2BL7A

1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
79
structure length
79
Chain Sequence
b'KNAKQIVHELYNDISISKDPKYSDILEVMQKVYLKLEKQKYELDPSPLINRLVNYLYFTAYTNKIRFTEYQEELIRNMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROCINE A IMMUNITY PROTEIN
publication title 1.6-A Crystal Structure of Enta-Im: A Bacterial Immunity Protein Conferring Immunity to the Antimicrobial Activity of the Pediocin-Like Bacteriocin Enterocin A
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Immune system
total genus 31
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08951 EntA_Immun Enterocin A Immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.50 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Ta0600-like 2bl7A00
2QZGA 2QSBA 2FU2A 2BL8A 2BL7A 1TDPA
chains in the Genus database with same CATH superfamily
1SJ8A 4G76A 3VA9A 2FUG1 2F6MB 4YZDA 3IAS1 2BL7A 2JB2A 5HGIA 2MJFB 1JQOA 3KP9A 3L0IA 4HEA1 3Q8DA 4YZCA 2F66B 1U5KA 2GSCA 4Z7GA 2E8GA 4YZ9A 2P22B 3FVVA 4Z7HA 2ZW3A 3LJ1A 2K19A 4U6RA 2FU2A 2V1CC 4I1TA 3FBVA 3DA3A 4NV2A 3IAM1 4HFVA 4Q9VA 1W3SA 4GXTA 4OAVB 3FNBA 2HGKA 3DA4A 2XTRA 4PL5A 2ETDA 2YFBA 2QZGA 2JB1A 2RIOA 2YFAA 4O1OA 2A2CA 2FEFA 4OAUC 4PL4A 2XTQA 3B55A 1TDPA 2QGMA 2JAEA 3UITA 4AS3A 3JSBA 4O1PA 3LJ0A 3SDJA 4DWLA 2V6EA 4PL3A 2KKMA 2A2DA 2JB3A 2ZRRA 3DO9A 2IP6A 3F4MA 4JCVE 3P23A 2BL8A 2L1LB 2RADA 5LNK1 4NV5A 3AJFA 2RLDA 1YO7A 2JBWA 3LJ2A 2QSBA 2XMXA 4G75A 2CAZB 3I9V1 4AS2A
chains in the Genus database with same CATH topology
2QZGA 2QSBA 2FU2A 2BL8A 2BL7A 1TDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZG A;  2QSB A;  2FU2 A;  2BL8 A;  2BL7 A;  1TDP A; 
#chains in the Genus database with same CATH topology
 1SJ8 A;  4G76 A;  3VA9 A;  2FUG 1;  2F6M B;  4YZD A;  3IAS 1;  2BL7 A;  2JB2 A;  5HGI A;  2MJF B;  1JQO A;  3KP9 A;  3L0I A;  4HEA 1;  3Q8D A;  4YZC A;  2F66 B;  1U5K A;  2GSC A;  4Z7G A;  2E8G A;  4YZ9 A;  2P22 B;  3FVV A;  4Z7H A;  2ZW3 A;  3LJ1 A;  2K19 A;  4U6R A;  2FU2 A;  2V1C C;  4I1T A;  3FBV A;  3DA3 A;  4NV2 A;  3IAM 1;  4HFV A;  4Q9V A;  1W3S A;  4GXT A;  4OAV B;  3FNB A;  2HGK A;  3DA4 A;  2XTR A;  4PL5 A;  2ETD A;  2YFB A;  2QZG A;  2JB1 A;  2RIO A;  2YFA A;  4O1O A;  2A2C A;  2FEF A;  4OAU C;  4PL4 A;  2XTQ A;  3B55 A;  1TDP A;  2QGM A;  2JAE A;  3UIT A;  4AS3 A;  3JSB A;  4O1P A;  3LJ0 A;  3SDJ A;  4DWL A;  2V6E A;  4PL3 A;  2KKM A;  2A2D A;  2JB3 A;  2ZRR A;  3DO9 A;  2IP6 A;  3F4M A;  4JCV E;  3P23 A;  2BL8 A;  2L1L B;  2RAD A;  5LNK 1;  4NV5 A;  3AJF A;  2RLD A;  1YO7 A;  2JBW A;  3LJ2 A;  2QSB A;  2XMX A;  4G75 A;  2CAZ B;  3I9V 1;  4AS2 A; 
#chains in the Genus database with same CATH homology
 2QZG A;  2QSB A;  2FU2 A;  2BL8 A;  2BL7 A;  1TDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...