2BKFA

Structure of the pb1 domain of nbr1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
AMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZINC-FINGER PROTEIN NBR1 (NEXT TO BREAST CANCER 1)
publication title Crystal Structure of the Pb1 Domain of Nbr1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Zinc-finger protein
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bkfA01
3EC8A 1Q0WB 2NPTB 5DPRA 3WAMA 4ASWC 2IZVB 2R2OA 2KHWB 1OQYA 3IFWB 2YVCA 3A9JB 3L08A 3AI5A 2L0TA 2B3AA 1E8WA 1WX7A 2D2QA 4ANUA 1WR6E 1C3TA 1WJ6A 2KJRA 4LDTD 3V60A 4W9JA 5E6NA 4DK5A 2FCSA 3NY5A 4IC7B 2Z0EB 3P2BA 2MBHA 2GMIC 5LXHA 2O2VA 2LVQA 1E90A 3H7SA 4FHJA 5JHBA 3V61A 3WAPA 4KDLB 4KSKC 3ZO5B 1K8RB 2CHZA 1KM7A 3ZDTA 1MG8A 2KC1A 4NAWB 4AOFA 4DDID 3ZLZA 2IY0B 4W9GA 3IG3A 2N4FA 1R4MI 4LJOB 4W9EA 4MGKE 3X0WA 1I42A 4IW0A 2PE9A 4MDKE 4B95A 5J18A 2RSUA 4DDGD 2JRIB 2BF8B 3D32A 4RMAA 5AZHA 1E8ZA 2KN5A 2JT4B 3VTWA 4BKGA 4GN1A 3DPDA 3HM3A 1ZW7A 2JZZA 2MP2A 1Q1OA 1GNUA 4GOCA 4W9DA 1UD7A 3N32A 3VH3B 1WGYA 2LGDA 1NBFC 3DVGX 4F7ZA 3OLMD 1WMHB 4K7SA 1GC7A 3U8ZA 3VHTC 4GSWA 3UGBB 3VDZA 4GDKA 4KV2A 2K6DB 3APDA 5CX3A 1WJ4A 2CS4A 3H7PA 4PYZA 1S3SG 2WX0A 3MHSD 4IWOA 4MGZE 2OOBB 3VTUA 3M63B 5CHWA 4WWPA 1P3QU 1R4NI 3EHVA 1WE7A 4EKUA 3ZUNA 4A20A 2N1VA 1CMXB 1HE8A 3CMMB 2WDTB 1UBIA 3N3KB 4IM0A 3VXWA 4K1RB 1TTNA 2RGFA 3IBEA 4JQWC 4XC2A 2DENB 2HE7A 2ZCBA 3PRPB 2NBWB 3UF8A 1WGRA 1P98A 5BO4B 3OJ4B 4KDIC 5DPWA 4K7UA 4MH0E 4EZLA 3VUWA 4JLCA 4AP4C 4NJ6A 1E7VA 1EF1A 4CYEA 3A9JA 3NZSA 5G2NA 3X23A 5KHQA 2KNBA 2RR9A 4W9LA 4KZ0A 3VQIA 3DOWA 5JHAA 3K9PB 4CHKA 3ZNHB 1E8YA 2CR5A 3MTNB 5IAAC 4ANVA 4E74A 1OEYJ 3TJPA 1J0GA 4NQKE 2KFJA 4K7WA 3QJZA 5EDSA 1YX5B 2JF5A 2KFKA 2DYMA 4DHJB 2KLGA 2QHOA 3B0AA 3RD2A 1WZ3A 4I6NB 1V2YA 4GGQA 3KYCD 2PJHA 3ECIA 2D3GA 4N9F4 2M17A 3PHWB 3PSEB 4M8MA 1KJTA 1LM8B 3WA0A 3PREA 4BOSC 1C1YB 4NPNA 5D2MB 2M1MA 3HK0A 4I6LB 3ML8A 4BBNF 3UQBA 3ZRFA 2LGXA 3RYTA 1TZ1A 3VTVA 4F1SA 3AULA 5TR5A 3QARA 4AWJA 1WXAA 3DCGA 3TCAA 2J7QB 3NZUA 2LRWA 1WMHA 2MWSB 1BT0A 3EFUA 3PHXB 1E7UA 3ENEA 1NI2A 4IUMB 2ZPNA 3H1UA 4K81A 2EMSA 4BBNC 5DPSA 2C7HA 2J0MA 3DBLI 2DYOA 4MELA 2JPHA 1P1AA 3DVNU 4HLEA 5AEKB 4WJPA 2O6VB 4FJYA 5J17A 2BPSA 5LXIB 2PE6B 1U4AA 3ONSA 3R3MA 2L76A 3AU5A 2R2QA 3V6EB 2N7EA 1EF5A 2LJ5A 4A3PA 1RFAA 4II3B 2KMAA 1WM2A 1WZ0A 4XZ4A 4M8NA 2KDFB 1YJ1A 4TKNA 1I35A 1L2NA 3PV1A 2KOXA 2ZZPB 2KVRA 4NJ7A 4II2B 4EFOA 2KDIA 2DYBA 3EECA 3PZDA 3A4SC 3T8MA 4URKA 1J8CA 3L10B 2FAZA 1WXMA 3ZNGC 2DAJA 1YIWA 4EZJA 2C60A 3M62B 3K9OB 4KIKB 3A1QA 2ASQA 2MSED 4IWPA 4BKTA 3PVLA 3QQ8B 1V9JA 2MLBA 4PS7A 1WXSA 3CSFA 4E71A 2KTRA 5L95C 1H4RA 2PEAA 4KSLC 2D11A 2ZCCA 2BYVE 3A9KB 3JSVA 3NHEB 4P7IA 1EUVB 2XEWA 2DAFA 2AL3A 2G3QB 4MJSB 3W1SA 4WWNA 1OTRB 4E3CA 2L05A 2L8JA 3S2AA 3TL5A 3VUXA 4TQ1A 4EZKA 1NDDA 1YX6B 2CU1A 1Y8RC 3PRMB 3AXCA 3SU8X 4BKSA 4FULA 2G4DB 2D10A 2GBMA 4PS3A 3R7QA 3BINA 3UQAA 1V86A 3NS8A 2NVUI 4GDLA 3QX1A 3DBSA 2EMTA 2I1JA 2GBJA 2KDBA 3APFA 4GIVA 1WM3A 1V80A 5FR6A 3C0RB 3HM6X 3IVFA 1P0RA 1GC6A 4G0NB 3JYUA 1IPGA 3HIZA 3QAQA 4IG7B 1RAXA 2FCMA 4ZRKA 2FCNA 4LDTB 3KVFB 3W1YA 1WX9A 2IO3B 4AUQC 3KUCB 4KVGB 2FIDA 2FUHB 2IO1B 4W9FA 3BY4B 2JZ3B 2KO3A 2NR2A 4G3XB 4EOYA 3N30A 2CKHB 2XK5A 2M4NA 4BVUC 2JRHA 1GG3A 2N9PC 3DVNV 4MGIE 4W9CA 2HJ8A 4W9KA 4MEMA 4BKSD 2DZKA 1J19A 1TBEA 3RT3B 4PYUA 2NPTA 2MBEA 4G50A 1YQBA 1UBQA 1E8XA 2FNJB 3KW5B 4PS8A 2KDEB 1YD8U 4OVUA 3I3TB 2MW5A 2Z0DB 3DVGY 2UYZB 2L3ZA 4FA6A 1WE6A 1UH6A 1OEYA 3VUYA 3ZTDA 1XT9B 2MA9B 1UGMA 4I6PA 2KWVB 1G6JA 3JVZX 3PLVA 2KXJA 2CHXA 2HTHA 2O2VB 3ZDMC 2RD0A 5L83A 2BYFA 3L16A 2L7RA 3W1SC 4NAWA 5AZFA 1WIAA 2ZVNA 5D94A 3QWZB 2GOWA 2IO0B 4HCPB 2ZNVC 4ZRIA 3U7DA 2MBOA 4BFRA 4X57B 2LZ6A 2FCQA 2BKFA 2UWQA 1Z5SB 2BWES 3QIJA 2HD5B 2YLMA 2AYOB 3V6CB 2MRPA 2VRRB 2GBRA 2A5UA 2KWCA 3LJ3A 2LVPA 3IHPC 4TV3A 4MJSA 2JWZA 2K39A 3Q3JA 3R66C 2KLCA 3KH0A 3RULA 2AEHA 2MP2B 4FJZA 4HPMB 3SD5A 1Q5WB 5IA7A 2K8HA 3DDCB 1LQBA 3RZWC 3VFKA 3KUDB 4DBGA 3H6NA 3H9DA 3A4RA 4G11A 4DHZE 3OJ3A 3TMPB 1WI0A 2LGYA 2REXA 3LDZE 4DHZB 1GJZA 1WY8A 3M3JA 4GDKB 2NS5A 4LCDE 4MSMB 4W9IA 2GBKA 5CHFA 5D6JB 2C7MB 1RRBA 3GZNI 4TQ0A 4IM2A 2LXCA 2XBBC 3RZFA 3DBHI 4JL9A 1JRUA 1TGZB 1WGGA 3RCZA 2LRUA 1E5WA 1L7YA 2IO2B 2OJRA 2WYQA 3WALA 4AJYB 4GMVA 4CO7A 2GBNA 2Z59B 3Q3FA 1V81A 3ZKJC 3L54A 3O65B 2LVOA 2ZEQA 4FADA 2KQSA 2M8SA 2N9XA 4MSQB 2I1KA 4ANWA 3U30A 4WQOB 2V1YA 2IYDB 5JZEB 4FN2A 1WH3A 4GXBA 3ZTCA 4F8CB 2KC2A 1T0YA 1D3ZA 1WJUA 2D07B 4JIOU 2K8BA 2L0FA 4HXDA 3QK0A 5DPTA 1V49A 2W9NA 3M95A 3L13A 3OAWA 4GU2A 3PT2B 5CHVC 3ZNID 4HJKA 3B1LX 3PS6A 1AARA 4IM3A 4MM3A 1UELA 3B08A 2NCNA 4WWOA 3JW0X 5E6OA 3VAWA 4WAAA 1PQSA 2A4ZA 2ZJDA 1RLFA 4WJNA 1VD2A 1IP9A 4AJWA 3ALBA 3MJWA 1WXVA 2LXAA 5JH5C 4ANXA 2KFKB 3SDLC 5J2RA 2J0KA 1WX8A 4HCNB 2MBBB 3PTFC 3PGEA 2LD9A 1H8CA 2DHZA 3GOEA 3ZW3A 4HK2A 3DQVA 1X1MA 4FJVB 1SGHA 3VH4B 3QA8A 3UINB 5GMVA 4IWQA 1S1QB 5CTRC 1WGDA 5DCNA 3KYDD 1V5TA 1GUAB 4NY0A 1UZXB 2J0JA 4WJQA 2JXXA 3V62A 2DZMA 2MBQA 4M0WB 4GB9A 4DWFA 3SHQA 5G55A 4JGHB 2JUOA 3T9LA 1OGWA 1XD3B 1LXDA 3A33B 4BOZB 3TIXA 4B6WA 5AZGA 2K8CA 1FXTB 5KHOA 4RM9A 3ZIMA 2N9EB 4DHJD 2G45B 1SIFA 2ZPYA 1WF9A 5C23A 2KMCA 2KD0A 4ZDVA 3PLUA 2BYEA 2KJ6A 1A5RA 4FHKA 2KQ7A 2O6VA 3WANA 3KUZA 5C1ZA 1WYWB 4RM8A 2KJHB 2IY1B 4ZRJA 2DZJA 2K25A 3NOBA 4FLHA 2KANA 1WFYA 2MCNB 3PPAA 2L00B 4NQLB 3QC8B 2BKRB 2LUEA 3QHTA 1KLVA 1M94A 2N1WA 1V6EA 5D7GA 3L0WB 2LI5A 2KTFA 4TUUA 1EO6A 4HVBA 2C5LC 1Z2MA 4YL8A 4J6IA 3PRZA 4HPLB 4KIKA 1LFDA 4KZCA 2PPHA 3L17A 1F9JA 2DX5B 2N7DA 3A1QB 4EEWA 1KOTA 3UIOB 4HWIB 1ZKHA 2O6VD 2WX1A 2Y5BB 2IBIB 1WJNA 3ZRCA 2M0XA 2JY6A 1WR1A 2KTRB 3A9KA 3QCAA 4ICUA 4HDOA 3CSTA 5LLIA 2KX0A 4OVVA 2CHWA 3JSVB 1SE9A 2C9WB 3ZVVA 4A3OA 2K6QA 2KWUB 2RPQA 2EKEC 3ML9A 3CF6E 3DBRI 5HKHA 1QZEA 2C7NB 2BGFA 2ZNVB 2BWFA 2NBUA 4B9KA 2ZVOA 4ZYNA 3R7RA 2MX2A 2DZIA 3HHMA 2KZRA 1IYFA 2NBVB 4HDQA 1P9DU 1WGHA 2FIFA 4ICVA 4GDLB 1ISNA 1WRDB 4W9HA 3VVWB 2KKCA 2MQJA 3H7PB 3WAOA 4EUTA 4XX5A 2V4LA 2LASA 3AU4A 3APCA 2LWPA 2JVCA 2AWTA 4MGYE 2G4SA 4LJPB 3RUIB 2AL6A 1VCBA 1ZGUB 4NNJB 3TBLD 3WIMA 4FBJB 1XQQA 1V5OA 3ZNZB 2K1FA 4DXAB 5E6PA 2XK5B 4WJOA 2KK8A 2KX3A 2WWZA 2V3SA 3UIPB
chains in the Genus database with same CATH superfamily
2BBCA 1Q0WB 4ASWC 1K51A 2R2OA 1KLUD 3AEEB 2YVCA 3AI5A 3PZ7A 2B3AA 5H8YE 1WR6E 4W9JA 1PDXA 2FCSA 2DWQA 1QOGA 2B76B 5LXHA 5HHDG 4FHJA 3O13A 4ZYSA 1QQRA 1B1ZA 1KM7A 2KC1A 4AOFA 2N4FA 2RSUA 2JRIB 3D32A 1E8ZA 3AE7B 4KGSA 4OZAA 4C4VA 2VZKB 1FPYA 3SFEB 4DQOC 1WGYA 2LGDA 4WH4A 2JYEA 3DVGX 1ZP0B 1DYQA 1TT5B 3VHTC 3UGBB 1CQVA 1J7CA 4GDKA 3APDA 1WJ4A 4PT5A 4WWPA 4EKUA 2FE8A 1JWUD 1KLGD 4A20A 1HE8A 2WLBA 2WDTB 3AE8B 2LHDA 1TTNA 2DENB 5C3JB 3NZ3A 4L2YA 5BO4B 4K7UA 4DXFA 3VUWA 3MJ5A 4XDDA 1EF1A 3A9JA 5E6JA 3NZSA 3N1YC 5G2NA 3TEXA 1GOZA 4KZ0A 1SJHD 2CR5A 4GLSC 3QJZA 2WXFA 1YX5B 5BMGA 5EDSA 4XDCA 4DHJB 3IAM1 2G9HD 3RD2A 4I6NB 2WU5B 3KYCD 4GGQA 2PJHA 3ZXRA 4HJGE 3AE2B 4NPNA 4I6LB 3ML8A 3VTVA 4YSXB 3AULA 2WGSA 4MACA 1BT0A 1E7UA 1NI2A 2ZPNA 1FCLA 1MVKA 4K81A 3RNFC 4BBNC 2C7HA 2J0MA 3DBLI 4MELA 3U7ZA 4HLEA 4WJPA 4BAXA 1JWBD 1KRHA 5LXIB 1U4AA 3ONSA 1VZ7A 2BS2B 2N7EA 1EF5A 2KMAA 2KYWA 4XZ4A 1T5XD 3V05A 1UWXA 2KOXA 1ZE3D 3T8MA 2LJIA 1IGCA 1FO4A 4EZJA 2C60A 1MJDA 3A1QA 3FILA 1DOIA 4JWUC 3PVLA 1A70A 4E71A 2ZW1A 1EUVB 1V1PA 2G3QB 4ZOHC 4LNFA 3AV8A 4E3CA 3VUXA 4TQ1A 2CU1A 3PRMB 4BKSA 3RN9C 3DBHB 3Q69A 4JE3B 2GBMA 1I4RA 1L6UA 2I2YA 2EMTA 3APFA 2WHIA 3P4PB 5FR6A 4A8XC 1IPGA 2FCMA 4ZRKA 2ONQA 1GB4A 4WAFA 1PFDA 2FIDA 1F0ZA 2JZ3B 2XK5A 4BVUC 2JRHA 2N9PC 4W9CA 4W9KA 2DZKA 3RT3B 4PS8A 4RGTA 1V1OA 3I3TB 2Z0DB 4HRSA 2UYZB 1UH6A 2M56B 1SE4A 5G5HA 3SEBA 1TZOA 4RCOA 2PIAA 2BVCA 1FCCC 2KXJA 3URYA 2BYTA 2HTHA 2O2VB 3ZDMC 5L83A 2BYFA 3L16A 2QEJC 3RNBC 4BFRA 1K53A 4YT0B 1J7BA 3N1XC 1MI0A 3BIID 2UWQA 2V3NA 3QIJA 3V6CB 2VRRB 2MJEA 3LJ3A 2LVPA 3Q3JA 3GB1A 3DHGC 1QOFA 4FJZA 3RZWC 5BYQA 3A4RA 4G11A 1FNWA 3OJ3A 2WXJA 1YN3A 3LDZE 2NS5A 1ESFA 4M01A 4IM2A 1TGZB 2H89B 4LNIA 3RCZA 2LRUA 4AJYB 3NVZA 3Q3FA 3OG5A 3N9YC 1DOXA 1V81A 2KACA 4TMAB 3BVMA 4FADA 5EE9A 2N9XA 1L0YB 4FN2A 3ZTCA 4QAYA 1T0YA 1WJUA 1RFKA 2MHJA 4HXDA 5DPTA 2WXOA 3U52E 1DGJA 3ZYYX 3ZNID 4K3CA 1AARA 3VAWA 5E6OA 1EU3A 3GE8C 1IBXA 4WAAA 1RLFA 4WJNA 4A6QA 3ALBA 3MJWA 3AMZA 2LXAA 2KFKB 1WGKA 1L0XB 3SDLC 1E6EB 1TKGA 1WX8A 1K50A 2V9HA 4HCNB 3VRBB 3PTFC 1B9RA 2XNAC 3PGEA 3TEWA 5BYSA 2DHZA 3AEBB 4FJVB 2BS3B 3UINB 1WGDA 1YJIA 1QKZA 1XLQA 4NY0A 2JXXA 2MBQA 4DXGA 3DBLB 4DWFA 4CQNA 4J3OD 3C8YA 1HTOA 3T9LA 4BOZB 2PLPA 1FXTB 3ZIMA 2N9EB 4RF1A 2G45B 5IP4D 2J42A 2KMCA 2KD0A 2BYEA 2KJ6A 2QILA 1JWAD 2L1AA 1ZXIA 1ZOYB 1XEEA 2IY1B 1KF6B 3FC4A 2IGGA 1VRAB 3P4QB 2K25A 3NOBA 3DHHC 1PGAA 1JCKB 1WFYA 2MCNB 3PPAA 2L00B 2PTLA 2BKRB 3L0WB 2LI5A 4RF0A 1D5XC 1EO6A 2C5LC 3AN1A 3C19A 3L17A 4HWIB 2O6VD 1PGBA 2L52A 3ZRCA 2M0XA 3A9KA 1UNSA 4IOIE 2KX0A 4OVVA 2CHWA 4ZRPA 3JSVB 3ZVVA 2K6QA 3ML9A 2EKEC 3DBRI 2GI9A 4N59A 2PMVA 4B9KA 4ZYNA 2Y3AA 2DZIA 1FXIA 3IT4B 4PK1A 2FIFA 1N63A 3VVWB 3H7PB 4XX5A 2LASA 3APCA 1RWSA 4MGYE 2W54A 4YSYB 2AL6A 2CJNA 3TBLD 1JMLA 3NUHB 3WIMA 2QJLA 4FBJB 1C77A 1YNTE 1Y56A 1XQQA 4NJCA 1SE3A 3DVGY 2V3SA 3Q8AA 1KTKA 1FFUA 2QDFA 1OQYA 2E3TA 2L0TA 1XF5L 1E8WA 2BQQA 4ANUA 5AUKA 2KJRA 3V60A 3Q8CA 4IC7B 3P2BA 2R61A 1UF0A 5FR3A 5JHBA 3HUIA 4KSKC 3ZO5B 3PZ8A 1K8RB 2Y5CA 3ZLZA 2IY0B 1XXGA 4W9GA 2J52A 1R4MI 2RDGA 4IW0A 2IGDA 4B95A 3W2DA 4RMAA 5AZHA 2KN5A 1EM7A 4BKGA 3DPDA 2MP2A 1UD7A 3OLMD 1WMHB 1YJJA 3VDZA 4R3DA 2K6DB 1GB1A 3ZJVA 4PYZA 3MHSD 4MGZE 3M63B 5CHWA 1P3QU 3EHVA 3MC8A 1CMXB 4L1BA 3CMMB 3P4RB 2RGFA 3EGRA 3IBEA 4JQWC 3I63C 2ZCBA 3PRPB 3OJ4B 1FEHA 4MH0E 4EZLA 4AP4C 4JLCA 1ZDVA 4NJ6A 1E7VA 2LHEA 2MEKA 1CJEA 5KHQA 1QF6A 2RR9A 1MPEA 3VQIA 3DOWA 3GS2A 3K9PB 4MM3B 4CHKA 4E74A 1SIJA 4ANVA 1F2RC 1OEYJ 1C9FA 2EELA 4K7WA 4LNOA 2KLGA 4A90A 2M19A 3FAHA 3ECIA 4N9F4 3PSEB 2KWDA 2Y5PA 1AYFA 3WA0A 1WXQA 3PREA 4BBNF 2BT6A 2LGXA 1TZ1A 4F1SA 3KLSX 3QARA 2MWSB 2D3CA 3H8HA 1TS5A 2EMSA 2JPHA 1P1AA 4HKQA 5AEKB 2O6VB 3Q2AC 3NG0A 2M0AA 3R3MA 2L76A 4P1BC 2R2QA 4A3PA 1WYGA 1WZ0A 2QC8A 4M8NA 1I35A 3PZDA 1J8CA 1D6EC 2IJ0A 4OHJA 3W9CB 4WQMA 3R2TA 2WXQA 3M62B 1XCTL 3K9OB 4KIKB 4YTPB 2ASQA 4IWPA 4YTNB 3QQ8B 4P16A 2MLBA 5L95C 3BZDB 2ZCCA 1T0QC 3NHEB 4P7IA 2XEWA 1YN5A 2AL3A 4MJSB 3WCQA 3AXCA 3SU8X 3VR9B 4B0MA 3NS8A 3ABVB 2K9XA 2GBJA 4OZCA 1GC6A 4G0NB 4S17A 1D4BA 1RAXA 2IO3B 4XWTA 4AUQC 3KUCB 4LLGM 2FUHB 2INCC 4W9FA 1XLOA 3DVNV 4MGIE 4BKSD 1TBEA 2NPTA 2ON8A 4G50A 4AQ7A 4A9AA 2YEPF 2MH7A 4FA6A 1WE6A 1R4MB 3VUYA 1XT9B 2W3SA 3P42A 2RD0A 4RGOS 3W1SC 4NAWA 5AZFA 2ZVNA 2GOWA 4ZRIA 4HCPB 2LZ6A 1YQ4B 1PYWD 1E9MA 2HD5B 2YLMA 2MRPA 2QCZA 2KVZA 2KWCA 3T3NA 3R8BA 2JWZA 4LTUA 3R66C 4C4VB 2KN4A 2AQ2B 1LQBA 3NVYA 2WXLA 3KUDB 3H6NA 4DBGA 3NVVA 1C79A 1NYQA 1SJED 2LGYA 2JWUA 2REXA 4GDKB 4W9IA 4IDIA 5D6JB 4HPPA 4TQ0A 2LXCA 2XBBC 3RZFA 3CWIA 3WALA 1E5WA 2OJRA 1L5PA 3DHIC 3MC0B 2LVOA 2KQSA 2I1KA 3U30A 4HKZE 2V1YA 1UUPA 4F8CB 2JXTA 2K8BA 3QK0A 1V49A 2W9NA 5CHVC 3TUOA 1SEBD 3PS6A 1V8CA 1UELA 3B08A 2NCNA 2A4ZA 4HROA 1IP9A 1XCQL 3AB5A 1FNVA 4JX1C 3LB8C 5JH5C 4ANXA 5J2RA 2LD9A 1T0RC 4YSZB 2D3BA 1S1QB 5IOIA 1V5TA 1Q10A 2J0JA 1VZ8A 4GB9A 3SHQA 2WS3B 3BYYB 5G55A 4JGHB 2JUOA 4ZRQA 1IGDA 1LXDA 4KX6B 4B6WA 1SIFA 2ZPYA 5C23A 1VR9A 4JPSA 1A5RA 4FHKA 5EE3A 3WANA 1WYWB 2MJ3A 2KJHB 1P7EA 1SB3C 2KANA 3QC8B 2UU7A 2N7JA 2PVOD 1V6EA 4Q2JA 5D3DA 2SEBD 1VJKA 5D3IB 3PRZA 1SSNA 2I38A 1LFDA 1NYRA 1SXTA 2PPHA 1F9JA 3FILB 3A1QB 4XWWA 4S0RA 1KOTA 3UIOB 2IDYA 1E0ZA 1WJNA 4HDOA 3CSTA 2PKOA 2KWUB 5FKAC 4B0EA 1V1PB 5AUIA 1FFVA 1T3QA 2BWFA 4EE2A 2N9LA 3R7RA 3BK1A 1WGHA 4ICVA 1VDVA 4NAMA 1ISNA 2MQJA 2KDMA 4OW0A 2V4LA 1KFYB 1YQ3B 2JVCA 1ZXHA 3HRDD 4NNJB 3CIRB 3RI7C 1TS4A 3OWEB 3ZNZB 2K1FA 4N58A 2XK5B 4YWGG 3Q14C 2E6XA 4WJOA 2VH2A 3UIPB 3EC8A 5DPRA 2WXHA 5TSSA 2KHWB 1N6ZA 1C4CA 4BZAA 3L08A 2D2QA 3ZXVA 4LDTD 5E6NA 3NY5A 2Z0EB 2MBHA 2LVQA 1L4DB 1JW9D 4KKIA 2CHZA 1TS3A 4W9EA 1I42A 3RNEC 1ZDXA 1ZPSA 4DDGD 2BF8B 1FRDA 3VTWA 3AEAB 4GN1A 1ZW7A 1FIQA 1I4QA 1Q1OA 1GNUA 1WSPA 3VH3B 1R7SA 4F7ZA 1GC7A 5HG2A 1E7PB 4GSWA 3BVZA 4KV2A 3AEFB 3HVDA 2CS4A 3H7PA 1S3SG 2WX0A 1HQRD 3VTUA 1L6VA 1R4NI 3NS1A 4N6EB 1WE7A 2LFIA 2WP9B 4AS1A 2N1VA 1SF0A 1UBIA 3N3KB 4IM0A 1TIFA 4XC2A 2HE7A 3UF8A 2WNMA 1P98A 4KDIC 5DPWA 2BB6A 2WXKA 2XN9C 3Q8FA 2NTSA 3ZNHB 1E8YA 1IBXB 5IAAC 2V4IB 2Q5WD 4NQKE 2LMCA 2JF5A 2DYMA 3B0AA 4D2KA 1WZ3A 2DBYA 3SR6A 2M17A 3PHWB 1KJTA 2IGHA 1EU4A 4XYCA 4M0WA 5D2MB 2M1MA 3ZRFA 4LK0M 1FRRA 2V3PA 5TR5A 4AWJA 1WXAA 2J7QB 5IO9A 1WMHA 3EFUA 3PHXB 4IUMB 3H1UA 5DPSA 4M02A 2DYOA 1JROA 3DVNU 3P4SB 1OFFA 5J17A 2PE6B 3V6EB 2LJ5A 4II3B 2L83A 1WM2A 2KDFB 3RNAC 3EA6A 2HDEA 1L2NA 5C2TB 1TS2A 2ZZPB 3EECA 4URKA 1IUEA 1HTQA 3RFZB 2FAZA 1WXMA 2WDRB 1YIWA 1F77A 2RDBC 1TY0A 2NMQA 4BKTA 4O1NA 4PS7A 3U2SC 2KTRA 1H4RA 2PEAA 2IPKD 4KSLC 2D11A 2BYVE 3A9KB 1AWDA 4WWNA 1OTRB 1V97A 4EZKA 3S2AA 1NDDA 1Y8RC 2D10A 2JSVX 3BINA 1L4ZB 1V86A 2NVUI 4GDLA 1P7FA 2N9KA 4GIVA 2I1JA 1WM3A 3IVFA 1P0RA 4US9A 3HIZA 2K5PA 3QAQA 1LGRA 4US8A 1VZ6A 4IG7B 3RNCC 4LDTB 1FMAD 3W1YA 3BWUD 3Q8EA 2IO1B 1AW7A 2NR2A 4G3XB 3N30A 4UDUC 1ZUD2 4H2AA 1GG3A 2JU6X 4MEMA 3I57A 1J19A 2WQYB 3N1ZC 4PYUA 3KW5B 2KDEB 1J7AA 2L32A 2MW5A 2VH1A 1ET9A 1N62A 3ZTDA 3R2IA 4I6PA 2KWVB 1G6JA 3PLVA 3Q3OC 1WIAA 5D94A 3QWZB 2IO0B 4OZBA 3U7DA 4X57B 2FCQA 1STEA 2BKFA 2WU2B 2BWES 3P63A 2YEPB 4TV3A 2A5UA 3IHPC 4MJSA 2H88B 2K39A 2D5GA 2KLCA 2CJOA 2AEHA 2MP2B 4HPMB 3SD5A 3DWGC 5IA7A 3DDCB 4XGAB 3NRZA 1I4XA 3VFKA 2BW2A 4DHZE 3TMPB 4DHZB 4LCDE 4MSMB 5CHFA 2JZPA 3TSSA 1RRBA 3GZNI 3KQ4A 3DBHI 1T6BX 4JL9A 1JRUA 3TEYA 5H92C 4GMVA 4CO7A 3AEGB 5EE0A 3ZKJC 3O65B 2ZEQA 2M8SA 3DWMA 4MSQB 4ANWA 5JZEB 1WH3A 3DBRB 4GXBA 3EFCA 2D07B 1TY2A 2N0SB 3OAWA 1GPXA 3L13A 5HI1A 4HJKA 2X8XX 4WWOA 3JW0X 2OJWA 1PQSA 2ZJDA 4AJWA 2LGSA 1MFWA 1QOAA 2J0KA 2WXRA 3AEDB 3ZW3A 3GOEA 4C00A 3V3XA 3DQVA 1X1MA 1SGHA 3ZQ4A 3QA8A 5GMVA 5CTRC 5DCNA 1UZXB 3VRAB 5FK9C 1OGWA 1XD3B 3A33B 3TIXA 5AZGA 5KHOA 1N5WA 1F2RI 1QOBA 2AQ3B 1WF9A 4ZDVA 3MC9A 2KQ7A 3KUZA 4RM8A 1I4HA 2EKIA 4NQLB 2INDC 1M94A 4RNAA 4ZHOA 2KTFA 2OHFA 4J6IA 2JYTA 1ZKHA 1NEKB 2IBIB 3ZJTA 2JY6A 2WXNA 3QCAA 5LLIA 1FNUA 3U4EG 1SE9A 4A3OA 3AE3B 3CF6E 5HKHA 1JALA 1YOVB 2ACZB 1SE2A 2ZNVB 3IXSA 2ZVOA 1SBBB 3HHMA 1IYFA 3NVWA 2NBVB 1P9DU 1HA5A 1WRDB 1GAQB 1F52A 4EUTA 2K22A 2G4SA 3W5VB 3RUIB 1VCBA 1ZGUB 2WXGA 2AQ1B 3AE5B 3T3OA 1V5OA 5E6PA 2Z8LA 1YN4A 5JXVA 2INPE 2KK8A 2KX3A 2WXIA 4LNKA 1XO3A 2NPTB 3WAMA 2IZVB 1QT9A 4KGRA 3IFWB 3A9JB 1WX7A 2HJ1A 1I7HA 1C3TA 1WJ6A 4DK5A 5IKCM 4YXDB 3RNGC 2GMIC 2O2VA 1E90A 3H7SA 3MFGA 3V61A 3I5JC 3WAPA 4KDLB 1HXYD 3ZDTA 1MG8A 4NAWB 2PVGC 4DDID 3IG3A 4LJOB 4KKJA 3X0WA 4MGKE 2KT7A 2PE9A 4MDKE 5J18A 1RYJA 2JT4B 4TSSA 1PGXA 4REZA 3J9CA 3HM3A 2JZZA 4GOCA 4W9DA 3GZNB 3N32A 1NBFC 4K3BA 4RGMA 1OQQA 4K7SA 1KH0A 3U8ZA 2PW9A 2SAKA 5CX3A 1BUIC 2BB5A 5BYRA 4IWOA 5BMIA 2OOBB 2GRIA 2TSSA 3ZUNA 2WXMA 1ACCA 3BYTB 3VXWA 4K1RB 3GP7A 5IN7A 2NBWB 3E56A 1WGRA 1N5XA 4CYEA 1QILA 1NENB 1M4VA 2INNE 3X23A 4ARCA 4OVZA 2KNBA 4IKGA 4W9LA 2QIEB 5JHAA 3MTNB 3TJPA 1J0GA 2KFJA 3AE6B 3SFDB 2KFKA 3PO0A 3RPFC 2QHOA 1DOYA 1OQRA 1V2YA 3NJTA 2D3GA 4M8MA 1XLPA 3MHZA 1LM8B 3KWVA 4LNNA 2CU3A 4RGNA 1C1YB 4BOSC 5GXGB 1UWMA 3HK0A 3UQBA 3VR8B 3RYTA 5MPOA 3DCGA 3TCAA 3NZUA 2LRWA 3AECB 3ENEA 1JWSD 2RPVA 2DLBA 4XE0A 2J53A 4FJYA 4ACFA 2BPSA 2WDQB 3AU5A 1C76A 1RFAA 3TEZA 2J4XA 1YJ1A 1LO5D 4TKNA 3PV1A 4L23A 2KVRA 4NJ7A 4II2B 4EFOA 2KDIA 2DYBA 1BXTA 3A4SC 2NTTA 2LUMA 3L10B 2W3RA 2DAJA 3ZNGC 3E9SA 1TJEA 2MSED 4ZHPA 1JRPA 1TKYA 1V9JA 1WXSA 3CSFA 3B9JA 3JSVA 2DAFA 3W1SA 3Q6BA 1K52A 2L05A 2L8JA 3TL5A 5HFYA 1NVID 1YX6B 4FULA 2G4DB 3IAS1 2DNFA 1UGJA 4PS3A 3R7QA 3UQAA 4C7ZA 3QX1A 1I4PA 3DBSA 2W55A 4RFBA 2KDBA 1V80A 3C0RB 3HM6X 2KQ4X 3JYUA 4WIPA 4ARIA 1QLBB 2FCNA 1T0SC 3KVFB 3FKYA 1WX9A 3KWLA 1WRIA 4KVGB 2HTME 3UI3A 2RMMA 3BY4B 3EUB2 2KO3A 2V0GA 4A55A 4EOYA 2CKHB 3LYYA 2M4NA 2HJ8A 1N60A 2X38A 2MBEA 1YQBA 1UBQA 1E8XA 2FNJB 1YD8U 1ET6A 4OVUA 4WWMA 2D3AA 5BMHA 2FUG1 2L3ZA 1OEYA 4P6VF 1XLNA 2MA9B 1UGMA 3AM9A 3JVZX 2ICIA 2CHXA 2L7RA 4KGTA 2ZNVC 2MBOA 3W5UB 3AH7A 1Z5SB 1VLBA 2AYOB 4JWSC 2KMMA 2GBRA 3IT6B 3AE9B 1BMLC 2K0PA 1TKEA 3KH0A 4ITKA 4NZLB 3RULA 4YTMB 1Q5WB 2K8HA 1C4PA 4P1CC 4HEA1 1MHHE 5LNK1 3H9DA 2BS4B 4C56C 1F1HA 1WI0A 3P1MA 1GJZA 1WY8A 3M3JA 2JX5A 2GBKA 4MT5A 2C7MB 2BTEA 2AX5A 4C7YA 2MJDA 1RM6C 1WGGA 1L7YA 2IO2B 2VZKD 2WYQA 5G5GA 2GBNA 1YMHE 2Z59B 3AE1B 3L54A 3Q8BA 1ENFA 4WQOB 1C4AA 2IYDB 1CK1A 1D5MC 3GE3C 2KC2A 1D3ZA 3Q3NC 1EWCA 4JIOU 2L0FA 4M00A 3M95A 3LXFA 4GU2A 3PT2B 1FM0D 3B1LX 4IM3A 2WDVB 4MM3A 2QSDA 1L0VB 1VD2A 4WURA 3Q3MC 1WXVA 2LEKA 1C78A 1JWMD 3B2FA 2MBBB 2OEDA 2WXPA 1H8CA 4HK2A 3VH4B 4USAA 4IWQA 3KYDD 1GUAB 4WJQA 3V62A 2DZMA 4M0WB 3ETRA 3ZGZA 1ROEA 1WWTA 4FXCA 5I4DA 1EWYC 2QMTA 2K8CA 2RDHA 4RM9A 4DHJD 3HVZA 1HZ5A 2G1EA 3PLUA 5T8IA 2O6VA 5C1ZA 3RMKC 1D5ZC 4ZRJA 2DZJA 4FLHA 2JQRB 2LUEA 3QHTA 1KLVA 2N1WA 1I4GA 2GB1A 2LGIA 5D7GA 4TUUA 2W82A 4HVBA 1FD6A 1Z2MA 4YL8A 4HPLB 4KIKA 3BK2A 4KZCA 2GLSA 3MP9A 1E10A 2DX5B 2N7DA 5EE1A 4EEWA 1HZ6A 3B2GA 2Y5BB 2WX1A 1MG4A 1MHXA 1WR1A 2KTRB 4ICUA 1AN8A 3ZJUA 2C9WB 2RPQA 4MH8A 1PUTA 2K3UA 3L4PA 1QZEA 1R4NB 2C7NB 2BGFA 2NBUA 2MX2A 1CZPA 2KZRA 3N20C 4HDQA 3AE4B 2KAJA 3BVGA 4GDLB 1FXAA 4W9HA 2KKCA 3WAOA 1JQ4A 3AU4A 2LWPA 1HEZE 2AWTA 1NI3A 2FBWB 4LJPB 4C80A 1TYGB 2ZW0A 4DXAB 4RH6A 1N61A 3I9V1 2WWZA
chains in the Genus database with same CATH topology
3EC8A 1Q0WB 2NPTB 5DPRA 3WAMA 4ASWC 2IZVB 2R2OA 2KHWB 1OQYA 3IFWB 2YVCA 3A9JB 3L08A 3AI5A 2L0TA 2B3AA 1E8WA 1WX7A 2D2QA 4ANUA 1WR6E 1C3TA 1WJ6A 2KJRA 4LDTD 3V60A 4W9JA 5E6NA 4DK5A 2FCSA 3NY5A 4IC7B 2Z0EB 3P2BA 2MBHA 2GMIC 5LXHA 2O2VA 2LVQA 1E90A 3H7SA 4FHJA 5JHBA 3V61A 3WAPA 4KDLB 4KSKC 3ZO5B 1K8RB 2CHZA 1KM7A 3ZDTA 1MG8A 2KC1A 4NAWB 4AOFA 4DDID 3ZLZA 2IY0B 4W9GA 3IG3A 2N4FA 1R4MI 4LJOB 4W9EA 4MGKE 3X0WA 1I42A 4IW0A 2PE9A 4MDKE 4B95A 5J18A 2RSUA 4DDGD 2JRIB 2BF8B 3D32A 4RMAA 5AZHA 1E8ZA 2KN5A 2JT4B 3VTWA 4BKGA 4GN1A 3DPDA 3HM3A 1ZW7A 2JZZA 2MP2A 1Q1OA 1GNUA 4GOCA 4W9DA 1UD7A 3N32A 3VH3B 1WGYA 2LGDA 1NBFC 3DVGX 4F7ZA 3OLMD 1WMHB 4K7SA 1GC7A 3U8ZA 3VHTC 4GSWA 3UGBB 3VDZA 4GDKA 4KV2A 2K6DB 3APDA 5CX3A 1WJ4A 2CS4A 3H7PA 4PYZA 1S3SG 2WX0A 3MHSD 4IWOA 4MGZE 2OOBB 3VTUA 3M63B 5CHWA 4WWPA 1P3QU 1R4NI 3EHVA 1WE7A 4EKUA 3ZUNA 4A20A 2N1VA 1CMXB 1HE8A 3CMMB 2WDTB 1UBIA 3N3KB 4IM0A 3VXWA 4K1RB 1TTNA 2RGFA 3IBEA 4JQWC 4XC2A 2DENB 2HE7A 2ZCBA 3PRPB 2NBWB 3UF8A 1WGRA 1P98A 5BO4B 3OJ4B 4KDIC 5DPWA 4K7UA 4MH0E 4EZLA 3VUWA 4JLCA 4AP4C 4NJ6A 1E7VA 1EF1A 4CYEA 3A9JA 3NZSA 5G2NA 3X23A 5KHQA 2KNBA 2RR9A 4W9LA 4KZ0A 3VQIA 3DOWA 5JHAA 3K9PB 4CHKA 3ZNHB 1E8YA 2CR5A 3MTNB 5IAAC 4ANVA 4E74A 1OEYJ 3TJPA 1J0GA 4NQKE 2KFJA 4K7WA 3QJZA 5EDSA 1YX5B 2JF5A 2KFKA 2DYMA 4DHJB 2KLGA 2QHOA 3B0AA 3RD2A 1WZ3A 4I6NB 1V2YA 4GGQA 3KYCD 2PJHA 3ECIA 2D3GA 4N9F4 2M17A 3PHWB 3PSEB 4M8MA 1KJTA 1LM8B 3WA0A 3PREA 4BOSC 1C1YB 4NPNA 5D2MB 2M1MA 3HK0A 4I6LB 3ML8A 4BBNF 3UQBA 3ZRFA 2LGXA 3RYTA 1TZ1A 3VTVA 4F1SA 3AULA 5TR5A 3QARA 4AWJA 1WXAA 3DCGA 3TCAA 2J7QB 3NZUA 2LRWA 1WMHA 2MWSB 1BT0A 3EFUA 3PHXB 1E7UA 3ENEA 1NI2A 4IUMB 2ZPNA 3H1UA 4K81A 2EMSA 4BBNC 5DPSA 2C7HA 2J0MA 3DBLI 2DYOA 4MELA 2JPHA 1P1AA 3DVNU 4HLEA 5AEKB 4WJPA 2O6VB 4FJYA 5J17A 2BPSA 5LXIB 2PE6B 1U4AA 3ONSA 3R3MA 2L76A 3AU5A 2R2QA 3V6EB 2N7EA 1EF5A 2LJ5A 4A3PA 1RFAA 4II3B 2KMAA 1WM2A 1WZ0A 4XZ4A 4M8NA 2KDFB 1YJ1A 4TKNA 1I35A 1L2NA 3PV1A 2KOXA 2ZZPB 2KVRA 4NJ7A 4II2B 4EFOA 2KDIA 2DYBA 3EECA 3PZDA 3A4SC 3T8MA 4URKA 1J8CA 3L10B 2FAZA 1WXMA 3ZNGC 2DAJA 1YIWA 4EZJA 2C60A 3M62B 3K9OB 4KIKB 3A1QA 2ASQA 2MSED 4IWPA 4BKTA 3PVLA 3QQ8B 1V9JA 2MLBA 4PS7A 1WXSA 3CSFA 4E71A 2KTRA 5L95C 1H4RA 2PEAA 4KSLC 2D11A 2ZCCA 2BYVE 3A9KB 3JSVA 3NHEB 4P7IA 1EUVB 2XEWA 2DAFA 2AL3A 2G3QB 4MJSB 3W1SA 4WWNA 1OTRB 4E3CA 2L05A 2L8JA 3S2AA 3TL5A 3VUXA 4TQ1A 4EZKA 1NDDA 1YX6B 2CU1A 1Y8RC 3PRMB 3AXCA 3SU8X 4BKSA 4FULA 2G4DB 2D10A 2GBMA 4PS3A 3R7QA 3BINA 3UQAA 1V86A 3NS8A 2NVUI 4GDLA 3QX1A 3DBSA 2EMTA 2I1JA 2GBJA 2KDBA 3APFA 4GIVA 1WM3A 1V80A 5FR6A 3C0RB 3HM6X 3IVFA 1P0RA 1GC6A 4G0NB 3JYUA 1IPGA 3HIZA 3QAQA 4IG7B 1RAXA 2FCMA 4ZRKA 2FCNA 4LDTB 3KVFB 3W1YA 1WX9A 2IO3B 4AUQC 3KUCB 4KVGB 2FIDA 2FUHB 2IO1B 4W9FA 3BY4B 2JZ3B 2KO3A 2NR2A 4G3XB 4EOYA 3N30A 2CKHB 2XK5A 2M4NA 4BVUC 2JRHA 1GG3A 2N9PC 3DVNV 4MGIE 4W9CA 2HJ8A 4W9KA 4MEMA 4BKSD 2DZKA 1J19A 1TBEA 3RT3B 4PYUA 2NPTA 2MBEA 4G50A 1YQBA 1UBQA 1E8XA 2FNJB 3KW5B 4PS8A 2KDEB 1YD8U 4OVUA 3I3TB 2MW5A 2Z0DB 3DVGY 2UYZB 2L3ZA 4FA6A 1WE6A 1UH6A 1OEYA 3VUYA 3ZTDA 1XT9B 2MA9B 1UGMA 4I6PA 2KWVB 1G6JA 3JVZX 3PLVA 2KXJA 2CHXA 2HTHA 2O2VB 3ZDMC 2RD0A 5L83A 2BYFA 3L16A 2L7RA 3W1SC 4NAWA 5AZFA 1WIAA 2ZVNA 5D94A 3QWZB 2GOWA 2IO0B 4HCPB 2ZNVC 4ZRIA 3U7DA 2MBOA 4BFRA 4X57B 2LZ6A 2FCQA 2BKFA 2UWQA 1Z5SB 2BWES 3QIJA 2HD5B 2YLMA 2AYOB 3V6CB 2MRPA 2VRRB 2GBRA 2A5UA 2KWCA 3LJ3A 2LVPA 3IHPC 4TV3A 4MJSA 2JWZA 2K39A 3Q3JA 3R66C 2KLCA 3KH0A 3RULA 2AEHA 2MP2B 4FJZA 4HPMB 3SD5A 1Q5WB 5IA7A 2K8HA 3DDCB 1LQBA 3RZWC 3VFKA 3KUDB 4DBGA 3H6NA 3H9DA 3A4RA 4G11A 4DHZE 3OJ3A 3TMPB 1WI0A 2LGYA 2REXA 3LDZE 4DHZB 1GJZA 1WY8A 3M3JA 4GDKB 2NS5A 4LCDE 4MSMB 4W9IA 2GBKA 5CHFA 5D6JB 2C7MB 1RRBA 3GZNI 4TQ0A 4IM2A 2LXCA 2XBBC 3RZFA 3DBHI 4JL9A 1JRUA 1TGZB 1WGGA 3RCZA 2LRUA 1E5WA 1L7YA 2IO2B 2OJRA 2WYQA 3WALA 4AJYB 4GMVA 4CO7A 2GBNA 2Z59B 3Q3FA 1V81A 3ZKJC 3L54A 3O65B 2LVOA 2ZEQA 4FADA 2KQSA 2M8SA 2N9XA 4MSQB 2I1KA 4ANWA 3U30A 4WQOB 2V1YA 2IYDB 5JZEB 4FN2A 1WH3A 4GXBA 3ZTCA 4F8CB 2KC2A 1T0YA 1D3ZA 1WJUA 2D07B 4JIOU 2K8BA 2L0FA 4HXDA 3QK0A 5DPTA 1V49A 2W9NA 3M95A 3L13A 3OAWA 4GU2A 3PT2B 5CHVC 3ZNID 4HJKA 3B1LX 3PS6A 1AARA 4IM3A 4MM3A 1UELA 3B08A 2NCNA 4WWOA 3JW0X 5E6OA 3VAWA 4WAAA 1PQSA 2A4ZA 2ZJDA 1RLFA 4WJNA 1VD2A 1IP9A 4AJWA 3ALBA 3MJWA 1WXVA 2LXAA 5JH5C 4ANXA 2KFKB 3SDLC 5J2RA 2J0KA 1WX8A 4HCNB 2MBBB 3PTFC 3PGEA 2LD9A 1H8CA 2DHZA 3GOEA 3ZW3A 4HK2A 3DQVA 1X1MA 4FJVB 1SGHA 3VH4B 3QA8A 3UINB 5GMVA 4IWQA 1S1QB 5CTRC 1WGDA 5DCNA 3KYDD 1V5TA 1GUAB 4NY0A 1UZXB 2J0JA 4WJQA 2JXXA 3V62A 2DZMA 2MBQA 4M0WB 4GB9A 4DWFA 3SHQA 5G55A 4JGHB 2JUOA 3T9LA 1OGWA 1XD3B 1LXDA 3A33B 4BOZB 3TIXA 4B6WA 5AZGA 2K8CA 1FXTB 5KHOA 4RM9A 3ZIMA 2N9EB 4DHJD 2G45B 1SIFA 2ZPYA 1WF9A 5C23A 2KMCA 2KD0A 4ZDVA 3PLUA 2BYEA 2KJ6A 1A5RA 4FHKA 2KQ7A 2O6VA 3WANA 3KUZA 5C1ZA 1WYWB 4RM8A 2KJHB 2IY1B 4ZRJA 2DZJA 2K25A 3NOBA 4FLHA 2KANA 1WFYA 2MCNB 3PPAA 2L00B 4NQLB 3QC8B 2BKRB 2LUEA 3QHTA 1KLVA 1M94A 2N1WA 1V6EA 5D7GA 3L0WB 2LI5A 2KTFA 4TUUA 1EO6A 4HVBA 2C5LC 1Z2MA 4YL8A 4J6IA 3PRZA 4HPLB 4KIKA 1LFDA 4KZCA 2PPHA 3L17A 1F9JA 2DX5B 2N7DA 3A1QB 4EEWA 1KOTA 3UIOB 4HWIB 1ZKHA 2O6VD 2WX1A 2Y5BB 2IBIB 1WJNA 3ZRCA 2M0XA 2JY6A 1WR1A 2KTRB 3A9KA 3QCAA 4ICUA 4HDOA 3CSTA 5LLIA 2KX0A 4OVVA 2CHWA 3JSVB 1SE9A 2C9WB 3ZVVA 4A3OA 2K6QA 2KWUB 2RPQA 2EKEC 3ML9A 3CF6E 3DBRI 5HKHA 1QZEA 2C7NB 2BGFA 2ZNVB 2BWFA 2NBUA 4B9KA 2ZVOA 4ZYNA 3R7RA 2MX2A 2DZIA 3HHMA 2KZRA 1IYFA 2NBVB 4HDQA 1P9DU 1WGHA 2FIFA 4ICVA 4GDLB 1ISNA 1WRDB 4W9HA 3VVWB 2KKCA 2MQJA 3H7PB 3WAOA 4EUTA 4XX5A 2V4LA 2LASA 3AU4A 3APCA 2LWPA 2JVCA 2AWTA 4MGYE 2G4SA 4LJPB 3RUIB 2AL6A 1VCBA 1ZGUB 4NNJB 3TBLD 3WIMA 4FBJB 1XQQA 1V5OA 3ZNZB 2K1FA 4DXAB 5E6PA 2XK5B 4WJOA 2KK8A 2KX3A 2WWZA 2V3SA 3UIPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EC8 A;  1Q0W B;  2NPT B;  5DPR A;  3WAM A;  4ASW C;  2IZV B;  2R2O A;  2KHW B;  1OQY A;  3IFW B;  2YVC A;  3A9J B;  3L08 A;  3AI5 A;  2L0T A;  2B3A A;  1E8W A;  1WX7 A;  2D2Q A;  4ANU A;  1WR6 E;  1C3T A;  1WJ6 A;  2KJR A;  4LDT D;  3V60 A;  4W9J A;  5E6N A;  4DK5 A;  2FCS A;  3NY5 A;  4IC7 B;  2Z0E B;  3P2B A;  2MBH A;  2GMI C;  5LXH A;  2O2V A;  2LVQ A;  1E90 A;  3H7S A;  4FHJ A;  5JHB A;  3V61 A;  3WAP A;  4KDL B;  4KSK C;  3ZO5 B;  1K8R B;  2CHZ A;  1KM7 A;  3ZDT A;  1MG8 A;  2KC1 A;  4NAW B;  4AOF A;  4DDI D;  3ZLZ A;  2IY0 B;  4W9G A;  3IG3 A;  2N4F A;  1R4M I;  4LJO B;  4W9E A;  4MGK E;  3X0W A;  1I42 A;  4IW0 A;  2PE9 A;  4MDK E;  4B95 A;  5J18 A;  2RSU A;  4DDG D;  2JRI B;  2BF8 B;  3D32 A;  4RMA A;  5AZH A;  1E8Z A;  2KN5 A;  2JT4 B;  3VTW A;  4BKG A;  4GN1 A;  3DPD A;  3HM3 A;  1ZW7 A;  2JZZ A;  2MP2 A;  1Q1O A;  1GNU A;  4GOC A;  4W9D A;  1UD7 A;  3N32 A;  3VH3 B;  1WGY A;  2LGD A;  1NBF C;  3DVG X;  4F7Z A;  3OLM D;  1WMH B;  4K7S A;  1GC7 A;  3U8Z A;  3VHT C;  4GSW A;  3UGB B;  3VDZ A;  4GDK A;  4KV2 A;  2K6D B;  3APD A;  5CX3 A;  1WJ4 A;  2CS4 A;  3H7P A;  4PYZ A;  1S3S G;  2WX0 A;  3MHS D;  4IWO A;  4MGZ E;  2OOB B;  3VTU A;  3M63 B;  5CHW A;  4WWP A;  1P3Q U;  1R4N I;  3EHV A;  1WE7 A;  4EKU A;  3ZUN A;  4A20 A;  2N1V A;  1CMX B;  1HE8 A;  3CMM B;  2WDT B;  1UBI A;  3N3K B;  4IM0 A;  3VXW A;  4K1R B;  1TTN A;  2RGF A;  3IBE A;  4JQW C;  4XC2 A;  2DEN B;  2HE7 A;  2ZCB A;  3PRP B;  2NBW B;  3UF8 A;  1WGR A;  1P98 A;  5BO4 B;  3OJ4 B;  4KDI C;  5DPW A;  4K7U A;  4MH0 E;  4EZL A;  3VUW A;  4JLC A;  4AP4 C;  4NJ6 A;  1E7V A;  1EF1 A;  4CYE A;  3A9J A;  3NZS A;  5G2N A;  3X23 A;  5KHQ A;  2KNB A;  2RR9 A;  4W9L A;  4KZ0 A;  3VQI A;  3DOW A;  5JHA A;  3K9P B;  4CHK A;  3ZNH B;  1E8Y A;  2CR5 A;  3MTN B;  5IAA C;  4ANV A;  4E74 A;  1OEY J;  3TJP A;  1J0G A;  4NQK E;  2KFJ A;  4K7W A;  3QJZ A;  5EDS A;  1YX5 B;  2JF5 A;  2KFK A;  2DYM A;  4DHJ B;  2KLG A;  2QHO A;  3B0A A;  3RD2 A;  1WZ3 A;  4I6N B;  1V2Y A;  4GGQ A;  3KYC D;  2PJH A;  3ECI A;  2D3G A;  4N9F 4;  2M17 A;  3PHW B;  3PSE B;  4M8M A;  1KJT A;  1LM8 B;  3WA0 A;  3PRE A;  4BOS C;  1C1Y B;  4NPN A;  5D2M B;  2M1M A;  3HK0 A;  4I6L B;  3ML8 A;  4BBN F;  3UQB A;  3ZRF A;  2LGX A;  3RYT A;  1TZ1 A;  3VTV A;  4F1S A;  3AUL A;  5TR5 A;  3QAR A;  4AWJ A;  1WXA A;  3DCG A;  3TCA A;  2J7Q B;  3NZU A;  2LRW A;  1WMH A;  2MWS B;  1BT0 A;  3EFU A;  3PHX B;  1E7U A;  3ENE A;  1NI2 A;  4IUM B;  2ZPN A;  3H1U A;  4K81 A;  2EMS A;  4BBN C;  5DPS A;  2C7H A;  2J0M A;  3DBL I;  2DYO A;  4MEL A;  2JPH A;  1P1A A;  3DVN U;  4HLE A;  5AEK B;  4WJP A;  2O6V B;  4FJY A;  5J17 A;  2BPS A;  5LXI B;  2PE6 B;  1U4A A;  3ONS A;  3R3M A;  2L76 A;  3AU5 A;  2R2Q A;  3V6E B;  2N7E A;  1EF5 A;  2LJ5 A;  4A3P A;  1RFA A;  4II3 B;  2KMA A;  1WM2 A;  1WZ0 A;  4XZ4 A;  4M8N A;  2KDF B;  1YJ1 A;  4TKN A;  1I35 A;  1L2N A;  3PV1 A;  2KOX A;  2ZZP B;  2KVR A;  4NJ7 A;  4II2 B;  4EFO A;  2KDI A;  2DYB A;  3EEC A;  3PZD A;  3A4S C;  3T8M A;  4URK A;  1J8C A;  3L10 B;  2FAZ A;  1WXM A;  3ZNG C;  2DAJ A;  1YIW A;  4EZJ A;  2C60 A;  3M62 B;  3K9O B;  4KIK B;  3A1Q A;  2ASQ A;  2MSE D;  4IWP A;  4BKT A;  3PVL A;  3QQ8 B;  1V9J A;  2MLB A;  4PS7 A;  1WXS A;  3CSF A;  4E71 A;  2KTR A;  5L95 C;  1H4R A;  2PEA A;  4KSL C;  2D11 A;  2ZCC A;  2BYV E;  3A9K B;  3JSV A;  3NHE B;  4P7I A;  1EUV B;  2XEW A;  2DAF A;  2AL3 A;  2G3Q B;  4MJS B;  3W1S A;  4WWN A;  1OTR B;  4E3C A;  2L05 A;  2L8J A;  3S2A A;  3TL5 A;  3VUX A;  4TQ1 A;  4EZK A;  1NDD A;  1YX6 B;  2CU1 A;  1Y8R C;  3PRM B;  3AXC A;  3SU8 X;  4BKS A;  4FUL A;  2G4D B;  2D10 A;  2GBM A;  4PS3 A;  3R7Q A;  3BIN A;  3UQA A;  1V86 A;  3NS8 A;  2NVU I;  4GDL A;  3QX1 A;  3DBS A;  2EMT A;  2I1J A;  2GBJ A;  2KDB A;  3APF A;  4GIV A;  1WM3 A;  1V80 A;  5FR6 A;  3C0R B;  3HM6 X;  3IVF A;  1P0R A;  1GC6 A;  4G0N B;  3JYU A;  1IPG A;  3HIZ A;  3QAQ A;  4IG7 B;  1RAX A;  2FCM A;  4ZRK A;  2FCN A;  4LDT B;  3KVF B;  3W1Y A;  1WX9 A;  2IO3 B;  4AUQ C;  3KUC B;  4KVG B;  2FID A;  2FUH B;  2IO1 B;  4W9F A;  3BY4 B;  2JZ3 B;  2KO3 A;  2NR2 A;  4G3X B;  4EOY A;  3N30 A;  2CKH B;  2XK5 A;  2M4N A;  4BVU C;  2JRH A;  1GG3 A;  2N9P C;  3DVN V;  4MGI E;  4W9C A;  2HJ8 A;  4W9K A;  4MEM A;  4BKS D;  2DZK A;  1J19 A;  1TBE A;  3RT3 B;  4PYU A;  2NPT A;  2MBE A;  4G50 A;  1YQB A;  1UBQ A;  1E8X A;  2FNJ B;  3KW5 B;  4PS8 A;  2KDE B;  1YD8 U;  4OVU A;  3I3T B;  2MW5 A;  2Z0D B;  3DVG Y;  2UYZ B;  2L3Z A;  4FA6 A;  1WE6 A;  1UH6 A;  1OEY A;  3VUY A;  3ZTD A;  1XT9 B;  2MA9 B;  1UGM A;  4I6P A;  2KWV B;  1G6J A;  3JVZ X;  3PLV A;  2KXJ A;  2CHX A;  2HTH A;  2O2V B;  3ZDM C;  2RD0 A;  5L83 A;  2BYF A;  3L16 A;  2L7R A;  3W1S C;  4NAW A;  5AZF A;  1WIA A;  2ZVN A;  5D94 A;  3QWZ B;  2GOW A;  2IO0 B;  4HCP B;  2ZNV C;  4ZRI A;  3U7D A;  2MBO A;  4BFR A;  4X57 B;  2LZ6 A;  2FCQ A;  2BKF A;  2UWQ A;  1Z5S B;  2BWE S;  3QIJ A;  2HD5 B;  2YLM A;  2AYO B;  3V6C B;  2MRP A;  2VRR B;  2GBR A;  2A5U A;  2KWC A;  3LJ3 A;  2LVP A;  3IHP C;  4TV3 A;  4MJS A;  2JWZ A;  2K39 A;  3Q3J A;  3R66 C;  2KLC A;  3KH0 A;  3RUL A;  2AEH A;  2MP2 B;  4FJZ A;  4HPM B;  3SD5 A;  1Q5W B;  5IA7 A;  2K8H A;  3DDC B;  1LQB A;  3RZW C;  3VFK A;  3KUD B;  4DBG A;  3H6N A;  3H9D A;  3A4R A;  4G11 A;  4DHZ E;  3OJ3 A;  3TMP B;  1WI0 A;  2LGY A;  2REX A;  3LDZ E;  4DHZ B;  1GJZ A;  1WY8 A;  3M3J A;  4GDK B;  2NS5 A;  4LCD E;  4MSM B;  4W9I A;  2GBK A;  5CHF A;  5D6J B;  2C7M B;  1RRB A;  3GZN I;  4TQ0 A;  4IM2 A;  2LXC A;  2XBB C;  3RZF A;  3DBH I;  4JL9 A;  1JRU A;  1TGZ B;  1WGG A;  3RCZ A;  2LRU A;  1E5W A;  1L7Y A;  2IO2 B;  2OJR A;  2WYQ A;  3WAL A;  4AJY B;  4GMV A;  4CO7 A;  2GBN A;  2Z59 B;  3Q3F A;  1V81 A;  3ZKJ C;  3L54 A;  3O65 B;  2LVO A;  2ZEQ A;  4FAD A;  2KQS A;  2M8S A;  2N9X A;  4MSQ B;  2I1K A;  4ANW A;  3U30 A;  4WQO B;  2V1Y A;  2IYD B;  5JZE B;  4FN2 A;  1WH3 A;  4GXB A;  3ZTC A;  4F8C B;  2KC2 A;  1T0Y A;  1D3Z A;  1WJU A;  2D07 B;  4JIO U;  2K8B A;  2L0F A;  4HXD A;  3QK0 A;  5DPT A;  1V49 A;  2W9N A;  3M95 A;  3L13 A;  3OAW A;  4GU2 A;  3PT2 B;  5CHV C;  3ZNI D;  4HJK A;  3B1L X;  3PS6 A;  1AAR A;  4IM3 A;  4MM3 A;  1UEL A;  3B08 A;  2NCN A;  4WWO A;  3JW0 X;  5E6O A;  3VAW A;  4WAA A;  1PQS A;  2A4Z A;  2ZJD A;  1RLF A;  4WJN A;  1VD2 A;  1IP9 A;  4AJW A;  3ALB A;  3MJW A;  1WXV A;  2LXA A;  5JH5 C;  4ANX A;  2KFK B;  3SDL C;  5J2R A;  2J0K A;  1WX8 A;  4HCN B;  2MBB B;  3PTF C;  3PGE A;  2LD9 A;  1H8C A;  2DHZ A;  3GOE A;  3ZW3 A;  4HK2 A;  3DQV A;  1X1M A;  4FJV B;  1SGH A;  3VH4 B;  3QA8 A;  3UIN B;  5GMV A;  4IWQ A;  1S1Q B;  5CTR C;  1WGD A;  5DCN A;  3KYD D;  1V5T A;  1GUA B;  4NY0 A;  1UZX B;  2J0J A;  4WJQ A;  2JXX A;  3V62 A;  2DZM A;  2MBQ A;  4M0W B;  4GB9 A;  4DWF A;  3SHQ A;  5G55 A;  4JGH B;  2JUO A;  3T9L A;  1OGW A;  1XD3 B;  1LXD A;  3A33 B;  4BOZ B;  3TIX A;  4B6W A;  5AZG A;  2K8C A;  1FXT B;  5KHO A;  4RM9 A;  3ZIM A;  2N9E B;  4DHJ D;  2G45 B;  1SIF A;  2ZPY A;  1WF9 A;  5C23 A;  2KMC A;  2KD0 A;  4ZDV A;  3PLU A;  2BYE A;  2KJ6 A;  1A5R A;  4FHK A;  2KQ7 A;  2O6V A;  3WAN A;  3KUZ A;  5C1Z A;  1WYW B;  4RM8 A;  2KJH B;  2IY1 B;  4ZRJ A;  2DZJ A;  2K25 A;  3NOB A;  4FLH A;  2KAN A;  1WFY A;  2MCN B;  3PPA A;  2L00 B;  4NQL B;  3QC8 B;  2BKR B;  2LUE A;  3QHT A;  1KLV A;  1M94 A;  2N1W A;  1V6E A;  5D7G A;  3L0W B;  2LI5 A;  2KTF A;  4TUU A;  1EO6 A;  4HVB A;  2C5L C;  1Z2M A;  4YL8 A;  4J6I A;  3PRZ A;  4HPL B;  4KIK A;  1LFD A;  4KZC A;  2PPH A;  3L17 A;  1F9J A;  2DX5 B;  2N7D A;  3A1Q B;  4EEW A;  1KOT A;  3UIO B;  4HWI B;  1ZKH A;  2O6V D;  2WX1 A;  2Y5B B;  2IBI B;  1WJN A;  3ZRC A;  2M0X A;  2JY6 A;  1WR1 A;  2KTR B;  3A9K A;  3QCA A;  4ICU A;  4HDO A;  3CST A;  5LLI A;  2KX0 A;  4OVV A;  2CHW A;  3JSV B;  1SE9 A;  2C9W B;  3ZVV A;  4A3O A;  2K6Q A;  2KWU B;  2RPQ A;  2EKE C;  3ML9 A;  3CF6 E;  3DBR I;  5HKH A;  1QZE A;  2C7N B;  2BGF A;  2ZNV B;  2BWF A;  2NBU A;  4B9K A;  2ZVO A;  4ZYN A;  3R7R A;  2MX2 A;  2DZI A;  3HHM A;  2KZR A;  1IYF A;  2NBV B;  4HDQ A;  1P9D U;  1WGH A;  2FIF A;  4ICV A;  4GDL B;  1ISN A;  1WRD B;  4W9H A;  3VVW B;  2KKC A;  2MQJ A;  3H7P B;  3WAO A;  4EUT A;  4XX5 A;  2V4L A;  2LAS A;  3AU4 A;  3APC A;  2LWP A;  2JVC A;  2AWT A;  4MGY E;  2G4S A;  4LJP B;  3RUI B;  2AL6 A;  1VCB A;  1ZGU B;  4NNJ B;  3TBL D;  3WIM A;  4FBJ B;  1XQQ A;  1V5O A;  3ZNZ B;  2K1F A;  4DXA B;  5E6P A;  2XK5 B;  4WJO A;  2KK8 A;  2KX3 A;  2WWZ A;  2V3S A;  3UIP B; 
#chains in the Genus database with same CATH topology
 2BBC A;  1Q0W B;  4ASW C;  1K51 A;  2R2O A;  1KLU D;  3AEE B;  2YVC A;  3AI5 A;  3PZ7 A;  2B3A A;  5H8Y E;  1WR6 E;  4W9J A;  1PDX A;  2FCS A;  2DWQ A;  1QOG A;  2B76 B;  5LXH A;  5HHD G;  4FHJ A;  3O13 A;  4ZYS A;  1QQR A;  1B1Z A;  1KM7 A;  2KC1 A;  4AOF A;  2N4F A;  2RSU A;  2JRI B;  3D32 A;  1E8Z A;  3AE7 B;  4KGS A;  4OZA A;  4C4V A;  2VZK B;  1FPY A;  3SFE B;  4DQO C;  1WGY A;  2LGD A;  4WH4 A;  2JYE A;  3DVG X;  1ZP0 B;  1DYQ A;  1TT5 B;  3VHT C;  3UGB B;  1CQV A;  1J7C A;  4GDK A;  3APD A;  1WJ4 A;  4PT5 A;  4WWP A;  4EKU A;  2FE8 A;  1JWU D;  1KLG D;  4A20 A;  1HE8 A;  2WLB A;  2WDT B;  3AE8 B;  2LHD A;  1TTN A;  2DEN B;  5C3J B;  3NZ3 A;  4L2Y A;  5BO4 B;  4K7U A;  4DXF A;  3VUW A;  3MJ5 A;  4XDD A;  1EF1 A;  3A9J A;  5E6J A;  3NZS A;  3N1Y C;  5G2N A;  3TEX A;  1GOZ A;  4KZ0 A;  1SJH D;  2CR5 A;  4GLS C;  3QJZ A;  2WXF A;  1YX5 B;  5BMG A;  5EDS A;  4XDC A;  4DHJ B;  3IAM 1;  2G9H D;  3RD2 A;  4I6N B;  2WU5 B;  3KYC D;  4GGQ A;  2PJH A;  3ZXR A;  4HJG E;  3AE2 B;  4NPN A;  4I6L B;  3ML8 A;  3VTV A;  4YSX B;  3AUL A;  2WGS A;  4MAC A;  1BT0 A;  1E7U A;  1NI2 A;  2ZPN A;  1FCL A;  1MVK A;  4K81 A;  3RNF C;  4BBN C;  2C7H A;  2J0M A;  3DBL I;  4MEL A;  3U7Z A;  4HLE A;  4WJP A;  4BAX A;  1JWB D;  1KRH A;  5LXI B;  1U4A A;  3ONS A;  1VZ7 A;  2BS2 B;  2N7E A;  1EF5 A;  2KMA A;  2KYW A;  4XZ4 A;  1T5X D;  3V05 A;  1UWX A;  2KOX A;  1ZE3 D;  3T8M A;  2LJI A;  1IGC A;  1FO4 A;  4EZJ A;  2C60 A;  1MJD A;  3A1Q A;  3FIL A;  1DOI A;  4JWU C;  3PVL A;  1A70 A;  4E71 A;  2ZW1 A;  1EUV B;  1V1P A;  2G3Q B;  4ZOH C;  4LNF A;  3AV8 A;  4E3C A;  3VUX A;  4TQ1 A;  2CU1 A;  3PRM B;  4BKS A;  3RN9 C;  3DBH B;  3Q69 A;  4JE3 B;  2GBM A;  1I4R A;  1L6U A;  2I2Y A;  2EMT A;  3APF A;  2WHI A;  3P4P B;  5FR6 A;  4A8X C;  1IPG A;  2FCM A;  4ZRK A;  2ONQ A;  1GB4 A;  4WAF A;  1PFD A;  2FID A;  1F0Z A;  2JZ3 B;  2XK5 A;  4BVU C;  2JRH A;  2N9P C;  4W9C A;  4W9K A;  2DZK A;  3RT3 B;  4PS8 A;  4RGT A;  1V1O A;  3I3T B;  2Z0D B;  4HRS A;  2UYZ B;  1UH6 A;  2M56 B;  1SE4 A;  5G5H A;  3SEB A;  1TZO A;  4RCO A;  2PIA A;  2BVC A;  1FCC C;  2KXJ A;  3URY A;  2BYT A;  2HTH A;  2O2V B;  3ZDM C;  5L83 A;  2BYF A;  3L16 A;  2QEJ C;  3RNB C;  4BFR A;  1K53 A;  4YT0 B;  1J7B A;  3N1X C;  1MI0 A;  3BII D;  2UWQ A;  2V3N A;  3QIJ A;  3V6C B;  2VRR B;  2MJE A;  3LJ3 A;  2LVP A;  3Q3J A;  3GB1 A;  3DHG C;  1QOF A;  4FJZ A;  3RZW C;  5BYQ A;  3A4R A;  4G11 A;  1FNW A;  3OJ3 A;  2WXJ A;  1YN3 A;  3LDZ E;  2NS5 A;  1ESF A;  4M01 A;  4IM2 A;  1TGZ B;  2H89 B;  4LNI A;  3RCZ A;  2LRU A;  4AJY B;  3NVZ A;  3Q3F A;  3OG5 A;  3N9Y C;  1DOX A;  1V81 A;  2KAC A;  4TMA B;  3BVM A;  4FAD A;  5EE9 A;  2N9X A;  1L0Y B;  4FN2 A;  3ZTC A;  4QAY A;  1T0Y A;  1WJU A;  1RFK A;  2MHJ A;  4HXD A;  5DPT A;  2WXO A;  3U52 E;  1DGJ A;  3ZYY X;  3ZNI D;  4K3C A;  1AAR A;  3VAW A;  5E6O A;  1EU3 A;  3GE8 C;  1IBX A;  4WAA A;  1RLF A;  4WJN A;  4A6Q A;  3ALB A;  3MJW A;  3AMZ A;  2LXA A;  2KFK B;  1WGK A;  1L0X B;  3SDL C;  1E6E B;  1TKG A;  1WX8 A;  1K50 A;  2V9H A;  4HCN B;  3VRB B;  3PTF C;  1B9R A;  2XNA C;  3PGE A;  3TEW A;  5BYS A;  2DHZ A;  3AEB B;  4FJV B;  2BS3 B;  3UIN B;  1WGD A;  1YJI A;  1QKZ A;  1XLQ A;  4NY0 A;  2JXX A;  2MBQ A;  4DXG A;  3DBL B;  4DWF A;  4CQN A;  4J3O D;  3C8Y A;  1HTO A;  3T9L A;  4BOZ B;  2PLP A;  1FXT B;  3ZIM A;  2N9E B;  4RF1 A;  2G45 B;  5IP4 D;  2J42 A;  2KMC A;  2KD0 A;  2BYE A;  2KJ6 A;  2QIL A;  1JWA D;  2L1A A;  1ZXI A;  1ZOY B;  1XEE A;  2IY1 B;  1KF6 B;  3FC4 A;  2IGG A;  1VRA B;  3P4Q B;  2K25 A;  3NOB A;  3DHH C;  1PGA A;  1JCK B;  1WFY A;  2MCN B;  3PPA A;  2L00 B;  2PTL A;  2BKR B;  3L0W B;  2LI5 A;  4RF0 A;  1D5X C;  1EO6 A;  2C5L C;  3AN1 A;  3C19 A;  3L17 A;  4HWI B;  2O6V D;  1PGB A;  2L52 A;  3ZRC A;  2M0X A;  3A9K A;  1UNS A;  4IOI E;  2KX0 A;  4OVV A;  2CHW A;  4ZRP A;  3JSV B;  3ZVV A;  2K6Q A;  3ML9 A;  2EKE C;  3DBR I;  2GI9 A;  4N59 A;  2PMV A;  4B9K A;  4ZYN A;  2Y3A A;  2DZI A;  1FXI A;  3IT4 B;  4PK1 A;  2FIF A;  1N63 A;  3VVW B;  3H7P B;  4XX5 A;  2LAS A;  3APC A;  1RWS A;  4MGY E;  2W54 A;  4YSY B;  2AL6 A;  2CJN A;  3TBL D;  1JML A;  3NUH B;  3WIM A;  2QJL A;  4FBJ B;  1C77 A;  1YNT E;  1Y56 A;  1XQQ A;  4NJC A;  1SE3 A;  3DVG Y;  2V3S A;  3Q8A A;  1KTK A;  1FFU A;  2QDF A;  1OQY A;  2E3T A;  2L0T A;  1XF5 L;  1E8W A;  2BQQ A;  4ANU A;  5AUK A;  2KJR A;  3V60 A;  3Q8C A;  4IC7 B;  3P2B A;  2R61 A;  1UF0 A;  5FR3 A;  5JHB A;  3HUI A;  4KSK C;  3ZO5 B;  3PZ8 A;  1K8R B;  2Y5C A;  3ZLZ A;  2IY0 B;  1XXG A;  4W9G A;  2J52 A;  1R4M I;  2RDG A;  4IW0 A;  2IGD A;  4B95 A;  3W2D A;  4RMA A;  5AZH A;  2KN5 A;  1EM7 A;  4BKG A;  3DPD A;  2MP2 A;  1UD7 A;  3OLM D;  1WMH B;  1YJJ A;  3VDZ A;  4R3D A;  2K6D B;  1GB1 A;  3ZJV A;  4PYZ A;  3MHS D;  4MGZ E;  3M63 B;  5CHW A;  1P3Q U;  3EHV A;  3MC8 A;  1CMX B;  4L1B A;  3CMM B;  3P4R B;  2RGF A;  3EGR A;  3IBE A;  4JQW C;  3I63 C;  2ZCB A;  3PRP B;  3OJ4 B;  1FEH A;  4MH0 E;  4EZL A;  4AP4 C;  4JLC A;  1ZDV A;  4NJ6 A;  1E7V A;  2LHE A;  2MEK A;  1CJE A;  5KHQ A;  1QF6 A;  2RR9 A;  1MPE A;  3VQI A;  3DOW A;  3GS2 A;  3K9P B;  4MM3 B;  4CHK A;  4E74 A;  1SIJ A;  4ANV A;  1F2R C;  1OEY J;  1C9F A;  2EEL A;  4K7W A;  4LNO A;  2KLG A;  4A90 A;  2M19 A;  3FAH A;  3ECI A;  4N9F 4;  3PSE B;  2KWD A;  2Y5P A;  1AYF A;  3WA0 A;  1WXQ A;  3PRE A;  4BBN F;  2BT6 A;  2LGX A;  1TZ1 A;  4F1S A;  3KLS X;  3QAR A;  2MWS B;  2D3C A;  3H8H A;  1TS5 A;  2EMS A;  2JPH A;  1P1A A;  4HKQ A;  5AEK B;  2O6V B;  3Q2A C;  3NG0 A;  2M0A A;  3R3M A;  2L76 A;  4P1B C;  2R2Q A;  4A3P A;  1WYG A;  1WZ0 A;  2QC8 A;  4M8N A;  1I35 A;  3PZD A;  1J8C A;  1D6E C;  2IJ0 A;  4OHJ A;  3W9C B;  4WQM A;  3R2T A;  2WXQ A;  3M62 B;  1XCT L;  3K9O B;  4KIK B;  4YTP B;  2ASQ A;  4IWP A;  4YTN B;  3QQ8 B;  4P16 A;  2MLB A;  5L95 C;  3BZD B;  2ZCC A;  1T0Q C;  3NHE B;  4P7I A;  2XEW A;  1YN5 A;  2AL3 A;  4MJS B;  3WCQ A;  3AXC A;  3SU8 X;  3VR9 B;  4B0M A;  3NS8 A;  3ABV B;  2K9X A;  2GBJ A;  4OZC A;  1GC6 A;  4G0N B;  4S17 A;  1D4B A;  1RAX A;  2IO3 B;  4XWT A;  4AUQ C;  3KUC B;  4LLG M;  2FUH B;  2INC C;  4W9F A;  1XLO A;  3DVN V;  4MGI E;  4BKS D;  1TBE A;  2NPT A;  2ON8 A;  4G50 A;  4AQ7 A;  4A9A A;  2YEP F;  2MH7 A;  4FA6 A;  1WE6 A;  1R4M B;  3VUY A;  1XT9 B;  2W3S A;  3P42 A;  2RD0 A;  4RGO S;  3W1S C;  4NAW A;  5AZF A;  2ZVN A;  2GOW A;  4ZRI A;  4HCP B;  2LZ6 A;  1YQ4 B;  1PYW D;  1E9M A;  2HD5 B;  2YLM A;  2MRP A;  2QCZ A;  2KVZ A;  2KWC A;  3T3N A;  3R8B A;  2JWZ A;  4LTU A;  3R66 C;  4C4V B;  2KN4 A;  2AQ2 B;  1LQB A;  3NVY A;  2WXL A;  3KUD B;  3H6N A;  4DBG A;  3NVV A;  1C79 A;  1NYQ A;  1SJE D;  2LGY A;  2JWU A;  2REX A;  4GDK B;  4W9I A;  4IDI A;  5D6J B;  4HPP A;  4TQ0 A;  2LXC A;  2XBB C;  3RZF A;  3CWI A;  3WAL A;  1E5W A;  2OJR A;  1L5P A;  3DHI C;  3MC0 B;  2LVO A;  2KQS A;  2I1K A;  3U30 A;  4HKZ E;  2V1Y A;  1UUP A;  4F8C B;  2JXT A;  2K8B A;  3QK0 A;  1V49 A;  2W9N A;  5CHV C;  3TUO A;  1SEB D;  3PS6 A;  1V8C A;  1UEL A;  3B08 A;  2NCN A;  2A4Z A;  4HRO A;  1IP9 A;  1XCQ L;  3AB5 A;  1FNV A;  4JX1 C;  3LB8 C;  5JH5 C;  4ANX A;  5J2R A;  2LD9 A;  1T0R C;  4YSZ B;  2D3B A;  1S1Q B;  5IOI A;  1V5T A;  1Q10 A;  2J0J A;  1VZ8 A;  4GB9 A;  3SHQ A;  2WS3 B;  3BYY B;  5G55 A;  4JGH B;  2JUO A;  4ZRQ A;  1IGD A;  1LXD A;  4KX6 B;  4B6W A;  1SIF A;  2ZPY A;  5C23 A;  1VR9 A;  4JPS A;  1A5R A;  4FHK A;  5EE3 A;  3WAN A;  1WYW B;  2MJ3 A;  2KJH B;  1P7E A;  1SB3 C;  2KAN A;  3QC8 B;  2UU7 A;  2N7J A;  2PVO D;  1V6E A;  4Q2J A;  5D3D A;  2SEB D;  1VJK A;  5D3I B;  3PRZ A;  1SSN A;  2I38 A;  1LFD A;  1NYR A;  1SXT A;  2PPH A;  1F9J A;  3FIL B;  3A1Q B;  4XWW A;  4S0R A;  1KOT A;  3UIO B;  2IDY A;  1E0Z A;  1WJN A;  4HDO A;  3CST A;  2PKO A;  2KWU B;  5FKA C;  4B0E A;  1V1P B;  5AUI A;  1FFV A;  1T3Q A;  2BWF A;  4EE2 A;  2N9L A;  3R7R A;  3BK1 A;  1WGH A;  4ICV A;  1VDV A;  4NAM A;  1ISN A;  2MQJ A;  2KDM A;  4OW0 A;  2V4L A;  1KFY B;  1YQ3 B;  2JVC A;  1ZXH A;  3HRD D;  4NNJ B;  3CIR B;  3RI7 C;  1TS4 A;  3OWE B;  3ZNZ B;  2K1F A;  4N58 A;  2XK5 B;  4YWG G;  3Q14 C;  2E6X A;  4WJO A;  2VH2 A;  3UIP B;  3EC8 A;  5DPR A;  2WXH A;  5TSS A;  2KHW B;  1N6Z A;  1C4C A;  4BZA A;  3L08 A;  2D2Q A;  3ZXV A;  4LDT D;  5E6N A;  3NY5 A;  2Z0E B;  2MBH A;  2LVQ A;  1L4D B;  1JW9 D;  4KKI A;  2CHZ A;  1TS3 A;  4W9E A;  1I42 A;  3RNE C;  1ZDX A;  1ZPS A;  4DDG D;  2BF8 B;  1FRD A;  3VTW A;  3AEA B;  4GN1 A;  1ZW7 A;  1FIQ A;  1I4Q A;  1Q1O A;  1GNU A;  1WSP A;  3VH3 B;  1R7S A;  4F7Z A;  1GC7 A;  5HG2 A;  1E7P B;  4GSW A;  3BVZ A;  4KV2 A;  3AEF B;  3HVD A;  2CS4 A;  3H7P A;  1S3S G;  2WX0 A;  1HQR D;  3VTU A;  1L6V A;  1R4N I;  3NS1 A;  4N6E B;  1WE7 A;  2LFI A;  2WP9 B;  4AS1 A;  2N1V A;  1SF0 A;  1UBI A;  3N3K B;  4IM0 A;  1TIF A;  4XC2 A;  2HE7 A;  3UF8 A;  2WNM A;  1P98 A;  4KDI C;  5DPW A;  2BB6 A;  2WXK A;  2XN9 C;  3Q8F A;  2NTS A;  3ZNH B;  1E8Y A;  1IBX B;  5IAA C;  2V4I B;  2Q5W D;  4NQK E;  2LMC A;  2JF5 A;  2DYM A;  3B0A A;  4D2K A;  1WZ3 A;  2DBY A;  3SR6 A;  2M17 A;  3PHW B;  1KJT A;  2IGH A;  1EU4 A;  4XYC A;  4M0W A;  5D2M B;  2M1M A;  3ZRF A;  4LK0 M;  1FRR A;  2V3P A;  5TR5 A;  4AWJ A;  1WXA A;  2J7Q B;  5IO9 A;  1WMH A;  3EFU A;  3PHX B;  4IUM B;  3H1U A;  5DPS A;  4M02 A;  2DYO A;  1JRO A;  3DVN U;  3P4S B;  1OFF A;  5J17 A;  2PE6 B;  3V6E B;  2LJ5 A;  4II3 B;  2L83 A;  1WM2 A;  2KDF B;  3RNA C;  3EA6 A;  2HDE A;  1L2N A;  5C2T B;  1TS2 A;  2ZZP B;  3EEC A;  4URK A;  1IUE A;  1HTQ A;  3RFZ B;  2FAZ A;  1WXM A;  2WDR B;  1YIW A;  1F77 A;  2RDB C;  1TY0 A;  2NMQ A;  4BKT A;  4O1N A;  4PS7 A;  3U2S C;  2KTR A;  1H4R A;  2PEA A;  2IPK D;  4KSL C;  2D11 A;  2BYV E;  3A9K B;  1AWD A;  4WWN A;  1OTR B;  1V97 A;  4EZK A;  3S2A A;  1NDD A;  1Y8R C;  2D10 A;  2JSV X;  3BIN A;  1L4Z B;  1V86 A;  2NVU I;  4GDL A;  1P7F A;  2N9K A;  4GIV A;  2I1J A;  1WM3 A;  3IVF A;  1P0R A;  4US9 A;  3HIZ A;  2K5P A;  3QAQ A;  1LGR A;  4US8 A;  1VZ6 A;  4IG7 B;  3RNC C;  4LDT B;  1FMA D;  3W1Y A;  3BWU D;  3Q8E A;  2IO1 B;  1AW7 A;  2NR2 A;  4G3X B;  3N30 A;  4UDU C;  1ZUD 2;  4H2A A;  1GG3 A;  2JU6 X;  4MEM A;  3I57 A;  1J19 A;  2WQY B;  3N1Z C;  4PYU A;  3KW5 B;  2KDE B;  1J7A A;  2L32 A;  2MW5 A;  2VH1 A;  1ET9 A;  1N62 A;  3ZTD A;  3R2I A;  4I6P A;  2KWV B;  1G6J A;  3PLV A;  3Q3O C;  1WIA A;  5D94 A;  3QWZ B;  2IO0 B;  4OZB A;  3U7D A;  4X57 B;  2FCQ A;  1STE A;  2BKF A;  2WU2 B;  2BWE S;  3P63 A;  2YEP B;  4TV3 A;  2A5U A;  3IHP C;  4MJS A;  2H88 B;  2K39 A;  2D5G A;  2KLC A;  2CJO A;  2AEH A;  2MP2 B;  4HPM B;  3SD5 A;  3DWG C;  5IA7 A;  3DDC B;  4XGA B;  3NRZ A;  1I4X A;  3VFK A;  2BW2 A;  4DHZ E;  3TMP B;  4DHZ B;  4LCD E;  4MSM B;  5CHF A;  2JZP A;  3TSS A;  1RRB A;  3GZN I;  3KQ4 A;  3DBH I;  1T6B X;  4JL9 A;  1JRU A;  3TEY A;  5H92 C;  4GMV A;  4CO7 A;  3AEG B;  5EE0 A;  3ZKJ C;  3O65 B;  2ZEQ A;  2M8S A;  3DWM A;  4MSQ B;  4ANW A;  5JZE B;  1WH3 A;  3DBR B;  4GXB A;  3EFC A;  2D07 B;  1TY2 A;  2N0S B;  3OAW A;  1GPX A;  3L13 A;  5HI1 A;  4HJK A;  2X8X X;  4WWO A;  3JW0 X;  2OJW A;  1PQS A;  2ZJD A;  4AJW A;  2LGS A;  1MFW A;  1QOA A;  2J0K A;  2WXR A;  3AED B;  3ZW3 A;  3GOE A;  4C00 A;  3V3X A;  3DQV A;  1X1M A;  1SGH A;  3ZQ4 A;  3QA8 A;  5GMV A;  5CTR C;  5DCN A;  1UZX B;  3VRA B;  5FK9 C;  1OGW A;  1XD3 B;  3A33 B;  3TIX A;  5AZG A;  5KHO A;  1N5W A;  1F2R I;  1QOB A;  2AQ3 B;  1WF9 A;  4ZDV A;  3MC9 A;  2KQ7 A;  3KUZ A;  4RM8 A;  1I4H A;  2EKI A;  4NQL B;  2IND C;  1M94 A;  4RNA A;  4ZHO A;  2KTF A;  2OHF A;  4J6I A;  2JYT A;  1ZKH A;  1NEK B;  2IBI B;  3ZJT A;  2JY6 A;  2WXN A;  3QCA A;  5LLI A;  1FNU A;  3U4E G;  1SE9 A;  4A3O A;  3AE3 B;  3CF6 E;  5HKH A;  1JAL A;  1YOV B;  2ACZ B;  1SE2 A;  2ZNV B;  3IXS A;  2ZVO A;  1SBB B;  3HHM A;  1IYF A;  3NVW A;  2NBV B;  1P9D U;  1HA5 A;  1WRD B;  1GAQ B;  1F52 A;  4EUT A;  2K22 A;  2G4S A;  3W5V B;  3RUI B;  1VCB A;  1ZGU B;  2WXG A;  2AQ1 B;  3AE5 B;  3T3O A;  1V5O A;  5E6P A;  2Z8L A;  1YN4 A;  5JXV A;  2INP E;  2KK8 A;  2KX3 A;  2WXI A;  4LNK A;  1XO3 A;  2NPT B;  3WAM A;  2IZV B;  1QT9 A;  4KGR A;  3IFW B;  3A9J B;  1WX7 A;  2HJ1 A;  1I7H A;  1C3T A;  1WJ6 A;  4DK5 A;  5IKC M;  4YXD B;  3RNG C;  2GMI C;  2O2V A;  1E90 A;  3H7S A;  3MFG A;  3V61 A;  3I5J C;  3WAP A;  4KDL B;  1HXY D;  3ZDT A;  1MG8 A;  4NAW B;  2PVG C;  4DDI D;  3IG3 A;  4LJO B;  4KKJ A;  3X0W A;  4MGK E;  2KT7 A;  2PE9 A;  4MDK E;  5J18 A;  1RYJ A;  2JT4 B;  4TSS A;  1PGX A;  4REZ A;  3J9C A;  3HM3 A;  2JZZ A;  4GOC A;  4W9D A;  3GZN B;  3N32 A;  1NBF C;  4K3B A;  4RGM A;  1OQQ A;  4K7S A;  1KH0 A;  3U8Z A;  2PW9 A;  2SAK A;  5CX3 A;  1BUI C;  2BB5 A;  5BYR A;  4IWO A;  5BMI A;  2OOB B;  2GRI A;  2TSS A;  3ZUN A;  2WXM A;  1ACC A;  3BYT B;  3VXW A;  4K1R B;  3GP7 A;  5IN7 A;  2NBW B;  3E56 A;  1WGR A;  1N5X A;  4CYE A;  1QIL A;  1NEN B;  1M4V A;  2INN E;  3X23 A;  4ARC A;  4OVZ A;  2KNB A;  4IKG A;  4W9L A;  2QIE B;  5JHA A;  3MTN B;  3TJP A;  1J0G A;  2KFJ A;  3AE6 B;  3SFD B;  2KFK A;  3PO0 A;  3RPF C;  2QHO A;  1DOY A;  1OQR A;  1V2Y A;  3NJT A;  2D3G A;  4M8M A;  1XLP A;  3MHZ A;  1LM8 B;  3KWV A;  4LNN A;  2CU3 A;  4RGN A;  1C1Y B;  4BOS C;  5GXG B;  1UWM A;  3HK0 A;  3UQB A;  3VR8 B;  3RYT A;  5MPO A;  3DCG A;  3TCA A;  3NZU A;  2LRW A;  3AEC B;  3ENE A;  1JWS D;  2RPV A;  2DLB A;  4XE0 A;  2J53 A;  4FJY A;  4ACF A;  2BPS A;  2WDQ B;  3AU5 A;  1C76 A;  1RFA A;  3TEZ A;  2J4X A;  1YJ1 A;  1LO5 D;  4TKN A;  3PV1 A;  4L23 A;  2KVR A;  4NJ7 A;  4II2 B;  4EFO A;  2KDI A;  2DYB A;  1BXT A;  3A4S C;  2NTT A;  2LUM A;  3L10 B;  2W3R A;  2DAJ A;  3ZNG C;  3E9S A;  1TJE A;  2MSE D;  4ZHP A;  1JRP A;  1TKY A;  1V9J A;  1WXS A;  3CSF A;  3B9J A;  3JSV A;  2DAF A;  3W1S A;  3Q6B A;  1K52 A;  2L05 A;  2L8J A;  3TL5 A;  5HFY A;  1NVI D;  1YX6 B;  4FUL A;  2G4D B;  3IAS 1;  2DNF A;  1UGJ A;  4PS3 A;  3R7Q A;  3UQA A;  4C7Z A;  3QX1 A;  1I4P A;  3DBS A;  2W55 A;  4RFB A;  2KDB A;  1V80 A;  3C0R B;  3HM6 X;  2KQ4 X;  3JYU A;  4WIP A;  4ARI A;  1QLB B;  2FCN A;  1T0S C;  3KVF B;  3FKY A;  1WX9 A;  3KWL A;  1WRI A;  4KVG B;  2HTM E;  3UI3 A;  2RMM A;  3BY4 B;  3EUB 2;  2KO3 A;  2V0G A;  4A55 A;  4EOY A;  2CKH B;  3LYY A;  2M4N A;  2HJ8 A;  1N60 A;  2X38 A;  2MBE A;  1YQB A;  1UBQ A;  1E8X A;  2FNJ B;  1YD8 U;  1ET6 A;  4OVU A;  4WWM A;  2D3A A;  5BMH A;  2FUG 1;  2L3Z A;  1OEY A;  4P6V F;  1XLN A;  2MA9 B;  1UGM A;  3AM9 A;  3JVZ X;  2ICI A;  2CHX A;  2L7R A;  4KGT A;  2ZNV C;  2MBO A;  3W5U B;  3AH7 A;  1Z5S B;  1VLB A;  2AYO B;  4JWS C;  2KMM A;  2GBR A;  3IT6 B;  3AE9 B;  1BML C;  2K0P A;  1TKE A;  3KH0 A;  4ITK A;  4NZL B;  3RUL A;  4YTM B;  1Q5W B;  2K8H A;  1C4P A;  4P1C C;  4HEA 1;  1MHH E;  5LNK 1;  3H9D A;  2BS4 B;  4C56 C;  1F1H A;  1WI0 A;  3P1M A;  1GJZ A;  1WY8 A;  3M3J A;  2JX5 A;  2GBK A;  4MT5 A;  2C7M B;  2BTE A;  2AX5 A;  4C7Y A;  2MJD A;  1RM6 C;  1WGG A;  1L7Y A;  2IO2 B;  2VZK D;  2WYQ A;  5G5G A;  2GBN A;  1YMH E;  2Z59 B;  3AE1 B;  3L54 A;  3Q8B A;  1ENF A;  4WQO B;  1C4A A;  2IYD B;  1CK1 A;  1D5M C;  3GE3 C;  2KC2 A;  1D3Z A;  3Q3N C;  1EWC A;  4JIO U;  2L0F A;  4M00 A;  3M95 A;  3LXF A;  4GU2 A;  3PT2 B;  1FM0 D;  3B1L X;  4IM3 A;  2WDV B;  4MM3 A;  2QSD A;  1L0V B;  1VD2 A;  4WUR A;  3Q3M C;  1WXV A;  2LEK A;  1C78 A;  1JWM D;  3B2F A;  2MBB B;  2OED A;  2WXP A;  1H8C A;  4HK2 A;  3VH4 B;  4USA A;  4IWQ A;  3KYD D;  1GUA B;  4WJQ A;  3V62 A;  2DZM A;  4M0W B;  3ETR A;  3ZGZ A;  1ROE A;  1WWT A;  4FXC A;  5I4D A;  1EWY C;  2QMT A;  2K8C A;  2RDH A;  4RM9 A;  4DHJ D;  3HVZ A;  1HZ5 A;  2G1E A;  3PLU A;  5T8I A;  2O6V A;  5C1Z A;  3RMK C;  1D5Z C;  4ZRJ A;  2DZJ A;  4FLH A;  2JQR B;  2LUE A;  3QHT A;  1KLV A;  2N1W A;  1I4G A;  2GB1 A;  2LGI A;  5D7G A;  4TUU A;  2W82 A;  4HVB A;  1FD6 A;  1Z2M A;  4YL8 A;  4HPL B;  4KIK A;  3BK2 A;  4KZC A;  2GLS A;  3MP9 A;  1E10 A;  2DX5 B;  2N7D A;  5EE1 A;  4EEW A;  1HZ6 A;  3B2G A;  2Y5B B;  2WX1 A;  1MG4 A;  1MHX A;  1WR1 A;  2KTR B;  4ICU A;  1AN8 A;  3ZJU A;  2C9W B;  2RPQ A;  4MH8 A;  1PUT A;  2K3U A;  3L4P A;  1QZE A;  1R4N B;  2C7N B;  2BGF A;  2NBU A;  2MX2 A;  1CZP A;  2KZR A;  3N20 C;  4HDQ A;  3AE4 B;  2KAJ A;  3BVG A;  4GDL B;  1FXA A;  4W9H A;  2KKC A;  3WAO A;  1JQ4 A;  3AU4 A;  2LWP A;  1HEZ E;  2AWT A;  1NI3 A;  2FBW B;  4LJP B;  4C80 A;  1TYG B;  2ZW0 A;  4DXA B;  4RH6 A;  1N61 A;  3I9V 1;  2WWZ A; 
#chains in the Genus database with same CATH homology
 3EC8 A;  1Q0W B;  2NPT B;  5DPR A;  3WAM A;  4ASW C;  2IZV B;  2R2O A;  2KHW B;  1OQY A;  3IFW B;  2YVC A;  3A9J B;  3L08 A;  3AI5 A;  2L0T A;  2B3A A;  1E8W A;  1WX7 A;  2D2Q A;  4ANU A;  1WR6 E;  1C3T A;  1WJ6 A;  2KJR A;  4LDT D;  3V60 A;  4W9J A;  5E6N A;  4DK5 A;  2FCS A;  3NY5 A;  4IC7 B;  2Z0E B;  3P2B A;  2MBH A;  2GMI C;  5LXH A;  2O2V A;  2LVQ A;  1E90 A;  3H7S A;  4FHJ A;  5JHB A;  3V61 A;  3WAP A;  4KDL B;  4KSK C;  3ZO5 B;  1K8R B;  2CHZ A;  1KM7 A;  3ZDT A;  1MG8 A;  2KC1 A;  4NAW B;  4AOF A;  4DDI D;  3ZLZ A;  2IY0 B;  4W9G A;  3IG3 A;  2N4F A;  1R4M I;  4LJO B;  4W9E A;  4MGK E;  3X0W A;  1I42 A;  4IW0 A;  2PE9 A;  4MDK E;  4B95 A;  5J18 A;  2RSU A;  4DDG D;  2JRI B;  2BF8 B;  3D32 A;  4RMA A;  5AZH A;  1E8Z A;  2KN5 A;  2JT4 B;  3VTW A;  4BKG A;  4GN1 A;  3DPD A;  3HM3 A;  1ZW7 A;  2JZZ A;  2MP2 A;  1Q1O A;  1GNU A;  4GOC A;  4W9D A;  1UD7 A;  3N32 A;  3VH3 B;  1WGY A;  2LGD A;  1NBF C;  3DVG X;  4F7Z A;  3OLM D;  1WMH B;  4K7S A;  1GC7 A;  3U8Z A;  3VHT C;  4GSW A;  3UGB B;  3VDZ A;  4GDK A;  4KV2 A;  2K6D B;  3APD A;  5CX3 A;  1WJ4 A;  2CS4 A;  3H7P A;  4PYZ A;  1S3S G;  2WX0 A;  3MHS D;  4IWO A;  4MGZ E;  2OOB B;  3VTU A;  3M63 B;  5CHW A;  4WWP A;  1P3Q U;  1R4N I;  3EHV A;  1WE7 A;  4EKU A;  3ZUN A;  4A20 A;  2N1V A;  1CMX B;  1HE8 A;  3CMM B;  2WDT B;  1UBI A;  3N3K B;  4IM0 A;  3VXW A;  4K1R B;  1TTN A;  2RGF A;  3IBE A;  4JQW C;  4XC2 A;  2DEN B;  2HE7 A;  2ZCB A;  3PRP B;  2NBW B;  3UF8 A;  1WGR A;  1P98 A;  5BO4 B;  3OJ4 B;  4KDI C;  5DPW A;  4K7U A;  4MH0 E;  4EZL A;  3VUW A;  4JLC A;  4AP4 C;  4NJ6 A;  1E7V A;  1EF1 A;  4CYE A;  3A9J A;  3NZS A;  5G2N A;  3X23 A;  5KHQ A;  2KNB A;  2RR9 A;  4W9L A;  4KZ0 A;  3VQI A;  3DOW A;  5JHA A;  3K9P B;  4CHK A;  3ZNH B;  1E8Y A;  2CR5 A;  3MTN B;  5IAA C;  4ANV A;  4E74 A;  1OEY J;  3TJP A;  1J0G A;  4NQK E;  2KFJ A;  4K7W A;  3QJZ A;  5EDS A;  1YX5 B;  2JF5 A;  2KFK A;  2DYM A;  4DHJ B;  2KLG A;  2QHO A;  3B0A A;  3RD2 A;  1WZ3 A;  4I6N B;  1V2Y A;  4GGQ A;  3KYC D;  2PJH A;  3ECI A;  2D3G A;  4N9F 4;  2M17 A;  3PHW B;  3PSE B;  4M8M A;  1KJT A;  1LM8 B;  3WA0 A;  3PRE A;  4BOS C;  1C1Y B;  4NPN A;  5D2M B;  2M1M A;  3HK0 A;  4I6L B;  3ML8 A;  4BBN F;  3UQB A;  3ZRF A;  2LGX A;  3RYT A;  1TZ1 A;  3VTV A;  4F1S A;  3AUL A;  5TR5 A;  3QAR A;  4AWJ A;  1WXA A;  3DCG A;  3TCA A;  2J7Q B;  3NZU A;  2LRW A;  1WMH A;  2MWS B;  1BT0 A;  3EFU A;  3PHX B;  1E7U A;  3ENE A;  1NI2 A;  4IUM B;  2ZPN A;  3H1U A;  4K81 A;  2EMS A;  4BBN C;  5DPS A;  2C7H A;  2J0M A;  3DBL I;  2DYO A;  4MEL A;  2JPH A;  1P1A A;  3DVN U;  4HLE A;  5AEK B;  4WJP A;  2O6V B;  4FJY A;  5J17 A;  2BPS A;  5LXI B;  2PE6 B;  1U4A A;  3ONS A;  3R3M A;  2L76 A;  3AU5 A;  2R2Q A;  3V6E B;  2N7E A;  1EF5 A;  2LJ5 A;  4A3P A;  1RFA A;  4II3 B;  2KMA A;  1WM2 A;  1WZ0 A;  4XZ4 A;  4M8N A;  2KDF B;  1YJ1 A;  4TKN A;  1I35 A;  1L2N A;  3PV1 A;  2KOX A;  2ZZP B;  2KVR A;  4NJ7 A;  4II2 B;  4EFO A;  2KDI A;  2DYB A;  3EEC A;  3PZD A;  3A4S C;  3T8M A;  4URK A;  1J8C A;  3L10 B;  2FAZ A;  1WXM A;  3ZNG C;  2DAJ A;  1YIW A;  4EZJ A;  2C60 A;  3M62 B;  3K9O B;  4KIK B;  3A1Q A;  2ASQ A;  2MSE D;  4IWP A;  4BKT A;  3PVL A;  3QQ8 B;  1V9J A;  2MLB A;  4PS7 A;  1WXS A;  3CSF A;  4E71 A;  2KTR A;  5L95 C;  1H4R A;  2PEA A;  4KSL C;  2D11 A;  2ZCC A;  2BYV E;  3A9K B;  3JSV A;  3NHE B;  4P7I A;  1EUV B;  2XEW A;  2DAF A;  2AL3 A;  2G3Q B;  4MJS B;  3W1S A;  4WWN A;  1OTR B;  4E3C A;  2L05 A;  2L8J A;  3S2A A;  3TL5 A;  3VUX A;  4TQ1 A;  4EZK A;  1NDD A;  1YX6 B;  2CU1 A;  1Y8R C;  3PRM B;  3AXC A;  3SU8 X;  4BKS A;  4FUL A;  2G4D B;  2D10 A;  2GBM A;  4PS3 A;  3R7Q A;  3BIN A;  3UQA A;  1V86 A;  3NS8 A;  2NVU I;  4GDL A;  3QX1 A;  3DBS A;  2EMT A;  2I1J A;  2GBJ A;  2KDB A;  3APF A;  4GIV A;  1WM3 A;  1V80 A;  5FR6 A;  3C0R B;  3HM6 X;  3IVF A;  1P0R A;  1GC6 A;  4G0N B;  3JYU A;  1IPG A;  3HIZ A;  3QAQ A;  4IG7 B;  1RAX A;  2FCM A;  4ZRK A;  2FCN A;  4LDT B;  3KVF B;  3W1Y A;  1WX9 A;  2IO3 B;  4AUQ C;  3KUC B;  4KVG B;  2FID A;  2FUH B;  2IO1 B;  4W9F A;  3BY4 B;  2JZ3 B;  2KO3 A;  2NR2 A;  4G3X B;  4EOY A;  3N30 A;  2CKH B;  2XK5 A;  2M4N A;  4BVU C;  2JRH A;  1GG3 A;  2N9P C;  3DVN V;  4MGI E;  4W9C A;  2HJ8 A;  4W9K A;  4MEM A;  4BKS D;  2DZK A;  1J19 A;  1TBE A;  3RT3 B;  4PYU A;  2NPT A;  2MBE A;  4G50 A;  1YQB A;  1UBQ A;  1E8X A;  2FNJ B;  3KW5 B;  4PS8 A;  2KDE B;  1YD8 U;  4OVU A;  3I3T B;  2MW5 A;  2Z0D B;  3DVG Y;  2UYZ B;  2L3Z A;  4FA6 A;  1WE6 A;  1UH6 A;  1OEY A;  3VUY A;  3ZTD A;  1XT9 B;  2MA9 B;  1UGM A;  4I6P A;  2KWV B;  1G6J A;  3JVZ X;  3PLV A;  2KXJ A;  2CHX A;  2HTH A;  2O2V B;  3ZDM C;  2RD0 A;  5L83 A;  2BYF A;  3L16 A;  2L7R A;  3W1S C;  4NAW A;  5AZF A;  1WIA A;  2ZVN A;  5D94 A;  3QWZ B;  2GOW A;  2IO0 B;  4HCP B;  2ZNV C;  4ZRI A;  3U7D A;  2MBO A;  4BFR A;  4X57 B;  2LZ6 A;  2FCQ A;  2BKF A;  2UWQ A;  1Z5S B;  2BWE S;  3QIJ A;  2HD5 B;  2YLM A;  2AYO B;  3V6C B;  2MRP A;  2VRR B;  2GBR A;  2A5U A;  2KWC A;  3LJ3 A;  2LVP A;  3IHP C;  4TV3 A;  4MJS A;  2JWZ A;  2K39 A;  3Q3J A;  3R66 C;  2KLC A;  3KH0 A;  3RUL A;  2AEH A;  2MP2 B;  4FJZ A;  4HPM B;  3SD5 A;  1Q5W B;  5IA7 A;  2K8H A;  3DDC B;  1LQB A;  3RZW C;  3VFK A;  3KUD B;  4DBG A;  3H6N A;  3H9D A;  3A4R A;  4G11 A;  4DHZ E;  3OJ3 A;  3TMP B;  1WI0 A;  2LGY A;  2REX A;  3LDZ E;  4DHZ B;  1GJZ A;  1WY8 A;  3M3J A;  4GDK B;  2NS5 A;  4LCD E;  4MSM B;  4W9I A;  2GBK A;  5CHF A;  5D6J B;  2C7M B;  1RRB A;  3GZN I;  4TQ0 A;  4IM2 A;  2LXC A;  2XBB C;  3RZF A;  3DBH I;  4JL9 A;  1JRU A;  1TGZ B;  1WGG A;  3RCZ A;  2LRU A;  1E5W A;  1L7Y A;  2IO2 B;  2OJR A;  2WYQ A;  3WAL A;  4AJY B;  4GMV A;  4CO7 A;  2GBN A;  2Z59 B;  3Q3F A;  1V81 A;  3ZKJ C;  3L54 A;  3O65 B;  2LVO A;  2ZEQ A;  4FAD A;  2KQS A;  2M8S A;  2N9X A;  4MSQ B;  2I1K A;  4ANW A;  3U30 A;  4WQO B;  2V1Y A;  2IYD B;  5JZE B;  4FN2 A;  1WH3 A;  4GXB A;  3ZTC A;  4F8C B;  2KC2 A;  1T0Y A;  1D3Z A;  1WJU A;  2D07 B;  4JIO U;  2K8B A;  2L0F A;  4HXD A;  3QK0 A;  5DPT A;  1V49 A;  2W9N A;  3M95 A;  3L13 A;  3OAW A;  4GU2 A;  3PT2 B;  5CHV C;  3ZNI D;  4HJK A;  3B1L X;  3PS6 A;  1AAR A;  4IM3 A;  4MM3 A;  1UEL A;  3B08 A;  2NCN A;  4WWO A;  3JW0 X;  5E6O A;  3VAW A;  4WAA A;  1PQS A;  2A4Z A;  2ZJD A;  1RLF A;  4WJN A;  1VD2 A;  1IP9 A;  4AJW A;  3ALB A;  3MJW A;  1WXV A;  2LXA A;  5JH5 C;  4ANX A;  2KFK B;  3SDL C;  5J2R A;  2J0K A;  1WX8 A;  4HCN B;  2MBB B;  3PTF C;  3PGE A;  2LD9 A;  1H8C A;  2DHZ A;  3GOE A;  3ZW3 A;  4HK2 A;  3DQV A;  1X1M A;  4FJV B;  1SGH A;  3VH4 B;  3QA8 A;  3UIN B;  5GMV A;  4IWQ A;  1S1Q B;  5CTR C;  1WGD A;  5DCN A;  3KYD D;  1V5T A;  1GUA B;  4NY0 A;  1UZX B;  2J0J A;  4WJQ A;  2JXX A;  3V62 A;  2DZM A;  2MBQ A;  4M0W B;  4GB9 A;  4DWF A;  3SHQ A;  5G55 A;  4JGH B;  2JUO A;  3T9L A;  1OGW A;  1XD3 B;  1LXD A;  3A33 B;  4BOZ B;  3TIX A;  4B6W A;  5AZG A;  2K8C A;  1FXT B;  5KHO A;  4RM9 A;  3ZIM A;  2N9E B;  4DHJ D;  2G45 B;  1SIF A;  2ZPY A;  1WF9 A;  5C23 A;  2KMC A;  2KD0 A;  4ZDV A;  3PLU A;  2BYE A;  2KJ6 A;  1A5R A;  4FHK A;  2KQ7 A;  2O6V A;  3WAN A;  3KUZ A;  5C1Z A;  1WYW B;  4RM8 A;  2KJH B;  2IY1 B;  4ZRJ A;  2DZJ A;  2K25 A;  3NOB A;  4FLH A;  2KAN A;  1WFY A;  2MCN B;  3PPA A;  2L00 B;  4NQL B;  3QC8 B;  2BKR B;  2LUE A;  3QHT A;  1KLV A;  1M94 A;  2N1W A;  1V6E A;  5D7G A;  3L0W B;  2LI5 A;  2KTF A;  4TUU A;  1EO6 A;  4HVB A;  2C5L C;  1Z2M A;  4YL8 A;  4J6I A;  3PRZ A;  4HPL B;  4KIK A;  1LFD A;  4KZC A;  2PPH A;  3L17 A;  1F9J A;  2DX5 B;  2N7D A;  3A1Q B;  4EEW A;  1KOT A;  3UIO B;  4HWI B;  1ZKH A;  2O6V D;  2WX1 A;  2Y5B B;  2IBI B;  1WJN A;  3ZRC A;  2M0X A;  2JY6 A;  1WR1 A;  2KTR B;  3A9K A;  3QCA A;  4ICU A;  4HDO A;  3CST A;  5LLI A;  2KX0 A;  4OVV A;  2CHW A;  3JSV B;  1SE9 A;  2C9W B;  3ZVV A;  4A3O A;  2K6Q A;  2KWU B;  2RPQ A;  2EKE C;  3ML9 A;  3CF6 E;  3DBR I;  5HKH A;  1QZE A;  2C7N B;  2BGF A;  2ZNV B;  2BWF A;  2NBU A;  4B9K A;  2ZVO A;  4ZYN A;  3R7R A;  2MX2 A;  2DZI A;  3HHM A;  2KZR A;  1IYF A;  2NBV B;  4HDQ A;  1P9D U;  1WGH A;  2FIF A;  4ICV A;  4GDL B;  1ISN A;  1WRD B;  4W9H A;  3VVW B;  2KKC A;  2MQJ A;  3H7P B;  3WAO A;  4EUT A;  4XX5 A;  2V4L A;  2LAS A;  3AU4 A;  3APC A;  2LWP A;  2JVC A;  2AWT A;  4MGY E;  2G4S A;  4LJP B;  3RUI B;  2AL6 A;  1VCB A;  1ZGU B;  4NNJ B;  3TBL D;  3WIM A;  4FBJ B;  1XQQ A;  1V5O A;  3ZNZ B;  2K1F A;  4DXA B;  5E6P A;  2XK5 B;  4WJO A;  2KK8 A;  2KX3 A;  2WWZ A;  2V3S A;  3UIP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...