2BKAA

Cc3(tip30)crystal structure
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
231
structure length
231
Chain Sequence
EALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAT-INTERACTING PROTEIN TIP30
publication title Crystal Structure of Cc3 (Tip30): Implications for its Role as a Tumor Suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 81
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bkaA00
4U0KA 3NRCA 2JD2A 3WQQA 3QV1A 4HFNA 4KDFA 3WG9A 3GLQA 2GASA 2EKPA 4NBUA 2J3IA 1KETA 3S2IA 3LU1A 3JQFC 1ENPA 2JCXA 1SEPA 3C7DB 1LU9A 4FJ0A 4S3MA 1V0JA 5FF9A 2CSUA 2GDZA 1P44A 3NGLA 1DIHA 1DAOA 4HX5A 4MIOA 2GN9A 3ZZNA 1GUZA 3NT2A 3VPGA 3JQ8B 5TQVA 2EP5A 2YQ4A 3OQ1A 3LLSA 4RZHA 3EHEA 4ALKA 2D2IA 4YJGA 2VHXA 2BD0A 1U7HA 2HMTA 1TEHA 3ANMA 4BL5A 4KOAA 3T7EA 1EK6A 1VJ1A 2BHLA 3OETA 8ADHA 5G0SA 1I2ZA 4BO5A 1KEVA 4ALNA 4YT2A 4YAJA 4FFRA 2BF7A 4PRLA 3E6AA 5HA5A 4WLUA 2BGLA 4HFMA 2GD1O 5U9CA 1NNUA 4PZEA 1OC2A 4QXMA 4L4SA 1TB4A 4R1NA 3I4FA 2I9PA 5EQFA 1HE3A 2O3TA 3Q1LA 2IEDA 5C3MA 3CMCO 1PIWA 3UCEA 1SO8A 4Q3AA 4UULA 5DF1A 5C7LO 2BMAA 3GDFA 5JXWA 3JQ9A 2PR2A 4R1SA 2EERA 1JKFA 2NNLD 4D3SA 3GEMA 1DHTA 2Y67A 3PQDA 1I3KA 4RVGA 1J6UA 4KQXA 5JCJA 2O3RA 3RFTA 4M87A 1E6UA 2WE8A 3ZN2A 2HO5A 4NI5A 3V8BA 4AJKA 4J2OA 3TN7A 4NNJA 4BV9A 3EUWA 3U4HA 2V6BA 2WD7A 2OMEA 3DB2A 5TJHA 1I3NA 3RBVA 5GZ1A 4WE3A 4JLWA 3BMCB 4P4GA 2Z1MA 1XLTA 4ZQFA 1UAYA 3M2PA 4Z9XA 2OP0A 5B1YA 3PFFA 5A5EA 2QW8A 5IF3A 4JROA 4R51A 2AEFA 4CV0A 4ND4A 5A3VA 3PTZA 5A05A 1LSUA 2W2KB 3FNHA 1IE3A 1KY4A 1JQBA 1Z82A 3ETGA 1YL6A 1BW9A 3ULKA 1F14A 1U9JA 2V6MA 3KTDA 4R3NA 5EL0A 4ZHSA 5EINA 1UAGA 3EAGA 3VPXA 3FCOA 3JQAB 3LT0A 3ORFA 2DBZA 1G0OA 4K6CA 2OXIA 5ITVA 3VTZA 5BT9A 1I5RA 3M1AA 3JD3A 4ZU3A 5I8WA 1D3AA 2JD1A 2UUPA 3WGGA 5BSGA 1D7OA 4H3VA 5A9TA 2EWMA 4DC1A 1I3MA 3A28A 1X14A 2I66A 2YFQA 3E9NA 4GWKA 4EJMA 3C7CB 4BKPA 4XYEA 1XWFA 2J5KA 2FZEA 4QFDA 5CAEA 3QVOA 2O3JA 3PYMA 3WQRA 4B7CA 4BKRA 1U3UA 3NTQA 2AG5A 1ULSA 1B15A 4K28A 3RCBA 1AGNA 2VT2A 5CFZA 3TL2A 4TVOA 1QR6A 3DZGA 5KJ6A 2X86A 1R4NB 1E3WB 5ICMA 5K6AA 3PQFA 4O59O 4XB1A 1K3TA 5A04A 3SC6A 4J16A 3C7AA 4DRYA 1ZJZA 5JAQA 2Y93A 3AY3A 2OBNA 1C1DA 2Y1EA 3OQ6A 4LCEA 4M54A 1KERA 3V2UA 2X0JA 3KM0A 3VH1A 1FJHA 5KVCA 3ONEA 1WDLA 3U49A 4GGOA 2WYVA 2C5AA 4NK5A 5IDXA 3F47A 3VPHA 4E6PA 2PH3A 4BO9A 2DFVA 2WDZA 2NU6A 3PWZA 4UVEA 1P0CA 4BQRA 1R66A 4WLNA 3KSDO 3ZU2A 4E0BA 4F46A 5JS6A 3NGXA 4D44A 4GGPA 3V5NA 3JCZA 4TWRA 3IOYA 3CMMA 1YS4A 2IODA 3QY9A 4N5LA 4E12A 3H7AA 1PS0A 1N9GB 1AXEA 2YV1A 4AJEA 1WAMA 3QW2A 2W2LA 4PLPA 5CDUA 1W4ZA 4IMRA 4QEDA 1Z73A 2GCGA 4WPGA 3AUSA 2AEJA 5DCYA 1PEDA 1ZSYA 4OJNA 2VOEA 4CL8A 3KYDA 4TRJA 1XYGA 4L4RA 3RUIA 3U4CA 1KC1A 1YXMA 5G4KA 3WTBA 1U8FO 1UZMA 1X1EA 3WMXA 1U3TA 3BIOA 3RC9A 2O3SA 1LDYA 3PYXA 3FHLA 2OORA 3U09A 2H1SA 1U1IA 3TZCA 5CPBA 3GRPA 4B4WA 3DBHA 2DBRA 5COBA 5ADHA 4Q3BA 1F8FA 4NIMA 3DBRA 3PI7A 9LDBA 3DOOA 4IDFA 3I6QA 5AXAA 1MB4A 3S1LA 4OO3A 4IXWA 2PLAA 1OOEA 3D0OA 5EN4A 3GQVA 3D3EA 4WLOA 4CMHA 1PS8A 4FFPA 1FDWA 3H4VA 4C4OA 3HADA 1G0NA 1N2SA 1SB9A 2GZ1A 2Y05A 5IG2A 4XJTA 3H9QA 3UVEA 1XKQA 1C3VA 2DKNA 4TQGA 1YDWA 5TGDA 1UP4A 3UN1A 2FRDA 3GN1A 2FR0A 3GVHA 3W4IA 5K0ZA 1HDRA 3RIHA 4DBZA 4NZ9A 1ADFA 1GCUA 4CMKA 5ITWA 3PDJA 1LDMA 2Y0EA 4D3DA 5JBIA 1YBVA 1BWSA 4R01A 2Y0CA 2C7VA 3VVCA 3E5MA 3BHJA 4IS2A 2VYNA 2PD4A 2FPGA 1X0VA 2CNBA 2ZJ1A 4L73A 3GZNA 3QWBA 4JQCA 3FPCA 5AXCA 3KYCB 1WLYA 1I8TA 5MDHA 3E9QA 2XXBA 1IY8A 2R6JA 1E1MA 3H5NA 1ULUA 4J9VA 1XSEA 3ZWBA 3CZRA 4L0QA 2Q45A 1MFZA 4AJ1A 3V2GA 5T57A 1EZ4A 4YWJA 1P1RA 4O5OA 3NKLA 3TSCA 5I7EA 2B69A 4I9UA 4J0EA 3PDUA 5F1KA 1HDGO 1DDOA 1R4MB 3LC1O 4OIMA 3DOCA 4YA6A 1YL5A 2X0NA 4IGEA 3ZHYA 1E6WA 3K2BA 1QYVA 4MP6A 1R0KA 4U6QA 1LI4A 3IJRA 2WM3A 1Y8QB 5GMOA 1K5HA 3JD2A 4CM8B 2BELA 1IUKA 3DHEA 1KEWA 1QYXA 2W2LD 1Q2XA 2HJSA 3JQ6A 3ANNA 3LYLA 3L4BA 4JJFA 3G0OA 5LCXA 4UVHA 3HDYA 3ZWPA 4HFRA 4RQUA 3QLJA 1UDCA 4DYVA 1MX3A 4S1VA 4TSKA 1H5QA 1TVEA 4DA9A 1P1IA 2CY0A 2EF1A 4R5MA 4AVYA 2EHDA 4UVDA 3LF2A 3UGKA 4HNGA 4XIJA 1F06A 2X5KO 3KV3O 3TL3A 3KLMX 3QWFA 4IMPA 4NBRA 2QRKA 1GZ3A 4BB6A 1F0YA 3TDKA 2X6TA 4L8VA 3VZRA 3WGTA 4J7UA 5KJFA 2D3TA 3WICA 5B4TA 2ZIZA 4Z0PA 4HFJA 3MJSA 2W98A 5JAIA 2VUUA 1OAAA 1E3SA 3DAFA 3H9JA 3W6ZA 1ZVMA 2D1YA 5BR7A 3WYBA 2PKRA 3MEQA 4TZKA 1UP7A 3CUKA 4NFYA 2FHSA 3B6ZA 1P77A 4BUCA 4QUKA 2P91A 3RI3A 1UXIA 3ENNA 3L4BC 1A4IA 3BTVA 1LLQA 2VTDA 1EVJA 4BO0A 1UXKA 3ABIA 3VH2A 4FC7A 1LNQA 2Q4BA 5TF4A 2OUIA 3UCFA 3WNVA 1MXHA 4IJWA 2ZATA 3WSVA 4JK3A 4HV4A 4GLLA 1R12A 1WDMA 5IAAA 1V35A 4GWGA 4TVBA 5KOIA 2UUOA 2VYND 1HWYA 2X9NA 4BO8A 4IDGA 2AE1A 3H6KA 3D3WB 2BFOA 5F21A 4CLOA 5ER9A 3N58A 5G0VA 4NFSA 4JP3A 2LDXA 3EW7A 1HE4A 4L75A 4ZRNA 4KDEA 3H9EO 3GVCA 4DPKA 4BNKA 5JFOA 1JA9A 3GAZA 3OJOA 3OIDA 4P8RA 2P5YA 3ZWVA 1V8BA 4I5DA 2ZB4A 1IHYA 2VWHA 1BHSA 3WGQA 4GH5A 2H5LA 4A7PA 5EQDA 4CUJA 4E5NA 3COSA 1P0FA 2VZ9A 3M6IA 3PWSA 1E3IA 4H15A 1A72A 1NVGA 2QYTA 3CIFA 4CQMB 3WIEA 4N18A 3BHIA 4MDHA 1XU7A 4RV9A 1JVSA 1W8DA 4XA8A 4PLYA 4CLDA 4EEZA 3DZFA 2XPCA 3JQ7A 4Q3DA 1GEGA 1MC5A 3U4IA 2GN4A 4GVLA 1N1EA 3KBOA 4JJIA 2W8ZA 1EUZA 3DZIA 5A1TA 3FR8A 4LMRA 2J3HA 3O26A 3ZU5A 4R9SA 3GEGA 4CQLA 4BMVA 4YAGA 1HTBA 3ZWXA 4RF4A 2NADA 3AY6A 1ZXBA 3K92A 2JHGA 1P1KA 2PY6A 3WGZA 5HWSA 4OMUA 3ZU4A 1B3BA 4YJFA 1K2WA 1M66A 3ONDA 3GPIA 4ZD6A 3TNLA 2GNAA 2ZYGA 2IYOA 2I67A 3PHJA 5JE8A 3GGPA 3AOEA 3B20A 2YHUA 5TRTA 5JDIC 3OJFA 3WGOA 4PLGA 4IJKA 2AQHA 5A06A 2Q99A 2VRCA 2ZCVA 3P19A 5EERA 5AYVA 4I9NA 4BHTA 5B12A 2R00A 3K5PA 3FWZA 4DMMA 1DXYA 1E7YA 4GVXA 3S2EA 1B8UA 4NBWA 4FPXA 1E3LA 2EIHA 3O4RA 1BXZA 3UICA 7MDHA 4PG7A 5COQA 3NX4A 2D8AA 3DMYA 4GKBA 1JAXA 5I8ZA 2FZWA 1IOLA 1MV8A 1F8GA 4NU6A 4U7WA 1UZLA 1HDOA 1LC0A 1NPYA 1JVBA 4WEQA 2NQTA 4UVGA 4CJXA 4B79A 1CF2O 1X13A 1U2GA 4OM8A 1DLJA 3DDNA 4EEXA 1PL6A 1X0XA 4W9NC 4QX6A 4CM9A 1B8PA 2DVMA 3RUDA 3U3XA 5T5QA 1UXJA 3VPFA 3RU7A 3RUHA 4MKZA 2NTNA 2R00C 3ZGYA 3R0IA 3ZNOA 3GC6A 1PWXA 3KXDA 3I9KA 1HDYA 3WB9A 1ZW1A 1I33A 3F46A 2PNFA 3LF1A 1WZIA 3EYWA 1CWUA 3GG9A 4JIGA 1I2CA 2B4QA 3RVDA 2CFCA 3DQPA 2EV9A 3K96A 4RDIA 1P74A 2C7GA 2YW9A 1LSJA 5CPFA 2YHIA 1Q7BA 2HRZA 4R68A 5CEFA 1NPTO 3V1TC 4B4VA 4TKLA 3ENKA 4CMJA 3NDRA 2WYWA 5IZ4A 3QVSA 3VTFA 4XGNA 1V3UA 3WDSA 2Q1SA 1K0UA 3I52A 4CR7A 4A0SA 2V6FA 3AWDA 3TRIA 4XDYA 1ZZEA 3MZ0A 4MINA 4ALIA 4BKUA 1SNYA 2VZ0A 3JSAA 3L07A 4DWVA 4IUYA 4LVUA 5COAA 4FFLA 1O5IA 4FGSA 2ZTUA 3GDOA 1KEUA 3O8QB 3IKVA 1B26A 1Q7GA 3GH3A 2CD9A 2QQ5A 4PLZA 1PJTA 3LLVA 3WGHA 4I08A 1SMKA 4YBZA 3HFGA 4XR9A 2BRUA 4EW6A 2VRCD 1AXGA 4FIZA 3EVTA 3E1KA 4F6LA 4QTZA 4ITUA 3NJ8A 3MJCA 4BNIA 3RKUA 2ZKLA 4CPDA 2DTDA 3DAGA 3R6DA 5KWEA 4WK6A 1I24A 2QZZA 2A35A 3DAPA 4KWIA 1J0XO 1U3WA 1ZJYA 4P22A 2NTVA 4FS3A 3GT0A 4R9RA 2G5CA 4L9RA 2G17A 3E5RA 2X9VA 3ZNNA 4AFNA 4AL4A 3QJ5A 3CPSA 3WFIA 1Z6ZA 2ZTLA 2NVUB 4CM7A 2O48X 4GPD1 1GQYA 4M86A 4QQRA 2BFMA 1TT5B 4FOSA 4B7UA 4YDRA 2NU7A 2OBYA 4DUPA 5G0TA 3LVFO 4AJNA 4YPOA 4CMAA 3DZHA 1H0KA 4GX2A 3AM5A 3ADOA 1O95A 4GMGA 2CDBA 2BGMA 4BNTA 3WFJA 1C0LA 2CVOA 2VTEA 1NQOA 3HG7A 3ROMA 4DC0A 3DWFA 4MKXA 5CG1A 4KWHA 1T2FA 1D1SA 4RZIA 4CL3A 4W4TA 1IYZA 1ISHA 2WE7A 1PR3A 1ISJA 1U28A 1EDOA 3LC7O 5U4QA 1GL3A 3OQBA 4N5MA 1XELA 4XQCA 2ZB7A 5L45A 4M8SA 4CM6A 5IXYA 5JY1A 3GR6A 3PP8A 5HTOA 4DTIA 2JD0A 1P3DA 2ZQZA 3BMCA 1WXDA 3PJGA 1HDCA 4R54A 4XJSA 3BMNB 4Q9NA 3H3JA 4XR4A 1GCOA 3Q9NA 1PZEA 2VYVA 4IINA 2VNSA 2NU9A 4IJUA 2PWZA 5IXSA 4E5MA 1FDVA 3RBZA 1P33A 2HK9A 4JBGA 3WNQA 1DJQA 1JWAB 3B1KA 4OXKA 5JMWA 1LLCA 4B4OA 1BMDA 1EE2A 5L4LA 1Y8RB 4OKIA 4K26A 1JWBB 4UUOA 1PQWA 3G1UA 3ZWCA 4CLRB 5FYDA 3W6UA 2Y1CA 4ND3A 1VL0A 3MWEB 1GAEO 5A3JA 4J3FA 1U5AA 1CQIA 4PZDA 3L6EA 4NU5A 4PG4A 2PFGA 4PLHA 3F5QA 1RM3A 1YO6A 4IDAA 4BNYA 4PN3A 4WLEA 2AQKA 3G17A 1EUDA 1E1LA 2W4QA 3BAZA 2EGGA 4OQZA 3W4JA 3OJ0A 1H6AA 3UW3A 1GUFA 4FCCA 1LUAA 1XQ1A 1ADCA 2VT3A 3BYZA 1DRUA 4YJDA 2D0IA 3KO8A 1LEHA 1HKUA 1NTOA 4J1QA 1E3WA 1LC3A 2G76A 1O6ZA 4YAKA 2VHVA 3KEQA 3SJUA 4WCFA 3PGJA 3GEDA 5JYDA 2DLDA 1XGKA 3DZBA 5JLAA 4UUMA 4ZQGA 4FFMA 3H65A 4L76A 1U8XX 3RBXA 3GFBA 3OF2A 4GX0A 5DOZA 4MOWA 4FC6A 4QFCA 1PL8A 2P2SA 3VHRA 4IY1A 1NQTA 1ISFA 1OFGA 1Y6JA 3QVXA 4A27A 2YZ7A 4HWKA 3NEPX 4BNLA 3GHHA 2Y0DA 1BRMA 4UEKA 1I3LA 1NHWA 5I7FA 3GVIA 3UAGA 1ISMA 1E92A 2AHRA 1ZEJA 2PGJA 5F5NA 2FR8A 2PV7A 3QWHA 4A5OA 1KBZA 1JKIA 2HLPA 4CMIB 1BGVA 4LGVA 1HXHA 4FD3A 4G81A 3KOUA 2D5CA 4LW8A 3NDIA 3AFNA 3JQGA 4WLVA 1N9GA 4MIEA 1C1XA 1DSSG 2VHWA 1GV0A 4I1IA 4A03A 1PJCA 1QKIA 4ND5A 4R3WA 2EEZA 3T4EA 1RWBA 5T8KA 3SXPA 4KQWA 4CUKA 7ADHA 4LRTB 4WCFC 4D0RA 3IP3A 2POQX 3DO5A 4ZQBA 3JQ9C 1YOVB 4Z0HO 5B37A 1MP0A 2PKQO 1IL0A 1OMOA 2BH9A 1PJ2A 3G79A 5L53A 2EW2A 1T1SA 1DAPA 1E3JA 4IQGA 5JY6A 1AUPA 3GNTA 5A9RA 2DBQA 1YL7A 1NXQA 1U2DA 1ZBQA 3CXRA 2BLLA 2V65A 4ONEA 3ZWWA 4U8GA 4Z9YA 1E1KA 3VVBA 1DB3A 4PVDA 1Y5MA 4BNUA 1R0SA 5DCUA 3PZRA 1Y1PA 2YDYA 1PJLA 2GZ3A 3UH1A 3DMTA 4WGGA 3QIVA 1NWHA 3DR3A 3MOIA 3NV9A 2B35A 3Q2KA 1FK8A 2FSSA 2SCUA 1WP4A 2O2YA 3W1VA 4FBGA 4E32A 3L77A 4WASA 4R41A 3RROA 2XF8A 1P31A 1U4SA 1RYDA 4WKGA 4IIVA 4BNHA 1WNTA 3AU9A 1PZHA 4LSWA 2A4KA 5KJEA 3ZWMA 1FDUA 1I0ZA 3ST7A 3IS3A 1AHIA 1FDSA 3IAHA 1V6AA 1PX0A 2JHFA 1PS9A 5DBGA 4UEOA 4CM1A 3ONFA 2HMWA 3IUSA 1H94A 4M1QA 3UCXA 4PG8A 5BQFA 3KEOA 1U3VA 4I5EA 3BTOA 1KVSA 4O0LA 3QE3A 1LBEA 5KKAA 2GN8A 3IMFA 4Z6KA 1E7WA 2DAPA 3CINA 5JAZA 1P1HA 3KYBA 2A92A 2GN6A 5JYEA 3OFSA 4EUFA 1R15A 1ZK1A 5KJ1A 3HB5X 5JCJD 1VLLA 2E49A 3HJAA 3DBLA 4XGIA 5DDIP 4WNIA 1ZNQO 4RVDA 2DTXA 4J4HA 1NWCA 3FF4A 3PVZA 1Y9AA 4I9HA 1C0IA 4AICA 2IE0A 3NT4A 1R4MA 1XQ6A 2O4UX 3WX0A 3BMOA 4OKNA 1PTJA 1PSDA 3ZHBA 5K6AC 4RLSA 2E6UX 1CERA 1Y8QA 2Q1WA 3HDJA 5IFLA 4EUHA 1GYRA 1XCBA 1CDOA 2VHYA 4EZBA 2CDCA 2H6EA 1T26A 5DP1A 5G0UA 3L6DA 4A26A 1BG6A 2JCVA 3KZVA 3W8DA 2F1KA 3ADPA 2C59A 4RVSA 3ZV4A 4G5HA 5LDHA 2NSDA 3RU9A 3MCVA 5A9SB 1XDWA 4YTEA 3AUTA 1DRVA 4F45A 4OL9A 3TJRA 2V7PA 4ILKA 2FN7A 2YQ5A 2JCYA 1BDBA 1ADBA 5LDGA 3PK0A 1YQXA 4MKRA 4KTVE 5KIAA 1O94A 1NFRA 2C82A 3N7UA 3GUCA 2PH5A 3E8XA 1VJTA 4J2HA 2B5WA 3QVWA 4XWYA 1EUCA 1UP6A 1E7SA 4MP3A 3RUFA 4GLOA 3WJ7A 2JL1A 3FN4A 1EQ2A 3CE6A 5ILGA 1L1FA 5JSFA 3W8FA 2C5EA 3ZV3A 3UOGA 4KUHA 3A4VA 4E31A 4IDCA 1OC4A 2EJWA 1WMBA 4IQ8A 4NPCA 2Y66A 3TZQA 4EITA 2RHRA 1GR0A 4GI2A 4RF5A 1J4AA 2NTJA 5KTKA 4NH4A 3VKUA 3EMKA 3DHYA 3S2GA 5JMPA 4MVJF 2VCYA 1NHGA 3EC7A 3P2YA 1OBFO 3HB4X 4XD2A 3K8ZA 4PLCA 2BFPA 1SOWA 3G49A 5JAMA 1VKOA 4GX1A 2GUGA 1R37A 4FFOA 4CMEA 3O03A 1EVZA 4B8WA 1C1DB 3D3WA 3NTOA 4MVJA 4BKQA 2C54A 2UYYA 4IJVA 4UAGA 4BO3A 4PCVA 4ZVVA 1GFSA 3RKRA 3GRKA 4DLAA 3OIFA 3I9MA 3WLEA 4RJTA 1R16A 3HDHA 4BO4A 3QHAA 3HN7A 1BXGB 1WDKA 3NT5A 3QA9A 3EGOA 1DFGA 4CR8A 4FFNA 3ZV5A 4CLHA 3ZU3A 1UXHA 4CQMA 3U0BA 4J43A 3IQDB 3NUGA 4E30A 4MJLA 5A02A 5BSEA 3UXYA 4BGUA 1LDBA 4CLEA 1H2HA 3ROKA 2Q1UA 1H9BA 1C0KA 4MIYA 4DIFA 3I4CA 4DBVO 4A10A 4O63O 1GYQA 4ROSA 1ZK3A 5BNTA 4GQAA 1M6WA 4O6VA 5ENVA 3CTMA 4RPJA 4HADA 1J49A 1NX6A 1QXSA 1A9ZA 2B4RO 3KUXA 4BKOA 3WWZA 2PA3A 1NR1A 5G4KB 1DIAA 3CSDA 4DQVA 3A14A 4BNXA 1T24A 3OP4A 2VWPA 2EKQA 1P1JA 4ZJUA 4B3JA 1IB6A 4NK4A 5JCXA 4YEDA 2VQ3A 2FPIA 3PRJA 3DBHB 1B14A 4XQ9A 1DC6A 4TRMA 4J6FA 4DYDA 2OO5A 1RM5A 2I6TA 1T2EA 2UVDA 4M89A 3FRJA 2WMDA 5T67A 3S8MA 3PHGA 1QLJA 3INTA 3KETA 2I65A 4BNWA 3AY7A 2XXJA 3GA0A 2ZQYA 1NFQA 2I99A 5GY7A 1K6XA 4F3YA 3ZHZA 4P4LA 4CLXA 5A03A 3O9ZA 3U5TA 1E7RA 3DZJA 1B3RA 2YV3A 5ER6A 4II3A 1YKFA 4NR0A 3D4OA 1X7DA 2FY8A 2IEBA 4IIUA 3W8EA 4BNVA 3X2FA 5AQ1A 3C85A 2X23A 1ADGA 1F12A 5HS4A 1QV6A 1HL3A 1NFFA 3SC4A 4YRBA 4J90A 2Q46A 4DLBA 3OICA 3OIGA 3P2OA 4ID9A 1YE3A 3WBFA 4H16A 4GSKA 5DN9A 2X0IA 2P9EA 3GZNB 2HSDA 4ZQHA 3F9IA 5IN5A 3OA0A 3BMQA 3OH8A 4MVJH 1LSSA 5L9AA 1P9LA 4NG5A 5BNIA 2J5RA 3LZ6A 1MFPA 1TXGA 4DREA 4WOKA 3FNEA 2F00A 5JO9A 3DFZA 1YDEA 1PJBA 3ITDA 2ZB8A 3WTCA 3TOXA 2P4QA 4RVUA 2J6IA 3V1UA 2FR1A 1D4FA 2VN8A 3MJEA 3E48A 3WGYA 3KHUA 4YT4A 1WPQA 3RAJA 1EVIA 1NBOA 5CEJA 4JX8A 2CF5A 1GY8A 1T25A 2QHXA 4PLTA 3AI1A 3AUAA 3I9OA 4JP2A 2FOIA 1VKNA 1E6EA 4DIBA 3HFSA 1A5ZA 2DQ4A 4CODB 4PIVA 2I3GA 4XQGA 3A9WA 4J0FA 1R0LA 1B2LA 2VWQA 2EXXA 3AOGA 3WOHA 4CMBA 1E0DA 2UV8A 3MJTA 1FXSA 3TZ6A 3DTYA 2Y1GA 3I9JA 4IPTA 4RQTA 4NJMA 1M67A 5F5LA 3IC5A 4AJHA 3FD8A 2D4AA 3RUEA 2PD3A 3GOHA 3GPDG 2FMUA 5AVOA 1HZJA 1ARZA 4OOFA 1DFHA 2NUAA 1I10A 3ZWNA 2NVBA 3MTJA 3H9GA 4NMHA 1RYEA 4JJGA 1M6HA 5ES3A 3LSYA 4K6FA 2CF6A 4P38A 1KVQA 4RVHA 2FWMX 3ZH2A 4BNFA 4IDBA 1HE2A 4EBFA 1RM4A 4IS3A 2V6GA 4NJOA 3VAZA 3WYEA 3TQHA 2IZZA 1SZJG 4XYLA 3PLRA 3FWNA 3MTGA 4WECA 4Z9FA 3ANLA 4KP7A 4JCOA 2FSVA 5JDCA 4EYEA 1ONNA 3P7MA 1YH3A 1ZSNA 3Q3CA 5TT1A 1LX6A 4YVFA 1GTMA 2X8LA 2NVUA 3AOEC 1KYQA 2NV6A 2VUTA 4OAQA 3WR5A 4FR5A 1HYGA 5LC1A 1TT5A 3TZKA 1LDGA 2P5UA 2ET6A 1FDTA 1TT7A 2DBVO 3I5MA 3VKVA 4AJLA 2NQ8A 4IBOA 4CLOB 4XYBA 1S6YA 5U1PA 1T2CA 1D1TA 4Y67A 3Q11A 3SVTA 5KJCA 4Y98A 3PJFA 5AOVA 3BZUA 4DXHA 1T2AA 1HSOA 3KB6A 4JBIA 4NDNE 1EEHA 2Y1DA 4NFHA 5TJ9A 3GGOA 4J7XA 4XX0A 5DBFA 3WXBA 3C24A 3RJ5A 2Z95A 2LDBA 2HRBA 4J4TA 1UJMA 3ZCXA 3ICCA 1GEEA 4HBGA 3BMNA 2B36A 5JDCC 2P68A 5IDYA 4QECA 3ZWAA 5EESA 5TS3A 3WWYA 3EY4A 3WGIA 3DTTA 1N7HA 3LT1A 1ZK2A 2X5OA 3KRTA 1MXFA 1YONA 3HNPA 4TRNA 2DUWA 2B37A 2I76A 1WZEA 2AA3A 1PGNA 5DULA 4BO2A 2J5QA 2PK3A 1Z75A 3N74A 4CQLB 4IQ0A 4EDFA 4F6CA 3KSUA 2PZJA 3P5SA 4J4BA 3JQ8A 2YUTA 5DCWA 3WLFA 1DIBA 4A73A 2DT5A 4CLRA 5JC8A 2YV2A 3T7CA 4E2XA 3KVOA 1UDAA 1LRLA 4MP8A 4XDZA 4YJFB 1SEVA 5G2OA 1DJNA 3IUPA 3VH3A 4E5KA 4NHEA 3STHA 3DFUA 2HKIA 2WTBA 4E2ZA 4JN6B 2GSDA 1QSGA 3HDQA 5L4SA 1CJCA 2G0TA 3KLPX 2HU2A 2QZ9A 2H9IA 2OP1A 4E3ZA 2J3KA 2Q2VA 3ZI0A 3LT2A 4XEHA 5C7OO 3OEYA 5FI3A 4B4UA 5DT9A 5IN4A 4E2YA 1O89A 4Q3CA 3FSRA 4D46A 3L9XA 4YT5A 3DXFA 3H8VA 4Z3KA 2WWRA 5I9NA 4IGFA 1IHXA 4RF2A 1H6BA 3V1YA 1MUUA 1LSOA 3T4XA 3K30A 4JGBA 2C0CA 3H2SA 4IZIA 4YAEA 1PWZA 3QSGA 4Y8VA 1IZ9A 4CM9D 1X7GA 4Y6PA 4BV8A 4GBJA 1PZGA 5T6BA 1EE9A 4LVCA 1MGOA 1WW8A 1D8AA 3F4LA 4LMPA 3Q6IA 1ZUD1 5JO0A 1E3EA 2ZJ0A 1SAYA 3ZDFA 1YBMA 1LLDA 4CM4B 2CUKA 3CH6A 4XIYA 2JFGA 2P9GA 2DTEA 4FW8A 4RORA 3E03A 4KUEA 2YFHA 4PLWA 2PZKA 4WOJA 3HZZA 4DQXA 5L4NA 3HHPA 3ROPA 5IJZA 3RJ9A 3UHAA 4YYZA 3IJPA 2VUSA 2I5PO 1EDZA 4W7IA 2PKQP 1CIVA 1KY5A 2W2KA 2WJPA 4L4XA 3ZHXA 1ENYA 2Q2QA 4MVJG 3H5AA 1U7TA 1PGJA 4UEJA 3I83A 1ISIA 4ZICA 1SC6A 4YXFA 1ORRA 1VJ0A 2DPHA 3JQAA 3ETDA 4OH1A 2YHIB 1LQTA 3UF0A 2O7QA 3SLKA 3GK3A 2WSBA 1LRKA 3JYQA 6ADHA 1ENZA 2VWGA 4WJZA 2GRAA 1GDHA 4XZ3A 3I9NA 1PJ4A 1ZMOA 4CMCA 4EUEA 2GERA 3NYWA 1SCUA 2GR9A 4NBTA 3EZLA 2FPPA 2TMDA 2JFHA 3ZWYA 1VE9A 1EVYA 3WSWA 4E4YA 4RPHA 5ENDA 4I5GA 2RCYA 1E7MA 4OSPA 3ZNQA 1N7GA 1B8VA 4UUNA 4GL4A 1WWKA 2DPGA 4QO8A 4FN4A 4JXKA 8LDHA 1R4NA 1ZKMA 2OFPA 1Q0LA 1CETA 5KKCA 4KZPA 3MJ4A 4W7HA 4J7CA 4KMSA 2ILTA 1PZFA 1ZSVA 1WVGA 5C37A 5CDTA 2Y1OA 1ISGA 1HRDA 1LLUA 4RF3A 3RC1A 4AJJA 3RSHA 4EJ0A 4U0JA 4G65A 4BGIA 4K1LA 2O2SA 1B16A 2RH4A 1QYCA 3FR7A 4X54A 2EJVA 3HUDA 4XKJA 1KIFA 1QORA 1GV1A 1YB5A 3RQSA 5L40A 1KVRA 3F4BA 2ZYDA 1X7HA 4WCDA 3FPLA 2WYUA 1DIRA 4RDHA 1HT0A 1TLTA 2Q3EA 3JD4A 1A9YA 5JC1A 4D43A 3JV7A 4JBHA 1TI7A 2VOJA 1QMGA 3BTUA 1GADO 2ZYAA 5CDSA 1GZ4A 1NYTA 2X5JO 3GVXA 3JD1A 3JYPA 5L51A 2EW8A 3PHHA 3WBBA 4KUGA 2QX7A 3B70A 4OGWA 1LTHR 3AM3A 1DFIA 4GKVA 4AJ4A 3WMWA 5L95A 1ZK4A 4PG6A 3WIDA 1DC5A 3FTNA 4RCVA 4BB5A 1R6DA 1ENOA 4W82A 1I30A 2DUUA 2VYVD 1PQUA 2X58A 1PGQA 1GQ2A 3H2ZA 5TSDA 3A1NA 4R1TA 4YJHB 3SLGA 4L74A 5TT0A 1I32A 4IDEA 2Q1TA 4UUPA 3VH4A 5GZ6A 3SX2A 1HETA 2HMVA 3RC7A 1GD1O 4YQZA 5A9SA 3PEFA 4WLFA 3JQAD 2O23A 1ZH8A 3LQFA 4BIIA 4BO7A 3GN2A 5FEUA 2I3AA 4OXNA 1GYPA 4D45A 1YWGO 2IXAA 2AMFA 3LK7A 3H3FA 3R1IA 4HNHA 4CV2A 3PQEA 4BGEA 3ASUA 4WEOA 1T4BA 4A2CA 1E5QA 1RM0A 3OBBA 4YJGB 4Q3NA 3FI9A 1HEUA 5T8KC 4IDDA 3S55A 2Z5LA 3GNSA 3SJ7A 5DOVA 3OMLA 3UKOA 5EJ2A 4D3FA 3C1AA 4XYGA 1I2BA 2D59A 4TKMA 1RKXA 1XG5A 3OHSX 5C5IA 2G1UA 4ALMA 2B0JA 5I7VA 3I6IA 4IXTA 4YQYA 1FF9A 5THKA 5G0WA 4RO0A 5CDGA 2RHCA 3VZQA 3KYCA 3OJEA 1SOVA 4BOYA 4RL6A 1Y5RA 1DOHA 1Z7BA 3DMTC 4FB5A 1GPJA 4WCFB 3D1LA 3A06A 3G3EA 4YAIA 3CZMA 4P4NA 2RBEA 2RH8A 3VPSA 1U4OA 1H2BA 4I8XA 4PFJA 1H9AA 1OI7A 4ZGWA 3IKTA 4D41A 3C8MA 1MG0A 2G82A 4G2NA 1SPXA 4D42A 3GF4A 4GMFA 3S2FA 5AXBA 2IZ0A 4R1UA 1KVTA 5L7WA 1BXGA 1JN0A 2E82A 4W99A 2JFFA 2WD7B 4CM8A 3X2EA 3TOZA 1FMCA 3HE3A 2OHXA 3QVTA 5DNAA 2TMGA 3JQGB 4MVJI 3IL2A 3AW9A 1C1XB 1O9BA 3ZNPA 2QRLA 1VI2A 3FBGA 3L6OO 4DQUA 5L7TA 2C20A 2Y99A 3JYNA 5JNLA 4DMLA 2PTGA 3VDRA 2XOXA 1BW9B 1B0AA 4YACA 2X22A 1JW9B 4ZRMA 3AUUA 3AK4A 3G1TA 4R4JA 3SEFA 4BS9A 1AN9A 1HE5A 2OZPA 2YJZA 4IZHA 1L7DA 3W4KA 5CG2A 2JAHA 1OZAA 3LT4A 2B83A 2W90A 4FOOA 1HDXA 2QIOA 4TMFA 1ML3A 3DOJA 3QRWA 2P4HX 1UDBA 5H83A 1O0SA 5TX7A 1KVUA 5BSHA 2DC1A 1Q0HA 3GY0A 4INAA 4M49A 1VL8A 1VC2A 4QO7A 4EI2A 1PR9A 2XAAA 2B4TO 3PHLA 4WUVA 4XYMA 5T64A 3ZWOA 2ZK7A 3GAFA 5EIOA 1ZXLA 1H93A 1RPNA 2RIRA 4K9DA 3D64A 4B8ZA 2ZTMA 4FJ1A 1W0CA 3QWAA 5ICSA 3L4SO 4Y6RA 1ONOA 3F1LA 3ZW8A 3H9UA 1UR5A 5L7YA 2BI8A 2E37A 4RGBA 3Q9UA 4ALJA 3PJDA 1HLPA 3HSKA 5EMHA 4BNMA 5MGBA 1LA2A 2Q49A 2O50A 3D4NA 1HLDA 2O3UA 3GUYA 1MC4A 3JQCA 4OXYA 4XGKA 1NAIA 3F6YA 1W73A 1PJ3A 3AJRA 2AXQA 1DHRA 1CQJA 1I36A 5CDYA 1DC4A 1HF3A 4UVIA 5TNXA 5F3RA 1L7EA 1PJQA 2YY7A 4URFA 2WD8A 1QG6A 3OSUA 2GF2A 2JJYA 2GZ2A 3M2TA 2Y68A 2NLOA 2NWQA 1CYDA 1QRRA 3IP1A 3BTSA 3PFWO 2J8ZA 3CKYA 5CEEA 3MJVA 3D5QA 4FJ2A 2OOSA 3I1JA 2Q50A 4ESOA 2CZCA 1GU7A 1LRJA 4MO2A 3UUWA 4NBVA 4B3IA 4CMGA 5G4LA 3I3OA 1EBUA 1Q1NA 3DBLB 4OSOA 1GUYA 1PL7A 1HDZA 2HDHA 3PJEA 4C7KA 4N7RA 1Y81A 2E48A 4PLVA 3BMOB 1DRWA 4AJIA 1LQUA 3F3SA 4DPMA 4E13A 3QWIA 4Y6SA 5IDWA 5B4UA 2PZLA 4ZA2A 5F1OA 5A4DA 3KYDB 3AU8A 2VZ8A 3NJ4A 3PIIA 4CMEC 1Y7TA 5FWNA 4RPGA 3U62A 4B3HA 3WYCA 2DU8A 1MA0A 4Q39A 3RUAA 2GO1A 1T2DA 1YQGA 3OA2A 4OOEA 1NPDA 2QRJA 5J23A 3Q0EA 4J1TA 4B7XA 4E5PA 3I9LA 2C29D 4BO6A 2HMUA 4Z3DA 1VSVA 1K6IA 4BNZA 3DBRB 2IRWA 4BVAA 1S7CA 1T4DA 1VL6A 3ON5A 2CDAA 4M55A 3AI3A 3HQ4O 3K6JA 2OL4A 3JQDA 4HP8A 4OQYA 1PGPA 4C7JA 5I9LA 3H5RA 1NVMB 3U4DA 1LXCA 2NACA 1EMDA 5C7IO 4RVFA 3VZSA 5HRUA 2EP7A 4PG5A 2JAPA 3PLNA 1ZEMA 4ND1A 1NQAO 3IIEA 1VM6A 3WS7A 1YBAA 3RUCA 3Q2IA 3UFXA 4LSMA 5CHEA 5DBIA 4J49A 5L3ZA 2QYSA 3R3SA 4I5FA 1LDNA 4E2WA 1KC3A 1XEAA 4BO1A 3LDHA 1QP8A 1KS9A 4CM5A 1MLDA 2C2YA 1A71A 5H82A 1XIVA 4RPKA 2AE2A 3AI2A 1AHHA 1YB4A 1SB8A 4AG3A 1G1AA 9LDTA 1DPGA 4NQZA 4XB2A 4AJ2A 3JYLA 4FGWA 4FQ8A 3OJLA 1NAHA 3BXXA 3TPCA 4FSHA 4BMSA 3K31A 4E5YA 1Z74A 3GVPA 4MVJD 4BNGA 4U6SA 1DLIA 1ZIDA 3NTRA 2H63A 3TFOA 4YT8A 4LISA 3I23A 1H6CA 1PU2A 2AEMA 3DC2A 2PGLA 3KSZO 1E77A 1ONPA 1P1FA 3DHNA 2EKLA 1C14A 3FNFA 1HSZA 3GG2A 1GQQA 2UAGA 3INRA 4BGVA 1UZNA 3FBTA 1M75A 1G6KA 5KVQA 3PHIA 3JQBA 2PD6A 2GGSA 1IPEA 3R3JA 2HQ1A 1NM5A 2YYYA 2O7SA 4J9UE 1PQPA 1EFLA 4CQMD 1MG5A 5JDIA 1N8KA 3L0DA 2Q4EA 4LK3A 4AJPA 4H7PA 3QP9A 2GPTA 5F1PA 5JW6A 3JD0A 2VNAA 3E9MA 1M76A 4Q3EA 2HK7A 2JKVA 1BDMA 2AW5A 1UXGA 3GFGA 3D4PA 4TRRA 1N1GA 2AG8A 3JQEA 3RFXA 1KOLA 3PWKA 1DO8A 4PZCA 1IULA 1A27A 1K89A 4TROA 3VOSA 3DONA 1QYWA 3WQSB 3TFQA 1EBFA 4QT0A 3ZW9A 4RLHA 1E7QA 4LRSB 4D7AA 5CP8A 2BGKA 2CVZA 5HBRA 3O8QA 4EGFA 2E4AA 4XCVA 2X7HA 1PJSA 1HZZA 2NVWA 3M1LA 1B7GO 3B1FA 3GDGA 3JQBC 5BNFA 2D5AA 4W9NA 3K73O 1QV7A 2NU8A 2RAFA 4GX5A 1A7AA 4CR6A 1AE1A 1PGOA 5DP2A 4GAEA 4CUZA 1HYEA 3PGXA 1JAYA 1N92A 4YR9A 1ZK0A 4CV1A 1YRLA 3DBVO 2VHZA 4IM7A 3RD5A 5BSFA 5KNLA 4O1MA 1GPDG 4MVJP 5KVSA 2PGDA 4HUJA 2IXBA 1LJ8A 3CEAA 4J1SA 4R5HA 1ZO8A 5HM8A 3ETEA 1GZ6A 1YVEI 1WMAA 5IZCA 4PRKA 3MWDB 2J3JA 1SBYA 3HN2A 1E5LA 3VC7A 3NDJA 4R69A 1DIGA 5H81A 4MVJM 4R16A 5KVVA 5TIIA 4OYRA 1DC3A 2IYPA 2O3QA 3QQPA 3D5TA 4BMNA 3EZYA 3GGGA 1XHLA 1BSVA 4YB8A 4CM3A 3NAQA 4EJ6A 4ZQEA 1YQDA 6LDHA 4HY3A 2ZTVA 4QSMA 1Q7CA 1M2WA 2QG4A 4J1NA 5AXDA 5EPOA 4Y9DA 4YCAA 1LDEA 3BMQB 3EK2A 1X1TA 2P9CA 2CMDA 1DBVO 1NP3A 1A7KA 1VRWA 5I7SA 1VSUA 2ZCUA 4MVJE 2WEKA 4BQPA 2X1HA 1BVRA 4CM4A 3GMSA 3VDQA 4D79A 4ZN6A 1KEPA 4ALLA 5HS6A 3GHYA 4E33A 3GZ4A 1Z7EA 4LCJA 2X4GA 3O38A 3JYOA 2HK8A 3PYLA 3JQ7B 2ZB3A 3K9QO 1N5DA 1P45A 3AM4A 3PZBA 5IZCC 1Y9EA 4J91A 1XU9A 3C3XA 3ICPA 2OGUA 5IDQA 3PPIA 1NQ5A 5TLSA 3B1JA 2GYYA 1V3TA 3D7LA 3C1OA 1A4UA 1NASA 1YB1A 2BFAA 3F1KA 5TC4A 4HXYA 2DM6A 1V9LA 5K9ZA 5KCZA 4BNNA 1Y8RA 2CVQA 2BKAA 1BXKA 4RPLA 3MOGA 4XRGA 3BHMA 4PVCA 3DZKA 3IDSA 3V2HA 3E82A 4WNCA 4DGSA 5JPIA 3RWBA 2C2XA 2HUNA 3RC2A 5I9MA 2X0RA 1NVTA 4HKTA 5DZSA 1YGYA 2A9FA 1HYHA 4NJMB 1UUFA 2DFDA 1BTOA 1NR7A 3ITKA 4Z0TA 4YRAA 5ILOA 3VZPA 1V3VA 1IZ0A 2EG9A 3PXXA 1T1RA 1K6JA 1W6UA 2HMSA 1UH5A 5THQA 1EK5A 4YRDA 1JLLA 4D0SA 1F17A 3ZV6A 2X9GA 1DEHA 5A5FA 1JTVA 2HAEA 3LC2O 4E21A 1QYDA 2IDZA 3BA1A 1I01A 4DLLA 1C0PA 1QLHA 2PZMA 3E18A 3GMDA 4W6ZA 4N5NA 3SBOA 4DL9A 1Q0QA 1X15A 2YDXA 3DL2A 4XQEA 2GLXA 2R2GA 3WJAA 4GSLA 2HJRA 4TZTA 1RJWA 1Z45A 4AJOA 3OECA 4ND2A 3TZHA 2Z1NA 1XA0A 2UDPA 3INGA 1ZCJA 1CRWG 3PIDA 1EQUA 1YJQA 3EDMA 3L9WA 2BI7A 1E1NA 3FTPA 1O8CA 2C07A 3EVNA 3ASVA 4JNKA 4DIOA 1EFKA 3TWOA 2O4CA 4BNJA 4XRRA 1JKJA 1IPFA 3JQFA 4CMIA 1H6DA 1BVUA 2B5VA 1JU9A 1YJ8A 3OM9A 2FP4A 4UREA 1U5CA 2VRBA 3DEYX 4DVJA 1J5PA 2Q2WA 1JDJA 4PLFA 4PGFA 4II2A 4KTTE 2IZ1A 5FI5A 1ZMTA 3AFMA 4CV3A 3ROQA 5B4VA 4U5QA 3HWRA 3TF5A 3U9LA 2HCTA 1TA4A 4MPDA 2AQIA 3FNGA 4OHUA 1ZFNA 4N54A 1YOVA 3JTMA 2A94A 3OEWA 1CEQA 1VPDA 2EGHA 3GNQA 3K2EA 4LN1A 2AQ8A 3RFVA 2NM0A 4DPLA 5GZ3A 3F5SA 3C1TA 1XR3A 4FDAA 5FFFA 3RASA 1ID1A 2Y1FA 4YJHA
chains in the Genus database with same CATH superfamily
4PS0A 1TZJA 1P6QA 3H0KA 4Q1VA 3FCEA 2ZRLA 3VO1A 1J9EA 1CUHA 2GBLA 2K2WA 3LU1A 4ZCTA 5KNDD 3DDOA 1SEPA 3C7DB 2FPRA 1QPZA 2XWSA 5CH3A 5FUBA 1NJ8A 2I34A 2Y2VA 2ZIFA 4HDAA 5ALWA 2GDZA 3HVUA 1Z7YA 3CJRA 1E4EA 2I8LA 4BRSA 1DAOA 3L0ZA 1H5UA 1QQTA 3BFKA 4CFSA 4RK6A 5BT8A 1PNTA 4MR9A 4MWBA 3NT2A 4KJXA 3JQ8B 1Z7GA 2PWAA 4OYYA 2ZRFA 1GQFA 2GAIA 3TXXA 3HVJA 5JASA 2ZXUA 2ZT6A 2R8OA 3G9ZA 1U0GA 3P0FA 3IGFA 4CT0A 1JMYA 4BLWA 3T5GA 4BL5A 3T7EA 4HGZA 1EK6A 5DBHX 1S8AA 3OETA 2QQEA 2FUKA 4IVRA 4A0HA 4ALNA 2GEBA 3ELBA 4YAJA 2KM1A 4FFRA 5JQGF 2CYBA 4N8EA 4YP5A 1NSYA 1KOGA 1BHJA 2H17A 2QQFA 1C7FA 3IELA 4G56A 4HZUB 3J80A 2BGLA 3N8IA 2DUJA 3A1UA 4P7GA 1QP0A 3FUUA 2GD1O 2AG1A 2RB5A 5FO0A 3NBYC 1NNUA 4GI7A 4HLUA 4J76A 4FMCB 3MHTA 1IJKA 5BNZA 3GIDA 2QVBA 2FWRA 2XWPA 4P1ZA 4HYYA 4K40A 5AOBA 2HU8A 2ZE7A 1GNTA 1GARA 1ZRNA 2BHSA 2CXHA 1V3QE 2Z2YA 1C8KA 2BMAA 2GBLC 2MDTA 4Q03A 2LCQA 4R1SA 1DT5A 3SIPA 1RAHA 1JKFA 2EERA 3MUOA 2GBGA 5BQOA 4D3SA 4NAHA 5KI6A 3RO7A 4LXTA 1NVUQ 2Y67A 5AHRA 3PQDA 4BLTA 4AKSA 1J6UA 3A2NA 1Q14A 2VP5A 3N8GA 2O3RA 4KQXA 4RENA 3CJQA 1RYYA 2EGUA 4UE3S 3RFTA 3F3KA 4DM3A 4EP1A 2HO5A 4QXQA 1MJ5A 4JI8B 1ZOPA 1CG6A 2XNSA 3V8BA 3TN7A 4BV9A 4UKDA 1UT6A 1X8JA 2QA5A 2ZBQA 3PG5A 5DM1A 3AETA 5BQ3A 3U4HA 2QMUA 3EF3A 4KMMA 5T7BA 1QX3A 2DYKA 4B3SB 4JBYA 3DB2A 2D0OB 5JPDA 3SQLA 2HZ7A 1QF7A 2HJGA 5MFPA 1POWA 2WIAA 1I3NA 4ESVA 1C50A 1NRJB 5BN1A 4HRYA 1A82A 2BMWA 5J2TF 1KDZA 4AAYA 3R9WA 2BP7A 5ESXA 4IZ6A 2BGRA 3RT7A 5KYVA 1O08A 1KJQA 3PUZA 5DBEX 3A25A 3EGEA 1MIHA 1G98A 1TECE 1BN6A 4HLUC 1YFKA 1M9NA 2EEPA 2JGLA 3JAKA 1YRHA 1LJLA 2I4RA 2Y92A 4M0CA 4ND4A 4ODIA 3UWSA 4GC5A 4H3HB 2ZJOA 4MW5A 4HVLA 4OATA 2WJZB 3ETGA 2PSDA 3IKLA 4Y6LA 3UV6A 5GTDA 5FBWB 3LQQA 3M6MD 2QQ0A 1DCTA 1NG9A 3L6BA 3KTDA 1ISRA 3HKCB 3HJNA 3EAGA 3VPXA 1QJCA 1ODFA 3JY6A 2QTBA 5DX0A 2C03A 3LT0A 1U7UA 4OJKA 4NOMA 2BZGA 2REXB 2YKGA 1QIHA 3CPJB 1FLVA 1VMKA 2DBZA 2OXIA 4O4IF 5ITVA 1UZAA 4TKVB 2ZJ8A 2GH1A 2M6RA 5LM3A 2YIMA 4JSRA 1DAIA 1Q0SA 1I5RA 2XY4A 4JJKA 4AP5A 2IHTA 4FM9A 3EC2A 5HOEA 3AXSA 4F4FA 4E5DA 2QE7D 1J1IA 3UAZA 1UMCB 3JU3A 2UUPA 3NP7A 3BSFA 4A8TA 3I2JA 3SIWA 3AWIA 4JVMA 2HLNA 3A28A 2ZJFA 1X14A 4QT4A 1AQYA 4GWKA 1SCUB 2DQKA 2LPMA 3D6TB 3FFTA 4YR7A 4RY8A 5BV7A 2V03A 4L1KA 4XYEA 2BBSA 3QXHA 4EUSA 2OBXA 2OV1A 2FZEA 4XGRA 4LZAA 2GPWA 4EG8A 4QFDA 4TLBA 4YQEA 3PQ6A 5F33A 4BKRA 3SMVA 1U3UA 3NTQA 1NLUA 4D8YA 4LA4A 3P9CA 3AT1A 3CVOA 1OXTA 4KXFB 1AKQA 3I92A 3TL2A 1OLXB 1QR6A 3PX7A 3HL0A 3KKZA 1R4NB 1K8ZB 3KL4A 4GXNA 1RACA 1FB5A 2WHPA 5IBQA 2F8TA 2I7XA 1RI5A 1M0WA 3NETA 4DRYA 1ZJZA 4YRKA 2Y93A 2EL9A 2OBNA 1C1DA 4LCEA 4ZARA 4BDSA 3H5LA 3KZMA 4LZOA 1P17A 5L3SA 4D9FA 2AFIE 2RGAA 3VH1A 1AMOA 1TQ2A 3ONEA 2GN0A 1KBOA 1ORTA 3VKFA 4GGOA 2WTAA 3G2HA 3LQRA 3KLBA 1Q1AA 1M8JA 3RVPA 3VYRB 2WQ7A 2QI9F 3EZFA 3RTDA 1ZC3A 5BV1A 1NKSA 3FPSA 5A5GA 2PH3A 4YPFA 1FS5A 3GEIA 4LJYA 3FYUC 4L8WB 2HLDA 1R66A 4F46A 1U0TA 2WM8A 3DE0X 2KSQA 1NVVR 2FEMA 3G9QA 2O2JA 5THXA 1DOZA 4FKZA 3MVEA 3ZY2A 5GV8A 4ML3A 5CNJA 1FLAA 3W90A 1CS0B 1N9GB 2WPNA 2VBFA 2YV1A 1WAMA 3QW2A 2CXXA 3BF7A 2ZRQA 3OSUA 4QDTA 5CDUA 2J9FB 1E2BA 3NOQA 3ZDCA 1OU0A 4MQEB 4MRRA 1II8A 3FMFA 2DG2A 5AVRA 1D2GA 3LZDA 1SUFA 5H59A 2AEJA 4QUDA 1ZSYA 1NW7A 5TQ2A 2VOEA 3DM5A 1XPJA 5MGNA 3KYDA 5CJPA 1DBRA 3RUIA 2J9RA 2QP3A 2F67A 3WTBA 1US8B 1GXSA 1X1EA 4XPIA 3IQEA 3HH8A 1U3TA 4FI3F 3RC9A 1XWWA 3H6GA 3PYXA 1KARA 2W00A 2OORA 4UC0A 3T35A 2PKXA 2H1SA 3ZCSA 1E3QA 3I32A 3WB2A 2VDUE 2X4IA 3VBEA 4B4WA 1A5AB 2B4KA 3W7AA 1GRNA 2F62A 3DBRA 1PFQA 5BMVA 3P9YA 4MYTA 2GBFA 4TWIA 1OI2A 3DOOA 3I6QA 3ZTTA 5IXSA 4I1VA 5FTMA 2PQ0A 3E0XA 2LTAA 2XZDA 2JJ8A 1XNJA 2KMLA 2FSGA 2VDOB 2IIVA 4FFPA 1DCMA 1ZH6A 3O8LA 4QPDA 2FFJA 4L07A 4ZI2A 3HADA 1N2SA 5HSGA 3S81A 3N87A 1UDXA 1V8ZA 2QR5A 1GPYA 1QFXA 2JLSA 2Z4SA 3G23A 4RHUA 4XJTA 1XZHA 3NHYA 3QXXA 1HM5A 1IM5A 3Q7IA 2Z0MA 4FZ3A 3MT7A 3A6PC 1XAHA 1HR0B 5TGDA 1X1QA 3FYUB 3COZA 4OG2A 2QSYA 3GVHA 1JZSA 2DQSA 1QQ5A 3W4IA 4DLNA 1HDRA 4YDHB 3H1AA 3KTAB 3HGTA 4CMKA 3PDJA 1LDMA 1T6XA 2YRXA 1NDHA 2XLCA 2D13A 3M0EA 4EGQA 1U2TA 2FKNA 1WCWA 1BWSA 4R01A 2Y0CA 3DTVB 4R7TA 4WY2A 3TX6A 2AFHB 4IS2A 1JLKA 4GMKA 2ZR0A 3KP1A 2RGRA 4LC9A 3N2YA 3AFGA 1I7SB 1U6KA 1L1EA 1ZVJA 2XNKA 3HB0A 3NWBA 4KYIB 4L73A 3AX6A 3A1FA 3GZNA 1LS6A 1OBHA 1AGYA 4JQCA 3CVYA 3AUYA 5AXCA 2ZSIA 1D2EA 1BS2A 2GAOA 16PKA 2XQFA 4KO8A 3DP9A 3LBHA 1ULUA 3U13A 1XSEA 2JIZA 1ONSA 3CZRA 4QTXA 1T6BY 4HNAA 2VPWA 4EW2A 2FSHA 3GQBA 3SXUB 1YCDA 3STWA 2P9ZA 1GPLA 1P1RA 1IMOA 3ZUPA 3HKBA 3TSCA 4AO8A 1KJIA 3IUMA 3TUZC 2C0QA 3F3MA 2GI4A 1ZCZA 1QRDA 3MMXA 3FCUB 5KYXB 1XNHA 3LY7A 5DHPA 3DOCA 3MK31 4YA6A 1YL5A 4HLCA 5GJWC 4C7XA 2H1IA 2ZYUX 1KFKB 1E6WA 3ZHYA 3O2NA 5JS7A 1THMA 1LI4A 1QUFA 1TQHA 2ERYA 3PX3A 4A6XA 2AKAB 1Y8QB 1GPNA 4CM8B 3DHEA 1A8HA 1IUKA 3DXZA 1KEWA 2W2LD 4L02A 5K0GA 1YK0A 1SH7A 5JANA 1RABA 1N78A 3LYLA 3U3JA 3L4BA 3TINA 2EG5A 3OEEA 4C03A 3CUUA 2XB4A 2ZAMA 3L7MA 5M7EA 2FQYA 1EP3B 2J3EA 5CLFA 4D3YA 5EY5B 1NBWB 4QTUB 4ND8B 4KR9A 3JTEA 4HL6A 4S1VA 1XMPA 3QLUC 4TSKA 1QH1B 3FOFC 2OTCA 4DWOA 4Q9KA 1CZRA 4DA9A 4CVNA 1Z5NA 3U40A 2JZOA 3NWEA 1X7WB 3LH5A 3PC2A 4XUEA 3EXG1 4YCCA 3TQRA 2WWHA 4R5MA 4AX8A 2HBZA 2Q8QA 3KSAC 4UVDA 1L3IA 1CFJA 3HY3A 4Y18A 4XIJA 2X2FA 3TECE 2FJUA 4XWTA 1BKDR 4NBRA 1KK1A 4KMRA 5KMGA 2QRKA 2IH4A 1GZ3A 3FUTA 2QGZA 1B73A 1N2OA 3H97A 1B42A 3WGTA 4AS2A 1DCKA 5KJFA 2IT1A 1P7PA 4BFWA 1NJ5A 1VL2A 2ZIZA 1E66A 3WRWA 5C32A 2N0SA 2GCNA 2OCKA 3MJSA 1HQDA 4JA0A 1W36B 4PAOA 2W98A 1AVTA 2VPYA 4JLVA 1U0FA 4L5JA 2XE4A 1E3SA 4JMLA 1KFEB 4Y1GA 1ZVMA 3EQZA 3K32A 4MZXA 2H1RA 5J2UA 2Y6VA 5ECDA 3DYIA 1MDBA 4P7JA 2XODA 3L5OA 1P77A 4AKEA 3HN6A 4BUCA 1SBHA 4G36A 4D6PA 4DMUB 3ENNA 3L4BC 1LLQA 1OV4A 3M6XA 1EVJA 4L9WA 1YRBA 4MUAA 1SKAA 3FYSA 4OF4A 3TSWA 1M1YA 2X1MA 3ABIA 2XVMA 2ZJZA 4FC7A 4J1TC 2GD6A 1AX9A 1GL9B 5TF4A 3DV9A 2Y4NA 4KACA 4OP1A 3WSTA 4TXNA 3RABA 3ZLUA 4JK3A 5BWMA 1Z2CA 3PR1A 1YOBA 4HV4A 1NXWA 3E1SA 4RZUA 1R12A 2D2XA 1RRMA 1WDMA 1FQOA 3AF5A 1EFVB 3ED5A 1RZRD 1T36A 1FTNA 2IVFA 5KOIA 2Q3BA 3IBGA 4DMKA 1QQ6A 4HQOA 1Y33E 3AZQA 1C80A 3DT6A 3RGGA 4EYSA 3ZJUA 2DHCA 5KYYB 3ZHUA 4CLOA 4W5OA 4W9RA 3N58A 2BM9A 4NFSA 2VZEA 5HZHA 2DWUA 3GEEA 5EZSA 3WHIA 8GPBA 4L75A 3DV2A 3GLGA 3AESB 4H3KB 3O83A 2I78A 1IOZA 1S1CA 2IZOA 3OQIB 4B43A 1FJXA 2NO6A 2REQB 1AC5A 3R5TA 3IE2A 5IHPA 4M0MA 3VBCA 4F93B 5JZMA 1KPIA 3CS3A 5EQDA 3UY4A 5C7YA 4UM8B 3V9PA 4H27A 3G5MA 3M6IA 3UC5A 3GLRA 1P5FA 4R81A 2H2FA 1VE3A 1DV2A 1RXYA 2IHVA 5FXMA 3WIEA 5JI2E 1EP2B 1X2BA 4B3XA 2A5JA 2VXOA 3M6VA 4XVUA 1JBQA 3GNLA 4RMJA 1S5PA 4PLYA 3BQNB 4CLDA 5IKEA 1K7FB 1MJHA 5EE1A 4RNCA 2XPCA 4NZOA 1SU6A 4Q3DA 2JLAA 4D8UA 1RT9A 2Z56A 1NBMD 3KCQA 3DKVA 2VDVE 1X86B 4DLVA 3WK8A 4TZ6A 2CHVA 1Z2OX 1GKLA 4JJIA 3TQIA 1OFHA 3NYRA 1GRQA 1JE0A 3FR8A 2CE7A 3RFCA 1Y37A 3ZU5A 5IBCA 4MAMA 4CQLA 4YAGA 3ZWXA 3A1TA 4C14A 1W49A 3N0TA 1T8WA 3ZCUA 2P9JA 1DI0A 3TL6A 1DJOA 1WUJS 1CFZA 3JZDA 4MCJA 2WV7A 4M4SA 2PY6A 2YJTD 5CW2A 3NORA 2FW9A 5ALKA 3ZU4A 5HWSA 3N7TA 4L27A 2M2IA 2ON6A 1K2WA 5DJ5A 2HPHA 1QIEA 3GPIA 3ONDA 4ZD6A 4WESB 4HRVA 2HHHB 2VTBA 1JR3D 1M10A 5JDIC 4XXHA 3RUPA 1R5JA 3WGOA 1EX6A 1BE0A 2W6ZA 3AIKA 2YY5A 2AQHA 3MGGA 2Q99A 3PNQA 4KRXA 3P19A 5EERA 4ZOLA 3CX8A 4I9NA 3D8RA 5B12A 4MUFA 2R00A 2QUKA 2WJJA 4LWOA 5KCMA 3FWZA 3RS2A 1FVXA 1E7YA 4BVHA 4NBWA 4YMSA 1AKRA 5DTIA 5AW6A 2EIHA 3BDVA 3DS8A 3HA5A 1BXZA 2P8SA 3O4RA 2VJQA 4QD3A 2X14A 2QUIA 4WOPA 5FCDA 3BM5A 3UICA 4ARZB 5COQA 4B3CA 3IVAA 1CNEA 4BCBA 4DMCA 5ICGA 3V7NA 1Z3CA 2E5FA 5LBTA 4UCXA 4KHZA 1JAXA 2IY8A 3GFPA 2FZWA 1MV8A 4JUFA 3FI0A 4DLRA 3OO1A 4ARBA 3J7TA 4NESA 5K8CA 5B6IA 3NVKI 3LXRA 1UZLA 2DBYA 5IABA 4RGVA 4XTRA 4PAWA 5ANRB 3WK6A 4BP1A 1WBBA 5C8VA 2RMKA 5J4HA 2EYUA 1CJUC 1H8HD 1E0KA 1WHSB 2AHOA 2ZI6A 4OQXA 4PHGA 1WZNA 3UM9A 1J22A 2WNSA 1RWKA 4HN9A 5CXXA 3G0HA 2CXTA 5JXGA 4L2IB 4EEXA 4D9IA 1B8PA 2DVMA 1QHGA 4GR9A 3RUDA 1GQSA 4G0ZA 1L4KA 4PCLA 4NZNA 3U3XA 4JVNA 3JASB 1GNVA 5G40A 4O2BA 3VPFA 1L7MA 2RHDA 1XL0A 1U0OC 1WDWB 2FQXA 2J07A 1UINA 2GPSA 3CNQS 4WT7A 1RVDA 4MKZA 2CJXA 4B6EA 4R05A 5JSZB 2R00C 3CLSC 1CEEA 1RAFA 121PA 1XT6A 2JAWA 2DFPA 1YC2A 3I6ZA 3FPGA 3K2QA 3KKLA 3GC6A 4MR8A 3ZNOA 1KP2A 1R6BX 1VL5A 1EGVB 3I9KA 3TIFA 4TOIA 4YV7A 1PFWA 2RJNA 1I33A 2C04A 2QN9A 1LJUA 1M34A 2PNFA 4LXIA 4MV0A 4ZU1X 3K9BA 5ELLA 4DCJA 5C8YA 3ET5A 3GG9A 2GEUA 2ASEA 3GJRA 4ZCSA 2QXYA 1I2CA 1P2DA 3T3HA 2WMNB 3CUVA 2B30A 3Q8WA 3SM3A 1Z4IA 3K96A 1IJBA 4RDIA 4F4IA 1C8LA 3MC1A 4GKAA 2YW9A 3D59A 4C2BA 3ANXA 2A1IA 3MLEA 4K88A 9ATCA 1PT5A 3HLTA 6Q21A 4YO7A 3OTGA 3LBIA 3U44A 2X19A 2W58A 5FNZA 4BVEA 4X6UA 1RYMA 5CEFA 1NPTO 1YS1X 4BVBA 1FP6A 3AF6A 4UATA 1FPQA 1QH8A 3U7IA 2PS9A 2XWJI 4CMJA 3CX7A 3G0IA 2VZLA 2WYWA 2YWXA 2REOA 2AYYA 3JRWA 3QHQA 4FGZA 4JGIA 4TV9A 1Q16A 3SY8A 2N75A 4RCYA 3VTFA 1P29A 2WF5A 3WISA 4F11A 3D31A 4Y0NA 1QAOA 1K0UA 3H1FA 5CTAA 2AOWA 4GYJA 2GPJA 4CR7A 1QVZA 1MAUA 2H2DA 3AWDA 1G16A 1ZZEA 2R8YA 1ORIA 3WWEA 2OCBA 1NUAA 1ZU5A 4U5XA 4XWAA 5DX1A 5BOVA 4EY6A 1IBKB 1GDDA 3VHLB 1KORA 2G88A 4IUYA 3GBPA 4TL7A 4PNEA 4FGSA 2XADA 1G3RA 2HJ9A 3QOXA 4YRNA 3VQTA 1DKLA 1F8XA 1ZONA 3I30X 3JATB 4N1AA 3GH3A 4BFXA 4CHTA 2E4UA 2QQ5A 1SBTA 4ICIA 4PLZA 3UGJA 3A2LA 3AKEA 3BJRA 4QU0A 4EJSC 4WKNA 4D8WA 4P58A 3HFGA 1TUBA 3DB1A 1T5SA 2R60A 1FA9A 4IEIA 5B7NA 2RKBA 2VDMB 1NN1A 3G7UA 2ZTSA 4N39A 3ZS9A 3BD6A 4ENQA 2YZGA 4OGKA 3RKUA 4Q1CA 2ZKLA 1QONA 1UBJS 3QX7A 2HY7A 4IV5A 4AW9A 5ALZA 3LY9A 1I24A 2LKDA 4N5HX 3CRVA 4P22A 2NTVA 1NN0A 2FW6A 2KQUA 2G5CA 2QF7A 5JCJA 1ZUNB 2NYRA 2QAJA 3OJXA 5JMOA 4PX2A 3P26A 5DT2A 3WFIA 1Z6ZA 5CJJA 4CM7A 5JXIA 4FOSA 1IWOA 2XCOA 3L41A 2OBYA 3QIAA 5AKIA 2YNMD 3LNCA 4HEJA 5G0TA 2D62A 3W0LB 1OB2A 3DZHA 2XYVA 1H0KA 1N7JA 6YASA 1KTIA 3ADOA 2AD5A 4BNTA 4EF6A 3WGVA 1WRBA 3BEOA 3L0OA 1BYUA 4P82A 2ENWA 5C8XA 3DWFA 5CG1A 1LQ2A 2J0VA 1SQFA 2OO3A 3LLUA 3T3IA 1JDPA 1N0IA 1ISHA 1ZN2A 2DPYA 1RXCA 3EDYA 3NNSA 4OUDA 4FFDA 4CFZA 3L0SA 1ISJA 2JAQA 3LC7O 3RR2A 4TSFD 1GL3A 4G89A 2PRJA 4N5MA 3KOZA 3ERCA 5HKAA 5HDQA 1DXQA 3N6RA 4CM6A 4HAYA 3I76A 4PWZA 1R6VA 4DTIA 2JD0A 1P3DA 2P3QA 4G4IA 4ENTA 1WXDA 3PJGA 4OLAA 4R54A 2J7PA 4FILA 4IMIB 1DX4A 5BW6B 3PL5A 2OHVA 1KOFA 2XDAA 1QHEA 3ELUA 2GFHA 4YYEA 4OSEA 1KJNA 3NHBA 1CX9B 1ESDA 2FFQA 3KXLA 1SVOA 5LA6A 2G8LA 4V24A 1Q20A 1S3GA 2IP4A 3AVWA 2WUEA 2IY7A 4AIRA 4Y6GB 5B3JA 4BQEA 4RK1A 3H19A 4YBRA 2WHEA 4INZA 5K0JA 4YLEA 1S2NA 2ODQA 3ZVLA 4TMVA 3P0EA 1PW5A 4QQNA 4C0AC 4C0SA 1YZNA 4B4OA 3OZUA 4LTMA 1C9NA 2FK7A 1Y8RB 3C4QA 1K0FA 4IEEA 1F2UA 3P97A 4JY7A 5L4LA 4UUOA 1LD3A 4ER6A 3NS7A 4BATA 5E9WA 1VL0A 3MWEB 2O19A 1E2UA 3RB8A 3GLFB 1PF7E 1QE0A 3OU6A 3Q3VA 3LOUA 3F5QA 4N3CA 4BNYA 4DNOA 2IHJA 1IQ0A 4IIJB 4C07A 2OVBA 2AQKA 3G17A 3I1YA 1SXJC 4BXOA 2W4QA 4EB6A 4OQZA 1GU0A 3W4JA 4Z2YA 4BAUA 1H6AA 1HDEA 2G4VA 4KQMA 3O4JA 4CF6A 2VF5X 5KHOC 1ADCA 1JLLB 4BGDA 4L6CA 1AGRA 4WNAB 2D0IA 3DLPX 4M1EA 4B6SA 4UM9D 5HRAA 1ZMRA 4WZBB 2H2WA 3TGLA 1X7YA 2O8CA 4J1QA 4MB0A 3CKMA 4GNRA 3QFHA 3W3AA 4KU4A 4QA9A 3VYSB 1ZINA 3S4YA 5BQ5A 1FFDA 4IIHA 4D80A 5A6VA 3DZBA 5B3JC 1UM9A 2R62A 2XT6A 5MN4A 4ZQGA 3HWSA 5IT0A 3H65A 1OA1A 4HMOA 3PC4A 3L5KA 1EP9A 2X3YA 3MINA 3EH1A 3JWPA 3WE7A 4QFCA 1PL8A 1KGSA 1F9AA 2R9VA 2NO4A 2YZ7A 5JJKA 3OQPA 2G70A 2ZAGA 3NEPX 1PKEA 4B3TB 2F1JA 1CP2A 2XVAA 1CR2A 1I3LA 1IK4A 1OZGA 3NR2A 5DEOA 5BOSA 4K0RA 3UAGA 1B0PA 2HLHA 3PUJA 2AHRA 3I6BA 5BV0A 2FR8A 5C8ZA 2WJWA 2O2IA 4AYXA 1N3YA 3DW1X 2XBUA 4JL5A 2F43B 3VDMA 3DT9A 1ZISA 3OMWA 3P0JA 2ZBRA 1IQRA 1Z2PX 2Z2KA 3KOUA 3LX6A 3NDIA 3AFNA 1EYZA 1MOZA 4LW8A 1USVA 2LZ0A 3H75A 1W2GA 3FPBA 4JJZA 2CFOA 1GUBA 1TMOA 3Q12A 1XUOA 1KNQA 2VNJA 4FP9A 1FPMA 4IJ5A 4EPRA 2ZWPA 5CTJA 2BH2A 3O7MA 1GTRA 3T4EA 1MABA 1Y1QA 3FZYA 3IAS1 4KN9S 4D02A 4KFSA 2QL9A 3QG1A 1RW4A 2VJMB 2A1TS 4C6HA 3VR4H 4D4JA 4DSZA 3RSFA 2POQX 3A3KA 2I2XB 3PEEA 5KAMA 3U60B 3AEYA 1YOVB 1IXKA 3CURA 3DP7A 2G9QA 1AO3A 2VQDA 3QLVA 2JGEA 2PKQO 1E2PA 2AVDA 3G79A 1FEZA 3N8HA 2EW2A 3Q0IA 4OB7A 1E3JA 4NENA 4U2BA 3RSQA 3GNTA 1SHJA 2J9ZB 5A4AA 4OYHA 5GVSA 5LZ2A 2Q3CA 1NXQA 4I4CA 4ZAXA 3OC0A 4O4JA 3CXRA 2IH5A 3ZWWA 4UD2A 4MV8A 1BZYA 4Z9YA 1KZ7B 4FOTA 3CISA 3S40A 4B81A 1E1KA 2QUAA 2EYQA 4KLCA 2QTFA 5A5VA 3REOA 2C95A 3VVBA 4BNUA 4KLRA 1HPLA 3PZRA 1Y1PA 4G1VA 1KDRA 1N5LA 3VGJA 4L57A 3UH1A 3GRCA 4WGGA 1WXIA 4ZAGA 3IE1A 4QU8A 1QVAA 2GXSA 3Q2KA 5K2MA 3WLNA 4BQPA 2FPPB 3W1VA 3OQNA 2GM4A 2PUJA 2XYQA 2JK0A 3AH8A 3M7IA 1JYEA 3NBUA 4E32A 3L77A 1T3TA 1A76A 2NT4A 4QYMA 5DNWA 3LHFA 2XF8A 3KQQA 3O84A 4WKGA 3AU9A 3SDZA 1XXHE 2A4KA 1RRVA 4CU5A 4EH1A 4P2GA 4YMUA 5SY6A 1JLHA 1ZA2A 2H9AA 5E6RA 4ZT7A 1NLFA 4G4SO 3JQRA 3IAHA 2X2OA 1QGOA 1CJVC 1PX0A 3D0QA 2P6NA 2CJYA 1XC7A 3IB3A 5ICEA 3QLVC 3P8ZA 4F3TA 5B3LA 1KO8A 3ADKA 3THYB 1B1CA 5KYUA 3WYAA 1IBRA 1Z07A 4M2LA 4M1QA 5K3DA 3UCXA 5EMNA 4D99A 4OX9Y 3RDPA 3DPIA 4ETIA 1FNMA 5BN5B 2M9MA 4CTNA 2HA0A 2Q6VA 3WIOA 2GN8A 2QVLA 3IMFA 5B1DA 5LDDC 1K4KA 1E7WA 4QSHA 3CINA 3WJ1A 3QKSB 2IU0A 4N41A 1CEYA 1YS9A 1T1IA 1MCZA 2A92A 3VSAA 5A3QA 2ZBUA 3GGCA 3OFSA 5JYEA 3K0FB 1ZK1A 3PUXA 4D8XA 3C6QA 1ABBA 3E8SA 3FZNA 1DQZA 4UNNA 1I5EA 2E49A 2NO5A 4ZYZA 2H1VA 3U4QB 2F55A 1SJ9A 1O97D 2ONCA 4HDMB 4PX5A 1NWCA 3FF4A 3PVZA 1Y9AA 3PF9A 4I9HA 4YRIA 1T9GS 1UJ5A 4HDOB 4AICA 4CIYA 3NT4A 2MSEB 4HJXA 1S02A 2IEZA 1R4MA 2O4UX 4CF5A 1XD2B 1JB1A 4Q15A 5JQWA 1MH1A 3I4LA 4QARA 3R9XB 4R8SA 5FLYA 2OYCA 1CZKA 1SVLA 1XEWX 4FFVA 4GDMA 1QZUA 5A7GA 3EFEA 3NC4A 4C21A 4RJIA 3HDJA 5TVGA 1GYRA 3KL2A 4D1YA 1IXRC 3L3BA 4G8CA 4B6JA 2VHYA 3RODA 1TZBA 1M8KA 3R3UA 5DP1A 2DQYA 3L6DA 4FQ7A 3SR3A 5FBKA 3M6AA 3UA3A 1BG6A 1O77A 2JCVA 3FCCA 1X8LA 3NIBA 4HPWA 4I8IA 5D7NA 2FWBA 2F1KA 3CHYA 3PC8C 3TPZA 2VG8A 4OMDA 1MTOA 4B3JA 3WL6A 4AZ3B 2C59A 4ZO9A 4NZZA 5AI9A 1A8UA 3ZV4A 5LDHA 4W5RA 5AW5A 2AS0A 4INOA 2NSDA 3WYFA 4NNOA 3LX8A 3PFNA 3BB4A 5A9SB 2J0UA 3AUTA 3RRZA 4CIWA 1TFRA 1DRVA 1WCV1 5H4HA 4IJ6A 3TI7A 2P1ZA 1T1GA 4QUIA 5T4HA 3TJRA 3WDMA 5JNRA 4TZ0A 4ILKA 3OCJA 5I48A 1ZD4A 4MQFA 3SWWA 1IBSA 2JCYA 3I73A 4RTRA 2O8BB 1HQKA 5LDGA 3GP3A 1O94A 2C97A 2OLJA 3PA6A 2C82A 1E9DA 2IZ5A 3N7UA 4TUYF 3GJQA 2G9ZA 3ESXA 3IMCA 3TZBA 2BDEA 1NXVA 3QVWA 4K9RA 1I4WA 3OFKA 3D0KA 2QVXX 4MP3A 3RU2A 2JANA 3RUFA 3WJ7A 3AKZA 1YB7A 5T4FA 2JL1A 3SFZA 2DERA 4Q47A 1J8VA 3FKSA 3I2KA 2WHYA 3O4HA 2YWBA 1L1FA 3RYTC 4I4TB 1E9AA 1CUXA 3A4VA 2I1LA 2A5DA 1OC4A 2QTHA 2VIIA 4WBSA 3QXCA 2G07A 2XMPA 4NPCA 2Y66A 4EHNA 3HM9A 4GMHA 3CN9A 3LT5A 3TIIA 3TZQA 5KOHB 2VF4X 1J4AA 1GT6A 4RIFA 1LPNA 3NUQA 1YULA 3DNFA 1OYYA 2ZUUA 3DXYA 3E9YA 4LZLA 3S2GA 4BBJA 3H16A 1NHGA 3P2YA 4FHGA 5DBOA 3WLLA 1SUSA 1DWQA 3Q2OA 4PLCA 2R8BA 3KQMA 1SOWA 3C15C 3KLOA 1WOMA 4GX1A 4CMEA 5JRJA 3R5HA 2DULA 1JQ3A 3N0VA 3YASA 2FG6C 4MVJA 3AHGA 3D6HA 2OSVA 3LOPA 3NTOA 2CV0A 2A9RA 2E9SA 4YCDA 1RIIA 4BO3A 3W1EA 3SHWA 1Z6QA 4OLBA 4ZVVA 1GFSA 3SXJA 1E18A 3HV2A 3GRKA 2PXHA 1LVUA 3MWLA 4JBNA 4DA8A 1IXYA 3EVEA 1JHMA 5JHGB 4B3DA 1OLUA 3CEMA 1L5HA 3RV4A 4RJTA 5LP6B 2OB2A 4C08A 3HDHA 2DHRA 3EZ9A 2ZG6A 4LYYA 3LCJA 4YAFA 3EGOA 4ZI7A 1DFGA 621PA 3D2CA 1DE0A 1PT8A 2JDIA 1KEZA 2JBWA 1WSWA 2JNWA 4J43A 3IQDB 1WF6A 2CFSA 4MJLA 4OX9B 1GPWB 2GCOB 3EZ2A 1NW6A 5BSEA 5BV8A 3CVVA 4CEJB 4CLEA 3AJ8A 3D6FA 3WIVA 4MGKR 4RXMA 3WMEA 5CA1A 1C0KA 3L7AA 4M83A 1U8AA 1WMFA 3I4CA 2R4UA 5FL7A 5FPHA 4DIFA 5IJWA 4ZZIA 4Y0VA 1GYQA 2WJYA 1HTWA 2OV3A 1CIPA 5EQTA 1WQ4A 4B47A 2PH1A 4O6VA 1GG2A 3CNBA 3CTMA 2GBIA 1J49A 1QXSA 3NBXX 1A9ZA 5F9FA 2B4RO 3KUXA 5EHGA 4TT3D 3WWZA 4AO6A 2YHBA 4C4RA 5M34A 3MAJA 1DIAA 4DUGD 4MRMA 1VSQA 3SZ3A 1FQWA 5LP1A 1GJRA 4BNXA 3ET4A 1T24A 1UK6A 1ECGA 2VWPA 1H8EA 1P1JA 2PLFA 3OP4A 1QC5B 1E1CB 2IS1A 1XCMA 2OFWA 2YJ4A 3IILA 1MAVA 2VQ3A 2FPIA 3PRJA 1FNDA 3FPHA 3QEMB 4RQBA 4IUBS 3HZHA 4FFBA 1JH9A 2AN1A 4XQ9A 2GXQA 5FWAA 3M34A 4TRMA 1FRQA 1C29B 1TE2A 3OWHA 3K0KA 3BXHA 3A36A 4LIPD 1T2EA 1ZN8A 2UVDA 3FRJA 2WMDA 3S8MA 4ES6A 2X8JB 5IW8A 1QLJA 2HCRA 2P3SA 1NQVA 2EFCB 5KQSA 2R79A 3KJGA 4U7JA 5J1SB 2IUSA 3KYJB 3PSHA 5ADWA 3MRSA 4S2UA 2YWHA 2A0FA 4F3YA 2EX0A 3QU7A 3PXEA 2IQIA 4P4LA 4WVFA 4CLXA 3NPMA 3EVGA 1F1JA 1L7QA 1QM5A 3O9ZA 1E7RA 2AR7A 3RW9A 1M0SA 1GGKA 3K0HA 2R44A 3B3AA 4YASA 4DDUA 3QFTA 5ESWA 5ADVA 2JARA 1OXUA 2FY8A 4QATA 3B2NA 2NYVA 2Z6AA 4MWTA 2SKCA 2CL7X 3E81A 4OHCA 4RKEA 2X23A 1FLDA 5AQ1A 2V6JA 2VSQA 2W2VA 5EI5A 1IDN1 5CB6A 1QV6A 2R4TA 1Q2UA 4MYUA 2V59A 2FQ1A 1CNMA 1CQJB 1PO7A 4JV5B 5DHTA 3OIGA 4ID9A 3QE2A 4QOJA 1WVIA 4U7TB 4Z7OB 1KP9A 2Q7DA 2IQ5A 3ZD6A 3KV1A 3KQOA 3Q87B 3G2NA 4H3SA 2X0IA 3CW9A 2HSDA 3G9XA 5AVQA 2OKCA 4ZHQF 2DPXA 5IN5A 3IUQA 1Z6GA 4DV0B 5L9AA 5FH9A 1X2EA 3VAYA 4R0VA 2AFRA 2PMDA 4M8NE 5D51S 4YUVA 1MFPA 3RSGA 2QTVA 3BWCA 3FNEA 1GSAA 1Z0AA 2F00A 2MWMA 3OPYB 2HXYA 5JBQA 5FBQB 2QAGC 1NIPA 3BRWA 1R0YA 2POCA 4GUAA 3WTCA 5EUCA 3DVSX 4GHWA 2XCIA 5EZQA 5KSWB 1D4FA 1XDDA 1P2VA 1Q17A 3WGYA 4N6NA 1J33A 4IO0A 2OCPA 5CEJA 2BCGY 1ZM4A 4PZ9A 3E1GA 1JFFA 5HJEA 3I9OA 1A3CA 3OKPA 4JP2A 1VKNA 1N6PA 4LNUB 4DGQA 3EFHA 4DIBA 2Y27A 5HEKA 1U99A 3Q9LA 4P54A 1A5ZA 2DQ4A 2FUG6 1D4OA 2J85A 3EXHA 1JFLA 1ZCBA 2MINB 4EPTA 4XQGA 5D86A 3HO1A 3WB1A 1MIOB 4LBYA 2NTEA 4KIFA 3WOHA 2JG3A 1ECJA 2XKKA 3TJMA 1FXSA 5FOUA 1QRAA 4N0EA 5FX2A 1J25A 2RI6A 4JX9A 4ZOQI 3V1MA 1N6HA 3HU2A 3QK7A 1JXQA 4ZCQA 1M67A 1XTTA 5F5LA 3G6WA 1JQDA 3A9RA 3HYRA 4KQHA 4RYLA 1WCYA 1M6NA 1Q1EA 3FD8A 3RUEA 2ECQA 4HO1X 3V4SA 1NVAA 1R8XA 2FMUA 4HXGA 1HZJA 4M9RA 4REQB 2ZBDA 3BERA 1FVFA 4OOFA 4UUAA 1TW3A 1I10A 4XPZA 3ADCA 2AZMA 3PUHA 5HG0A 3F3YA 1ZI9A 2C2MA 5AUNB 2WW8A 1M6HA 2E21A 3D6JA 4ASUA 1XCLA 2O6LA 5AVJA 2WFLB 1JQAA 3P1JA 1PDVA 2XI4A 3ZH2A 1NRWA 3GMTA 4EABA 4EO9A 4RY9A 5FBLB 4BFVA 3PL1A 3P2EA 4G0YA 4IDBA 1HE2A 4RPCA 1L4LA 1J56A 5H3LA 1WW3A 2C88A 2ZROA 2OBBA 4WX2B 4RTOA 1RLUA 3VU0A 3CVJA 3R9IA 3EWSA 3VX3A 2MR5A 3O47A 4JLPA 2P79A 1YUMA 2R1VB 3EXHC 4QICA 5IX8A 3QMMA 1Y5LA 2R66A 5AJHA 3K4QA 4UE2A 4NCXA 3C5HA 2JCBA 4XYLA 5IKMA 1JPUA 1QWSA 2LIVA 4B5KA 1IHUA 3ANLA 4ZAYA 1TJ4A 2IY9A 3FA2A 1KDTA 4EYEA 5JDCA 3TD6A 3P7MA 3A3PA 3USCS 4DG5A 1NW5A 4RZQA 4EHJA 4OA5A 2PXCA 5F7JA 1W5TA 5TT1A 4O4HA 4KPFC 2VFAA 3TEJA 4NEGA 3KZOA 1F20A 2NVUA 3AOEC 1KYTA 2WC1A 4AUKA 4DMHA 1MVLA 4X85A 4EKIA 3TZKA 4JLJA 3L7BA 2ZXFA 2VNKA 4N7JA 3DCIA 4JBWA 4L6AA 1GLVA 1GKIA 1W4CA 2DBVO 1M6VB 2QT1A 4UDYX 3VKVA 3OX4A 4IBOA 4KZKA 4AJLA 1GNQA 4WN9B 5K3FA 1TMKA 1X8XA 1EAYA 5U1PA 3OIVA 5AHOA 2FW8A 2HWXA 1E96A 5BN3A 4PC6A 1DBPA 1E9RA 5ITZB 3QV2A 4CCYA 3HBFA 4C89A 1A8PA 1HSOA 4GR4A 3EIHA 2RD2A 2D7CA 1XA4A 4XSVA 5FUXA 2E4YA 1HGXA 2VH1A 3GGOA 1CR0A 1AIPA 3F71A 4PCAA 3C24A 2ZJBA 4PW0A 2R5NA 4Q1BA 5FPYA 8OHMA 2NXJA 2XDQB 4OHBA 4RH3A 4YXWA 3I8SA 4N5DA 3HYSA 1I1NA 4JMPA 1ABFA 1FNCA 3W9YA 2PA0A 1XMOB 5E4YA 2B7LA 3K1JA 3UJ8A 1KIMA 2D3WA 5JDCC 4DQKA 4RNDB 1GGNA 3TOSA 5BQXA 1SUWA 2YMQA 3BIJA 4WXRA 2HT6A 1NU6A 1JQ5A 1SIUA 1II9A 2LE0A 4ED9A 3WGIA 3V8VA 4C6TB 4LF8B 4ZCLA 3LT1A 3MWFA 1ZK2A 2YWRA 4HC4A 4X41A 1MXFA 1L4FA 2H29A 2OHFA 3HNPA 1R0WA 4ETNA 4OBBA 5BUCA 2DUWA 2B37A 1WZEA 3DKPA 1VGRA 3A70A 2PL9A 5NULA 1Z75A 2BY4A 3N74A 3Q7QA 1XROA 3NNDA 1SM4A 4HQRA 4DW8A 4ETWA 5FJJA 5ADUS 5B7QA 4F6CA 3KSUA 2L2QA 2PZJA 3P5SA 1KDVA 1PK9A 5JC8A 1N1DA 2DT5A 5EWMA 1VB3A 1VIVA 2DR0A 4MLCA 2C92A 2WU1A 4YECA 4R1MA 3AQIA 5KQGA 5EWLA 3E70C 1SEVA 4W8GA 1NMSA 1N6RA 1C4XA 2HQSA 3IUPA 3VH3A 3PT9A 3STHA 2MR6A 3DEIA 2WTBA 5EKXA 4E2ZA 1RYNA 1E2HA 3FLAA 1F2DA 2GSDA 4FMCF 1TMGE 4NHOA 1OI4A 1WPGA 3HDQA 2KBEA 2H31A 4LZNA 3W2IA 3B38A 2WLSA 3PVCA