2BLFB

Sulfite dehydrogenase from starkeya novella
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
APLTYELPDETAQLKPAPQPGFEAAQNNCAACHSVDYINTQPPGKGQAFWDAEVQKMIKVYHAPVDEADAKAIADYLAKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sulfite:cytochrome c oxidoreductase subunit A
publication title Molecular Basis of Intramolecular Electron Transfer in Sulfite-Oxidizing Enzymes is Revealed by High Resolution Structure of a Heterodimeric Complex of the Catalytic Molybdopterin Subunit and a C-Type Cytochrome Subunit.
pubmed doi rcsb
source organism Starkeya novella
molecule tags Oxidoreductase
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2blfB01
4EIFA 1KIBA 1GU2A 5B66V 1KV9A 3HQ7A 1LFMA 2EXVA 1CSVA 4PJ0V 3PXSA 4FA1A 1AKKA 1FHBA 1CHIA 2OZ1A 1CRJA 3MK7C 4WQDA 2GC7D 1N90A 1M6ZA 1K3GA 1DW3A 4FB1A 1OAEA 1BE3D 3WU2V 1GQ1A 1KB9D 1N50A 3WFCC 351CA 2GIWA 4YE1A 1W2LA 1L9JC 5AURA 1RAQA 1CIFA 2ZXYA 1EB7A 1MG2D 1CTYA 1CYIA 3TGUD 5CIGB 1EZVD 1IZL0 3SLEA 2YK3A 1CCRA 2CA3B 1F1CA 1FI9A 2C8SA 4PD4D 3O1YA 3A9FA 1L0ND 2OZ1B 4Y5RA 1LC1A 2I8FA 2FWLA 3L75D 1H9XA 1I5TA 2BLFB 1I6EA 1HZUA 2N3BA 5KLIB 3RN1A 1CRHA 3O0RC 4NFGB 1DW2A 4LJIA 1CRGA 3ZOYA 2N9IA 1RAPA 3C2CA 1LS9A 2D0WA 1A2SA 4KMGA 1C2NA 1C75A 3OCDB 2JQRA 2AXTV 4N0KA 2AI5A 1QL4A 4GYDA 5B6QA 4AAMA 3CXHD 1AYGA 2YQBA 1S6VB 4V2KA 1N15A 2N18C 3ZOXA 1QYZA 1SQXD 1WVEC 1CEDA 2ORLA 2LIRA 1CYCA 1CNOA 1WEJF 1MZ4A 1L0LD 5CIHB 4AX3A 3CWBD 1KX7A 2C1DB 4WQ9A 1B7VA 2QJYB 3ZOOA 3CX5D 5KLVD 1CRCA 3PH2B 2BH4X 2YIUB 1KX2A 1FOCA 155CA 5CIFB 4K3IA 3ORVA 4J20A 1NTZD 3HQ8A 1J3SA 3O20A 1S5LV 4QAOA 2QJKB 3DMIA 1ZRTD 1C6SA 1CHHA 4O1QA 1C6OA 1AOQA 1ETPA 4H0KA 5IY51 3OA8A 1IRWA 2YCCA 3ZBMA 2AIUA 1YICA 2B4ZA 1CRYA 4UB8V 1DT1A 4D6TD 3ZCFA 1I8OA 1CC5A 3OCDA 1QN2A 4XXLA 1C2RA 3A0HV 1NNOA 5H2FV 1CSUA 1I54A 3JBTB 1NTKD 1CTJA 1DW1A 1IO3A 1KYOW 1CO6A 1CIEA 4WQEA 2PACA 5DF5A 3OA8B 1E2RA 1YEBA 3HQ6A 2N3YA 4Q5PA 1H31B 1HJ4A 3ZOWA 1R0QA 2C1DA 4U3FD 1GJQA 1P84D 2BH5X 1CSXA 1YTCA 3ZIYA 1NMIA 2JTIB 3H1KD 1YNRA 3BCCD 3PXTA 1A56A 1IRVA 1NTMD 3WFEC 3CYTI 1FI3A 2FYUD 2B12B 2CE1A 4EIEA 2VHDA 3A0BV 2A06D 3VYMA 1H33B 1H1OA 1GIWA 1GKSA 1DW0A 1KB0A 4O1WA 1MG3D 1SQPD 1H32B 1YEAA 2LITA 4MU8A 1CXAA 1W5CT 4EICA 5KKZB 1ZZHA 1H9YA 2C1VA 4DY9A 1DIQC 1NMLA 1OCDA 1HCMA 1YCCA 1CHJA 3L72D 5CIDB 1DIIC 2BCNB 1C6RA 1I55A 4AANA 1CORA 4FA4A 2ZONG 3CX5W 1DVHA 2PCBB 2MTAC 2QJPB 2V07A 2CE0A 1SQVD 2ZOOA 4AAOA 1M70A 2FYNB 4L3HA 1F1FA 5GTIV 5E79V 1I6DA 1JDLA 3H1LD 1QKSA 1CTZA 2HV4A 5DFSA 1FI7A 2BCCD 2V08A 4L1QA 2XTSB 1E8EA 1BGYD 4JCGA 3L71D 3WFDC 1HH7A 1HRCA 4FAVA 2C9XB 1H31A 2GB8B 1LMSA 4P4QB 1N9CA 3L70D 3VRDA 1IQCA 4WQ8A 3H1HD 1U74B 5GTHV 3DP5A 1NU1D 1CIHA 5DJQB 1PP9D 2D0SA 1CXCA 3RN0A 3L74D 5CYTR 2DGEA 3NBTA 4L3GA 1H33A 1YIQA 1CRIA 1H32A 1E29A 3WUIA 5DJQC 4WQ7A 3SXTA 3PXWA 1I8PA 1FCDC 3H1ID 4H0JA 1C52A 1VYDA 4PWAA 1AOFA 3TYIA 5CIEB 3RMZA 5C0ZA 1SQQD 3NWVA 5TISV 1KYOD 2ZZS1 3RLMA 3NBSA 4UB6V 3SJLA 5B5EV 3HQ9A 1HJ5A 3DR0A 2IBZD 2B10B 4IL6V 2N9JA 1A8CA 1RZ6A 1DVVA 2L4DA 3L4MA 3SWSA 1SQBD 4WQAA 1HJ3A 2B11B 3X39A 1NIRA 3WFBC 3M97X 2CXBA 2PCCB 1CCHA 4FA9A 3CXHW 1CIGA 4EIDA 3SVWA 3CU4A 3O5CA 5KAIV 5C9MA 2N18B 1C7MA 1QL3A 3L73D 1CYJA 3KZIV 1BCCD 2MHMA 4AALA 1K3HA 2C1UA 1GDVA 5KAFV 2FRCA 4XYDB 2DVHA 4WQBA 5CICB 4FA5A 1YFCA 3L4OA 3H1JD 2GC4D 1M60A 1PPJD 1LC2A 5CIBB 3VNWA 4PW9B 1U75B 1HZVA 2CA4B 1FJ0A 2BGVX 3WC8A 1RZ5A 2ZBOA 1COTA 1HROA 1CSWA 1L9BC 2BPBB 2B0ZB 5EXQA 4RSZA 2C2CA 1BL9A 3CP5A 3MK7B 4FANA 4GEDB 4WQCA 451CA
chains in the Genus database with same CATH superfamily
4EIFA 1KIBA 1GU2A 5B66V 1KV9A 3HQ7A 1LFMA 2EXVA 1CSVA 4PJ0V 3PXSA 4FA1A 1AKKA 1FHBA 1CHIA 2OZ1A 1CRJA 3MK7C 4WQDA 2GC7D 1N90A 1M6ZA 1K3GA 1DW3A 4FB1A 1OAEA 1BE3D 3WU2V 1GQ1A 1KB9D 1N50A 3WFCC 351CA 2GIWA 4YE1A 1W2LA 1L9JC 5AURA 1RAQA 1CIFA 2ZXYA 1EB7A 1MG2D 1CTYA 1CYIA 3TGUD 5CIGB 1EZVD 1IZL0 3SLEA 2YK3A 1CCRA 2CA3B 1F1CA 1FI9A 2C8SA 4PD4D 3O1YA 3A9FA 1L0ND 2OZ1B 4Y5RA 1LC1A 2I8FA 2FWLA 3L75D 1H9XA 1I5TA 2BLFB 1I6EA 1HZUA 2N3BA 5KLIB 3RN1A 1CRHA 3O0RC 4NFGB 1DW2A 4LJIA 1CRGA 3ZOYA 2N9IA 1RAPA 3C2CA 1LS9A 2D0WA 1A2SA 4KMGA 1C2NA 1C75A 3OCDB 2JQRA 2AXTV 4N0KA 2AI5A 1QL4A 4GYDA 5B6QA 4AAMA 3CXHD 1AYGA 2YQBA 1S6VB 4V2KA 1N15A 2N18C 3ZOXA 1QYZA 1SQXD 1WVEC 1CEDA 2ORLA 2LIRA 1CYCA 1CNOA 1WEJF 1MZ4A 1L0LD 5CIHB 4AX3A 3CWBD 1KX7A 2C1DB 4WQ9A 1B7VA 2QJYB 3ZOOA 3CX5D 5KLVD 1CRCA 3PH2B 2BH4X 2YIUB 1KX2A 1FOCA 155CA 5CIFB 4K3IA 3ORVA 4J20A 1NTZD 3HQ8A 1J3SA 3O20A 1S5LV 4QAOA 2QJKB 3DMIA 1ZRTD 3D0WA 1C6SA 1CHHA 4O1QA 1C6OA 1AOQA 1ETPA 4H0KA 5IY51 3OA8A 1IRWA 2YCCA 3ZBMA 2AIUA 1YICA 2B4ZA 1CRYA 4UB8V 1DT1A 4D6TD 3ZCFA 1I8OA 1CC5A 3OCDA 1QN2A 4XXLA 1C2RA 3A0HV 1NNOA 5H2FV 1CSUA 1I54A 3JBTB 1NTKD 1CTJA 1DW1A 1IO3A 1KYOW 1CO6A 1CIEA 4WQEA 2PACA 5DF5A 3OA8B 1E2RA 1YEBA 3HQ6A 2N3YA 4Q5PA 1H31B 1HJ4A 3ZOWA 1R0QA 2C1DA 4U3FD 1GJQA 1P84D 2BH5X 1CSXA 1YTCA 3ZIYA 1NMIA 2JTIB 3H1KD 1YNRA 3BCCD 3PXTA 1A56A 1IRVA 1NTMD 3WFEC 3CYTI 1FI3A 2FYUD 2B12B 2CE1A 4EIEA 2VHDA 3A0BV 2A06D 3VYMA 1H33B 1H1OA 1GIWA 1GKSA 1DW0A 1KB0A 4O1WA 1MG3D 1SQPD 1H32B 1YEAA 2LITA 4MU8A 1CXAA 1W5CT 4EICA 5KKZB 1ZZHA 1H9YA 2C1VA 4DY9A 1DIQC 1NMLA 1OCDA 1HCMA 1YCCA 1CHJA 3L72D 5CIDB 1DIIC 2BCNB 1C6RA 1I55A 4AANA 1CORA 4FA4A 2ZONG 3CX5W 1DVHA 2PCBB 2MTAC 2QJPB 2V07A 2CE0A 1SQVD 2ZOOA 4AAOA 1M70A 2FYNB 4L3HA 1F1FA 5GTIV 5E79V 1I6DA 1JDLA 3H1LD 1QKSA 1CTZA 2HV4A 5DFSA 1FI7A 2BCCD 2V08A 4L1QA 2XTSB 1E8EA 1BGYD 4JCGA 3L71D 3WFDC 1HH7A 1HRCA 4FAVA 2C9XB 1H31A 2GB8B 1LMSA 4P4QB 1N9CA 3L70D 3VRDA 1IQCA 4WQ8A 3H1HD 1U74B 5GTHV 3DP5A 1NU1D 1CIHA 5DJQB 1PP9D 2D0SA 1CXCA 3RN0A 3L74D 5CYTR 2DGEA 3NBTA 4L3GA 1H33A 1YIQA 1CRIA 1H32A 1E29A 3WUIA 5DJQC 4WQ7A 3SXTA 3PXWA 1I8PA 1FCDC 3H1ID 4H0JA 1C52A 1VYDA 4PWAA 1AOFA 3TYIA 5CIEB 3RMZA 5C0ZA 1SQQD 3NWVA 5TISV 1KYOD 2ZZS1 3RLMA 3NBSA 4UB6V 3SJLA 5B5EV 3HQ9A 1HJ5A 3DR0A 2IBZD 2B10B 4IL6V 2N9JA 1A8CA 1RZ6A 1DVVA 2L4DA 3L4MA 3SWSA 1SQBD 4WQAA 1HJ3A 2B11B 3X39A 1NIRA 3WFBC 3M97X 2CXBA 2PCCB 1CCHA 4FA9A 3CXHW 1CIGA 4EIDA 3SVWA 3CU4A 3O5CA 5KAIV 5C9MA 2N18B 1C7MA 1QL3A 3L73D 1CYJA 3KZIV 1BCCD 2MHMA 4AALA 1K3HA 2C1UA 1GDVA 5KAFV 2FRCA 4XYDB 2DVHA 4WQBA 5CICB 4FA5A 1YFCA 3L4OA 3H1JD 2GC4D 1M60A 1PPJD 1LC2A 5CIBB 3VNWA 4PW9B 1U75B 1HZVA 2CA4B 1FJ0A 2BGVX 3WC8A 1RZ5A 2ZBOA 1COTA 1HROA 1CSWA 1L9BC 2BPBB 2B0ZB 5EXQA 4RSZA 2C2CA 1BL9A 3CP5A 3MK7B 4FANA 4GEDB 4WQCA 451CA
chains in the Genus database with same CATH topology
4EIFA 1KIBA 1GU2A 5B66V 1KV9A 3HQ7A 1LFMA 2EXVA 1CSVA 4PJ0V 3PXSA 4FA1A 1AKKA 1FHBA 1CHIA 2OZ1A 1CRJA 3MK7C 4WQDA 2GC7D 1N90A 1M6ZA 1K3GA 1DW3A 4FB1A 1OAEA 1BE3D 3WU2V 1GQ1A 1KB9D 1N50A 3WFCC 351CA 2GIWA 4YE1A 1W2LA 1L9JC 5AURA 1RAQA 1CIFA 2ZXYA 1EB7A 1MG2D 1CTYA 1CYIA 3TGUD 5CIGB 1EZVD 1IZL0 3SLEA 2YK3A 1CCRA 2CA3B 1F1CA 1FI9A 2C8SA 4PD4D 3O1YA 3A9FA 1L0ND 2OZ1B 4Y5RA 1LC1A 2I8FA 2FWLA 3L75D 1H9XA 1I5TA 2BLFB 1I6EA 1HZUA 2N3BA 5KLIB 3RN1A 1CRHA 3O0RC 4NFGB 1DW2A 4LJIA 1CRGA 3ZOYA 2N9IA 1RAPA 3C2CA 1LS9A 2D0WA 1A2SA 4KMGA 1C2NA 1C75A 3OCDB 2JQRA 2AXTV 4N0KA 2AI5A 1QL4A 4GYDA 5B6QA 4AAMA 3CXHD 1AYGA 2YQBA 1S6VB 4V2KA 1N15A 2N18C 3ZOXA 1QYZA 1SQXD 1WVEC 1CEDA 2ORLA 2LIRA 1CYCA 1CNOA 1WEJF 1MZ4A 1L0LD 5CIHB 4AX3A 3CWBD 1KX7A 2C1DB 4WQ9A 1B7VA 2QJYB 3ZOOA 3CX5D 5KLVD 1CRCA 3PH2B 2BH4X 2YIUB 1KX2A 1FOCA 155CA 5CIFB 4K3IA 3ORVA 4J20A 1NTZD 3HQ8A 1J3SA 3O20A 1S5LV 4QAOA 2QJKB 3DMIA 1ZRTD 1C6SA 1CHHA 4O1QA 1C6OA 1AOQA 1ETPA 4H0KA 5IY51 3OA8A 1IRWA 2YCCA 3ZBMA 2AIUA 1YICA 2B4ZA 1CRYA 4UB8V 1DT1A 4D6TD 3ZCFA 1I8OA 1CC5A 3OCDA 1QN2A 4XXLA 1C2RA 3A0HV 1NNOA 5H2FV 1CSUA 1I54A 3JBTB 1NTKD 1CTJA 1DW1A 1IO3A 1KYOW 1CO6A 1CIEA 4WQEA 2PACA 5DF5A 3OA8B 1E2RA 1YEBA 3HQ6A 2N3YA 4Q5PA 1H31B 1HJ4A 3ZOWA 1R0QA 2C1DA 4U3FD 1GJQA 1P84D 2BH5X 1CSXA 1YTCA 3ZIYA 1NMIA 2JTIB 3H1KD 1YNRA 3BCCD 3PXTA 1A56A 1IRVA 1NTMD 3WFEC 3CYTI 1FI3A 2FYUD 2B12B 2CE1A 4EIEA 2VHDA 3A0BV 2A06D 3VYMA 1H33B 1H1OA 1GIWA 1GKSA 1DW0A 1KB0A 4O1WA 1MG3D 1SQPD 1H32B 1YEAA 2LITA 4MU8A 1CXAA 1W5CT 4EICA 5KKZB 1ZZHA 1H9YA 2C1VA 4DY9A 1DIQC 1NMLA 1OCDA 1HCMA 1YCCA 1CHJA 3L72D 5CIDB 1DIIC 2BCNB 1C6RA 1I55A 4AANA 1CORA 4FA4A 2ZONG 3CX5W 1DVHA 2PCBB 2MTAC 2QJPB 2V07A 2CE0A 1SQVD 2ZOOA 4AAOA 1M70A 2FYNB 4L3HA 1F1FA 5GTIV 5E79V 1I6DA 1JDLA 3H1LD 1QKSA 1CTZA 2HV4A 5DFSA 1FI7A 2BCCD 2V08A 4L1QA 2XTSB 1E8EA 1BGYD 4JCGA 3L71D 3WFDC 1HH7A 1HRCA 4FAVA 2C9XB 1H31A 2GB8B 1LMSA 4P4QB 1N9CA 3L70D 3VRDA 1IQCA 4WQ8A 3H1HD 1U74B 5GTHV 3DP5A 1NU1D 1CIHA 5DJQB 1PP9D 2D0SA 1CXCA 3RN0A 3L74D 5CYTR 2DGEA 3NBTA 4L3GA 1H33A 1YIQA 1CRIA 1H32A 1E29A 3WUIA 5DJQC 4WQ7A 3SXTA 3PXWA 1I8PA 1FCDC 3H1ID 4H0JA 1C52A 1VYDA 4PWAA 1AOFA 3TYIA 5CIEB 3RMZA 5C0ZA 1SQQD 3NWVA 5TISV 1KYOD 2ZZS1 3RLMA 3NBSA 4UB6V 3SJLA 5B5EV 3HQ9A 1HJ5A 3DR0A 2IBZD 2B10B 4IL6V 2N9JA 1A8CA 1RZ6A 1DVVA 2L4DA 3L4MA 3SWSA 1SQBD 4WQAA 1HJ3A 2B11B 3X39A 1NIRA 3WFBC 3M97X 2CXBA 2PCCB 1CCHA 4FA9A 3CXHW 1CIGA 4EIDA 3SVWA 3CU4A 3O5CA 5KAIV 5C9MA 2N18B 1C7MA 1QL3A 3L73D 1CYJA 3KZIV 1BCCD 2MHMA 4AALA 1K3HA 2C1UA 1GDVA 5KAFV 2FRCA 4XYDB 2DVHA 4WQBA 5CICB 4FA5A 1YFCA 3L4OA 3H1JD 2GC4D 1M60A 1PPJD 1LC2A 5CIBB 3VNWA 4PW9B 1U75B 1HZVA 2CA4B 1FJ0A 2BGVX 3WC8A 1RZ5A 2ZBOA 1COTA 1HROA 1CSWA 1L9BC 2BPBB 2B0ZB 5EXQA 4RSZA 2C2CA 1BL9A 3CP5A 3MK7B 4FANA 4GEDB 4WQCA 451CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIF A;  1KIB A;  1GU2 A;  5B66 V;  1KV9 A;  3HQ7 A;  1LFM A;  2EXV A;  1CSV A;  4PJ0 V;  3PXS A;  4FA1 A;  1AKK A;  1FHB A;  1CHI A;  2OZ1 A;  1CRJ A;  3MK7 C;  4WQD A;  2GC7 D;  1N90 A;  1M6Z A;  1K3G A;  1DW3 A;  4FB1 A;  1OAE A;  1BE3 D;  3WU2 V;  1GQ1 A;  1KB9 D;  1N50 A;  3WFC C;  351C A;  2GIW A;  4YE1 A;  1W2L A;  1L9J C;  5AUR A;  1RAQ A;  1CIF A;  2ZXY A;  1EB7 A;  1MG2 D;  1CTY A;  1CYI A;  3TGU D;  5CIG B;  1EZV D;  1IZL 0;  3SLE A;  2YK3 A;  1CCR A;  2CA3 B;  1F1C A;  1FI9 A;  2C8S A;  4PD4 D;  3O1Y A;  3A9F A;  1L0N D;  2OZ1 B;  4Y5R A;  1LC1 A;  2I8F A;  2FWL A;  3L75 D;  1H9X A;  1I5T A;  2BLF B;  1I6E A;  1HZU A;  2N3B A;  5KLI B;  3RN1 A;  1CRH A;  3O0R C;  4NFG B;  1DW2 A;  4LJI A;  1CRG A;  3ZOY A;  2N9I A;  1RAP A;  3C2C A;  1LS9 A;  2D0W A;  1A2S A;  4KMG A;  1C2N A;  1C75 A;  3OCD B;  2JQR A;  2AXT V;  4N0K A;  2AI5 A;  1QL4 A;  4GYD A;  5B6Q A;  4AAM A;  3CXH D;  1AYG A;  2YQB A;  1S6V B;  4V2K A;  1N15 A;  2N18 C;  3ZOX A;  1QYZ A;  1SQX D;  1WVE C;  1CED A;  2ORL A;  2LIR A;  1CYC A;  1CNO A;  1WEJ F;  1MZ4 A;  1L0L D;  5CIH B;  4AX3 A;  3CWB D;  1KX7 A;  2C1D B;  4WQ9 A;  1B7V A;  2QJY B;  3ZOO A;  3CX5 D;  5KLV D;  1CRC A;  3PH2 B;  2BH4 X;  2YIU B;  1KX2 A;  1FOC A;  155C A;  5CIF B;  4K3I A;  3ORV A;  4J20 A;  1NTZ D;  3HQ8 A;  1J3S A;  3O20 A;  1S5L V;  4QAO A;  2QJK B;  3DMI A;  1ZRT D;  1C6S A;  1CHH A;  4O1Q A;  1C6O A;  1AOQ A;  1ETP A;  4H0K A;  5IY5 1;  3OA8 A;  1IRW A;  2YCC A;  3ZBM A;  2AIU A;  1YIC A;  2B4Z A;  1CRY A;  4UB8 V;  1DT1 A;  4D6T D;  3ZCF A;  1I8O A;  1CC5 A;  3OCD A;  1QN2 A;  4XXL A;  1C2R A;  3A0H V;  1NNO A;  5H2F V;  1CSU A;  1I54 A;  3JBT B;  1NTK D;  1CTJ A;  1DW1 A;  1IO3 A;  1KYO W;  1CO6 A;  1CIE A;  4WQE A;  2PAC A;  5DF5 A;  3OA8 B;  1E2R A;  1YEB A;  3HQ6 A;  2N3Y A;  4Q5P A;  1H31 B;  1HJ4 A;  3ZOW A;  1R0Q A;  2C1D A;  4U3F D;  1GJQ A;  1P84 D;  2BH5 X;  1CSX A;  1YTC A;  3ZIY A;  1NMI A;  2JTI B;  3H1K D;  1YNR A;  3BCC D;  3PXT A;  1A56 A;  1IRV A;  1NTM D;  3WFE C;  3CYT I;  1FI3 A;  2FYU D;  2B12 B;  2CE1 A;  4EIE A;  2VHD A;  3A0B V;  2A06 D;  3VYM A;  1H33 B;  1H1O A;  1GIW A;  1GKS A;  1DW0 A;  1KB0 A;  4O1W A;  1MG3 D;  1SQP D;  1H32 B;  1YEA A;  2LIT A;  4MU8 A;  1CXA A;  1W5C T;  4EIC A;  5KKZ B;  1ZZH A;  1H9Y A;  2C1V A;  4DY9 A;  1DIQ C;  1NML A;  1OCD A;  1HCM A;  1YCC A;  1CHJ A;  3L72 D;  5CID B;  1DII C;  2BCN B;  1C6R A;  1I55 A;  4AAN A;  1COR A;  4FA4 A;  2ZON G;  3CX5 W;  1DVH A;  2PCB B;  2MTA C;  2QJP B;  2V07 A;  2CE0 A;  1SQV D;  2ZOO A;  4AAO A;  1M70 A;  2FYN B;  4L3H A;  1F1F A;  5GTI V;  5E79 V;  1I6D A;  1JDL A;  3H1L D;  1QKS A;  1CTZ A;  2HV4 A;  5DFS A;  1FI7 A;  2BCC D;  2V08 A;  4L1Q A;  2XTS B;  1E8E A;  1BGY D;  4JCG A;  3L71 D;  3WFD C;  1HH7 A;  1HRC A;  4FAV A;  2C9X B;  1H31 A;  2GB8 B;  1LMS A;  4P4Q B;  1N9C A;  3L70 D;  3VRD A;  1IQC A;  4WQ8 A;  3H1H D;  1U74 B;  5GTH V;  3DP5 A;  1NU1 D;  1CIH A;  5DJQ B;  1PP9 D;  2D0S A;  1CXC A;  3RN0 A;  3L74 D;  5CYT R;  2DGE A;  3NBT A;  4L3G A;  1H33 A;  1YIQ A;  1CRI A;  1H32 A;  1E29 A;  3WUI A;  5DJQ C;  4WQ7 A;  3SXT A;  3PXW A;  1I8P A;  1FCD C;  3H1I D;  4H0J A;  1C52 A;  1VYD A;  4PWA A;  1AOF A;  3TYI A;  5CIE B;  3RMZ A;  5C0Z A;  1SQQ D;  3NWV A;  5TIS V;  1KYO D;  2ZZS 1;  3RLM A;  3NBS A;  4UB6 V;  3SJL A;  5B5E V;  3HQ9 A;  1HJ5 A;  3DR0 A;  2IBZ D;  2B10 B;  4IL6 V;  2N9J A;  1A8C A;  1RZ6 A;  1DVV A;  2L4D A;  3L4M A;  3SWS A;  1SQB D;  4WQA A;  1HJ3 A;  2B11 B;  3X39 A;  1NIR A;  3WFB C;  3M97 X;  2CXB A;  2PCC B;  1CCH A;  4FA9 A;  3CXH W;  1CIG A;  4EID A;  3SVW A;  3CU4 A;  3O5C A;  5KAI V;  5C9M A;  2N18 B;  1C7M A;  1QL3 A;  3L73 D;  1CYJ A;  3KZI V;  1BCC D;  2MHM A;  4AAL A;  1K3H A;  2C1U A;  1GDV A;  5KAF V;  2FRC A;  4XYD B;  2DVH A;  4WQB A;  5CIC B;  4FA5 A;  1YFC A;  3L4O A;  3H1J D;  2GC4 D;  1M60 A;  1PPJ D;  1LC2 A;  5CIB B;  3VNW A;  4PW9 B;  1U75 B;  1HZV A;  2CA4 B;  1FJ0 A;  2BGV X;  3WC8 A;  1RZ5 A;  2ZBO A;  1COT A;  1HRO A;  1CSW A;  1L9B C;  2BPB B;  2B0Z B;  5EXQ A;  4RSZ A;  2C2C A;  1BL9 A;  3CP5 A;  3MK7 B;  4FAN A;  4GED B;  4WQC A;  451C A; 
#chains in the Genus database with same CATH topology
 4EIF A;  1KIB A;  1GU2 A;  5B66 V;  1KV9 A;  3HQ7 A;  1LFM A;  2EXV A;  1CSV A;  4PJ0 V;  3PXS A;  4FA1 A;  1AKK A;  1FHB A;  1CHI A;  2OZ1 A;  1CRJ A;  3MK7 C;  4WQD A;  2GC7 D;  1N90 A;  1M6Z A;  1K3G A;  1DW3 A;  4FB1 A;  1OAE A;  1BE3 D;  3WU2 V;  1GQ1 A;  1KB9 D;  1N50 A;  3WFC C;  351C A;  2GIW A;  4YE1 A;  1W2L A;  1L9J C;  5AUR A;  1RAQ A;  1CIF A;  2ZXY A;  1EB7 A;  1MG2 D;  1CTY A;  1CYI A;  3TGU D;  5CIG B;  1EZV D;  1IZL 0;  3SLE A;  2YK3 A;  1CCR A;  2CA3 B;  1F1C A;  1FI9 A;  2C8S A;  4PD4 D;  3O1Y A;  3A9F A;  1L0N D;  2OZ1 B;  4Y5R A;  1LC1 A;  2I8F A;  2FWL A;  3L75 D;  1H9X A;  1I5T A;  2BLF B;  1I6E A;  1HZU A;  2N3B A;  5KLI B;  3RN1 A;  1CRH A;  3O0R C;  4NFG B;  1DW2 A;  4LJI A;  1CRG A;  3ZOY A;  2N9I A;  1RAP A;  3C2C A;  1LS9 A;  2D0W A;  1A2S A;  4KMG A;  1C2N A;  1C75 A;  3OCD B;  2JQR A;  2AXT V;  4N0K A;  2AI5 A;  1QL4 A;  4GYD A;  5B6Q A;  4AAM A;  3CXH D;  1AYG A;  2YQB A;  1S6V B;  4V2K A;  1N15 A;  2N18 C;  3ZOX A;  1QYZ A;  1SQX D;  1WVE C;  1CED A;  2ORL A;  2LIR A;  1CYC A;  1CNO A;  1WEJ F;  1MZ4 A;  1L0L D;  5CIH B;  4AX3 A;  3CWB D;  1KX7 A;  2C1D B;  4WQ9 A;  1B7V A;  2QJY B;  3ZOO A;  3CX5 D;  5KLV D;  1CRC A;  3PH2 B;  2BH4 X;  2YIU B;  1KX2 A;  1FOC A;  155C A;  5CIF B;  4K3I A;  3ORV A;  4J20 A;  1NTZ D;  3HQ8 A;  1J3S A;  3O20 A;  1S5L V;  4QAO A;  2QJK B;  3DMI A;  1ZRT D;  3D0W A;  1C6S A;  1CHH A;  4O1Q A;  1C6O A;  1AOQ A;  1ETP A;  4H0K A;  5IY5 1;  3OA8 A;  1IRW A;  2YCC A;  3ZBM A;  2AIU A;  1YIC A;  2B4Z A;  1CRY A;  4UB8 V;  1DT1 A;  4D6T D;  3ZCF A;  1I8O A;  1CC5 A;  3OCD A;  1QN2 A;  4XXL A;  1C2R A;  3A0H V;  1NNO A;  5H2F V;  1CSU A;  1I54 A;  3JBT B;  1NTK D;  1CTJ A;  1DW1 A;  1IO3 A;  1KYO W;  1CO6 A;  1CIE A;  4WQE A;  2PAC A;  5DF5 A;  3OA8 B;  1E2R A;  1YEB A;  3HQ6 A;  2N3Y A;  4Q5P A;  1H31 B;  1HJ4 A;  3ZOW A;  1R0Q A;  2C1D A;  4U3F D;  1GJQ A;  1P84 D;  2BH5 X;  1CSX A;  1YTC A;  3ZIY A;  1NMI A;  2JTI B;  3H1K D;  1YNR A;  3BCC D;  3PXT A;  1A56 A;  1IRV A;  1NTM D;  3WFE C;  3CYT I;  1FI3 A;  2FYU D;  2B12 B;  2CE1 A;  4EIE A;  2VHD A;  3A0B V;  2A06 D;  3VYM A;  1H33 B;  1H1O A;  1GIW A;  1GKS A;  1DW0 A;  1KB0 A;  4O1W A;  1MG3 D;  1SQP D;  1H32 B;  1YEA A;  2LIT A;  4MU8 A;  1CXA A;  1W5C T;  4EIC A;  5KKZ B;  1ZZH A;  1H9Y A;  2C1V A;  4DY9 A;  1DIQ C;  1NML A;  1OCD A;  1HCM A;  1YCC A;  1CHJ A;  3L72 D;  5CID B;  1DII C;  2BCN B;  1C6R A;  1I55 A;  4AAN A;  1COR A;  4FA4 A;  2ZON G;  3CX5 W;  1DVH A;  2PCB B;  2MTA C;  2QJP B;  2V07 A;  2CE0 A;  1SQV D;  2ZOO A;  4AAO A;  1M70 A;  2FYN B;  4L3H A;  1F1F A;  5GTI V;  5E79 V;  1I6D A;  1JDL A;  3H1L D;  1QKS A;  1CTZ A;  2HV4 A;  5DFS A;  1FI7 A;  2BCC D;  2V08 A;  4L1Q A;  2XTS B;  1E8E A;  1BGY D;  4JCG A;  3L71 D;  3WFD C;  1HH7 A;  1HRC A;  4FAV A;  2C9X B;  1H31 A;  2GB8 B;  1LMS A;  4P4Q B;  1N9C A;  3L70 D;  3VRD A;  1IQC A;  4WQ8 A;  3H1H D;  1U74 B;  5GTH V;  3DP5 A;  1NU1 D;  1CIH A;  5DJQ B;  1PP9 D;  2D0S A;  1CXC A;  3RN0 A;  3L74 D;  5CYT R;  2DGE A;  3NBT A;  4L3G A;  1H33 A;  1YIQ A;  1CRI A;  1H32 A;  1E29 A;  3WUI A;  5DJQ C;  4WQ7 A;  3SXT A;  3PXW A;  1I8P A;  1FCD C;  3H1I D;  4H0J A;  1C52 A;  1VYD A;  4PWA A;  1AOF A;  3TYI A;  5CIE B;  3RMZ A;  5C0Z A;  1SQQ D;  3NWV A;  5TIS V;  1KYO D;  2ZZS 1;  3RLM A;  3NBS A;  4UB6 V;  3SJL A;  5B5E V;  3HQ9 A;  1HJ5 A;  3DR0 A;  2IBZ D;  2B10 B;  4IL6 V;  2N9J A;  1A8C A;  1RZ6 A;  1DVV A;  2L4D A;  3L4M A;  3SWS A;  1SQB D;  4WQA A;  1HJ3 A;  2B11 B;  3X39 A;  1NIR A;  3WFB C;  3M97 X;  2CXB A;  2PCC B;  1CCH A;  4FA9 A;  3CXH W;  1CIG A;  4EID A;  3SVW A;  3CU4 A;  3O5C A;  5KAI V;  5C9M A;  2N18 B;  1C7M A;  1QL3 A;  3L73 D;  1CYJ A;  3KZI V;  1BCC D;  2MHM A;  4AAL A;  1K3H A;  2C1U A;  1GDV A;  5KAF V;  2FRC A;  4XYD B;  2DVH A;  4WQB A;  5CIC B;  4FA5 A;  1YFC A;  3L4O A;  3H1J D;  2GC4 D;  1M60 A;  1PPJ D;  1LC2 A;  5CIB B;  3VNW A;  4PW9 B;  1U75 B;  1HZV A;  2CA4 B;  1FJ0 A;  2BGV X;  3WC8 A;  1RZ5 A;  2ZBO A;  1COT A;  1HRO A;  1CSW A;  1L9B C;  2BPB B;  2B0Z B;  5EXQ A;  4RSZ A;  2C2C A;  1BL9 A;  3CP5 A;  3MK7 B;  4FAN A;  4GED B;  4WQC A;  451C A; 
#chains in the Genus database with same CATH homology
 4EIF A;  1KIB A;  1GU2 A;  5B66 V;  1KV9 A;  3HQ7 A;  1LFM A;  2EXV A;  1CSV A;  4PJ0 V;  3PXS A;  4FA1 A;  1AKK A;  1FHB A;  1CHI A;  2OZ1 A;  1CRJ A;  3MK7 C;  4WQD A;  2GC7 D;  1N90 A;  1M6Z A;  1K3G A;  1DW3 A;  4FB1 A;  1OAE A;  1BE3 D;  3WU2 V;  1GQ1 A;  1KB9 D;  1N50 A;  3WFC C;  351C A;  2GIW A;  4YE1 A;  1W2L A;  1L9J C;  5AUR A;  1RAQ A;  1CIF A;  2ZXY A;  1EB7 A;  1MG2 D;  1CTY A;  1CYI A;  3TGU D;  5CIG B;  1EZV D;  1IZL 0;  3SLE A;  2YK3 A;  1CCR A;  2CA3 B;  1F1C A;  1FI9 A;  2C8S A;  4PD4 D;  3O1Y A;  3A9F A;  1L0N D;  2OZ1 B;  4Y5R A;  1LC1 A;  2I8F A;  2FWL A;  3L75 D;  1H9X A;  1I5T A;  2BLF B;  1I6E A;  1HZU A;  2N3B A;  5KLI B;  3RN1 A;  1CRH A;  3O0R C;  4NFG B;  1DW2 A;  4LJI A;  1CRG A;  3ZOY A;  2N9I A;  1RAP A;  3C2C A;  1LS9 A;  2D0W A;  1A2S A;  4KMG A;  1C2N A;  1C75 A;  3OCD B;  2JQR A;  2AXT V;  4N0K A;  2AI5 A;  1QL4 A;  4GYD A;  5B6Q A;  4AAM A;  3CXH D;  1AYG A;  2YQB A;  1S6V B;  4V2K A;  1N15 A;  2N18 C;  3ZOX A;  1QYZ A;  1SQX D;  1WVE C;  1CED A;  2ORL A;  2LIR A;  1CYC A;  1CNO A;  1WEJ F;  1MZ4 A;  1L0L D;  5CIH B;  4AX3 A;  3CWB D;  1KX7 A;  2C1D B;  4WQ9 A;  1B7V A;  2QJY B;  3ZOO A;  3CX5 D;  5KLV D;  1CRC A;  3PH2 B;  2BH4 X;  2YIU B;  1KX2 A;  1FOC A;  155C A;  5CIF B;  4K3I A;  3ORV A;  4J20 A;  1NTZ D;  3HQ8 A;  1J3S A;  3O20 A;  1S5L V;  4QAO A;  2QJK B;  3DMI A;  1ZRT D;  1C6S A;  1CHH A;  4O1Q A;  1C6O A;  1AOQ A;  1ETP A;  4H0K A;  5IY5 1;  3OA8 A;  1IRW A;  2YCC A;  3ZBM A;  2AIU A;  1YIC A;  2B4Z A;  1CRY A;  4UB8 V;  1DT1 A;  4D6T D;  3ZCF A;  1I8O A;  1CC5 A;  3OCD A;  1QN2 A;  4XXL A;  1C2R A;  3A0H V;  1NNO A;  5H2F V;  1CSU A;  1I54 A;  3JBT B;  1NTK D;  1CTJ A;  1DW1 A;  1IO3 A;  1KYO W;  1CO6 A;  1CIE A;  4WQE A;  2PAC A;  5DF5 A;  3OA8 B;  1E2R A;  1YEB A;  3HQ6 A;  2N3Y A;  4Q5P A;  1H31 B;  1HJ4 A;  3ZOW A;  1R0Q A;  2C1D A;  4U3F D;  1GJQ A;  1P84 D;  2BH5 X;  1CSX A;  1YTC A;  3ZIY A;  1NMI A;  2JTI B;  3H1K D;  1YNR A;  3BCC D;  3PXT A;  1A56 A;  1IRV A;  1NTM D;  3WFE C;  3CYT I;  1FI3 A;  2FYU D;  2B12 B;  2CE1 A;  4EIE A;  2VHD A;  3A0B V;  2A06 D;  3VYM A;  1H33 B;  1H1O A;  1GIW A;  1GKS A;  1DW0 A;  1KB0 A;  4O1W A;  1MG3 D;  1SQP D;  1H32 B;  1YEA A;  2LIT A;  4MU8 A;  1CXA A;  1W5C T;  4EIC A;  5KKZ B;  1ZZH A;  1H9Y A;  2C1V A;  4DY9 A;  1DIQ C;  1NML A;  1OCD A;  1HCM A;  1YCC A;  1CHJ A;  3L72 D;  5CID B;  1DII C;  2BCN B;  1C6R A;  1I55 A;  4AAN A;  1COR A;  4FA4 A;  2ZON G;  3CX5 W;  1DVH A;  2PCB B;  2MTA C;  2QJP B;  2V07 A;  2CE0 A;  1SQV D;  2ZOO A;  4AAO A;  1M70 A;  2FYN B;  4L3H A;  1F1F A;  5GTI V;  5E79 V;  1I6D A;  1JDL A;  3H1L D;  1QKS A;  1CTZ A;  2HV4 A;  5DFS A;  1FI7 A;  2BCC D;  2V08 A;  4L1Q A;  2XTS B;  1E8E A;  1BGY D;  4JCG A;  3L71 D;  3WFD C;  1HH7 A;  1HRC A;  4FAV A;  2C9X B;  1H31 A;  2GB8 B;  1LMS A;  4P4Q B;  1N9C A;  3L70 D;  3VRD A;  1IQC A;  4WQ8 A;  3H1H D;  1U74 B;  5GTH V;  3DP5 A;  1NU1 D;  1CIH A;  5DJQ B;  1PP9 D;  2D0S A;  1CXC A;  3RN0 A;  3L74 D;  5CYT R;  2DGE A;  3NBT A;  4L3G A;  1H33 A;  1YIQ A;  1CRI A;  1H32 A;  1E29 A;  3WUI A;  5DJQ C;  4WQ7 A;  3SXT A;  3PXW A;  1I8P A;  1FCD C;  3H1I D;  4H0J A;  1C52 A;  1VYD A;  4PWA A;  1AOF A;  3TYI A;  5CIE B;  3RMZ A;  5C0Z A;  1SQQ D;  3NWV A;  5TIS V;  1KYO D;  2ZZS 1;  3RLM A;  3NBS A;  4UB6 V;  3SJL A;  5B5E V;  3HQ9 A;  1HJ5 A;  3DR0 A;  2IBZ D;  2B10 B;  4IL6 V;  2N9J A;  1A8C A;  1RZ6 A;  1DVV A;  2L4D A;  3L4M A;  3SWS A;  1SQB D;  4WQA A;  1HJ3 A;  2B11 B;  3X39 A;  1NIR A;  3WFB C;  3M97 X;  2CXB A;  2PCC B;  1CCH A;  4FA9 A;  3CXH W;  1CIG A;  4EID A;  3SVW A;  3CU4 A;  3O5C A;  5KAI V;  5C9M A;  2N18 B;  1C7M A;  1QL3 A;  3L73 D;  1CYJ A;  3KZI V;  1BCC D;  2MHM A;  4AAL A;  1K3H A;  2C1U A;  1GDV A;  5KAF V;  2FRC A;  4XYD B;  2DVH A;  4WQB A;  5CIC B;  4FA5 A;  1YFC A;  3L4O A;  3H1J D;  2GC4 D;  1M60 A;  1PPJ D;  1LC2 A;  5CIB B;  3VNW A;  4PW9 B;  1U75 B;  1HZV A;  2CA4 B;  1FJ0 A;  2BGV X;  3WC8 A;  1RZ5 A;  2ZBO A;  1COT A;  1HRO A;  1CSW A;  1L9B C;  2BPB B;  2B0Z B;  5EXQ A;  4RSZ A;  2C2C A;  1BL9 A;  3CP5 A;  3MK7 B;  4FAN A;  4GED B;  4WQC A;  451C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...