2BL7A

1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
79
structure length
79
Chain Sequence
KNAKQIVHELYNDISISKDPKYSDILEVMQKVYLKLEKQKYELDPSPLINRLVNYLYFTAYTNKIRFTEYQEELIRNMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.6-A Crystal Structure of Enta-Im: A Bacterial Immunity Protein Conferring Immunity to the Antimicrobial Activity of the Pediocin-Like Bacteriocin Enterocin A
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Immune system
molecule keywords ENTEROCINE A IMMUNITY PROTEIN
total genus 31
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08951 EntA_Immun Enterocin A Immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.50 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Ta0600-like 2bl7A00
2FU2A 2QZGA 2BL7A 1TDPA 2QSBA 2BL8A
chains in the Genus database with same CATH superfamily
3P23A 3UITA 2QGMA 2QSBA 3B55A 2FU2A 2ETDA 2K19A 2A2DA 2A2CA 4HFVA 4Q9VA 3LJ2A 5LNK1 3DO9A 4GXTA 4G76A 2XTRA 4YZDA 4OAVB 2JB3A 3L0IA 1YO7A 4DWLA 4OAUC 2JBWA 2ZRRA 1U5KA 4Z7GA 4AS2A 4JCVE 4O1PA 2RIOA 3F4MA 2GSCA 4YZ9A 3LJ0A 2F66B 2RLDA 4AS3A 2MJFB 3SDJA 4HEA1 2KKMA 2IP6A 2JB2A 3DA3A 2BL8A 4PL5A 2V1CC 2F6MB 2HGKA 2BL7A 3IAM1 2L1LB 4Z7HA 4NV2A 1TDPA 3IAS1 2XTQA 2CAZB 5HGIA 2QZGA 2JB1A 3DA4A 3KP9A 4O1OA 3Q8DA 2YFBA 3JSBA 4NV5A 2JAEA 4I1TA 2FEFA 2P22B 4PL4A 4U6RA 3AJFA 2YFAA 2ZW3A 3FVVA 1W3SA 4G75A 4YZCA 2RADA 3I9V1 1SJ8A 2FUG1 1JQOA 2XMXA 3FBVA 3FNBA 2V6EA 3VA9A 4PL3A 3LJ1A 2E8GA
chains in the Genus database with same CATH topology
2FU2A 2QZGA 2BL7A 1TDPA 2QSBA 2BL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FU2 A;  2QZG A;  2BL7 A;  1TDP A;  2QSB A;  2BL8 A; 
#chains in the Genus database with same CATH topology
 3P23 A;  3UIT A;  2QGM A;  2QSB A;  3B55 A;  2FU2 A;  2ETD A;  2K19 A;  2A2D A;  2A2C A;  4HFV A;  4Q9V A;  3LJ2 A;  5LNK 1;  3DO9 A;  4GXT A;  4G76 A;  2XTR A;  4YZD A;  4OAV B;  2JB3 A;  3L0I A;  1YO7 A;  4DWL A;  4OAU C;  2JBW A;  2ZRR A;  1U5K A;  4Z7G A;  4AS2 A;  4JCV E;  4O1P A;  2RIO A;  3F4M A;  2GSC A;  4YZ9 A;  3LJ0 A;  2F66 B;  2RLD A;  4AS3 A;  2MJF B;  3SDJ A;  4HEA 1;  2KKM A;  2IP6 A;  2JB2 A;  3DA3 A;  2BL8 A;  4PL5 A;  2V1C C;  2F6M B;  2HGK A;  2BL7 A;  3IAM 1;  2L1L B;  4Z7H A;  4NV2 A;  1TDP A;  3IAS 1;  2XTQ A;  2CAZ B;  5HGI A;  2QZG A;  2JB1 A;  3DA4 A;  3KP9 A;  4O1O A;  3Q8D A;  2YFB A;  3JSB A;  4NV5 A;  2JAE A;  4I1T A;  2FEF A;  2P22 B;  4PL4 A;  4U6R A;  3AJF A;  2YFA A;  2ZW3 A;  3FVV A;  1W3S A;  4G75 A;  4YZC A;  2RAD A;  3I9V 1;  1SJ8 A;  2FUG 1;  1JQO A;  2XMX A;  3FBV A;  3FNB A;  2V6E A;  3VA9 A;  4PL3 A;  3LJ1 A;  2E8G A; 
#chains in the Genus database with same CATH homology
 2FU2 A;  2QZG A;  2BL7 A;  1TDP A;  2QSB A;  2BL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...