2BKAA

Cc3(tip30)crystal structure
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
231
structure length
231
Chain Sequence
EALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TAT-INTERACTING PROTEIN TIP30
publication title Crystal Structure of Cc3 (Tip30): Implications for its Role as a Tumor Suppressor
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bkaA00
3HE3A 1KVSA 4NJOA 3C1TA 2W98A 4WGGA 1GQQA 3HN7A 4PZEA 3MOIA 4BO9A 4BO6A 2EW2A 4KMSA 3ONFA 4PG7A 3BMQA 2C59A 4OJNA 4CL3A 4B7CA 1P1FA 5CDSA 2O3RA 1P9LA 3HNPA 4XRRA 1SEPA 1VLLA 4E5PA 3AM3A 1FDWA 1WLYA 3D0OA 1QV7A 3TZHA 3OJOA 4E31A 3BMCB 5KKAA 5IZCA 4CL8A 4I5FA 1DIBA 3EK2A 3GAFA 2JCVA 2PZJA 4FFPA 4O5OA 3CH6A 5AXBA 1DEHA 3RASA 1M76A 3QVXA 3BMOA 4RDIA 3D4OA 2FPPA 4YJDA 1V3VA 3QP9A 2NTNA 4CR6A 4YB8A 1P1IA 5L7WA 3WTCA 3KSUA 2RBEA 4BNYA 4BO2A 1HYGA 1R4NA 1YRLA 1YDEA 3O9ZA 4LVCA 5G4KA 5TC4A 4BB5A 1GV0A 2DT5A 3KBOA 3ETGA 1DFHA 1RPNA 2CF6A 3PDUA 5JXWA 1IE3A 2C07A 1IPEA 2X5OA 3GVXA 1W4ZA 1NQTA 1O5IA 2VQ3A 3HJAA 4CQMA 2O23A 4UVDA 1PGOA 4CQLB 2G76A 4ND4A 1KOLA 4LRTB 4NIMA 2UUPA 2XAAA 3LU1A 2PZKA 3JQ9A 4BO4A 1A71A 3BHMA 4JBHA 4Q3EA 1U28A 3DMTA 3KUXA 1XLTA 4UVGA 1LSJA 4B4VA 4N18A 4YT8A 2VWGA 3ZU2A 2JAHA 2OBNA 4R4JA 4XQEA 5JO9A 3CEAA 2SCUA 1Q7GA 4CMJA 2YV3A 2X22A 1EVJA 3LT0A 1U9JA 5L40A 3KHUA 4S3MA 4BV9A 5DZSA 3RUDA 4MINA 3U3XA 2HK7A 3LF1A 4H15A 4DIBA 1EQ2A 4HADA 3RVDA 2F00A 5AVOA 3JQ8B 3CIFA 1EFLA 4FPXA 4TMFA 8ADHA 3FRJA 1U3WA 2PWZA 1HDYA 3FWNA 4AJ1A 4F46A 5FWNA 1DO8A 3TOZA 4R5HA 1YBAA 4U0JA 4P4GA 1MLDA 1NAIA 1ZCJA 2D1YA 2E48A 1GZ4A 4ONEA 5JCXA 4WEOA 5EPOA 2OXIA 4DQVA 1ADBA 4RLSA 3U9LA 1QMGA 1V3UA 3PIDA 4JJFA 3CZMA 4MVJP 2PKQP 4Z0TA 3DOJA 5H82A 3TSCA 1YOVA 4G2NA 2X86A 4XJTA 3U5TA 2OORA 1C14A 3GK3A 4TRNA 2CDBA 3HDYA 3VPGA 1EBUA 3A06A 2P5UA 4FC7A 1EVIA 4IDGA 1PX0A 3TDKA 5A3VA 3ROQA 1ONPA 1N9GB 1YJ8A 2NU7A 2EGGA 4IZHA 4N5NA 3GC6A 3WS7A 1UXKA 2NWQA 4JBIA 1NVMB 1K6XA 4FFLA 4J7UA 5EINA 4RQTA 4DQXA 4INAA 2D4AA 3PQEA 3DZHA 2NACA 2BFMA 1E5QA 1ZXLA 2CUKA 4XZ3A 3WFJA 3BTOA 1LDNA 3PJGA 4NI5A 2GYYA 1XWFA 1C0KA 2RAFA 3N74A 4YEDA 4CMHA 3O8QA 5L53A 5HS4A 2QW8A 3X2FA 4IJWA 3PWKA 2Y1FA 1XA0A 3AY7A 3RC9A 4FS3A 4NBVA 3FBGA 3MJ4A 2YV2A 4BNTA 2Y0DA 2AMFA 4CMEA 2BLLA 3GEGA 4J4BA 4TRJA 4DL9A 3BMQB 2PD3A 1ONNA 4XQCA 2Y05A 1X0VA 4E33A 2P91A 4O59O 1PZHA 5A1TA 1Q0QA 3VDQA 1D1SA 4E4YA 4P4LA 3GG9A 3TNLA 4JX8A 4CR8A 5H81A 1NP3A 3PHIA 1ZJYA 5KJEA 1VC2A 3TZCA 3EVNA 2OP1A 3I9JA 3MWDB 3GPIA 4DRYA 3NDRA 1ZO8A 2IZ0A 4M87A 3BMOB 4MVJH 5ES3A 3ZH2A 4ND2A 4BNZA 4WOJA 3DAPA 3RJ5A 1UAGA 2ZIZA 4ZICA 1ZSNA 2X4GA 3Q9UA 4FFRA 3G17A 3G1TA 2JCYA 3M1LA 1IB6A 2DC1A 4IXTA 4MVJI 3FPCA 1R4NB 4CM3A 5G4KB 2FR1A 3L6DA 3V2GA 1ZBQA 2DTDA 2POQX 1YQXA 2X0IA 2QRLA 4CPDA 2ZK7A 4KWHA 4K26A 4YJHA 2IZZA 1YL5A 3JYNA 2QZ9A 3OF2A 5CHEA 3TQHA 2FMUA 5L4SA 4M55A 3LZ6A 5H83A 4CQMB 2FHSA 2Q1SA 4KQWA 2VWHA 5KVQA 1WNTA 4DA9A 4PLFA 4GLLA 2J3HA 1ENOA 1ZK2A 4TRMA 3HB5X 2EJWA 1YO6A 1YJQA 3DMTC 3EMKA 1B16A 5C3MA 3D3WA 2AHRA 2G0TA 4ALLA 4PLHA 1L7EA 1EVYA 2QQ5A 1L7DA 1W6UA 3C3XA 2YJZA 2YYYA 1UDAA 4IS2A 1RM5A 2IYOA 3BYZA 4Q9NA 1Y9AA 3V2UA 2NADA 4IJVA 3AY3A 1ULSA 3RAJA 2WWRA 1EE9A 2DAPA 1E7RA 5JMPA 2EEZA 2UAGA 4R68A 4WOKA 3W6UA 3G3EA 3V8BA 3OSUA 3KSZO 4UUNA 3VTZA 3JTMA 1NFQA 2WD7A 1GUYA 2IE0A 5KCZA 2PH5A 4RQUA 1GUZA 2ZCUA 1OC2A 1UDBA 2ZATA 1G0OA 4KWIA 2AQKA 4NNJA 1DC6A 4RVFA 1H9BA 2BGMA 4O6VA 4ZQHA 3FR7A 4D0RA 1V6AA 2QYTA 1PL8A 4MPDA 1MX3A 4LW8A 4RLHA 4ALNA 5JFOA 3JQEA 2VYVD 3NGXA 4A7PA 1RWBA 3EZYA 1G6KA 1R0LA 4U5QA 3NT4A 5JMWA 1PIWA 3M2PA 2FWMX 4LN1A 3IJRA 3X2EA 3ICCA 5FI5A 1P45A 5BR7A 3QQPA 3VDRA 2OHXA 2I3AA 2O2YA 1ZK1A 2E82A 3K73O 3R6DA 2VRCA 1B2LA 2I67A 1UXHA 2OGUA 2QX7A 1T26A 3PPIA 2NU6A 3QE3A 2C7VA 2X5KO 5JAMA 1MG0A 1Y8RB 2C5AA 4XKJA 1LQTA 1V8BA 2BH9A 4BIIA 3E9NA 1JKFA 5L3ZA 3ZNOA 1IULA 5ILOA 2R6JA 2ZYAA 4KDFA 1LEHA 2I76A 2VZ8A 1ONOA 4PVDA 5TS3A 4JLWA 4P22A 4J6FA 4TWRA 4QECA 3O8QB 4J0FA 5GZ3A 3DQPA 3NTRA 3RSHA 3U0BA 3NEPX 3Q1LA 2CDCA 4K28A 3RBZA 1CQIA 1ZJZA 4XEHA 4Z0PA 4CMEC 1A7KA 4XA8A 2FPGA 4DLLA 3PFWO 1HDCA 4WASA 1VPDA 3ANMA 2YQ4A 5CEFA 1CQJA 5COQA 1B14A 3KOUA 1GYQA 5F5NA 4GL4A 1HKUA 2PLAA 5CEJA 3EAGA 4G81A 4YAIA 2JD0A 5LDGA 5I9NA 2E6UX 4B4OA 1P31A 4MVJG 1AN9A 4BKQA 4BGUA 4YWJA 3PQDA 4D46A 4DUPA 3IL2A 3OQ1A 1DPGA 3TZQA 1ENPA 3FTPA 3NT2A 3UCXA 1A4IA 3TZ6A 3BTVA 5ER9A 4Z9FA 2EKLA 4YDRA 5GZ1A 2Q2VA 5TT1A 4BNHA 1O89A 4R3WA 3OEWA 3FN4A 3T4XA 3IUSA 4IDEA 2AEJA 4AJHA 3EC7A 1Y6JA 4WLEA 2P9GA 1PJ4A 4AJNA 1NR7A 3VC7A 1RM0A 3MTJA 3PQFA 3TWOA 1ZSVA 5B4UA 2WE8A 1I2ZA 3P2OA 4JIGA 4PG4A 1ADFA 4KUHA 3WGIA 4LCEA 1QYWA 4JK3A 2O4CA 4LCJA 3DEYX 1R4MB 3ZHBA 1Y1PA 2DBRA 3VZSA 4BO1A 4XYBA 5JC8A 1YS4A 4EJ0A 3RFXA 3CKYA 4GSLA 2XXJA 2EGHA 2EIHA 2FR8A 1B7GO 1HSZA 1NFFA 1XG5A 4DWVA 1XGKA 1U5CA 4L75A 4KDEA 3IOYA 3C7CB 5JDIC 4XYMA 4BNLA 1EUCA 3U4DA 4OSOA 2ZKLA 3NX4A 3JYLA 4DGSA 2ZB8A 1GR0A 3TZKA 1HEUA 3GLQA 5EERA 1OOEA 4JQCA 3RUFA 1Q0LA 4J2HA 4W82A 3HDJA 4YA6A 4BMVA 1ZKMA 4R01A 1C0PA 1R6DA 3L0DA 2WD7B 1T2CA 2GUGA 3DOCA 4KOAA 4EZBA 4YQZA 5JC1A 3FTNA 4BNUA 3BAZA 2BHLA 2QRJA 1LDEA 3ZCXA 5JYDA 4ALKA 3FD8A 2JL1A 4W9NA 3QW2A 4CLHA 4RDHA 1GUFA 1JU9A 2CFCA 2P5YA 3PWZA 4KUGA 3V2HA 5HWSA 3GVHA 3IDSA 4R16A 3C8MA 3E6AA 1E3WA 3C7DB 3INTA 4IINA 3WGQA 4DREA 2XF8A 4YAKA 2YV1A 4J16A 4OSPA 1P74A 1I3LA 3GPDG 2YHUA 4QO8A 4M89A 3IQDB 2V65A 3RUAA 4R1SA 3PJFA 1HDOA 2Q3EA 1IUKA 5ENDA 3GMDA 1E1MA 1DJQA 3DTTA 3V1TC 1NWHA 3ZHXA 3IJPA 3L6OO 4EI2A 3AK4A 4HFMA 4NMHA 1N7HA 3AM5A 1ISJA 9LDBA 1FJHA 3ANNA 4R1UA 1KC1A 3RC1A 3LT2A 4XQGA 3GHYA 3PLNA 4MVJF 4CLXA 3UCEA 5L9AA 1T1RA 1SMKA 2R2GA 1U4OA 3EW7A 3ITKA 4GX1A 2DUWA 1F8FA 2HJSA 5JE8A 1SOWA 3ZWXA 2D2IA 4ID9A 3RJ9A 4AJ2A 4M49A 4AJOA 4CMGA 4NBRA 3PZRA 1XIVA 2B4RO 2NM0A 3HDQA 3ZHZA 4EEXA 3A14A 3I6QA 3WFIA 4YVFA 1NXQA 1QYCA 1DIAA 2O3JA 4NR0A 1FF9A 1PQWA 3UOGA 1JW9B 1HE2A 3W6ZA 3BMCA 4JP2A 3C1OA 2GASA 5A02A 5AQ1A 4R5MA 2NQTA 4LK3A 4WLFA 3ZWCA 4B4UA 4HY3A 4GX2A 2FR0A 5EN4A 1YGYA 1MA0A 2X9GA 3VVBA 4RF2A 1EEHA 2YUTA 2ZQZA 4JROA 4CUKA 3OIGA 1GY8A 2BELA 4FN4A 3KV3O 4CM7A 4I1IA 3ZWOA 1GV1A 4TRRA 3DBVO 2Q4BA 1JQBA 2VRCD 2P4QA 3S2GA 2VNAA 5CDYA 3DFUA 1Y81A 1TB4A 2O3SA 3AUTA 2ZYGA 2Y67A 2VRBA 3S8MA 3DHNA 1P33A 1WMBA 5LCXA 2QZZA 3I9OA 4GLOA 4GPD1 2HMTA 3SXPA 3ZWPA 1LXCA 2DBVO 1UUFA 2VOEA 1JWAB 3K92A 2X5JO 4MKXA 3RKUA 1HE5A 4IQ8A 4Y9DA 1WDLA 2HMVA 3BA1A 3GFGA 4CMCA 2EV9A 4PN3A 1E1LA 4K6CA 2YHIB 1YONA 1IHXA 4QSMA 3R3SA 5I9MA 3VPHA 1GAEO 1UP4A 4YXFA 1AHHA 4YYZA 1E1NA 4PLYA 3AI2A 5KWEA 4BO0A 5IN4A 3O03A 1BVUA 1WZEA 1ZK3A 1GEEA 1SO8A 2NVBA 2Z1MA 2I65A 1H2HA 1A27A 1F0YA 1U7HA 3PYXA 4MKRA 4CV0A 5ICSA 3D5QA 1W8DA 5ENVA 4YT4A 2NUAA 2B4TO 3Q3CA 4J90A 4I5EA 3PYLA 5ILGA 3UAGA 4I8XA 1KBZA 2ZJ1A 5EQDA 3WJ7A 5C7IO 1MUUA 3JQFA 1A4UA 2ZTUA 2ZJ0A 4NU5A 2FZEA 2H5LA 2JFHA 1WMAA 3PTZA 4U7WA 4TVOA 4KUEA 1QG6A 2X7HA 3E48A 4FW8A 4FFOA 4YBZA 2B4QA 3PP8A 3WXBA 1Q2XA 4ZRMA 1NQOA 4BS9A 3WMWA 2HKIA 4YJGA 3V1YA 6ADHA 1NHGA 2PR2A 2EXXA 4ZQFA 3RFVA 4E13A 4N5MA 1K0UA 2CY0A 1K5HA 4TQGA 5I9LA 3VH4A 4UREA 3AOEA 1P44A 5TLSA 5DP1A 1DIGA 2Q46A 1UZLA 4BKPA 1E3WB 4R69A 3G49A 3ZW9A 4EUEA 3V5NA 2PV7A 5KKCA 4GVXA 3WNQA 1N9GA 4BO7A 4RL6A 1E3LA 1DOHA 1U8XX 2OO5A 3DR3A 3OQ6A 4CM8A 3HWRA 4OAQA 3DZBA 3UCFA 1ZVMA 2CVOA 4XCVA 3C1AA 2WE7A 1DHRA 1VJ0A 4FR5A 3OIDA 2J5RA 1HZJA 1R37A 1O9BA 3VOSA 1ZZEA 3JQAD 3ETDA 3K31A 3A28A 1P1RA 3AOGA 1QYVA 3D4PA 4D44A 1GEGA 3AU8A 1QSGA 3OBBA 3VAZA 5HTOA 4OXNA 4ALMA 1PJCA 4AJ4A 1PGJA 2BMAA 1EUDA 3UGKA 4E2XA 5AXAA 4J43A 1D1TA 1PZGA 2W4QA 4ZQGA 4UEJA 4II3A 5TJHA 4EUFA 2BGKA 5EESA 1P77A 1X1TA 2DFDA 5DBIA 2AG5A 1X1EA 3MJVA 1PR3A 1IHYA 1WDKA 4XR9A 3WQSB 1UXJA 4C4OA 2JCXA 4ZU3A 1OMOA 4PGFA 1BGVA 4ILKA 4KQXA 1E3IA 2DTXA 3HG7A 3JSAA 3ZN2A 2GLXA 1YB1A 4YAJA 4UVHA 5B12A 3QWAA 3SLKA 3AJRA 4BNGA 3KXDA 2GN6A 1QRRA 3ZNQA 3VZQA 2HRBA 1B26A 5JS6A 2ZB7A 1GL3A 1I3MA 2G1UA 3LK7A 1CIVA 4JXKA 2VHYA 1OFGA 3QIVA 3F1KA 4AVYA 3HSKA 3GG2A 5HBRA 2J6IA 2O4UX 3I4FA 5DN9A 5FEUA 3PJDA 1WAMA 4XRGA 4G65A 1DRVA 2Q2WA 1U2DA 3TRIA 2DTEA 3ZWAA 2X0JA 1U3VA 3HB4X 2OL4A 4OH1A 4JBGA 4IIVA 2UV8A 2PA3A 4E2WA 3ZV6A 3ST7A 2B69A 1EK5A 1WZIA 1UZMA 1DFGA 2HDHA 4QFDA 4H16A 3K30A 1QORA 4BNFA 2ZB4A 4XR4A 2Z5LA 2VYNA 2FN7A 2YDYA 3H9GA 4L4RA 1FDVA 2BFAA 2G5CA 4BKUA 2CVQA 4TKLA 2RH4A 3WQRA 4WLNA 2GN8A 3Q0EA 2WYUA 3JQBA 1I01A 1I0ZA 3GEMA 4DYVA 4FFNA 3B70A 4NH4A 4E5NA 4OXYA 1XU9A 2NV6A 4JGBA 2NVUB 1E3SA 1DIHA 4CM6A 1R16A 4R54A 4WNCA 1T24A 2O2SA 4GQAA 4EDFA 1T2FA 2X23A 1DIRA 2HAEA 4J3FA 3RD5A 2V7PA 1HTBA 1KVQA 4GGOA 3VH3A 2Y99A 1YL6A 4AJIA 4CM4B 4BGVA 1MFZA 3SLGA 1U5AA 5BNTA 4RF4A 4CM5A 1AUPA 1U8FO 3ZNNA 5F5LA 2DQ4A 3AWDA 2LDXA 3L9WA 4FJ2A 1HYHA 1GCUA 1GQ2A 4R9RA 3OETA 2C20A 2Y1GA 2GN9A 3B1FA 3I9NA 5JY6A 2GN4A 2WEKA 2AQIA 3BTSA 1GCOA 1LSUA 1R0KA 2FY8A 4YJGB 1MB4A 1OAAA 2R00C 3K5PA 4XYLA 5T8KA 1BW9B 3FNEA 2W2LA 3AOEC 3DTYA 4D3SA 1PJSA 1VKNA 1I2CA 1W73A 2IRWA 1K6IA 1B8UA 5G2OA 3NJ4A 2RIRA 3ZWWA 4QFCA 2P2SA 1U3TA 1VJ1A 3BHJA 4GX0A 3DZJA 5F3RA 3ZWMA 5TNXA 1S6YA 4YR9A 3OECA 3DZIA 5CPBA 4CM8B 4IDAA 3OJ0A 3RKRA 3QWHA 1KY5A 1LC3A 4AG3A 1ZK0A 1I24A 1Y8RA 2XOXA 1CRWG 1X7GA 3R3JA 5FFFA 1H2BA 1XEAA 2PK3A 1LRKA 4U6SA 1HT0A 1HDXA 1IY8A 5JBIA 1A5ZA 3SC4A 1YVEI 1L1FA 2OFPA 4GX5A 1ULUA 3WJAA 4CMKA 3I3OA 4R41A 4CUJA 3C85A 5K6AA 4PLWA 2O48X 3RBXA 1CETA 5JAZA 4PLTA 1C1XA 4BOYA 5A06A 5TT0A 4BMSA 5DBFA 2WTBA 3EZLA 1N5DA 1LSOA 2EF1A 2DLDA 4LRSB 4PLPA 1G1AA 2JD2A 2PD6A 4S1VA 1HLDA 2A9FA 3JV7A 1ADGA 4D3FA 3TOXA 2YFHA 3IUPA 4ND3A 1BSVA 1SPXA 4MO2A 3TF5A 9LDTA 2DUUA 3GGGA 1I3NA 4I08A 3D3EA 3OM9A 3NAQA 5CG2A 5IZCC 1D8AA 2BI7A 1J5PA 1PJBA 3ROMA 2CNBA 1PJLA 2D5CA 5IXSA 7MDHA 5U4QA 1XHLA 2Q1UA 1CEQA 1O0SA 3GOHA 4E5YA 1I10A 1XQ6A 2W2KB 2EJVA 3ZDFA 1U4SA 3DL2A 3GEDA 5KTKA 4FQ8A 2HUNA 1KEPA 4QQRA 3U62A 4IJKA 2Y1EA 3HFSA 3QHAA 1N2SA 5T67A 2C82A 5CPFA 1YWGO 5C37A 2O3QA 4J9VA 2E4AA 4IPTA 2AQ8A 3BZUA 4LMPA 5HRUA 1R4MA 1T2EA 3C24A 3SJUA 4PCVA 1DC4A 1T4DA 1YH3A 3H3FA 2F1KA 1EE2A 1XKQA 4A5OA 3JQ9C 5HS6A 4L4SA 4RPHA 3IKVA 3KYDA 3HUDA 3JQBC 1O95A 2FRDA 1ID1A 2JHFA 3CMMA 4L9RA 4BNIA 5B1YA 1LUAA 3A4VA 3DBHB 1KEVA 1Z73A 2YDXA 5JO0A 4R3NA 1NASA 3RIHA 5TGDA 1KC3A 5JW6A 3UF0A 5C7OO 1IYZA 5DCWA 5JY1A 4BO3A 1QKIA 1GADO 4MVJA 1WVGA 1JKIA 1LNQA 3ZWNA 4GSKA 1T2DA 1JAYA 4GVLA 4BO5A 1PGNA 5TJ9A 4WECA 2Y1OA 3OJFA 5AXDA 1SCUA 3GVPA 3WR5A 5FI3A 3E03A 3G1UA 1MXFA 3WSVA 3SVTA 1XU7A 1XR3A 4WCDA 1AXGA 3E5RA 3PYMA 2EW8A 4HV4A 2LDBA 1BXKA 1HXHA 1JWBB 3F3SA 5KVVA 1BXGA 3CE6A 3ASUA 4NHEA 4Y6PA 5L45A 2DVMA 2O7QA 3I1JA 1ZIDA 2IDZA 4MP8A 4AJLA 4XJSA 5CDTA 1PJQA 1NNUA 4ZRNA 3FSRA 2QG4A 5T8KC 2I9PA 1BWSA 3EYWA 3GDGA 4ITUA 1Y7TA 5GY7A 4CQMD 1Z45A 3H4VA 1TVEA 1PTJA 5LC1A 3UVEA 1BMDA 2I5PO 3PHGA 5CDGA 4CR7A 1KEWA 3QWBA 3E9QA 3AUUA 1N7GA 3LLVA 3NV9A 2AEFA 1KS9A 2AG8A 1SB8A 1DC5A 2IXAA 4MJLA 4RF3A 4LISA 1KEUA 3NRCA 2GO1A 1PQUA 2CZCA 4J0EA 3GVIA 1PWXA 4CLRA 1IOLA 2EERA 1I30A 4MOWA 1HF3A 3RUHA 1SNYA 3NT5A 3F46A 5HM8A 3H5AA 1M75A 2VT3A 4GMFA 2H9IA 4TZKA 5U1PA 2E37A 3BTUA 2BF7A 5DF1A 2D0IA 2V6MA 2X1HA 3QWFA 3TPCA 4MVJE 1H6DA 1H6BA 1B8PA 5A05A 4FJ1A 1LLUA 4FOSA 3ZWVA 4DQUA 3KEOA 1MC5A 1CERA 4RCVA 4EYEA 4NDNE 3KLPX 1Z7EA 2BGLA 4RV9A 1YQDA 3H7AA 4YJFB 4RZHA 5EL0A 1C1XB 1LQUA 2O3TA 3TL3A 5IDQA 3GA0A 1EUZA 1KY4A 4TROA 3RBVA 3GZNB 1YBMA 5A03A 4ZD6A 2CMDA 2ZQYA 2HJRA 5MGBA 1EQUA 1DAOA 3AI1A 5KVSA 2B35A 3P19A 4AL4A 1I32A 5IDXA 4Q3BA 1JA9A 2Z1NA 3JQGA 4L74A 1YB5A 1LDBA 3NTOA 4E5MA 3C7AA 3LF2A 5T57A 1XSEA 3EVTA 4MP6A 1T4BA 4F6LA 4R9SA 3WYCA 3MJSA 3WGHA 4E3ZA 3OEYA 1T2AA 4YTEA 3T7CA 5KNLA 3QJ5A 2WM3A 3KYCA 3RUEA 1ZEJA 2Y0CA 3NJ8A 2X8LA 4OO3A 1TA4A 1VSVA 1UR5A 2PZMA 1N1GA 5B4VA 4A27A 3RCBA 3L4SO 4MVJM 1OC4A 2UDPA 3WTBA 3RUIA 5IZ4A 2NU9A 1OBFO 5A3JA 3VZPA 4G5HA 2PY6A 4CM9A 3DHEA 2NU8A 2W8ZA 4DMMA 1VJTA 4YACA 3ICPA 3NKLA 5A9SB 2XPCA 3KM0A 4CUZA 3JQ7A 4PG5A 1EK6A 2D59A 1E7MA 5EIOA 2YHIA 1T1SA 4OQZA 1IL0A 3VKUA 3KYDB 1BG6A 3MWEB 4UUMA 4BGIA 4A10A 3CSDA 4IDFA 3B1KA 3TN7A 4HNHA 4YT5A 3KO8A 3A9WA 3AU9A 2WMDA 3JQCA 4YQYA 1H5QA 1DRWA 4FIZA 4NZ9A 1AE1A 3ZW8A 3DBLA 3PZBA 1HL3A 4II2A 1QYXA 4RPGA 1NM5A 3PDJA 2ZTLA 5KJ1A 1UDCA 4FGWA 3ZV4A 3ZHYA 3RC7A 1WWKA 2DM6A 3G79A 5ITWA 4W7IA 4MIYA 2B83A 1B15A 3GF4A 1LBEA 1HSOA 3B6ZA 3UHAA 3UH1A 1BXGB 2IYPA 4XWYA 2CSUA 1SAYA 1X7DA 1NVGA 4I9NA 4IMPA 3LYLA 1ARZA 3GH3A 4J4HA 1Y9EA 2PFGA 1K89A 3WSWA 2C7GA 4E0BA 2Y0EA 3O38A 4P8RA 5C5IA 3NGLA 4Z9YA 4YPOA 1LC0A 3LC1O 1X13A 5IDYA 3F4BA 1BDBA 3WGGA 3KRTA 3WIDA 4M8SA 3H9UA 1MG5A 4CLRB 1HLPA 2YQ5A 3I4CA 4XGNA 5KJCA 3S1LA 4ZJUA 1MP0A 1Z75A 1X14A 3OQBA 2HMUA 3PGXA 5DULA 1ZH8A 2WDZA 1GZ6A 4MVJD 4ZA2A 3VZRA 4JCOA 4KTVE 2Q2QA 5JPIA 1GU7A 4BNNA 3RWBA 1PGPA 2CDAA 2C29D 1NFRA 1ZXBA 2DKNA 5A5EA 2YZ7A 3H6KA 5AYVA 5ITVA 3LQFA 5J23A 3SBOA 1D7OA 2ZYDA 1HDZA 4LSMA 1GTMA 1UP7A 1VE9A 4PLVA 4U6QA 4ZQBA 3WNVA 1LU9A 2VHXA 1ISHA 4A03A 3QVWA 4RJTA 1R0SA 4NBWA 1H6AA 1TT7A 2IEDA 4FGSA 3H5NA 1VL0A 1C0LA 5T6BA 3WICA 3OA2A 4KP7A 5GMOA 5IFLA 1JKJA 3D1LA 2G17A 2B0JA 3AM4A 3BXXA 5JAQA 3ZI0A 3KZVA 2PH3A 4L0QA 2NLOA 4HFNA 3JQGB 3HADA 3I6IA 1JN0A 1H0KA 3MEQA 3WIEA 2TMDA 3PHJA 2Q1TA 3JCZA 1V35A 4EUHA 5DCUA 4BGEA 3ENNA 4XQ9A 4WLUA 4EW6A 3IP3A 4J1QA 4NK4A 1ISFA 2NQ8A 3FBTA 4CV2A 3U49A 4DXHA 1PSDA 3B1JA 4E30A 5DNAA 3KYCB 4J9UE 5TQVA 4J1SA 1MXHA 3V1UA 2Y1CA 5T64A 3D4NA 3PLRA 5K9ZA 4LMRA 3OH8A 4GWKA 3F47A 4PZCA 4Z0HO 2ZTVA 5EQFA 4OGWA 2VT2A 3FI9A 5HA5A 4UAGA 4EBFA 4J7XA 1J0XO 2CVZA 5JYEA 1BRMA 1WPQA 3JQ7B 3WX0A 1NQAO 3DAGA 5TF4A 6LDHA 1XCBA 3DHYA 4HX5A 2NVUA 1K6JA 5IN5A 3ROKA 3RROA 2NTVA 1LDMA 2CD9A 4O1MA 2V6GA 3OJLA 4BQRA 3INRA 2DPHA 2H6EA 2GERA 1LRJA 3UN1A 3DOOA 2BKAA 4CM4A 1QR6A 3U4HA 3ZWBA 5KIAA 1BTOA 2D3TA 3DBLB 1NPTO 1HZZA 4C7KA 1J6UA 4D41A 5KJ6A 3UFXA 1Q7CA 4Q3DA 4ZGWA 5TSDA 1YB4A 3A1NA 5K0ZA 4IUYA 3QVOA 1KIFA 2A92A 4GH5A 4BNMA 3F6YA 2FOIA 5CFZA 3M6IA 4GBJA 4NK5A 4RPJA 1NVTA 5G0WA 1C3VA 4QEDA 1HETA 1S7CA 2VUTA 3L07A 3FHLA 3L77A 4R1NA 4TKMA 4W9NC 3GFBA 3I9KA 1KYQA 4OOFA 3LSYA 4NQZA 4Z6KA 3KETA 1BW9A 4ALIA 3L9XA 3WWZA 2VNSA 4IDBA 4DVJA 4W6ZA 3AI3A 5L4LA 4J7CA 2B36A 4RVHA 4NU6A 3VHRA 1H6CA 3D64A 1PS9A 4WNIA 4E2ZA 2VTDA 2VZ9A 1XYGA 2ZTMA 4GWGA 5G4LA 4UUOA 2UYYA 4EJ6A 8LDHA 3S2EA 1I2BA 1LSSA 4J1TA 2V6FA 1IPFA 1K3TA 2JJYA 3D7LA 3WDSA 4DIFA 2ILTA 1K2WA 1CF2O 4Q39A 2FZWA 3IP1A 1KVUA 1Y5MA 1DLIA 4GI2A 4MIOA 5JSFA 2HMWA 2G82A 1EMDA 2PZLA 3E82A 4OKNA 2QYSA 3ZNPA 4D7AA 1HWYA 4WJZA 3L4BA 3FNFA 4ROSA 2YY7A 1WW8A 3CUKA 4EGFA 1EVZA 1LDGA 3ONDA 2C2XA 4BKRA 3KLMX 4YAEA 3ZU4A 3PIIA 4CLOB 3HQ4O 3EDMA 1DJNA 3GY0A 3ENKA 5JCJA 5I7EA 2C0CA 4TVBA 1ZEMA 2GF2A 3T4EA 1QYDA 2QIOA 5F1OA 3GRKA 2XXBA 3MZ0A 1J4AA 3GRPA 2J3IA 3H9QA 4I5DA 5DCYA 3AFNA 1NAHA 3EUWA 1Z74A 2VUSA 3OA0A 1SZJG 2I6TA 3PHLA 1PR9A 4WK6A 5AOVA 3LLSA 1P1KA 2JHGA 2J3JA 1EZ4A 5BSHA 5DDIP 1NBOA 4D79A 3CXRA 3I83A 1FDUA 4NJMA 3Q6IA 2HU2A 3DAFA 3WYBA 3GVCA 4XYEA 2W2KA 3IAHA 1EBFA 4PFJA 4IGEA 1SBYA 1ZUD1 3DBRB 3JYOA 3QY9A 4YT2A 2ET6A 1SOVA 2WYWA 1H94A 4Z3KA 5IDWA 1ADCA 1PL6A 1NQ5A 3HDHA 5JDCA 1DXYA 3TL2A 3OFSA 4IBOA 3GT0A 1YL7A 4B3IA 1X15A 3COSA 4UUPA 3M2TA 3TJRA 4RPLA 4J1NA 1HE3A 3WOHA 4OMUA 2VUUA 5B37A 4BNKA 4PLGA 3MJTA 4DPLA 3UKOA 2FPIA 2VTEA 3F5SA 1PS8A 3BHIA 3INGA 4JJGA 3ADPA 3WGTA 2JFGA 4XDZA 3DBHA 3H9EO 5IJZA 3K2EA 4PLZA 2VYVA 1E5LA 2Q45A 5CG1A 3TFQA 1A9YA 1WXDA 4DYDA 1C0IA 4XIJA 3K6JA 4B7UA 1P1JA 4HNGA 1RYDA 2Y66A 3B20A 3WMXA 5THKA 3VH1A 4HBGA 1QXSA 4Y6SA 5L7YA 3FNGA 2DFVA 1SC6A 4WPGA 3QLJA 1DLJA 4W99A 1Z6ZA 2JAPA 2GZ1A 1E7SA 3JQFC 2VN8A 4IY1A 3RQSA 1U7TA 1BVRA 2O50A 3GMSA 3H8VA 3MCVA 1MC4A 1KVTA 4K1LA 3IKTA 3KEQA 2IEBA 2VHZA 3FR8A 4AICA 4WLOA 1JAXA 4MP3A 2OMEA 3CINA 1NHWA 4QTZA 2H1SA 4XX0A 1N92A 4J91A 2B37A 2PGDA 1MFPA 2DPGA 4A73A 3ANLA 4DMLA 1PGQA 3S2FA 3P2YA 3HHPA 1KVRA 3GDOA 2Y1DA 4XYGA 4M86A 3DDNA 4ESOA 5CEEA 1FDSA 1I3KA 1I33A 4EITA 1JLLA 4PVCA 3UICA 3DONA 4WLVA 4BVAA 3IS3A 3K2BA 3WLFA 1GZ3A 2GPTA 3S55A 3ZV5A 1DBVO 1U2GA 2HRZA 3Q9NA 4IDDA 5COBA 3RU7A 1R15A 5FF9A 4CLEA 3EHEA 3WWYA 1PEDA 2EWMA 4P38A 4URFA 1UP6A 2ZB3A 3U4IA 3PRJA 4FD3A 4Y6RA 4D43A 3HZZA 1M6WA 1OI7A 5ER6A 4UVEA 5KVCA 4H3VA 4XGIA 5G0TA 4OM8A 1GYRA 3GN1A 1JVSA 4BNXA 4F6CA 1JTVA 3GNTA 3MJEA 4KTTE 2X0RA 4PZDA 2NTJA 4LVUA 1UJMA 4ND5A 1B3BA 4YJFA 4I9HA 2HQ1A 3L4BC 2Q4EA 1ZK4A 5DOVA 1AXEA 3F4LA 3GZNA 5G0SA 1MV8A 4AJKA 1M66A 2FSSA 4MIEA 1RYEA 3UW3A 4BKOA 3PEFA 3SEFA 1F8GA 1GFSA 2C2YA 3JQ6A 3EY4A 2PD4A 3W1VA 4M1QA 3W4IA 2HK9A 4Z3DA 1C1DB 1LI4A 2GNAA 3GNSA 5I8ZA 2VZ0A 1DHTA 1Q1NA 3LT4A 3GAZA 1F14A 2YW9A 5A9TA 4JJIA 2I99A 2Q49A 4NJMB 1I5RA 1LLDA 3KB6A 2AEMA 2P9EA 2A35A 2BFOA 2PGLA 1NTOA 5KJFA 2Q1WA 3VPXA 4QT0A 4JNKA 4BL5A 5JDCC 2BI8A 5JNLA 5JAIA 3GGPA 3JD2A 5F1PA 1LJ8A 4HP8A 1M2WA 1E6WA 1YKFA 4IDCA 4XB2A 5A9SA 3PI7A 1HDRA 2C54A 3ZWYA 3TFOA 5I7FA 3H3JA 4OQYA 3SX2A 1Q0HA 4L76A 5KOIA 5CAEA 5GZ6A 4RZIA 1B0AA 3GUCA 2OBYA 3UXYA 1TXGA 2CF5A 2GSDA 4CODB 3DO5A 5BNFA 2P4HX 3KTDA 3GQVA 3STHA 3U4CA 4MDHA 4FB5A 5JCJD 4I9UA 2X6TA 1O6ZA 1CWUA 3GHHA 4NFYA 1GQYA 2J8ZA 3VPFA 1RJWA 3ZU5A 1V9LA 4XB1A 1CJCA 1EDZA 3ORFA 1QP8A 3QWIA 5ADHA 1PJ2A 2O7SA 4HWKA 1NR1A 3E1KA 3LVFO 1FXSA 3DZFA 3HN2A 4B3JA 3N7UA 3QVSA 3GR6A 2OOSA 1JDJA 3D5TA 3I9MA 1P0CA 3FPLA 5JDIA 3E8XA 2GD1O 3KVOA 3OJEA 4FOOA 4RVDA 2EP7A 4U0KA 4UULA 4WCFA 1VM6A 2DU8A 2WD8A 4PRKA 2PGJA 4QUKA 3RUCA 4XIYA 2ZCVA 4D3DA 5COAA 4LSWA 5DT9A 3W8DA 4A0SA 4BQPA 1BDMA 3PGJA 4E6PA 3F1LA 1Q7BA 4F3YA 3GZ4A 1PU2A 3I9LA 3G0OA 1ML3A 3R0IA 3OMLA 4HXYA 4RORA 4EEZA 1IZ9A 1X7HA 4JP3A 2VOJA 3AY6A 4ZQEA 5IG2A 1BXZA 3I23A 1QLHA 1DSSG 2VYND 3HFGA 4L73A 3W4JA 5I7SA 4IGFA 5AXCA 1SEVA 1UZNA 4ND1A 3PHHA 1NPYA 3IC5A 4HFJA 3O4RA 2RHRA 2BRUA 1DFIA 1GYPA 2OUIA 4IMRA 2GGSA 3GN2A 2WYVA 3BMNA 3RI3A 1YOVB 3ONEA 1FK8A 3KSDO 3E5MA 2RCYA 1MGOA 3NUGA 5TRTA 2Y68A 2RH8A 1DRUA 4BNVA 2UVDA 4IXWA 3SC6A 2A94A 1DAPA 1ENYA 1XQ1A 1J49A 1CDOA 2EHDA 4XDYA 3I52A 4IQ0A 5K6AC 2D8AA 3VPSA 3OIFA 3WGZA 3O26A 3AFMA 2H63A 3LC7O 4XGKA 1TT5A 2B5WA 5FYDA 2X58A 2AXQA 3GGOA 5G0UA 5L7TA 3GDFA 1Y8QA 2GZ3A 3PJEA 3OP4A 5TX7A 4EJMA 3JD4A 4BUCA 4B8WA 1A72A 1OZAA 4FFMA 1UH5A 3K9QO 4NBUA 3JD0A 4YCAA 5ICMA 1NYTA 1R66A 3M1AA 1EFKA 2W2LD 4CMIA 5BSFA 2JKVA 1I36A 2PKQO 4CMAA 1PS0A 5A5FA 1PJ3A 1E6EA 3PXXA 3WQQA 4RVGA 4NG5A 4QO7A 5BSEA 2FSVA 4BB6A 4H7PA 1HYEA 1TLTA 5IXYA 2WSBA 1LA2A 1PZEA 4Q3CA 3LC2O 4BV8A 4D42A 4O0LA 3H65A 4CJXA 3QV1A 3DXFA 4Y98A 1UAYA 1E3JA 1YQGA 5BT9A 3VKVA 1E1KA 3I5MA 2IZ1A 4YRDA 1VSUA 4NFSA 5LDHA 3VTFA 2AA3A 1NPDA 3VVCA 4O63O 4UEKA 4WKGA 4XD2A 4ZHSA 4HKTA 3AW9A 3W8EA 1H9AA 4CV1A 1ISMA 2J5QA 4P4NA 1H93A 4CM1A 2J5KA 4GKBA 2I66A 3IMFA 1PWZA 4OKIA 4RO0A 3DWFA 3ZZNA 3CPSA 3NDJA 4RVUA 5CP8A 4FC6A 1NWCA 4DBVO 2X0NA 3ZGYA 4B4WA 4LGVA 3BIOA 4M54A 4YJHB 4MKZA 4HUJA 3PVZA 4WUVA 3MTGA 2A4KA 4BO8A 2VWPA 3AUAA 4DPMA 1ZSYA 4OHUA 3P7MA 4IJUA 3ADOA 3WB9A 1ZFNA 1M6HA 3WG9A 5A4DA 4GAEA 1O94A 4FCCA 1ISGA 4W7HA 4B3HA 2HO5A 2HSDA 3JQAA 2VHVA 3AUSA 4YAGA 4GKVA 3D3WB 2NSDA 4E2YA 1D3AA 4D45A 1TI7A 4Q3NA 4WCFC 1XDWA 3FCOA 4WCFB 3WBBA 4Y67A 4RGBA 1VKOA 4J49A 3ZV3A 1T25A 5DOZA 2FP4A 3W8FA 1ZMTA 3H2SA 3ULKA 1E7WA 1QV6A 4PG6A 3CTMA 4N5LA 2GDZA 5MDHA 3S2IA 4FSHA 4CV3A 2AE1A 1P3DA 4E12A 3EGOA 2B5VA 2IODA 3FWZA 2W90A 3K8ZA 2QHXA 2HK8A 3L6EA 4AJEA 1P0FA 4PG8A 1D4FA 4B7XA 1HDGO 4BHTA 4IS3A 5I8WA 1UXIA 2OP0A 1KERA 3IIEA 2E49A 2P68A 4E21A 2HMSA 4GMGA 1R12A 1PJTA 3H2ZA 4DPKA 3FF4A 4F45A 4DC0A 4BMNA 3BMNB 4FDAA 1DC3A 2O3UA 5BQFA 4NBTA 2VHWA 5DBGA 4DTIA 5EMHA 1X0XA 3U09A 4DC1A 3E9MA 2Q99A 2GR9A 1VL8A 1E77A 1U1IA 1E92A 2DBQA 4N54A 3Q11A 4NPCA 5B4TA 5C7LO 1YXMA 3JD1A 4Z9XA 3CZRA 4RPKA 4CLOA 4AJJA 1F17A 3P5SA 2GZ2A 2BD0A 1TT5B 4GGPA 3WYEA 2UUOA 2YFQA 1G0NA 1DB3A 4QX6A 5BNIA 1RKXA 2J3KA 4WEQA 1V3TA 1Y8QB 1E7QA 2VWQA 5T5QA 2I3GA 3MOGA 1N1EA 2JD1A 4IM7A 1IZ0A 3H5RA 1EDOA 5A9RA 3Q2KA 5U9CA 1WDMA 3E18A 2DBZA 3JQDA 4AJPA 1LTHR 1DDOA 3LDHA 1I8TA 1KETA 4K6FA 2GRAA 4CMIB 4W4TA 3SJ7A 3NDIA 4JN6B 1ISIA 1LRLA 5L95A 1HE4A 2C5EA 1LDYA 4FJ0A 1GD1O 1GPDG 1ORRA 1YDWA 2BFPA 3F5QA 1GPJA 4YRBA 4BNJA 3WGOA 4CLDA 4DBZA 3QSGA 4B79A 3DMYA 3DBRA 3K96A 2PKRA 1UXGA 3JYPA 1SB9A 4J2OA 3ON5A 3GUYA 3PWSA 4TSKA 1Y5RA 1BHSA 1PQPA 5IF3A 3T7EA 4OYRA 1LLQA 1P1HA 3RFTA 3MJCA 1M67A 2P9CA 3GNQA 3ITDA 1CYDA 2PTGA 1PL7A 1E3EA 2NVWA 3NYWA 1ZW1A 1RM3A 3LT1A 3PFFA 4Q3AA 1FMCA 1B3RA 1YE3A 4UVIA 3ASVA 4PRLA 2OZPA 3RC2A 5L4NA 3NTQA 4YRAA 3VH2A 3PK0A 4A26A 2Z95A 5I7VA 5F21A 4Y8VA 2VCYA 4CQLA 1V0JA 1NX6A 2PNFA 3Q2IA 4IZIA 4K9DA 3JD3A 3WLEA 5JLAA 1U3UA 1PZFA 2RHCA 4R1TA 3QVTA 4IIUA 1W0CA 1E0DA 2AE2A 5G0VA 3CMCO 1ZMOA 4A2CA 1TEHA 1ZNQO 5BSGA 3OICA 4D0SA 2HCTA 4UEOA 3QRWA 4CMBA 1O8CA 3JQAB 2QRKA 1E6UA 2JFFA 4QXMA 3R1IA 7ADHA 4B8ZA 2WJPA 1LLCA 3H9JA 1WP4A 3RU9A 4BNWA 1VRWA 2D5AA 1XELA 4DLBA 2EP5A 3JQ8A 4C7JA 5DP2A 4E32A 1HRDA 2V6BA 2TMGA 3OHSX 5A04A 4I5GA 4N7RA 4OIMA 3WBFA 3QA9A 2EG9A 3KYBA 1A9ZA 2EKPA 4L8VA 1F06A 4FBGA 3FNHA 4CM9D 1VI2A 3ROPA 3F9IA 5THQA 2Q50A 2HLPA 4PLCA 1LX6A 4IQGA 4DIOA 1QLJA 3DZGA 3DB2A 3WGYA 4TZTA 3W4KA 5IAAA 2GCGA 1F12A 4R51A 2R00A 3UUWA 3ABIA 3ZU3A 5EJ2A 4OL9A 1VL6A 1RM4A 5F1KA 1AGNA 1FDTA 4OOEA 3ETEA 1GDHA 1A7AA 5TIIA 2NNLD 4HFRA 3N58A 4PIVA 4U8GA 3JYQA 2Y93A 2EKQA 4E5KA 4ZVVA 1B8VA 4NFHA 2X9NA 4RF5A 1YBVA 3DZKA 2AQHA 1Z82A 4DLAA 2IXBA 1JVBA 4AFNA 2AW5A 2X9VA 4RVSA 5L51A 5CDUA 4OXKA 1E7YA 4WE3A 4ZN6A 4J4TA 3DFZA 1N8KA 4L4XA 4X54A 1AHIA 1ENZA 4KZPA 4ALJA 3DC2A 1Z7BA 1C1DA
chains in the Genus database with same CATH superfamily
4QPZA 1CY6A 3RS5A 2WUVA 2QP4A 4JXZA 1OT5A 3E7PA 5I9IA 1L3IA 3H11B 1A5AB 3F7NA 1YZHA 3OTWA 2DRIA 1AV6A 4UZEA 4BMOB 1PNQA 1U65A 1Q15A 5H3LA 3EDQA 1E9BA 3IPXA 1N25A 4RGQA 5J4VA 2B1QA 2O2DA 3L7IA 1P1FA 2XE4A 4XVUA 4URZR 4N0PA 1VP3A 1XYYA 3AP3A 4H3KB 2GJAA 1WL8A 4LYYA 2PBZA 2NAPA 5FA6A 1KL7A 2H85A 2QL6A 3STTA 1FDWA 4A0FA 2ZDHA 4LBWA 4RK5A 1W5TA 3TZHA 2VXYA 3RVSA 2VATA 5KKAA 4E31A 3B2EA 2A0KA 3OUUA 1RLIA 5KNBH 3QENA 2JCVA 4F1JA 1N2BA 4BKMA 3QVXA 4LYEA 2H11A 4JIMA 1XB2A 3GCGA 2ZCJA 4LYFA 2YKGA 4A0HA 2HM7A 1A98A 4CG2A 4CCWA 4YV1A 2QLFA 1WO8A 1OROA 4TT3A 4R9NA 4EFKA 2ZBGA 3ED1A 3OSZA 4B47A 1E6KA 4BNYA 1R4NA 3O9ZA 5CJ2A 5G4KA 1ONSA 1OZHA 1Q1AA 3ZUGA 5E6SB 1EIWA 2KLHA 3ETGA 3AKCA 3TXYA 1JG4A 1BFDA 1LJUA 1UBUS 2IYQA 5DM70 2L82A 4BCDA 1IE3A 2REOA 3FDIA 3QX9A 1AJEA 1IPEA 1P8JA 3FTCA 4F91B 2ISCA 5EUQB 5J4LA 3K0FB 4NU8X 1CZHA 3EIQA 2O23A 4HLUA 4OLAA 4A6XA 4ED9A 2NZ8A 2M6KA 4DLKA 2GX6A 1KOLA 4LRTB 2O06A 2UUPA 3R5HA 4URHA 5IBQA 2IDJA 4ZEVA 4BO4A 3KALA 4B6QA 4R31A 1F2UA 1SXJE 4JBHA 4QREA 3K6SB 1YUMA 4LFBB 3KUXA 9MHTA 1HZZC 1VLJA 1XLTA 1OH6A 1KS2A 4OQDA 5HX7A 2VWGA 2CLCX 3RYFB 4H17A 3ZU2A 3EYAA 1AZSC 4JB0A 2YV3A 3SQXA 3SC2B 4CKWB 3RRXA 1H1LB 4WVLA 2NGRA 3GEEA 5CM2Z 1U9JA 5JANA 5DZSA 3P26A 1DX6A 4MINA 2C8KA 1BKSB 3LF1A 3E9CA 4H15A 5EIHA 3ZEAA 1N78A 3ELBA 3RSZA 3WP0A 1FTYA 4MNTA 5AVOA 1UEJA 1GVNB 3CC8A 2P6RA 2QTGA 5ALJA 5J63A 1ZMXA 3AFIA 2HQBA 3IQEA 1KF0A 5CBPB 1HDYA 4F46A 5KAPA 1Z8FA 1DO8A 1YBAA 1ESNA 4RMIA 4DSTA 1K9SA 1ILWA 1H22A 3DA8A 2NXNA 4P4GA 1MLDA 2D1YA 1BE8A 2W2NA 1Q0ZA 3A11A 8AT1A 5JCXA 2NSYA 1IG0A 1TQ2A 4WEOA 5BWMA 1CP3A 2LBPA 1IXSB 1U2TA 4NAHA 3KWLA 3QX3A 4F5WA 1A82A 2GBLA 3PIDA 1PRYA 3BORA 2E1PA 4NBSA 4ZEWA 4X92A 1MD9A 3VI3B 1YOVA 1T9BA 1KEZA 3RHZA 3AERA 3L0PA 2OORA 3LW8A 1C14A 2CDBA 3RREA 1YOBA 3HDYA 1FSPA 5DXJA 5FOXA 3ZHTA 3IOBA 1EBUA 3UHPA 1E8MA 1H0SA 2H51A 3OZWA 2P5UA 1ILEA 4AKSA 4NV3A 3AYXB 4XDHA 1PX0A 4IIDA 5A3VA 1CQZA 1TUEA 2JZNA 3HO8A 3OY2A 1TZJA 2B82A 1TPYA 4ZMSA 1FVOA 1VTKA 1YJ8A 3H0KA 2X8BA 3O8BA 3SBEA 5CA0F 2NW6A 3CX8A 4IZHA 3WS7A 3GC6A 3K09C 5ENZA 4INJA 4Q1EA 2OFFA 1RIIA 4J7UA 1T9HA 3IP7A 1CZUA 1Q3TA 2I7CA 5EJ9A 3QPWA 2D4AA 2PN1A 2RHJA 3O73A 4QYSA 1WHTB 2YZNA 4NMLA 5CA1B 4U39A 7ABPA 1L5FA 2HBZA 2JIZA 4I55F 5B55A 2W6ZA 4UTZA 3DKVA 1C0KA 3N74A 3AFGA 4YEDA 4Y1GA 2LNDA 2ZIVB 2PL1A 1XROA 2JAQA 4QGAA 4BMYA 1W0KD 2GRUA 3H3XA 1UIRA 1EM8A 3W9YA 1I1QB 4ZI3A 1XMPA 2QXTA 2VHUA 3BRQA 4F9EA 1K06A 1QPBA 1SXJC 3FBGA 3PICA 4MCHA 4NEHB 3OKAA 4OATA 1MZVA 2AMFA 5C4IA 4TRJA 2DFPA 2I2XB 1V2GA 3EGIA 3BMQB 2IXGA 3C8UA 1ONNA 1J56A 2YIVX 1P39A 2Y05A 3C6ZA 5JSHA 1V45E 4GI3A 5E3IA 4AZWA 4DARA 1SKAA 1NVEA 3LV8A 1M0SA 3HCFA 3WMGA 4O59O 2Y76A 1Q0QA 4N01A 3K9FC 3HNRA 3VDQA 3ISJA 2EDCA 4XIIA 1JHYA 1G19A 5E2AA 3TE7A 2ZXUA 3TNLA 4LYAA 1JPNA 4CR8A 5ADWA 2W6NA 4OH7A 2QU7A 4TS9A 2ODPA 1Q1GA 2Q62A 4AO7A 1IUOA 2FJUA 4JSTA 4TLCA 4QGGA 1EE1A 1ODIA 5IAEA 2ZJZA 1NMXA 1SIWA 5G41A 2OP1A 3I9JA 4Q1AA 2CL5A 1WU8A 3AGQA 3P0RA 1SELA 1ZO8A 3V8EA 4M87A 3BMOB 1LJLA 3C5CA 3STXA 1A04A 4D96A 2Z8XA 4UEQA 1RC8A 2FPPB 2WUFA 3KTAA 1Y3BE 2XBLA 3RJ5A 4AN0A 3EH2A 4ZICA 2IGBA 3HA5A 3B6MA 2F3SA 2AW3A 3G17A 1X7WA 3G1TA 5JYBA 2JCYA 3A6LA 3AF0A 1T0UA 1QYIA 3TSAA 4CM3A 3AFHA 3L6DA 3V2GA 1JR3A 2O7VA 2OZKA 1TM2A 1KWGA 5IFKA 4H9GA 1GL7A 2IVFA 2LR0A 4TM7A 1C29B 3ZK7A 1FX0A 5JSUA 3NFRA 4KWHA 2P41A 1JFLA 2IZZA 1M6YA 1YL5A 2PH1A 2QZ9A 3OF2A 4MHSA 3UHOA 4HAUA 5G1OA 2NP6A 5D01A 1NVUQ 2FHSA 3IKLA 4IDHA 1TKBA 4MUJA 1F8YA 2PKCA 5KVQA 1SXJD 4F56A 4IAOA 4ZZ3A 2M6LA 5FUYA 1PJRA 5KTNA 1KYYA 4JR0A 5FNVF 4LF6B 1YMQA 4V0MA 1T6YA 3DMTC 2AF3C 2QN3A 4F2WA 1P5FA 2VA8A 4C78A 2YOGA 4K40A 3D3WA 3COJA 1M0WA 2G0TA 4C05A 4IUBS 5EWMB 3QUBA 4DCGA 3U7QB 1W6UA 2B92A 4AWXA 1BOOA 2J7PD 1RM5A 2WAMA 3BYZA 4Q9NA 5EXDA 2ZJ7A 3V2UA 1C9KA 3D0RA 2PLRA 4U2KA 3RAJA 3M49A 3OJWA 3UWDA 1AC5A 3QV2A 2EEZA 2XF2A 2LCFA 3EAFA 4JHXA 5B2ZA 3K70B 4HEHA 3GXOA 2CNOA 3G3EA 1KP9A 4I9GA 3KSZO 2XY4A 3CISA 3I4LA 3JTMA 4PQYA 3ND8A 2J6BA 5FUXA 5D7NA 2WNHA 1WDWB 4LWZA 4IFIA 1MT3A 2Z58A 5KCZA 4JY7A 4M8NE 2ZCUA 1TQ4A 3HBMA 1OC2A 3BWDD 4LE2A 1KO8A 2ZATA 1JI3A 1G0OA 1KDOA 3H86A 1WSAA 1EPUA 3HA3A 3OZBA 4LV6A 2CK3D 4PU0A 2VIIA 3L43A 3MCTA 3FR7A 5FPPA 4OHYA 1V6AA 1PL8A 4BVLA 4MPDA 4LW8A 4RLHA 4Y6LA 5JFOA 1U2GC 1C9DB 4PCUA 2GXAA 3T7IA 1SA0A 1KMIY 1AUVA 4JLPA 2NUTB 5E0OA 5DSXA 1G6KA 1M1ZA 3D8NA 3UKDA 1R0LA 4U5QA 3VNRA 5TE9A 2R8OA 5JMWA 1JZQA 1PIWA 2V9CA 3X2EA 5AVWA 2JLUA 2IYTA 4NZPA 3A6KA 2H3HA 5FLEX 1MABB 5KSZA 3AJ8A 1MU0A 2JGNA 2ZR0A 4PEVA 2OHIA 1G20A 1X86B 2CGEA 3U3ZA 5EPUA 1SKBA 4TKUA 2L2QA 4PGAA 1DBWA 1SXIA 5DCLA 5MF6A 3JS5A 1NXSA 1UXHA 5GONA 4IEIA 2P40A 4ZCMA 2NU6A 4QG7A 2C7VA 4RY0A 5JAMA 5HDBB 3GLFB 2VPQA 2EU8A 3KOMA 1Y8RB 3KKQA 3GEPA 5IYZB 4X65B 1H4QA 4IOLA 4CQNA 2BH9A 1SPBS 4BIIA 1GAQA 4P58A 3ZNOA 1SXQA 2CNNA 2R6JA 1BYIA 4IOKA 5ILOA 3AVWA 3A1WA 4OMFG 2J0UA 3T0FA 4IQ4A 4Z53A 3C45A 2GKGA 5TS3A 4N8SA 2C96A 4ENQA 1RXWA 2QPOA 3DEKA 2ECFA 4QECA 4J0FA 4O4JF 4PYQA 4U7FA 3TNDA 1U2RA 1Z26A 2N46A 4JKIA 1ZJ6A 3EEOA 1MX5A 4TXLA 3RV3A 2HJWA 2H5EA 3RBZA 1ZJZA 4XEHA 2GTHA 3R76A 4C6TA 1QIHA 4CMEC 4FXPA 4CBVA 1A7KA 2FPGA 3A1SA 3LQ4A 2QAGC 3PFWO 2EBFX 4KVFA 1KPGA 4YXWA 1JZSA 3ANMA 3VV2A 3O4VA 2IYEA 4YHHB 2EARA 2X0DA 2EFDB 1RFGE 5I5GA 4X7MA 1YAHA 2ONCA 2GPAA 2PYZA 4M0PA 4P98A 2FDCA 1B14A 3KXLA 1MRSA 4Y0AA 4DV4B 4AI6A 2TSYB 2PLAA 3VGPA 3EAGA 4AN1A 4G81A 2JJ1D 3AILA 4YAIA 2JD0A 2V5AA 5ARBA 2M32A 2E6UX 4S12A 4B4OA 5K2MA 1AN9A 2YH2A 4YWJA 1TZKA 1RBZA 4HPWA 4XFKA 3OQ1A 1E0KA 3MMSA 1DPGA 2BM0A 3TZQA 3NT2A 4QLBA 3NHPA 3ZGNA 2FFAA 5LP6A 2C2BA 4A4DA 1OPRA 2AN1A 2GCOB 1ZP6A 1SK8A 4HGPA 5ER9A 1VBMA 3BJMA 5E38A 2Y0BA 1K8XB 1NI3A 1JKXA 1M2NA 2BMVA 2IEGA 4IH4A 4Z9FA 5GZ1A 4BNHA 5JMOA 5CXQA 1O89A 1ZCFA 3WMRA 1PZXA 3FN4A 1C8LA 3IUSA 5TEWA 3KWFA 3N8HA 1A8SA 4AW9A 3SE0A 2V7XA 3EC7A 5FR1A 3DFKA 1N6OA 1XTUA 2P9GA 2ZI7A 4QGFA 3VC7A 2P27A 1NW8A 2VDVE 1RM0A 3OP1A 5H1YA 4TUYF 3TWOA 4QOSA 1A9XA 4BY9E 5LZ8A 3P2OA 3EXHC 5CK4A 5IT5A 1AQYA 4KUHA 2BTQB 1RLMA 4LCEA 3QKTA 4FUTA 2OVBA 4LCJA 5TVGA 4KGVA 3ZHBA 2ZSHA 3C8ZA 4FS8A 1L4LA 3U3JA 3VZSA 3GCDA 4X6UA 4KV7A 5LZ9A 2YUIA 5BQ5A 2DR3A 3AIOA 2XXJA 1XCOA 2QGZA 3LY5A 3U3RA 1CIPA 4C6SA 1XG5A 4QYIB 4HLQB 3BL6A 4J0DA 4LNHA 4QBHA 3SIPA 3ZY5A 4YMGA 5KAMA 4RMGA 2CCGA 3IOYA 1IXKA 3S40A 3I3SR 1W85B 4HDNB 1U0LA 4NMXB 4XYMA 1PK9A 4JC0A 1BXRB 3NX4A 1UWKA 2P9HA 3FB4A 3ZTWA 3CX7A 3DEZA 4DGSA 1ORVA 2DGDA 2HW8A 3OZCA 2QX6A 3CZ9A 1KOJA 1NIJA 4DV1B 1NJSA 5LMNB 2FJ0A 3GLQA 1ZOOA 2IEIA 1M2FA 1OOEA 4KYIB 4Q9HA 2BBSA 4TQUS 4TWBA 5EIBC 2C2GA 2RGCA 4J2HA 4X71A 5JJCA 3EX7C 3KD3A 2HC9A 3M4ZA 1NURA 2ZBFA 1LPPA 2GARA 1X77A 1GGNA 4XOUA 3EIFA 4XASA 3FOZA 3BXGA 2AFIA 2IXTA 2O57A 4QT4A 5I7RA 4WZ6A 1H2WA 2QRJA 5IKEA 4NKRA 4GR5A 3SVLA 2K2QB 2ZT5A 5JYDA 1KJZA 2P2DA 5DTIA 2GHQA 3NHFA 4ALKA 4EGJA 5BQOA 2AF4C 4G0QA 3CRNA 5HE8A 3I6ZA 3QW2A 3V2HA 4CLHA 4NCBA 1V1RB 4PTLA 1PBTA 1SCQA 1TVKA 1ZHHA 6PFKA 4BRSA 3B51X 4ZOBA 4HDAA 4Y2UA 4UARA 4C5BA 1MGPA 1KGDA 1MEOA 3C8MA 3OPVA 3E6AA 4RIHA 2GEVA 4W5WA 3SBDA 2F9LA 2HSZA 3Q3GE 1G17A 1QX4A 3WGQA 4EW3A 1ORHA 4Q34A 3LUDA 1C30A 4EW2A 4CFSA 1GA4A 1QUFA 2AZ4A 2JA1A 3D3KA 3L4KA 3HM2A 2QR5A 3E5NA 3HLTA 1Q1ZA 2YHUA 4IP0A 4NOKA 3IQDB 3WRYA 2V65A 2I2DA 2OWEA 2J08A 3QYJA 4IVPA 4R1SA 4JLMA 4S24A 1HDOA 1GU1A 1IUKA 2Y3IA 3G59A 4NBNA 3GMDA 3K05A 1N6LA 4DJAA 3ZHXA 5DGTA 1DL5A 4IV5A 3W2TA 5BVGA 1J0AA 3V42A 4D3XA 2A0WA 2ZBVA 4QASA 3W0LB 3I8OA 3W5HA 3U17A 1EK0A 2VPIA 4R1UA 5MFZA 3Q7RA 5TPZA 1NLMA 1YQEA 2BW0A 2KBEA 2LRHA 4XQGA 5BMOA 4CLXA 3A3OA 3K16A 3UCEA 1L7NA 4YRFA 2CWDA 2PX0A 4ILEA 3NHLA 5EIBD 4E5SA 3RVJA 2PX5A 4FGJA 1GAJA 2O2XA 1QU2A 3ITKA 3F3MA 4AS2A 1F8FA 1D6MA 1EHYA 4ZT7A 1SOWA 1MH1A 1SKYB 3BD7A 1PFGA 2X1VA 3DLAA 3MELA 4ID9A 4JUBA 2JIPA 3IQFA 3OZFA 4M49A 4MS1A 1PYGA 2H9YA 5EPEA 2OLKA 3ZXSA 4AJOA 1XIVA 4X1KA 4CMGA 3DEFA 3TSZA 3ZHZA 5IDWA 3A14A 3BRCA 1HFEL 3I6QA 4O33A 1JJFA 1NXQA 1QYCA 3LL4A 1DIAA 1SU8A 3L46A 3N8KA 2UU9B 1Y6ZA 4NR0A 1M2JA 4X8MA 5JS1A 3QOYA 2JLRA 1JW9B 4H1TA 2PFSA 4NHOA 4L4ZA 2XYHA 4O29A 3BMCA 5AQ1A 2G09A 2TMKA 2ON6A 3X1WA 4LJ7A 4MVXA 1MAVA 1NRJB 2H2DA 1X74A 3B1VA 4LK3A 3J80A 2YC2C 3S28A 2E4XA 2FZ5A 1FFEA 1U6IA 2Z08A 3PC4A 5C8XA 1MA0A 1QK3A 2X9GA 4RF2A 3VGJA 1JAHA 3V4PB 2BTOA 3OIGA 1GY8A 3AP1A 2XA1A 5IBRA 3V33A 2AWNA 5H68A 3TLKA 1YQUA 3BGWA 1KGSA 1Q0UA 1V71A 2YN0A 4HWPA 4FEAA 1DEXA 2Q4BA 1XXHA 2QV7A 2X77A 3DBVO 4ARUA 1KQOA 1XPJA 2WTAA 3Q9LA 5F2KA 2JBAA 3W5AA 1E9RA 3G9QA 2FPRA 2ZJBA 5AKHA 1Y81A 3MVEA 3M83A 2B78A 1TB4A 1KQNA 5J2UF 1UBTS 3PE4A 5DBEX 4H18A 2RHMA 4LY6A 1WEHA 4EJSA 5LNK1 2EIXA 2HMTA 4PCLA 2ZR9A 2DBVO 2WKRA 2VOEA 5B1HA 3D0KA 3Q8KA 4C0XA 3UB4A 4B7AA 521PA 4Y2XA 3TAHA 4KNWA 2R87A 4MKXA 1HE5A 3EQ7A 2IKQA 4YRLA 1BQ3A 5EE5B 2EV9A 4ACAA 4AS3A 3BEDA 4PN3A 1IOWA 2O0MA 4K6CA 4QSMA 5IVIA 1ZIPA 3R3SA 2AFHA 4MQEB 5I9MA 5GJBA 3CUUA 3KKPA 4M88A 4WY2A 1AHHA 3ADKA 3PPYA 4RNCA 5DV9A 2I1QA 2OV8A 4BO0A 2H29A 1GEEA 1HQKA 1SO8A 4INOA 2I65A 1XMVA 1H2HA 1EUCB 1GILA 1U7HA 2D5BA 1L5HB 2H48A 2I6SA 3N6RA 3QYPA 2Q6IA 1JYFA 4MKRA 4Y18A 5E8JA 4ARBA 4CV0A 4PV7A 5IAOA 3R8FA 1QBGA 3G02A 1GKKA 2NUAA 2B4TO 3EVCA 1E2DA 4I5EA 4LJYA 3ZD8A 5K0BA 3UAGA 2BKXA 2H31A 3HVKA 3ZK8A 5EQDA 2IYVA 3H5LA 4J75A 1VHQA 2HXYA 2I2FA 2VDOB 3P9SA 5J9FA 3AF1A 1AGYA 1WF6A 3JQFA 2ZTUA 3RG2A 3CB2A 1XWWA 4UU8A 4JU8A 2BISA 4NU5A 1PYDA 1UPTA 1WMAA 4CE6A 2JVJA 2XRFA 3SKYA 1LVGA 5FDFA 3BSSA 2GPWA 2NN3C 4TVOA 1QG6A 2FNAA 1BYUA 2P79A 1RKVA 4BMCA 4EHLA 4Q7QA 1Q2XA 3DMNA 1WXWA 1NQOA 4BS9A 5KYXB 3GLTA 2HKIA 1Y3IA 2Q2OA 3V1YA 4MUIA 3WMWA 1RT9A 3FCEA 3DCNA 3I5YA 4KPGA 4M60A 2QUJA 2EX1A 1GSAA 4FWIB 1U3GA 2CY0A 2Y6VA 5I9LA 1JXMA 1Q7RA 1HEIA 1P44A 1XZFA 2QN2A 3NKVA 4BB0A 5AESA 1D2NA 5D1NA 1JIKA 2GJSA 3BXFA 4M1KA 5AMXA 4YS6A 1EFRA 5K4AA 3ZV4A 4R69A 1BMFA 1KI9A 4EUEA 3X2SA 5DPMA 2PV7A 4RU1A 2XZOA 2ZIXB 5KKCA 3DV0A 5CTAA 2CFTA 1N9GA 4RWEA 1GJRA 5ECDA 4RL6A 1CD5A 2R1UA 3OQ6A 3DR3A 4E51A 2DERA 3HWRA 3NAZA 4OAQA 1ZVMA 3EXG2 5EUBA 3KB8A 3N2GB 4ZO8A 4ZOAA 4HAIA 4BTLA 1R37A 1O9BA 2G7MC 3JQAD 3HL4A 4ZO6A 3RHSA 4RVNA 2Y9MB 2Z1DA 3A28A 2AOTA 3VZCA 3AOGA 1HYBA 1L9KA 1Y9DA 2ZR7A 4ENVA 4D44A 3AU8A 2PXHA 5C8VA 5HTOA 2KYRA 3K8OE 1JEQB 1VL5A 3LA6A 2Q9CA 5HZKA 4D26A 1SOUA 3QF7A 4LF5B 3CWCA 2YVQA 1UC5B 3T3DA 3UGKA 1NBAA 2G04A 3MMNA 1D1TA 7REQA 1NF3A 3K53A 2OBXA 4W6QA 3TB4A 4UEJA 1FC0A 5DTMA 2ORWA 2BGKA 4ENTA 3LTEA 2WHPB 2WJJA 3R7WA 2R7MA 2A3NA 3DPUA 2J4DA 3LQYA 3HWWA 1I2MA 4JR2A 5DBIA 2AG5A 1X1EA 2ZWMA 3D6UA 3IPAA 3M5DA 4B3CA 2PUBA 2G3YA 2FX2A 5IVDA 2V55B 2BKEA 2YTZA 2FN8A 3PNBA 5EE3A 2F90A 3ZBUA 4XWTA 3SN6A 3HG7A 3KKOA 3O4GA 5IAKA 3HLKA 2WJAA 2J46A 4PTZA 1JKJB 3DFMA 2VRWA 1QANA 3KXDA 4OV6B 4BNGA 3U1VA 3CM0A 4Q1VA 1UBMS 4N6GA 2QDKA 1XF9A 2XEDA 4GPIB 4B71A 3DE4X 3LK7A 2D4HA 2W83A 3RVMA 4JXKA 2IPOA 2QY6A 2WVAA 5FBKA 2OB2A 5I4IA 4N8EA 3HSKA 4ARCA 5FIUA 4BRUA 3BCUA 4N3NA 5HBRA 1EWYA 2ZRCA 3AF3A 1XK6A 3I4FA 1WAMA 4OU4A 3COZA 5FEUA 4OK5A 4QICA 2XNDD 3DH0A 2BGWA 2UXBB 3PXAA 2VAPA 5CX4A 3U1BA 1NYQA 1U3VA 3I2KA 4TL8A 2F64A 2UV8A 2OECA 1XVVA 1GGKA 4FGZA 1EK5A 3NBKA 2QTBA 1EFTA 5BSRA 3KR2A 5CNJA 2PMWB 2HIMA 3COPA 3Q12A 4H16A 4QFDA 2C7PA 1T2UA 4O8CA 4JC4A 4N0MA 2Z5LA 2VYNA 3PUJA 3H9GA 3IBYA 1FDVA 1JHOA 2ZSDA 4BPBA 1QJ4A 1J20A 4TKLA 4DS3A 1CUDA 2XD9A 4WLNA 4DUGA 2H18A 4CN8A 5BMVA 3JQBA 4KQGA 4P08A 1JG6A 9GPBA 5JI3E 3E05A 3GBPA 1N0HA 1Q50A 3PC7A 2C42A 3RGGA 2HRCA 1UMBA 2QGNA 2NVUB 3ZHQA 5JNVA 2Q9BA 4LZZA 2PSFA 4Q4JA 4U5XA 4OU5A 2H5JA 1WP9A 1NVXQ 1CYEA 2A0XA 2HAEA 4PNEA 2GFQA 4LAFA 4RY9A 4YJ2B 3RVNA 3UJNA 4FYMA 4MA5A 2JI4A 3Q3EA 1IMJA 4GGOA 3VH3A 2Y99A 3I1FA 4J0HA 3U13A 2UXCB 2IOHA 4KVZA 4ZAZA 1P4RA 3QYFA 3D43A 2UZ0A 3WQHA 4JC8A 3PPWA 3K7EA 1KBOA 2C1EA 4FOPA 4CI0B 2IIQA 3ZNNA 5AW6A 4ZMRA 4C07A 1M34E 3L9WA 4FJ2A 5A4MS 5J2TF 4RVCA 2OCYC 5K0LA 2GN9A 2AN5A 2PX4A 3DL4A 4FW9A 4MRNA 2ZS7A 4PNPA 4QOFA 1L4YA 3OT1A 4RTOA 3U61B 3LIPA 5K8CA 5B1EA 4EVQA 2AQIA 1D6JA 1P2GA 3UJ6A 1MJFA 3IOEA 4HLDA 4QHTA 3GLGB 4LZPA 3QY0A 1OD6A 4XYLA 3ZHSA 2W2LA 5AH0A 3AOEC 4L7VA 4GICA 4D3SA 1PJSA 1VKNA 1DP4A 2IXFA 3R6WA 5G2OA 1XN4A 1B8UA 1IQRA 3EA4A 1KAHA 1Z39A 4OHZA 5JROA 2CYCA 1MTZA 3R2JA 4QFCA 1U3TA 3BHJA 2LW7A 1V5IA 2HCRA 4LJ6A 3R3ZA 1S6YA 4L9WA 3L04A 3ZHOA 4QXAA 5CPBA 1V48A 4DMGA 3K8QA 5FUWA 3OFNA 2HTEA 2XVXA 1RXYA 3EG9A 1X2BA 3QLUC 1E2LA 4L57A 4PHHA 1CEEA 2IYWA 1GNQA 1XZIA 2V5VA 4OI2A 5H4GA 4JVNA 3E81A 4GRAA 4AF6A 4LRWA 4TM8A 2J4FA 4GMHA 1CRWG 1AQLA 2PUJA 2PK3A 1QGYA 2W6OA 1YRYE 1HT0A 1YS2X 3OZIA 4L6AA 2CJPA 4OQ4A 3O7MA 3SJAA 5AW4A 1WETA 2YHBA 1L1FA 3FYTA 3OZAA 1Y48E 2C3OA 4BX0A 3E2PA 3SZMA 3PA8A 3GRAA 2P62A 4YJ3A 3C85A 5AHWA 5AI5A 3P45A 4CUJA 5F7OA 1TQ8A 2OE2A 1J8VA 2RGNA 3ZOZA 1CRZA 3KU4A 5KHLB 5HQ3A 4DR1B 1CUEA 4IV8A 4M1ZA 5E0KB 3F6RA 3RBXA 1CETA 1OGYA 4IUCS 2NMVA 1EUDB 1RLTA 3ORHA 4KXLA 2E5FA 4NG4A 3SHQA 2FB9A 4BMSA 3O8OB 1P2DA 5DBFA 1IM2A 3EZLA 1H69A 3BBPA 5ICEA 4IRXA 1VJRA 2EF1A 2BWJA 3MAAC 3GCWA 4HNUA 2VYFA 1OILA 1JHMA 2W37A 1Z62A 2ZLBA 4KIFA 2QMHA 1TVCA 4S1VA 3UJBA 3WJ1A 2RBGA 2A9FA 3HRKA 2J0SA 3MXTA 1D4OA 1JMKC 1O4VA 1Z2PX 2GM4A 1XPRA 3LPDA 4UNPA 5IARA 3IUPA 4ND3A 2QJFA 3QLTA 2NUTA 4A1OA 4BQFA 3N2NA 4JJ4A 2ID7A 4NDAA 4Y2RA 5FPTA 2AUMA 4ER7A 1N3BA 1AGXA 2DUUA 4LF4B 1I3NA 1JHUA 3TLBA 4RD2A 4L8FA 4V0NA 5ECYA 1Y8CA 1YZVA 4M0DA 1F6WA 1KYZA 13PKA 4NX2A 5CB4B 4RWZA 1AK9A 1L3BA 1RXCA 3T34A 3KAJA 4ZO7A 5IXSA 2DCMA 3FPSA 1ULAA 4WFKA 3W2HA 5A3RA 2NP7A 3GOHA 3L5KA 5AUQA 3AR7A 2YWDA 5EJ4A 1U7WA 2BGTA 2IOFK 3M70A 3ND6A 2REQA 4BJHB 4KSYA 1U9CA 4RHEA 1NJ8A 1Y1SA 1XP5A 3GARA 4UXHA 1RRMA 1U2DC 2O8BB 3RHFA 3DE0X 3SHTA 3H18A 4QQRA 1PNTA 1O96A 1NUQA 3JX9A 4MAAA 4QUIA 3U62A 4IJKA 2Y1EA 4GU5A 4X1YA 1D0VA 1N2SA 3H17A 2ERCA 5T67A 3UMVA 1C4XA 3FNBA 1ZD4A 4D3YA 5KKNB 3B78A 3BZUA 5HRUA 3GA5A 1C5KA 2HHCA 1T91A 5DNEA 4HLUC 2WIFA 3F8SA 3MRSA 2Q3DA 1EBBA 1EJ0A 1TJYA 1DC4A 3PD1A 1FCJA 1DRJA 4LQLA 1QH1A 4M9RA 2Q3CA 4AY4A 1XKQA 4A5OA 4B84A 2FPOA 3ZCQA 3QKRA 4UATA 5GWXA 4FX5A 1QP0A 1SY7A 1XLTC 3CMMA 1BJRE 3LWBA 4P3KA 4ZVQA 3N0VA 1LUAA 3A4VA 2ZWIA 2PX2A 3OE5A 2IHUA 3BXPA 2QA5A 4R3NA 4XD7A 3K0HA 4NDZA 3RIHA 3NP7A 3KYJB 4MWSA 4OHKA 3WGKA 5C7OO 5JW6A 1AV7A 1IYZA 4BO3A 4C2AA 1QKIA 1GADO 4MVJA 3M7IA 1WVGA 4KXUA 3WIBA 4R6XA 3LUJA 4DLSA 3ILYA 2QLNA 3M9LA 4BO5A 2OG2A 2VCHA 5C1OA 4BNIA 2ID9A 2RHOA 4PSDA 4UQOA 3KR0A 3Q7EA 5B1YA 2ZM6B 2ANBA 1GTZA 2K6GA 3CTPA 4RJKA 3WR5A 3R3UA 4FGKA 2Q27A 4YV7A 3VJRA 3A6PC 4YONB 5C1BA 1XU7A 2XVAA 3CUWA 2E0IA 1R8JA 1AXGA 3E5RA 3VSDA 2VXCA 1PKEA 3HJUA 3WLAA 2JATA 5JZBA 1BXGA 1EG7A 3W2IA 4BC1A 2EBHX 1KP3A 4O02B 2VJLA 3QW4B 2HD4A 3PDIA 5AKLA 4KV9A 2RAUA 4AJLA 1AZLA 3LRPA 1NNUA 4ZRNA 4L6IA 1OBVA 1C50A 3KKEA 5EZ5A 1OVGA 4JLAA 1CDDA 1JR3E 3PGLA 5JCOA 1EESA 3E9DA 1BWSA 3KQUA 5E6UB 4S04A 1RAGA 1TVEA 4G0ZA 3RRFA 1SQ5A 2CNLA 3GMTA 1ZBDA 4BLPA 4EPYA 4RDXA 2I5PO 2ZTHA 3RU2A 3NYIA 5CDGA 2V3CC 3HBFA 2Y4OA 1KEWA 3KWMA 4CKCB 1K6EA 3O94A 1KS9A 3KD2A 4XIYA 2IXAA 4MJLA 2WHRA 1KEUA 3C8HA 2GO1A 2WUDA 3NRCA 3RJZA 4J0EA 3OM1A 1H42A 1UT6A 1W9MA 4GGMX 3NWOA 1PWXA 3Q7SA 1U6KA 4V0ME 1LY1A 1HF3A 3JAWB 3OCYA 4UKDA 3SQWA 4XI9A 3LHDA 3WDMA 3RUHA 4DR7B 2G0AA 2PZEA 3E0QA 2IY8A 3CWQA 4GMFA 9ATCA 2H9IA 2MINA 3B13B 4A8JB 4EF4A 3KT0A 3I45A 5F4BA 2AI3A 3TEJA 2WWIA 2BF7A 2QTVA 3FOWA 5DF1A 1FEZA 2ZWOA 4H4DA 4OQNA 4TTRA 4LHVA 1XZMA 4MCAA 3EFOA 2P6OA 2ZSEA 4DQUA 4QHYA 3G2IA 3LWZA 3DMHA 5LQJA 2XCQA 4N41A 4HUTA 5HZGA 4YJFB 5EL0A 1MC8A 1C1XB 3FG9A 4JVSB 3SYLA 3TL3A 3WKDA 4AECA 4BCCA 5IDQA 1TC1A 1OJ7A 3LCRA 1T10A 2J9ZB 3AVPA 4U2EA 4U7TB 3TJMA 3IR7A 4CTNA 1TEZA 4EQ6B 1YBMA 2GLTA 5A03A 4BZXA 3M81A 1D07A 5C3UA 3CKMA 2Y71A 3C3KA 3FRHA 1JX6A 1WUYA 2I54A 5BXQC 1T8PA 2WMOB 3MFYA 4HVLA 2WICA 1LF0A 1U94A 1ZOLA 3MCAA 1NXOA 4AL4A 3FZQA 4N03A 2Z1NA 4NYIQ 3E1SA 5KVAA 2CVHA 3JQGA 3P9IA 1OXBB 4XWGA 5KX5B 1LDBA 5BV7A 2WHYA 5JIBA 2PSJA 3VPDA 3ZZTA 4DY6A 1A1SA 1KZ1A 3TQRA 2H2IA 3WYCA 3MJSA 5LQMA 5TVKA 4BBJA 5JISA 1T0HB 2ZAGA 1RMTA 2G40A 4S0XA 3QKSB 1Y42X 5EKTA 2X3YA 1YR8A 3QJ5A 1G20E 4J7AA 2I4MA 3T7CA 3ACDA 3GJ4A 1DBPA 2WM3A 1T1JA 4DADA 3W9UA 1TRHA 4CIYA 3NJ8A 3W6OA 4CCYA 1B42A 2H4YA 2X8LA 3SYTA 3UKJA 5KQRA 1LLFA 2C8VA 4HBZA 3T3GA 1M7BA 2Q5EA 3HBNA 4LXHA 4MVJM 5CIWA 4LF9B 4JJAA 3WTBA 1YT5A 1I3OA 5A3JA 1HFJA 3DAHA 3FLEA 4RANA 3RABA 2NO6A 4HDNA 4CM9A 1IN5A 1RZVA 4ZOLA 4DMMA 2QVZX 4NMWA 3VNBA 3LYHA 2XPCA 3SJCA 3H2YA 1WQ3A 1E59A 2D59A 4IOMA 2F2TA 5EIOA 2VTBA 3N2KA 1W35A 1T1SA 4TYMA 2Z3ZA 5DEIA 1SKQA 1JPVA 4ARSA 5DHSA 1X7XA 1U8AA 4TX1A 5C8YB 4MPJA 4OI0A 4TYYA 1J0CA 3AY0A 1EH5A 2H1RA 3CSDA 4BJ6A 4K9PA 3PEVA 2XX3A 4B46A 2QI9F 4M1SA 4YT5A 5A6SB 1KA9H 4DDKA 3GP5A 3A9WA 1JLHA 3IERA 1QUEA 3ILSA 3SM3A 3DSRA 4HTFA 1V16A 4FIZA 1WKBA 3U4QB 1TK2A 4UPEA 4II2A 2X0FA 4AY5A 3ELYA 4RPGA 2FLWA 1NM5A 1Q91A 2ZSUA 4C0WA 3I76A 3OIWA 3PDJA 1SCNE 3HEAA 1TW3A 1SCUB 1UDCA 1EA7A 1P4JA 1RLOA 6CHYA 2PCJA 5KJ1A 4ZEXA 1WWKA 2XXAA 2DM6A 2VZEA 2D5LA 3EG5A 3AR5A 2MMGA 2QE6A 3UMCA 3R5JA 5EYPA 3AEZA 2P6PA 1E2MA 2ZW9A 4UVIA 2BHTA 3UH1A 4ZHQB 4J8PA 4QNNA 1V26A 3F3KA 1AX9A 4I9FA 4WHMA 1WBJB 2CSUA 4XWYA 4D92A 1ZWKA 3CH4B 3GCXA 5IM4F 3ROXA 2J9YB 1LZKA 3DTVA 3ZTTA 5K45A 1ARZA 4DZZA 3GH3A 4DM7A 1UAAA 1RR6A 2Y0PA 4IDOA 4KCGA 4HVCA 8ABPA 3IUEA 5CT4A 2O20A 1D5CA 1WZNA 2CFOA 3OCZA 1MO3A 3ZGXA 3N86A 1RJDA 3O38A 4P8RA 1USUA 4GECA 3CO5A 4RADA 5FFNA 3T15A 3WA6A 5C7YA 5AW2A 1LC0A 3QX7A 1Y4UA 1OQAA 3E7DA 3H1FA 3PEUA 1RKQA 4CDRA 3W06A 2X40A 3K9CA 2K4MA 3NLLA 3PFKA 4QC2A 3RDPA 3AL2A 3HHEA 2QTTA 4MWOA 3WIDA 1JGTA 2I6QA 1GKIA 4P84A 2A5DA 2EHJA 3FKJA 1MG5A 3QFRA 4CLRB 4K81B 3BD8A 2QAJA 2YQ5A 1CF4A 1ZCAA 3UMSA 3S1LA 1MP0A 1X14A 2C3UA 2HMUA 4HNRA 4FZ5A 4FZ3A 4O5AA 3ZLBA 3A36A 4OHRA 3T1NA 4N7MA 4N4AA 1XMIA 1QHGA 1O54A 4QUDA 3MPOA 5DISB 1PV4A 3U4GA 3DJFA 4GG1A 1QBKC 4QYMA 2CDAA 1FJ2A 1VL1A 2BF4A 1BX3A 1R9NA 2WR8A 1ZXBA 1UEXC 2DWUA 1E9CA 1IDN1 2O52A 3LDAA 4JA0A 1E4EB 3H6KA 3PPXA 5AYVA 3MBKA 2P6UA 3SBOA 5JASA 1L3CA 2B4KA 1M8PA 4D6YA 1L1QA 2A0YA 4K3UA 2AFIE 2BN4A 1ZUNB 2MSKA 5FUMA 4HNQA 3FPKA 3C2QA 1S3SA 4OJYA 4EHNA 1T2VA 2FTKE 1OZFA 3GFSA 4WDRA 1W36B 3CNQS 4NBWA 4DUZB 1H6AA 4DMRA 5AM5A 1SUBA 1VL0A 2OV4A 2XWQA 1E6CA 1VSTA 4HGYA 5IFLA 1P61B 3L6CA 4FCTA 2JCGA 4HF7A 3MWGA 3D1LA 4LMBA 3JYHA 2PNJA 2GSWA 3AM4A 5I48A 1NXTA 3BXXA 1PDWA 3TPZA 3KZVA 3ZI0A 5ITSA 1UDWA 4IGAA 2PH3A 3BDVA 1X3SA 1QC5B 3QVKA 1AUQA 4HFNA 4L0QA 4M36A 3T1OA 1JN0A 4AZ0A 1QM5A 2RH9B 3FPHA 4C6HA 3IIMA 3GL9A 5BN1A 5CFNA 2YV4A 4F11A 2Q1TA 3JCZA 3L1JA 3GUHA 4ER6A 4L5CA 2C8LA 4L2IB 4MI3A 4XQ9A 3V7FA 1KTVA 4KZKA 4GI7A 1PWEA 5JXHA 1VPWA 1XRQA 3MGBA 3P9XA 4DXHA 4TN1A 1L5ZA 1ZIYA 3LM8A 1FSFA 4MWDA 2QRPA 1XK7A 3BIXA 1OFIA 2R60A 3CRZA 4CHTA 1KP2A 3D4NA 5IJ9B 1B6TA 2A88A 2D6FA 3GELA 4LMRA 1H5UA 4GWKA 1CNEA 3F47A 3JAKA 1RKUA 4PZCA 2ZTVA 4EI9A 1WXFA 2PV0A 1JEOA 3IT3A 4ZYYA 2NU9B 4B6RA 2F6RA 5HA5A 4BJ3A 1E2HA 5AJTA 5K4GA 2IZ5A 2GN0A 1PEKE 3MS4A 2NU8B 4HR7A 3L4JA 4EBFA 2VHJA 1JF8A 3DXZA 4J7XA 1J0EA 4RD3A 4XGQA 5D3MB 3ESQA 1EU1A 5EJMA 4ABYA 5HJEA 1RIFA 1WPQA 1E2FA 1BEUB 1NQAO 3WNBA 4MEAA 4CDGA 5F9HA 1TZCA 5HIKA 2O1XA 3RROA 1QZ3A 1YQQA 2NTVA 2CD9A 4OFZA 1NXVA 4YXWD 4RTNA 1WCV1 1F1JA 2OFWA 4FD2A 3VYUB 3SJUA 1KH1A 4XFDA 2X2FA 4UTPA 1IDOA 5DGXA 2H6EA 2PMFA 1K7YA 3UN1A 2FUKA 5LNK6 1KZHA 3S0JA 1B93A 1K2VN 2WU3A 1NZDA 3FHOA 4A36A 3R20A 3ZWBA 2BP7B 3DNMA 4H6XA 3QXXA 2YZMA 4LTDA 4ER5A 5ES4B 3HYCA 3LQ1A 1C7IA 5KIAA 3OPNA 2O8CA 1SUDA 4YP5A 1MA3A 1L8XA 4C7KA 4F3CA