1GYPA 4CQLA 3H4VA 2PK3A 3AUAA 4HUJA 5AVOA 3H5NA 4GL4A 1HETA 3NT2A 5DOZA 3RQSA 4BMNA 4JP2A 3KSDO 5A05A 1EVYA 1FDTA 2JD1A 4ROSA 4DIFA 2D0IA 1K6XA 4EDFA 2I66A 1MA0A 4JCOA 5T64A 2Q45A 3WG9A 3WWZA 4BHTA 5EJ2A 4PGFA 3VKUA 1YJQA 1AGNA 3FBGA 3ZHBA 4BO8A 5GZ3A 3FNFA 3U9LA 4RVGA 4C4OA 3SJUA 1QP8A 4TSKA 4TKMA 1IY8A 3FNEA 4G65A 1NASA 4NJMA 3W4KA 2X1HA 2X58A 1KEVA 4KUGA 1SOVA 3ADOA 3KETA 3AOEA 3AK4A 3ANNA 3F5QA 3K96A 4UVIA 1M6HA 1YRLA 2BI8A 2FN7A 5I9MA 3WBFA 4J49A 2P4HX 1PZEA 1EE9A 1A4UA 2YHIB 3G3EA 3RFVA 2GN4A 4QSMA 2FPGA 3A14A 1T1RA 2X23A 2O50A 2H63A 3X2FA 3WSWA 4PLTA 1YGYA 1Z75A 3JQ7A 4XB2A 4YJHB 4QQRA 2JD0A 4J0FA 2X5KO 4ZJUA 5FWNA 4OXKA 4MKXA 4CM3A 5JYDA 2JD2A 1JTVA 3ITDA 2PA3A 4AVYA 1DAPA 2B36A 4CQMD 4EYEA 2WYVA 4LRSB 3VKVA 3I9OA 2NADA 3GVPA 2ZB7A 4AICA 4E21A 3PEFA 3ANLA 4ALMA 2B83A 2DBRA 3D3WB 3RWBA 4BNZA 4U0JA 2EKPA 1H2BA 1OC4A 3R3SA 3WGTA 4W7IA 5HS6A 4OXNA 3O26A 1DC6A 3BMCA 1GADO 1U5CA 4JK3A 5CP8A 3WFIA 2P9EA 2C59A 1ZK1A 4GKBA 1ADGA 4MPDA 1C14A 3PP8A 1QR6A 3I1JA 3ZWNA 1UP4A 1R16A 2NWQA 1JVBA 1N5DA 1D7OA 4DLBA 1P0CA 4GI2A 3PDJA 5ICMA 5EESA 5L95A 4IIVA 2CMDA 2EKQA 3ONDA 1JDJA 3NDRA 5COAA 3RAJA 3ETEA 2NLOA 1BXGA 3H6KA 1Z74A 3PIDA 2JHFA 4ALJA 2PLAA 4BOYA 3TNLA 4GLOA 1Y8RB 2DC1A 4BMVA 1HRDA 1D8AA 4N7RA 1HL3A 1QV6A 5AYVA 3I5MA 2Q2VA 4L74A 1GUFA 2V6GA 3D4OA 4IJWA 1YL6A 2E4AA 1ARZA 2XF8A 4CQLB 2Y67A 4M87A 4HFRA 4I08A 5B4TA 1WDMA 2PZLA 1H94A 1P74A 1EUZA 2I9PA 5G2OA 1LU9A 4KWHA 3C7CB 3WJ7A 3ZWOA 2CFCA 4BNVA 3GK3A 4GWGA 3RBVA 4R54A 4Y6SA 3PQFA 2Y93A 1B8PA 3UF0A 3CMMA 1KEWA 4K6FA 4Z3KA 4J7UA 4MVJD 4U6SA 3TOZA 1BWSA 4BGUA 3WGHA 3A4VA 1U7HA 1LX6A 2OZPA 4I5DA 2JCXA 4AJHA 3I9MA 3JQEA 4W82A 4GAEA 2RHRA 4D44A 1J0XO 1SCUA 1NAHA 1UXKA 1QYCA 2IEBA 4GWKA 4WECA 5F3RA 1E3JA 5KVCA 3WYEA 1G0OA 1PJBA 4NFYA 3SEFA 3GUYA 1O9BA 3ONFA 2VUTA 4PG4A 2HQ1A 3EK2A 1XQ1A 4XRGA 3WQRA 2OOSA 3DOJA 4JN6B 2J8ZA 3U09A 3GY0A 2YHIA 1SMKA 4Q3BA 3D4NA 4U0KA 2X7HA 1IULA 4B4VA 3OA2A 4OL9A 4XEHA 5C37A 1B2LA 3RJ9A 3ULKA 3Q2IA 2NVUA 4ZRMA 4PZEA 1ISFA 4BNKA 3RJ5A 1GZ3A 2Y99A 5JO9A 1NQAO 4DREA 5TIIA 2NVWA 3DZIA 4B7UA 3WDSA 2D2IA 1I0ZA 1ZSYA 3AI1A 1BTOA 3ZU2A 1EBFA 3GQVA 5HRUA 1MFPA
chains in the Genus database with same CATH superfamily
4S0ZA 4C04A 1Z39A 2VDRB 2ZBEA 4I5IA 3ZHCA 3LE8A 5HIJA 3V97A 3P9ZA 3RIYA 2VCHA 4B44A 5AW1A 3CLSD 3OZRA 3W6ZA 5DK4A 2REOA 1IZ9A 1Z6TA 1OC2A 4HGYA 4EELA 2PGNA 1MEEA 2NO9A 3IKMB 4K6KA 5LQCA 4DDUA 4FZVA 2Q27A 3DB2A 4DIOA 3FNHA 1Y4SA 1ZITA 5EGSA 3P97A 1K9SA 1FXWA 2B3TA 4YJGA 2WA2A 1KKLA 2PFSA 3H84A 4JOCA 1ZHOA 1C1DB 1GU7A 2GGSA 3AMVA 1REQB 2O8NA 4Y1RB 1C1XB 1XCJA 4HDOB 1OBHA 2PV0A 4PHFA 4HY3A 1YOBA 2FWBA 2VP9A 1IQUA 5LXTA 3KSBC 2Y2VA 2GBLA 5FTJA 1EFPB 1HLFA 2IY7A 1M2FA 3AFIA 3U80A 1R5OA 3QM1A 3I30X 1F3LA 5IYZB 4FINA 4Z54A 3F73A 4P58A 1LNZA 5L7WA 4TOIA 1E7WA 2G9QA 1CR4A 2VOJA 3FKQA 1G3RA 4S1NA 1JPVA 2CFRA 3VOAA 4FFNA 2Q2WA 3NVAA 2CY0A 4HQNA 5DLYA 4MWZA 1G21B 4ZVQA 3IVCA 3WB2A 3TRFA 1QLJA 5LYJB 4TM8A 5D5PA 3KLBA 4ND6A 3I04M 4RBNA 3DR3A 3WIBA 1F2VA 1TXGA 1G8GA 1VBMA 4PAMA 3QE0A 1UWKA 3LT1A 4AF6A 5HRAA 2IS2A 3TTYA 1XEFA 1RQPA 1Q7GA 2CDCA 4W5WA 4S24A 4WNIA 3F9RA 1OBOA 2YXPX 3KQQA 4IXDA 4KG7A 5EIBC 2YIMA 1BCSB 1K6IA 3DA8A 4HTAA 4DDHA 2IYQA 4UTPA 1F5SA 1OX5A 3IJPA 5CM2Z 6AT1A 2FPUA 3LVFO 1IQ0A 2YXEA 2HDOA 3K35A 3OUUA 1TD1A 4YXWD 1XL0A 2FZCA 3RK1A 1RHQA 3ZDQA 1JG4A 2FGJA 4OREX 3R76A 4NAUA 4GEGA 4N0PA 1C30A 1D2MA 2QUZA 3A32A 4RV4A 1E2UA 5LDDC 5LFAA 1XPUA 1FYDA 4PGAA 3BULA 3FLBA 2NZWA 3GRUA 5D2CA 2C3PA 4REQB 1XFAA 1MFZA 3G9TA 1H3FA 4ARBA 1HXHA 3TDNA 2CMFA 2H06A 3JALA 3EQ6A 5JNWA 3LDAA 5GADl 5AVJA 3OTHA 2FPKA 3RS8A 2EX4A 3PUXA 1JFFB 4O2LA 4R8SA 3TSOA 2OD9A 1CZUA 5H5JA 5E3HA 1ZR4A 1Q7EA 1U2SA 3KZCA 1HEIA 1VKHA 1Z8FA 1DWUA 4PLFA 4ZCPA 2GN8A 4JXXA 2NO0A 2BM1A 2OECA 3GDFA 4K26A 4KXLA 3E9ZA 2KMLA 2PUAA 1Z29A 1QZUA 1KBZA 1T0UA 1Z2AA 2H1LA 2WFLA 3QEOA 5T4EA 4R1OA 4XX0B 2NT3A 1ONNA 1SK9A 1UC5B 1MABB 1SB8A 1N7JA 3BA6A 3OE7D 2DUMA 2B6NA 4YJDA 3RPEA 3VR5A 1NQVA 1RLJA 1KJNA 2GTIA 1TUBB 3RIMA 3IKTA 1S8AA 1X8XA 3JARA 2JIZA 3DE4X 4YAWA 1QIIA 1TDJA 3OZSA 4OI0A 4G07A 2XCRB 1YQEA 3FROA 2XNKA 4UVDA 3ZUPA 1C3EA 1TX4B 3CF2A 3HGMA 1RIFA 4KGZA 1JN0A 5DCUA 3ZNPA 1VKOA 3DGFC 3L1UA 4EHFA 2NXEA 1R7RA 4HO1X 6Q21A 3VR2A 1AKNA 1XK6A 2JZCA 2R00C 4G1UC 4NZ9A 4CKEA 3LQ2A 3VKFA 1F20A 3OA0A 3RGGA 2ZYGA 2JAQA 2C84A 5DGDA 4B6QA 1UMDB 3HP1A 1Z12A 1VL2A 1PJ8A 1TF5A 2GM5A 2VTEA 4XIYA 5BN4B 5IK2D 5GIOE 1BS1A 4GIBA 3TF5A 3QVGA 3ET4A 1X2BA 4PBSA 4WY2A 4EY3A 1QZXA 3PDWA 3PC7A 1DC8A 3GDOA 1ZJZA 2HDNB 1F12A 1ZVQA 1GNQA 2V6IA 2W8BA 2ZFUA 3D4IA 3HY6A 4P4GA 4Q34A 4CGYA 4EO4A 2HDHA 3NYRA 1G2OA 4WH0A 2LR0A 2C5BA 4BMDA 1DIAA 3M3DA 1TU0A 1VGQA 2FDRA 4UCXA 4WLUA 3WYGA 3GRPA 4NP6A 4JBNA 1OFGA 4B7AA 1Y3BE 5K0EA 4IDAA 4BWYA 4Q4AB 1B23P 3CC8A 3KM0A 3JATB 1QYXA 3I76A 4QXAA 5CW1A 2V8BA 1SEPA 1JSZA 3OF2A 3RTGA 1SVLA 3A6HA 4D8YA 2AIRA 2YV3A 3L8MA 4UBJA 3ORYA 5DTJA 1IJBA 4UTOA 3A1WA 3MW8A 5D01A 3A04A 4IZOA 3OZUA 4I7EA 3KR0A 3L8CA 1JNYA 1H65A 5H3CA 4MVJG 4Q7QA 5JMOA 5HUJA 3U62A 5J2UA 4K9SA 3T3PB 2P7HA 4L15A 2BFBA 2JA1A 5G1OA 5GVRA 3H9UA 4YAKA 1R0RE 3S3TA 4BJ6A 3SGLA 1PP4A 3K9QO 4K1LA 4YLYA 3QIAA 2RGAA 5TMEA 2DFVA 3QUAA 3BC1A 3NTVA 4KMRA 3QWHA 5HF8A 1VB5A 1Y9JA 3EYWA 2E55A 2DH6A 1UAYA 2QUAA 3FNBA 1SA0A 1EX7A 1QUFA 1UZMA 3HUEA 5I8PA 5JASA 3B51X 5BVHA 2WZDA 3EDYA 1P1KA 2XVYA 4F84A 2N0SA 3CUWA 3KTAB 3THYB 3WRWA 3HWX1 1W94A 3CLKA 3DVAB 3F4BA 3IOEA 1JDZA 4Q18A 3ZIAD 4QHYA 4WNCA 2X3UA 3PQCA 4HB0A 4QASA 3VI3B 1LA2A 2J4CA 4A26A 1DQSA 5FQOA 2MINB 3SKVA 1NR7A 3LHFA 4WXRA 2P62A 2B4KA 3PGVA 3PEEA 4LJSA 3WYAA 1FZQA 5DN6A 4KE7A 3VR6H 4LYGA 3ZK9A 2P8JA 4NHOA 1NVXQ 4KDFA 1JL3A 1XE3A 1E6WA 3DO6A 1OW3B 4WBXC 5ALEA 4MCJA 3L6RA 3BFJA 3KZMA 3TZQA 5FBVB 2XY4A 4O4JA 4PYKA 1XEXA 3OO1A 4E2ZA 5K8VA 2DFDA 4RD4A 1JDVA 1M54A 2W6IA 1VLZA 4ETIA 3RC1A 3N2NA 4L5CA 3UAGA 5EIWA 2ATCA 4ARIA 3ZE8A 1BVRA 1H6BA 5G4KA 4E13A 2YIDA 3QYJA 2PAFA 1NHGA 2ETXA 4ZPXA 3VPCA 1M2VB 1QYIA 3FHJA 1PW7A 4HBZA 1PDVA 2XNSA 4F7WA 5HZGA 1SAYA 4DILA 5C1BA 4MSUA 1Q7RA 1JHAA 4NOLA 4PFSA 1AZLA 2RHDA 2E5WA 1V6SA 2YVLA 4IX9A 5H80A 2DUJA 1TGYA 2XT0A 3NWBA 4LDQA 3R5SA 4KR6A 1SXJC 3ITKA 2ZWMA 5BPHA 3LOQA 2PMFA 5U4QA 3GYGA 2C61A 1SD2A 3RU9A 1V16A 2WI8A 3ODPA 3B82A 1RHJA 3OFSA 1YZHA 2WM2A 3V48A 5EJ6A 1G5RA 2ERCA 4Q9IA 1OFHA 2AFVA 2GM3A 2TMGA 2R8PA 1IBKB 1LF0A 5DNAA 2VJMA 4ZEWA 2HU5A 3AFMA 2D5CA 4LE2A 3ZU3A 3VM6A 5A4JA 3ROXA 5AW6A 2PL9A 3U2QA 1Z3CA 5CA1B 2FEMA 5CTJA 5HA5A 4EL0A 4NDZA 1OX4A 4QJ5A 2HNAA 3HFSA 3SM3A 3LGAA 4RGBA 3CG4A 1CJTC 3CVXA 3F74A 3QQPA 2BSQA 2IYZA 2MOKA 2CHEA 3TOXA 1R6DA 4MS1B 2VYND 1YL7A 1E6MA 3O8RA 5TQJA 1QNFA 4AZWA 7REQB 1V4NA 2ZQZA 3WKBA 2QN9A 3RC3A 4RJIA 3I92A 4BMXA 4CIBA 5G41A 4DB4A 5LQKA 4UHKA 1FVXA 3OEHA 1SU4A 1OJLA 1T1SA 5CX4A 5FA8A 3SNHA 3ETLA 3GLSA 3U1BA 4RL6A 2HU2A 521PA 4U7DA 5BW8A 3O4IA 3PRYA 4RORA 5T4FA 2WSYB 1E5LA 4X63A 4BNWA 2XUPA 2A5GA 5C80A 2ZUDA 2WWFA 2FRDC 3I2GA 3K2BA 4MKRA 4PFQA 2QNIA 5PGMA 4NZYA 2FWNA 1NE2A 3SBXA 1XZJA 4ZCRA 4B3FX 4J7XA 3PR2B 3ZWBA 3BTSA 4RULA 2DPYA 4K1XA 5JQGA 1Y1KE 4EITA 2EATA 1JXQA 5CVEA 4CDGA 4F72A 2CMHA 3HXOA 1R5BA 2QM8A 3GXBA 4OBXA 4FJ1A 4TROA 4WZAA 3EEQA 1L4YA 3SXUA 5EIHA 2CB0A 3RANA 1AKEA 3G68A 3TPCA 1I33A 2JGFA 4M54A 3WTCA 2E1RA 2PL5A 1KZ9A 3N2YA 1EFDN 4CG3A 2EZ8A 4N8EA 4LOAA 1DELA 4YJKA 5H7XA 2D4AA 4BZWA 1REQA 4Y1RA 3AGQA 2W48A 2OB2A 5K8IA 2OO5C 1J5EB 2B4RO 1QB8A 4OHUA 4UHFA 3U5TA 5JZBA 4U39A 3P9RA 2JCVA 3DUWA 3L0IB 3SEQA 4X7PA 2LBPA 1VIVA 3LPAA 2I6TA 2OHXA 1XRNA 2VTDA 2H17A 1Z07A 2OQRA 2PLRA 1EQAA 2WWGA 1Y6QA 2WP8J 3MMSA 3O8QB 4H4DA 3OTWA 1K08A 2BLNA 3E0QA 4O33A 2OO5A 4ND7A 1XOIA 4II3A 3CSSA 3LLSA 5ALRA 2XI4A 3WB0A 3NNDA 4XVUA 1JAYA 4HBGA 4PO8A 3MXTA 3UOAB 1NUQA 3LNTA 3SF0A 1PNRA 4CF5A 4FNGA 1GAEO 4FEEA 1VYHA 4MR8B 2XMZA 1TF2A 4TXMA 2HIAA 4ZARA 1TZCA 1KYYA 2H3EA 4OMFG 1LUAA 3GEMA 4RXMA 4U7TB 4DY4A 4EGCB 1CUJA 3U0VA 1QZTA 1A5TA 1TYZA 4LHWA 2V9PA 4M0UA 3RV3A 4WIAA 4BGEA 1Q84A 1YA6A 1RQ7A 3VJRA 4JUBA 4EYGA 1WD7A 4X9XA 1E3LA 5A9TA 2EBFX 1YQXA 3HN6A 3B2QA 4M7WA 2DETA 5HM8A 2XRZA 1F2UB 1XRPA 5ESWA 3ZWYA 1PEDA 2O3RA 4JY7A 3AR9A 1FYVA 1OU4A 2CFTA 2QB5A 4M1KA 4FTWA 2AEMA 2V1UA 3BRWD 5AI8A 2X5JO 3FPHA 3C1UA 1S1MA 2C0QA 2I6UA 4F11A 1IWBB 3I28A 3GOHA 3KOYA 2FPXA 2QN2A 2ZTVA 5HK9A 4UTVA 2EOAA 4FYXA 3F90A 3BB1A 3CB4A 3FDFA 3QXSA 2FMUA 2XVXA 4LE0A 5EP4A 4U2BA 3RVOA 2YRWA 2CLFB 1BDJA 5GIPE 3JALB 4G5SA 4DV5B 2IIBA 4D25A 4M1QA 1NUHA 1N8TA 2Z3ZA 4V1CB 5KVSA 1AN9A 4TRJA 3VU8A 2Y0CA 3DZBA 4MGIR 5DXAA 4GM0A 1T4BA 1X42A 1K8RA 1IZ8A 3IA2A 3GLFE 2CUZA 1KYIA 2IITA 4NBUA 3MMZA 4YAIA 1FYXA 4V03A 2V7QA 3D6AA 1JH9A 3ZNNA 2WG2A 4MYCA 4XCXA 3BL6A 5IDYA 2WFLB 5ADWA 1E58A 5DLPA 2P3LA 3FPKA 3GFGA 1GHTA 5EJ9A 3EGOA 1EUCB 4A15A 4QPPA 1BMFA 1VOTA 1VRVA 4CFSA 1U6JA 2E4ZA 4QPJC 1GAWA 4IH9A 1P0IA 2Q3CA 2CCGA 4Y6RA 5BOSA 3NHKA 3GOQA 1NVVR 3DMPA 1TLFA 2IIPA 1QFJA 3GVHA 2FW7A 4IFTA 1S3GA 2QVXX 4M89A 3N76A 1T9GS 4HH1A 2COUA 3C2QA 5B6IA 4M38A 2A1UA 3HMQA 4XKJA 3CJTA 2HCTA 4YQEA 1WB6A 4E2WA 3I39X 1ZRNA 3LIIA 1E6KA 3K8OE 4ENRA 1B8VA 4F8JA 3INRA 5KTOA 1C0EA 1P44A 2EBUA 4OM8A 5KYYB 2DTXA 3NWEA 4FT2A 4Z99A 4YDSA 4RHTA 3AVTA 2Z5LA 3LLCA 3BIWA 2CCKA 3BCHA 4B3HA 2VBFA 1YU9A 1N5IA 2GCPA 5LYYA 1I3MA 5KNCH 4TT3A 3E82A 3FKSD 3L8HA 1H2HA 3E35A 3EY4A 4R9RA 1FNDA 4UW9A 5A02A 4GRDA 1NNUA 3PRJA 1QCCA 2ZRAA 3G0CA 4MO2A 3DEJA 3BA1A 5CK5A 1W75A 1UH5A 1NRXA 1RPAA 4HF7A 4S1PA 4G4SP 4R2IA 5G3ZA 5BSEA 1ZD2P 5EHZA 1PVOA 3MTGA 4M36A 1M7GA 1HE4A 2AI1A 4DA4A 3DAPA 3OKCA 3O2JA 3ZKWA 4ZI7F 2VNJA 1KYQA 4UUPA 4Z6KA 1DINA 5G40A 1XXLA 1ILWA 1NF3A 3AI2A 1SKBA 3H9GA 3OCYA 4LDRA 3ZU6A 1WETA 4OFZA 1QMPA 4I55F 5ECYA 1ZVJA 3WGYA 4ARZB 5K9ZA 4EDHA 5IVDA 4XPZA 1XD2A 1ZH0A 2TMDA 1NXSA 2Q1TA 2ZJ6A 1Q50A 3I37X 1U4OA 4PFKA 2N9UA 2AFHB 4J8PA 3KC2A 5G0UA 2F67A 3L8YA 3OZVA 2Z4TA 2ZRLA 4H77A 1EFLA 2BGWA 3DPUA 2V03A 5IAKA 4Z3OA 2GLXA 4FSHA 1OBFO 3OPQA 5IDWA 1FDSA 4QU5A 5FR1A 3AEYA 1JQKA 2PWAA 1NBWB 2JJMA 4UMDA 4GZ3A 2VDJA 2JGJA 3KTAA 1DHRA 1SK8A 1Y3HA 1X80B 4WTOA 3THYA 5I9TA 2CV2A 5CURA 4J4HA 5JJCA 2WD7A 2Q6OA 1DARA 1UDWA 3DCIA 2YJ5A 1J5PA 3I72A 5P21A 4N3NA 5K0GA 3RS4A 2C2ZA 1RM4A 3KO8A 1VKRA 2W6QA 4U63A 3TGWA 3OAAD 3S40A 1WP4A 2E37A 3CLHA 3HG7A 4OMUA 3M5CA 1U81A 2X2EA 4E70A 6ADHA 4Q4JB 4UXIA 1M67A 3PK0A 3DE3X 5C51B 4C2AA 2FWJA 1M2EA 4F9FA 3ND8A 4PCVA 1IUPA 4RA9A 4H60A 4D7AA 1TO2E 1XEXB 3UTCA 2XOXA 4RVHA 4ZI7B 3ZJ5A 1A7JA 1ZO8A 5CNIA 3QNUA 2QRGA 4KWTA 3AFGA 2RGGA 5TV2A 4YX9A 4NL4H 2JLSA 2QW1A 3RKRA 3HXTA 1DT5A 3D6MA 3ABOB 4XH9B 2ZSAA 3CNEA 5D5HA 1A71A 2WICA 3HGQA 2WF9A 3O8BA 3MGBA 3Q5DA 3NH9A 2JHCA 2C0PA 3NHPA 4W8HA 4EMTA 2VG8A 4ON9A 2WMOB 1XTRA 3HBMA 3IAHA 3FRIA 4MCIA 1X7YA 4BC0A 3EWIA 1U9JA 4IDCA 2HMTA 2J3EA 4LY0A 3DTNA 5SYAA 2QROA 3GT3A 1AB5A 1P61B 2A33A 1OB2A 5NULA 1O3YA 3DONA 1HQDA 2Q0HA 1ZIDA 3DBLA 3G7SA 4LZJA 3JCZA 2JLAA 3COJA 4A0HA 2EV9A 4LWOA 2DT8A 2C5FA 2GN2A 2OXFA 5FUVA 3T5PA 1VKZA 3NI2A 4IMJB 5EIAA 1F8FA 2O2SA 2OD2A 4MV7A 5CA1A 1GDHA 3GZJA 5THXA 1GNTA 4HXFB 3GLGE 1ZMRA 3P7MA 5IXYA 3SYKA 4XEUA 3ZS8A 3Q7QA 3CLTD 3LP8A 4FQ8A 4IGIA 3BXFA 4TN5A 2AN3A 1XZNA 1SO8A 4C2BA 1J2RA 2RD2A 1QYDA 1P77A 3IQHX 1NQTA 3OD5A 5ALVA 4X90A 3DDNA 1UDXA 2FU5C 2HEIA 4KPEC 2FDXA 4HPXB 4P5EA 5CFMA 1CP2A 1Q22A 1AE1A 4OL0A 4G4SO 3RS0A 1UM9B 4F06A 3GLFB 4B3GA 5JD3A 3U7QA 1K97A 3AR6A 3OBIA 3UMBA 3UOGA 4PZAA 4R3NA 1QZZA 1E9AA 1MX3A 1PGJA 3MBIA 1G6HA 3GLHB 1QQTA 4DT1B 1FZTA 5DB4A 4Z8XA 3SC4A 1NU6A 3KJZA 3NC4A 2CYAA 3L7BA 4J0HA 3VH2A 2WUDA 4L9AA 5D7BA 1S5PA 1KTVA 1K8XB 1KR5A 2ZB4A 4RGQA 3H19A 4F4UA 2GTPA 3FN4A 1QDLB 3CRZA 1YBAA 1E8MA 2HCRA 2P11A 4AY2A 1PJSA 1YZUA 4CMBA 1B4DA 1IE3A 3QQ5A 3OM9A 1GU1A 3ZYCA 3Q8KA 1FDRA 2V4UA 4BQNA 4UOZA 3FF1A 4PLVA 5IABA 5C52B 2VXCA 1JHXA 3DL7A 3RIHA 3IL2A 2FW9A 4JYBA 4M8NE 4JI0B 4M60A 1EA7A 4P3KA 7YASA 2WILA 1OFIA 2GM4A 1HTWA 1Q1EA 3PWSA 5KEIA 3KELA 4QELA 4G5OA 4L0DA 5D6NA 3F6YA 3LRPA 4UBNA 4X00A 1D8TA 3LVRE 3ABSB 3U4DA 3VPBA 1KAHA 2O8BA 2P0EA 2YXLA 3I09A 2MU1A 4F1KA 4C7BA 4NCXA 4RIFA 5JXJA 1OX6A 3AFNA 3QLUC 4S1OA 4DZTA 4NHEA 4YJ3A 3IAAA 4KLCA 4D99A 3L4JA 2G5TA 2FN4A 1CDDA 4RETA 2DUNA 2IPOA 3IBFA 1IHYA 2WWHA 3E2PA 4KI0A 2BR4A 2JFQA 1QV9A 3PX3A 4OGLA 1L5GB 1DBSA 1EK2A 3SMVA 3I83A 4PEVA 3MXOA 3BHMA 2GD1O 4N7MA 4MLDA 1FBTA 4RVCA 4Z1MD 1D6JA 4HDKA 1Z63A 1TA4A 4I4TF 4BVEA 3NM5A 1WCIA 4OMDA 1DXHA 4R84A 3T9BA 2XZDA 3D0RA 5ALWA 1V11B 3VZBA 2CLDX 2WE7A 3MG9A 3ZHRA 3U56A 2RIPA 3K2QA 5F5XA 1T26A 1W4ZA 1Z68A 4TZ6A 4PAGA 1D07A 1AK2A 2RH9B 3G2PA 3KXDA 4XI9A 3PXUA 4RF2A 1NMEA 3EUWA 1LTQA 3I6ZA 2X9NA 4RHFA 3FPFA 4CU2A 4YUZA 4GUDA 4RQAA 4DLRA 4IIJB 3REQB 2BMAA 2PJDA 4LMPA 2WG0A 3K0SA 1XYYA 4C7JA 4KE6A 4CM1A 4G6ZA 1Y5IA 2IEDA 3TB4A 1U28A 2BBSA 3HNPA 1KE1A 2LCIA 2PO5A 4DJEC 1QRTA 1TJ3A 3R5JA 3RTBA 3ADPA 3O31A 4ROTA 4QUHA 5I3CA 3AUSA 2J3HA 1E2FA 1UBHS 3VNRA 1E63A 2H1RA 3A28A 4HPWA 2CVQA 1P5FA 1XDWA 2VHUA 3FLAA 4XASA 3WK7A 1FUIA 2H5LA 3NFRA 4AYTA 2A1TR 4EB0A 4YT4A 3IAS6 3GPLA 2FAXA 5JJLA 4QODA 1RM0A 4O4HA 3TQRA 4BNIA 1JFVA 1VM6A 1ZD5A 4ARCA 1CWUA 1PV1A 1Z5WA 1D5WA 4FR0A 2GXSA 1HO3A 4JR2A 4PPFA 2PRSA 3CSUA 1O7JA 5INTA 3PTLA 2VTBA 2SECE 3ICCA 1F2DA 3R0QA 2QLNA 2EERA 1TJ4A 3BDAA 5EA2A 3TUJC 5E4YA 3BJEA 2VRBA 3HY3A 4FOLA 2QRZA 5TF0A 3FMGA 1C9YA 3QVUA 3UFXA 2BTQA 2D00A 3Q8MA 3DW1X 2DUUA 4KXXA 4L4SA 3VBCA 4V0QA 4GGPA 3IJEB 2KI5A 5AXBA 3EDRA 3IT0A 1P7VA 5E7JA 4NCBA 2NU6B 1RQLA 3DL2A 5B58C 2HCBA 1T6XA 2ESRA 1WABA 1W44A 2JFZA 1YWGO 3AFHA 5HIKA 1T4CA 4FM9A 2UDPA 1WJGA 3RUPA 1J24A 5HEKA 2J9FB 2IU4A 4V0OA 3MHTA 3IIEA 4I46A 2FSPA 1ND6A 1Z5PA 1ZBDA 2EZUA 2O6LA 4RH0A 3VAYA 2PJRA 3ZJTA 5DHPA 4S1VA 3ZD8A 4B17A 4JJ8A 3DBIA 1EJ6A 3G7NA 1Z7BA 4FHZA 3ETDA 4PRYA 4TKVB 2PKYX 5GONB 2H5EA 4GLJA 1SPBS 1UKCA 5B1DA 2O1XA 4P22A 3HVHA 2ZLBA 2JRLA 4RA6A 4GBMA 4US0R 2X4DA 4EGQA 1DB3A 2XTMA 5BN1A 1FTGA 5FBRB 3CIOA 5A4AA 1WMSA 3DEYX 5A06A 3ZX4A 1MJGA 1U11A 1ZNXA 1JECA 5C3UA 1OBCA 5K6AC 1U2DC 3H42B 2JI6A 4PG5A 1S96A 2H48A 3HHEA 3BXXA 3T9DA 4W7SA 5CYOA 3CY6A 1J33A 3TLKA 3ZOZA 4AX4A 4Z49A 1KOGA 3GPDG 2GTHA 1Q95A 3MWKA 4J43A 1NVKA 4F3NA 1T8TA 3FYUC 2P9JA 3FUVA 4HGOA 2YW9A 4WHMA 1YQ9A 1W35A 3AM5A 4XD7D 1NYRA 4EPVA 1CY4A 5FDFA 2H1WA 4MVJM 9LDTA 4N3GA 1ORTA 3OPYB 4RWEA 3H6HA 5F4ZA 4WY8A 4Y2SA 3E8SA 1P4SA 2O9JA 4L3OA 1H6CA 3WK9A 3V8MA 3I0NA 2A59A 3GLTA 2IUTA 2CLOB 2SHKA 5A7GA 4GLFA 4AJ9A 2EP8A 4FW9A 3P5SA 2BMJA 2WMYA 1JSRA 4JUIA 5DXJA 2VJNA 2WSSD 3IPAA 5CAEB 2NUTA 1JMVA 4E14A 2A3RA 2WDPA 2ZIFA 4Z8YA 1RPTA 3FTFA 3H11B 3B6JA 1K6EA 4CLHA 6ABPA 1QRUA 4NU0A 2OSVA 3IUEA 5IARA 1P7YA 4HMPA 4Y2PA 2FQXA 5CCXA 1XV5A 4M9ZA 2B0JA 4HNGA 2XYGA 2CK3A 4CGZA 5H4HA 4EF5A 4LZNA 3SZMA 3VU9A 4ILEA 4DMRA 3UMRA 4EA7A 2UUOA 5LVAA 2IYAA 2PKRA 3ESYA 3R3XA 3K2IA 3HEBA 1YKFA 4WWHA 4BFZA 4PYJA 5BV2P 1ZOPA 4I9HA 1NFFA 1RAIA 4KH1A 1EFCA 2QG4A 4BFLA 1P2SA 1ISHA 1QPGA 1W2WB 1X14A 4LJLA 2JIBA 1EIWA 2DY1A 3G5MA 2XKKA 2XMCA 1ZR2A 4IDEA 3RVJA 2H16A 1KSGA 4TMVA 1BSVA 1PNTA 1ZA1A 1DBVO 1J21A 1RHRA 2AVDA 1T5BA 4IJQA 2ZT8A 2CHGA 4OFWA 4BV2A 4AQYB 1B8NA 2XBUA 4EVRA 1UPUA 3VH4A 1XTUA 3OTQA 4GI3A 4R31A 5EIOA 2YCLA 1WXGA 1KO1A 4OYRA 4ZHSA 3NBMA 1IMJA 1VP3A 1Z2PX 5KSWB 1T0IA 2OCDA 4MWOA 2D1TA 2WT4A 3ER8A 1YDWA 1OWNA 3L7CA 1E0JA 2FSVA 4KOAA 3T1VA 2IUYA 1TO1E 2I99A 4P33A 4YA6A 1EB8A 5CJ2A 1K5PA 3A6KA 3I9LA 2ONKA 4TT3D 4TSFA 1FLNA 1C3OA 1GDDA 5FUQA 1JR4A 1GTMA 1ZM7A 3I45A 3OQPA 3QW2A 1K89A 5E3IA 2CXSA 5EG5A 3I0ZA 4MHOA 3FDXA 3A1CA 3EPJA 3PHGA 2XDQA 4OH7A 5IWCA 3V4RA 4HDQB 1S01A 2Q1XA 4EY8A 2B2NA 1JG2A 3LF1A 4FNOA 3VBEA 3WDLA 5ALPA 2I67A 5CHEA 3IUYA 4KRFA 3V55A 4B3XA 5HYVA 4KE8A 4UU1A 1EIZA 1NT4A 1GPWB 3PWTA 4CKCA 5CEFA 4ER3A 2A9PA 1PWZA 5LIPA 4G63A 4BECA 2GRJA 4XUEA 4XPIA 2XE7A 2KE5A 2XOEA 3ESDA 3LRXA 1BMDA 3BE5A 5BYKA 4KB5A 2AOUA 2X0EA 1MGOA 1VMKA 2VHCA 2V3CC 1NOKA 1QIEA 1RXCA 2YASA 13PKA 1H1TA 1T6NA 3AIIA 4YWJA 3SD7A 4NJEA 4LGVA 4A0QA 4YH1A 1D04A 4BCBA 3KHKA 4I14A 4R41A 4E4RA 1P5JA 1T9ZA 2HI0A 5DM0A 2GNOA 1U2GA 5J63A 3S4YA 3IPCA 1FUUA 4YBZA 4OSOA 1SN7A 2LCQA 5DTEA 2C82A 4A5OA 1E2LA 3NBZC 3NORA 2WFZA 3P9XA 5B2FA 1H4SA 1PWEA 2Q5JA 1Z4MA 3OQIA 3SFVA 3KTOA 2XTNA 1PEYA 1FVOA 2D4HA 1HG1A 2PRIA 2QVZX 4YO7A 4NZNA 1OMOA 1GWNA 4KXQA 1CKEA 3QOYA 4KZPA 5DNEA 1XEWX 2H4WA 4JFRA 1EX9A 2C99A 3IQEA 1YJXA 3I6YA 3RKUA 3BMOA 5BRAA 4IV0A 2EKZA 1ZGHA 3IESA 2HA0A 1EE2A 4URFA 1AN0A 2VRWA 3ZDFA 1DKNA 4I81A 1U1DA 4IM7A 4A8JC 3TZHA 3URKA 2ISSD 4J07A 1U2EA 1FJ2A 1R10A 3F2IA 3ZPXA 2BR3A 2YFYA 3LUHA 4PICA 1VIMA 3NM6B 1AV7A 2B8EA 1Y8QB 3MCUA 1ZXXA 2RMKA 1SCAA 4IUYA 2XUGA 4I9GA 3UFBA 3AW8A 1RP7A 4N8DA 3RVDA 4AG6A 1LI4A 3CR8A 2HSEA 1F38A 1ZM9A 3EWAA 3TQIA 1X7WB 2Q5CA 3JQQA 5LOVF 1Y5LA 1MO4A 2Y76A 1UODA 2RKWA 2Z4SA 2DBVO 2P6OA 4WZZA 4ER7A 1CQIA 5JSUA 2G1AA 2VBCA 5EKSA 2I7VA 4HNRA 2PSSA 2XODA 1ZAYA 2HMYB 1O96B 1SM4A 1AKUA 3Q1LA 4GVLA 2C8JA 1NXQA 2C4NA 3C1TA 4UM5A 1GTSA 3N05A 4Q3OA 3QYAA 1VJCA 4LRQA 1LPNA 1OQAA 3FPBA 1UOOA 2WOOA 2WQZA 2H0QA 1ANKA 1L4LA 3OQVA 5JSKA 3DVLA 2JAUA 1LF5A 2YRFA 2A67A 2QUBA 2V1XA 4L4XA 1YU6A 2YC4C 3H7AA 3RFTA 1DBWA 4LFCB 1CE8A 3PFGA 4Y2HA 3ICEA 1I7LA 3GR6A 4DC1A 2VNSA 1U7DA 3ILVA 4QUAA 5CLQA 4MDEA 4OY3A 4YRSA 4QLBA 2V0GA 4HDKB 4IQ0A 3BL8A 4LJKA 5BV7A 3E9RA 3U9SA 1YI0A 1TB4A 1T25A 3SZUA 1G18A 1ZINA 4YMUA 1DVRA 3OOYA 3QBEA 3SN6A 5KOJA 3F6RA 3VNSA 3H8SA 1WTCA 4O1IA 2E6UX 2I0FA 4L6CA 3PC3A 3DKVA 4PQFA 2PUDA 1VLVA 2YZKA 2VQ3A 2HUNA 3MB5A 4HAXA 3M1LA 4X20B 4YREA 4WX2B 4R9UC 1G5QA 3DYVA 1K92A 5KNLA 1KERA 4DTIA 2G04A 3DAGA 1D4OA 5A5EA 4F7DA 1FW6A 2OAGA 3EDQA 3HDQA 5K3FA 3L41A 5F9FA 3E9YA 3O0DA 2BMDA 1TFRA 1X94A 5BV0A 4QC2A 2D8MA 3UJ3X 2UYGA 2LPMA 3BQ9A 2FZKA 4H3KB 3T7CA 2FY8A 3OPXA 1JQAA 3WXBA 1BXKA 5I4CA 4OX9Y 4Z51A 2Q9BA 5FAKA 3ZDDA 1YGPA 2R6R1 3ZGLA 4HX5A 4IR7A 4AG5A 2C88A 3RVRA 1TZ2A 4R8MA 1UEJA 2WTMA 2E4YA 2PSEA 3MUNA 4Y6GB 4XYLA 1RXWA 5G0SA 3GARA 4OP1A 3N8NA 1OYWA 3G1TA 4CF4A 3A25A 3W3ZB 1RRCA 2P9HA 5LOVA 2QTZA 1HSOA 3KQSA 3Q6IA 2BGUA 3CJRA 3N7UA 3PQEA 1KDRA 1Z5NA 5H83A 3RTDA 1V3TA 4V2UA 3EVNA 3OKPA 2GESA 4FS8A 1YJCA 2EJTA 4MV3A 2GVZC 3R9KA 1CJVC 2HF7A 5JBIA 3OE5A 2ZVJA 2WZBA 4U7WA 2RH5A 4GOKA 1Z0ZA 4R3UC 4BQFA 2JG3A 4PZZA 1EH5A 1G0NA 2NU6A 1KC3A 1U7WA 4TYQA 3K5PA 3SYLA 3E48A 1X1TA 1LQTA 1X7XA 2FZ4A 3TBFA 4R1UA 4PTYA 1MQ8B 2VP6A 3A2LA 4F5DA 5JROA 3P94A 4G81A 1X39A 5CIQA 4R2MA 4ZO6A 5AVRA 5KNCD 4OYYA 3WMRA 2W2KB 1H6DA 2Y8EA 5K0CA 2EFDB 1O0CA 5ERGB 1UZNA 2AXEA 4X6YA 1NVUQ 3VR6A 5J4KA 1IY1A 3D3QA 3NEAA 5AKZA 3WLTA 3OVMA 3LQRA 1C0IA 1KU6A 1W5TA 4NF2A 5IFKA 1YA8A 2X6RA 2D0PB 1VHWA 2HXGA 3OTGA 3UK1A 1YJ8A 3LT2A 2BHSA 3REGA 2HQSA 2O2IA 5JLAA 2XPCA 5BN4A 1VPEA 5TPZD 3Q8LA 1U5BA 4WVLA 1DBRA 3FRHA 4NBNA 1FRVA 1D1SA 2E9SA 3IQDB 2ZIWB 4NBSA 3ZLTA 5C7LO 2JDID 4LGCA 3RIEA 3UAXA 1E6CA 4OYLA 5B3LA 3AEKA 3L7OA 1IIBA 2EJWA 2PGLA 4DV6B 2B7CA 1WKCA 2W6ID 3T7EA 2A88A 4LJ4A 2ZB3A 3NASA 2L82A 1C1HA 4LHSA 4YPFA 5C3MA 5JQWA 4UPDA 1FFBA 2D5BA 2YOHA 2I34A 1E9CA 2AE2A 3CUUA 4AK9A 2IOFA 3GQBB 3RSHA 4Q4AA 1NBMA 4RF5A 3JATA 3A6DA 3QLJA 3IHTA 3KZKA 3LGSA 1P2VA 1GO2A 3AIKA 3TW6A 4YT8A 3GMTA 1K6JA 4ZVTA 4HQLA 3L79A 4J75A 1NW4A 1Z6PA 2C1EA 2IUEA 2VQSA 3VH3A 4BUCA 2PSDA 4DZRA 3DLHA 3G2KA 1EHCA 2EC5A 5AHWA 2G17A 3OQ1A 1USKA 4P3XA 3P2JA 3C8MA 3C24A 4HLCA 4I9UA 3X3HA 5IP5A 3LL4A 3ZU5A 3B13B 3E3OA 1QF9A 3EH1A 3TZLA 1RCUA 5BT8A 1ZUHA 3FF4A 3S8MA 3KLNA 3FI0A 2VJBA 2IYXA 3B8HA 2VPWA 2JW5A 3R41A 2XUAA 1AX9A 2GCOA 1N0HA 2QT1A 4PN7A 3OHPA 3AIMA 1AXEA 5LU8A 1C9KA 4O4LA 2JRCA 4E07A 1Q2UA 4Z1OA 3FMPB 5B7GA 2BFCA 1A0OA 4L76A 4MWGA 4QQ8A 3K4PA 5EXDA 4AICA 1WB5A 4CV2A 3FOCA 4O2AF 4GSYA 1FU4A 2QRVB 5AK3A 2NU9B 1WEHA 5JNRA 5KYUB 5G53C 3UMFA 2GNAA 3AU9A 2F59A 1VL0A 4OQZA 2HHAA 4OA8A 2YL2A 5AJZA 4CG0A 3JQGB 1OUMA 4WLFA 3RYHA 1PK9A 2H1CA 2F2TA 4GR4A 1Y82A 3IQZA 4YJFB 4EECA 2J07A 3NKLA 3FYDA 3HKDB 3CNNA 4EFNA 1GCAA 1RAFA 3GD5A 3LYLA 4CFZA 3OZGA 2HWWA 1BAPA 1M34E 2FYTA 2YNMD 1NW6A 4FGUA 4PPGA 4Y9TA 2FJPA 4PO1A 1L4MA 4C0SA 3VR1A 1ADFA 3UAWA 3SCZA 2P2LA 4WEOA 4E22A 4EJMA 3DUFA 3RC8A 1NUTA 1EGQA 3S7TA 3TI9A 4F1WA 5BR4A 1BD3A 4ZN6A 2CXQA 3GBPA 1I01A 3NR2A 2AZMA 4E88A 1W36C 3QEMB 4G56A 3COSA 4YMLA 1M2VA 1T4GA 3KKOA 4Q82A 2AEJA 3TW8A 3QELB 5IN4A 1ISSA 3ZEIA 1SVWA 2GB4A 2DUWA 2W2VA 4RO0A 2WHEA 4GOJA 5K1ZA 5JWRA 1FRZA 5A5VA 4TKUB 3ZQKA 2HWXA 3SSMA 3LI2A 1DEKA 2BDTA 2JCYA 4NYJR 4AFNA 1C7RA 1KDPA 2YWXA 3VJMA 4RSHA 2Q8NA 4UKDA 3VU0A 1HTBA 3VZRA 4WOPA 1M1NB 2FG5A 2DLDA 1TA0A 1U9YA 1Y4AE 2AK2A 1PYGA 1VSQA 2H4YA 3BWCA 3C4QA 3EW9A 1I6WA 2QN1A 3FW1A 1KSFX 3JD3A 3OZEA 3DBRB 4N6OA 4H1TA 1AK1A 4HAVA 1WBDA 1A4XA 4Q4CA 2KLBA 1C8BA 5HIAA 1G55A 3N8IA 4BMSA 1K2VN 3NDJA 2ZIXA 5EJ8A 1A2QA 3E8MA 1B0PA 3JQFA 1FTQA 4G0OA 2W11A 2OV4A 1J7KA 2GKSA 2VR1A 3O4HA 3K0AA 4NMMA 1D3AA 4IY1A 3ZE1B 1P60A 4LTDA 3WTBA 1KKMA 1OU0A 3QVSA 4RSRA 5IANA 3OY7A 3PQ3A 3UC5A 4MS4A 1TCCA 1P6UA 1DWQA 4K6OA 1BKYA 3NU1A 5B57C 3HABA 3DFFA 2WNIA 1Y5NA 2TRSB 2J30A 1R5JA 3E3NA 3FZNA 3L7AA 1N5MA 2HSWA 5CX1B 3STUA 1NV9A 4OB8A 2ZXEA 5FUYA 5KWIA 4RZUA 3F1KA 1YJ5A 5JJBA 4FUTA 3CEPB 3ORQA 4QX6A 1N2HA 3UG6A 4ZT4A 1BEZA 4YXWA 1HYQA 3PG5A 5JG7A 1IVYA 4HT3B 4EMBA 2JGRA 3Q88A 4PNHA 4D96A 1SXJB 5BMVF 4AP9A 5A9SB 2C31A 3OT5A 3RC2A 1AF7A 3RT7A 3I52A 1CDZA 2BF4A 2QW8A 1LTHR 1MAWA 1O8BA 4K2HA 1YE3A 5DLEA 4B8ZA 4ESOA 2BGJA 4LY3A 3MF4A 1YAHA 4MYUA 5JCXA 4KZKA 1ZU5A 4TRNA 3K6JA 4FDVA 4B3CA 1PAUA 4PO9A 2O14A 3ROFA 4WZAE 3NYIA 5DHRA 4CIVA 2J6BA 3QG5A 3UAZA 4A03A 4U7JA 2KBFA 5LL6P 1W2GA 3MAAC 4Y2TA 1B8OA 3OM1A 4LZPA 2VYCA 1XQYA 4WKGA 3JQ8B 1PS9A 2DPGA 5AT1A 4E3WA 5KYXB 2ZPAA 3HKEA 2R96A 4EK9A 4EVIA 4ZVKA 1W9HA 3DDSA 4R1TA 3OZBA 4F21A 4JROA 3AP3A 2O2ZA 3MJSA 4UEQA 5L9AA 1KBQA 2FNAA 4X61A 1DRUA 2XCQA 2XMDA 2YMMA 4ZQEA 4XSVA 1MXHA 3HWWA