2BLLA

Apo-structure of the c-terminal decarboxylase domain of arna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
330
Chain Sequence
MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVVEHRKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L- Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PROTEIN YFBG
total genus 128
structure length 330
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2bllA02
3JQFC 1YQGA 3CZMA 1DLIA 1OOEA 1NYTA 4OGWA 2PZJA 2EXXA 1PGJA 4AJNA 2JD2A 1G1AA 5CG1A 5A9TA 5ER9A 1U4OA 4FOOA 3ONFA 2FMUA 4NNJA 4NR0A 1WWKA 4XQCA 5FEUA 2XF8A 4TQGA 4EBFA 1EE9A 5TF4A 5CDGA 4E31A 3WG9A 3B1KA 1F12A 3RASA 3V2HA 1NWHA 3H9EO 5HWSA 3INRA 3DBLB 5L9AA 1SOWA 2NSDA 1EQ2A 5A3JA 5KJCA 2X9NA 4MKZA 2PR2A 4NH4A 1TT5A 1QV6A 1R4MA 2O2YA 3H3FA 1GPJA 1R16A 4IS2A 4CUZA 1NQOA 4C4OA 4XGNA 4U6QA 1H6AA 3ZW8A 5CEEA 3TOZA 3PJEA 4XJTA 1JQBA 2ZYAA 1DO8A 3L07A 4JBIA 3GPDG 1ZUD1 4AJKA 2VCYA 1SO8A 4IJKA 5BSEA 3BMQB 4GWKA 1RM0A 3O8QB 2E6UX 5C5IA 1YL5A 2ZB8A 2P9CA 4B8ZA 2VTDA 3NT4A 3H4VA 3R1IA 3PDUA 1IY8A 3GNSA 4FFRA 1LSOA 1ONOA 4GAEA 1ZEJA 4GX5A 4B7UA 1YL7A 3PQDA 3JD2A 1E1KA 2CDBA 4BMSA 3PFWO 1EQUA 1T26A 3OA0A 2IXBA 4UAGA 3PYLA 3BTVA 4FS3A 4E2YA 3GZNB 1YBVA 2GO1A 4EZBA 1NP3A 4MVJI 5DCWA 1NX6A 1NQAO 4MIOA 4AJ2A 3RROA 3O4RA 5KCZA 1C14A 2X5KO 2PH5A 1P1FA 1V3TA 3KTDA 3WLEA 2OUIA 1HRDA 4W6ZA 3NKLA 1GEEA 3PYXA 1GV1A 2NU7A 2Y93A 4WCDA 3TPCA 1UXGA 5JYDA 2CNBA 2I5PO 4J9UE 4OIMA 4YQYA 3HZZA 2NTVA 3U4DA 4RPKA 3EW7A 3D4OA 1I10A 4NK5A 4R3NA 1E7MA 4ZQBA 3UCFA 3A28A 3X2EA 4BO2A 4PLPA 3F4BA 3QVOA 2O3QA 1GU7A 3ZNOA 2HMVA 2BKAA 4RPHA 3WXBA 3OECA 4GGPA 4P4NA 3G49A 3HJAA 4ALJA 3PHHA 2WD7B 4A27A 5KNLA 4EUEA 2NADA 1AN9A 3OIGA 2Q1WA 2I3GA 3NX4A 3LT4A 2HO5A 3WGQA 3P2YA 5IFLA 4TROA 2FPGA 5I9LA 3W6ZA 4U5QA 1H9BA 3SEFA 4IGEA 3L9WA 4PLFA 4XR9A 5JXWA 2C2XA 4E2WA 3GNQA 2NLOA 1VJTA 2D5CA 5A06A 3BHIA 4XIYA 1HEUA 1M75A 4J91A 4KUEA 3DZFA 4DPKA 3FRJA 1M76A 3GVCA 5DZSA 4BKPA 1K3TA 3M6IA 1P1KA 1U3TA 2P9GA 1PGQA 1ZCJA 2P9EA 4KMSA 3I9MA 1XCBA 2ZQYA 3HADA 5I7EA 4BMVA 1JWBB 4M87A 5L7WA 4EUHA 3SX2A 2PGJA 4NHEA 1HDYA 4DL9A 2DFDA 3DOCA 3KSZO 2PZMA 4L0QA 5G4KB 1B8PA 4YRBA 3F1LA 1Y8QA 3KYCA 3Q2KA 4E5PA 1DDOA 2O2SA 2Q2QA 3RUDA 5I7FA 4LRSB 2DUWA 2PLAA 2RHRA 3QP9A 2B37A 4HV4A 4NK4A 4OH1A 2VHXA 3RUCA 1A7AA 1I32A 5C7OO 1LRKA 4J1QA 5ER6A 1JKJA 5JCJA 2JL1A 3I6QA 3LF2A 3IJPA 5T57A 3UUWA 4XRGA 4DVJA 4CLOB 1LRJA 2Y1DA 4WLFA 5COQA 1UXJA 1FDTA 4XKJA 2WM3A 3ZWXA 5CHEA 2D5AA 2QZ9A 4BB6A 5G0TA 4YT2A 1ISGA 3K2BA 4RVFA 4NBUA 4HXYA 2JAPA 1BXKA 1U3UA 3F4LA 3ROMA 2HDHA 5IN4A 3ICPA 3D0OA 3ETEA 3KV3O 5IDQA 4K26A 1DB3A 2YZ7A 1T2CA 3E18A 1QV7A 3GVXA 5JBIA 3CEAA 1BXGB 4KZPA 4IS3A 3JQ8B 1M2WA 3NYWA 3UKOA 5JW6A 3GG9A 3GK3A 4E12A 3LC1O 1I2ZA 4HNHA 4AJEA 1I8TA 2VHZA 2F00A 3VAZA 4MIEA 4L75A 1O95A 1Y5MA 2FWMX 4EJ0A 2PV7A 4E2XA 2J3IA 4MO2A 4B7XA 4C7KA 3FNFA 2ET6A 4CMIB 2E37A 1NAIA 2QRJA 5JLAA 3UF0A 2JKVA 3TWOA 4AVYA 1PJ3A 2YV2A 4ZHSA 1SEVA 3U9LA 5T64A 1E0DA 1JAXA 4YJDA 2VYVD 3JQEA 1R37A 4BNFA 1XGKA 3VDQA 1B3BA 1L1FA 4Q3DA 1Q0HA 1BHSA 5F5NA 2E4AA 5BNIA 3JSAA 3GMSA 1HE2A 2HKIA 3WBFA 5H82A 5IN5A 4E5NA 2ZB4A 5TT1A 2V65A 3M1AA 1ZK2A 2X6TA 1U3WA 3ZNNA 1A4IA 2H1SA 2DU8A 1DC4A 1E6WA 4HFRA 4RDHA 4KUHA 1XSEA 1PL8A 5AXDA 1HWYA 1LSJA 1R15A 4CV1A 5T8KA 5L53A 1H2HA 3V1YA 2AEMA 3P5SA 1BRMA 4B4VA 5KWEA 1C3VA 5LC1A 4R5MA 5JSFA 3FR7A 5JDCC 4RJTA 4ONEA 4O59O 4CMHA 4G81A 1U4SA 2BFOA 2JFFA 4IMRA 3ANLA 2DTDA 2BI8A 4OSOA 2I3AA 4CLDA 4NFSA 2ZB3A 4FFNA 4YTEA 1U5CA 1NFFA 3KSUA 3W4JA 2GN4A 2NACA 2PY6A 2EW2A 3UHAA 5THQA 1T2EA 5I7SA 4DBZA 3FF4A 2EKQA 5EIOA 1NR1A 3FBTA 1Y5RA 1NHGA 2PGDA 2O3JA 2NVBA 1VC2A 4GBJA 2B36A 4AJHA 3ZZNA 1W4ZA 4RPLA 5IDYA 3MWDB 1ISMA 3FPLA 1PQUA 4JIGA 4O5OA 1HZJA 4FC6A 3NUGA 5JYEA 2ILTA 3BMOB 4YAKA 3UCXA 3Q9NA 4MVJH 1X0VA 5THKA 1X7HA 4QECA 3PEFA 3UFXA 3AU9A 3QA9A 5CDSA 3W8DA 1HDOA 4XDZA 1MG5A 4AJLA 2YJZA 3Q3CA 4HY3A 4Q9NA 3IKTA 3AK4A 1FK8A 1UUFA 4IDGA 3MJSA 3PPIA 1N1GA 4CM9D 3ZHXA 1LTHR 2XOXA 4TRNA 3IP1A 3TF5A 2G0TA 4CMEA 3GPIA 1PJBA 3RKRA 2LDBA 2EJVA 2Q45A 4Q3AA 3ZU3A 5AXCA 3U4IA 5A3VA 5DF1A 2HMWA 4W7IA 1PX0A 1E5QA 1UP4A 5B4TA 4CQMB 4OL9A 1HE5A 4RPGA 3TZKA 5A4DA 4YAJA 1LJ8A 5IZ4A 2Q1TA 4GKVA 4OO3A 1YBAA 3O8QA 2QYSA 1E6EA 3M2PA 2G17A 1EDZA 3VDRA 3KB6A 4GX2A 4JXKA 4YXFA 3VPFA 3AUSA 3PHGA 4I5FA 4NBTA 4FB5A 2I76A 2YW9A 1N9GA 1UDCA 2DLDA 3VH3A 4YJFA 2AE1A 3U5TA 3SLKA 3DXFA 4PZEA 5DOZA 3IDSA 2PD4A 4PG6A 3H2ZA 1FDWA 2GD1O 5C3MA 5KJ1A 3CPSA 1FJHA 2VZ0A 2VUUA 2O7SA 1ENYA 3TFOA 3BZUA 3W8FA 2W2LD 2Y1EA 4IY1A 2CVZA 4AJ4A 3GHYA 3DZKA 4M49A 4AJPA 1SAYA 1Z73A 4NG5A 4UVIA 3WGZA 3TJRA 1R12A 4CL3A 1YKFA 1DLJA 4R1UA 5AXBA 3RFXA 4CL8A 4D45A 1NFQA 3UICA 4PG8A 1ZVMA 1OFGA 3WR5A 2X0JA 2OO5A 3HQ4O 2FSSA 1KIFA 1D1SA 3ON5A 4XYBA 1YBMA 4ZRMA 2ZTUA 3NAQA 3FWNA 1NASA 2GRAA 4R9RA 1V8BA 1WDLA 1B8UA 1IYZA 2Y05A 1PEDA 1N5DA 3G0OA 5G0SA 2DT5A 5BNTA 3DTYA 1HDGO 3NJ4A 4ROSA 1OBFO 1PJ4A 3ENKA 3H8VA 3K2EA 3ZWAA 3RBVA 4J49A 3VPGA 3WQSB 5BSGA 4DTIA 1GDHA 2WTBA 1O0SA 2DTXA 3E5RA 4L4SA 3P7MA 1XR3A 4IIUA 2XPCA 3GMDA 3U4CA 3PTZA 3ITDA 4IZHA 2Q4EA 1PGPA 4HBGA 1O89A 4FJ2A 2W2KA 4JX8A 2PD3A 4YT8A 4I08A 1SOVA 4FOSA 4IDDA 4PLTA 2WE8A 1UXIA 3Q0EA 3EK2A 4WLEA 1LNQA 4OYRA 1I2CA 4BO8A 1LA2A 3GFBA 4DQUA 3KYDB 3DZBA 1H0KA 1IL0A 1Z45A 2DAPA 3H5AA 2VNAA 2PH3A 2GNAA 1B7GO 2I99A 4U6SA 2O48X 3M1LA 5G4KA 4F45A 4FR5A 5GMOA 3T4XA 5A9SA 2D2IA 2FPPA 4X54A 2BGMA 1N1EA 4QO7A 4J7XA 3U3XA 5TS3A 1DIHA 1DEHA 4TVOA 4CQLA 4Z9XA 1SC6A 3H6KA 4W7HA 4E21A 4BKUA 2PA3A 2HK7A 2AE2A 4BO7A 4LVUA 1BMDA 3AOEC 5KVSA 2HQ1A 3DMTA 4DLAA 3QRWA 1LDNA 5IF3A 2WEKA 4P38A 2JCYA 4IMPA 2TMDA 4KWIA 3QWAA 4F6LA 4OXYA 3RQSA 4EEXA 4FDAA 2VUSA 3NT5A 3N58A 1PS8A 4L4RA 4YCAA 5HA5A 2LDXA 3A06A 4D46A 4FPXA 3ZU2A 2DC1A 2FSVA 3JV7A 3WTCA 3ZCXA 5JS6A 1GAEO 5EERA 2UYYA 2HSDA 2VRCA 4BNNA 3GN2A 4FIZA 3AFMA 1LSSA 3G1UA 3ZHBA 3WICA 4D0SA 1E3IA 5KJEA 3UCEA 4J1SA 3EZYA 4M86A 4R68A 1K89A 2H63A 3GDGA 4TWRA 4CV0A 5JDIA 3NTQA 2H6EA 2B35A 4H3VA 4CMIA 2ZK7A 5ICSA 4AJ1A 1AHHA 1Q7CA 1VKNA 4O63O 3HDQA 3LVFO 4W4TA 3FPCA 3KZVA 4W9NC 4WEOA 2YQ5A 4FBGA 4OKNA 3QIVA 3MOGA 3TL3A 2EP5A 1PZHA 3TN7A 1DIBA 4YEDA 3ZU4A 5FYDA 3V2GA 1E1MA 5J23A 1IUKA 1SB9A 5T8KC 3KO8A 3ETDA 2UV8A 4WLVA 1KEPA 2VTEA 2AQIA 4ALMA 1XYGA 1BTOA 1JKIA 3ROKA 2C29D 3ICCA 3P19A 2QZZA 1XKQA 3LLVA 3PLRA 1U7TA 1T2AA 3NT2A 3QW2A 4L76A 4XB1A 3WMXA 3EZLA 2JFHA 3MWEB 3MTJA 4J0EA 4BGEA 1ISFA 4WECA 1QLJA 4J1NA 5JE8A 4J16A 4Q39A 4JQCA 2V7PA 2GUGA 3VPHA 2J6IA 2Y66A 4FQ8A 1E7RA 5U4QA 1ORRA 3TNLA 4M89A 3AUUA 1BDBA 1UZNA 1MGOA 2HRZA 4PVCA 2CF6A 1E3JA 3ZHZA 2IEBA 1FDUA 2EV9A 3QVTA 3JYLA 1I3MA 3AUAA 3OJFA 3AI2A 5A05A 1F06A 3NRCA 3ZW9A 3NEPX 4CMCA 4C7JA 1DIGA 3O9ZA 3SVTA 3DMYA 4WOJA 3COSA 1V3VA 4MIYA 4K6CA 3I4FA 1PQWA 4PG5A 4Z9FA 2GLXA 1GUZA 1WNTA 3TL2A 4CM1A 5BR7A 1P31A 2VYVA 3HNPA 3WDSA 4YJGB 3VZQA 3MJTA 1GZ3A 2HLPA 3E5MA 3OIDA 4FFLA 4YB8A 2D0IA 1SEPA 4EJ6A 2GDZA 1I3NA 3H5NA 1HDCA 4Y9DA 3OJEA 3FCOA 1Y9AA 1E6UA 1E3WB 4F3YA 3OIFA 4ZQHA 4XA8A 3HDHA 3HN7A 4GKBA 1UJMA 3H2SA 4MVJD 4ZU3A 1CETA 3UVEA 4CM6A 1Z7EA 1DC3A 4ESOA 1KEVA 1PR3A 2UUPA 1YQDA 3R0IA 4GLLA 1I5RA 2YV1A 1PZGA 4LMRA 5DOVA 1I30A 1KYQA 3WQRA 4YYZA 3RJ9A 1C0IA 1NTOA 4IIVA 4H15A 1DJQA 3RU9A 2PWZA 4PLCA 4BKQA 3PZRA 5IAAA 1EEHA 4E2ZA 2EW8A 5HBRA 2IEDA 1QORA 1QYCA 4O6VA 3WQQA 3M2TA 3KYCB 1YJ8A 2BLLA 4ZRNA 4HFMA 2AEFA 2OFPA 1HSOA 3UOGA 3TDKA 2Y68A 3IMFA 4PLWA 1YGYA 3B6ZA 3VZRA 3W8EA 1MXFA 3S2GA 1HZZA 3ZV5A 4NJMA 3RWBA 4CUKA 3JYOA 3RC1A 1PJLA 5TLSA 3SC4A 5COBA 5L95A 1H9AA 4CMGA 4BV8A 4KDFA 4FFOA 4UEOA 5IJZA 1ZZEA 4JLWA 1PGOA 3K6JA 2YFQA 2DPHA 3BAZA 4YT4A 4BNGA 4D3DA 3H3JA 1BXGA 1BG6A 5I8WA 1SB8A 1H6BA 1P1RA 2YHIB 1Y8RA 2P68A 2Y1GA 1L7DA 2B69A 3AY3A 4BO0A 4IQGA 2B4QA 5BSHA 5KVVA 4WLOA 2IZ0A 4RF5A 1N7GA 3GUCA 3L0DA 2YUTA 4AJOA 3GGGA 4DLBA 3QVXA 4RV9A 4UUOA 2Q1SA 1JAYA 4RVGA 4U8GA 2O4CA 2ZJ1A 4KUGA 5EPOA 1T4DA 4IGFA 2NVUB 5TC4A 1GPDG 3OQ1A 4NJOA 3F1KA 2P91A 4BS9A 1XDWA 4L73A 3WYCA 2NU8A 1CIVA 1YONA 1HYGA 4UREA 2GZ2A 2GSDA 3GC6A 3IKVA 1NQ5A 4MKRA 4ZQGA 4J4BA 4K6FA 5IZCC 2DBVO 3GOHA 1NHWA 1UR5A 2ZIZA 4M55A 1U7HA 5K0ZA 4BOYA 4B3HA 5EL0A 4K9DA 1HT0A 2HAEA 2JFGA 3LK7A 5FI5A 1PJTA 1IOLA 4IQ0A 1PWZA 2B83A 1JWAB 1B14A 5F5LA 2FY8A 4TRJA 3UGKA 4PN3A 3DHEA 3L9XA 5CDUA 1Y1PA 5C37A 3RCBA 2VUTA 1IE3A 4FFMA 4KTVE 3ROQA 3HDYA 3JQGA 4WCFA 4I5DA 4L74A 1T25A 2G1UA 1YWGO 2ZCUA 3WIDA 5EN4A 1RM4A 4H16A 2EGGA 2X23A 4FJ0A 2Y1OA 3RUAA 2OP0A 1AHIA 3QE3A 4B4WA 4G65A 2AHRA 5AOVA 2P4QA 3K30A 3GZ4A 4S3MA 4ND5A 1KERA 4UEKA 1N92A 2VT2A 1PGNA 1GQYA 1Q7GA 3K92A 3T4EA 3WGOA 5I9MA 2Z1NA 5A9SB 3RFVA 3JYQA 4IXTA 1UP6A 1NWCA 3A14A 3LC2O 4O0LA 4BMNA 4YJHA 5A5EA 3K8ZA 3MTGA 4FGWA 2CY0A 3D7LA 4HFJA 2JD1A 4BNLA 3F5QA 3I1JA 1ENZA 4J2OA 3VZSA 2GYYA 1HF3A 3ASUA 5MDHA 1I24A 4DYVA 5TJ9A 4FSHA 4OXNA 2OGUA 1N8KA 3CIFA 4E5KA 2R00C 2B5VA 3E48A 1AUPA 1R0SA 4NPCA 1RKXA 3WGHA 4YA6A 1W6UA 2X8LA 1K0UA 4RPJA 2OBNA 5COAA 1B15A 4AICA 1TXGA 2GPTA 3DR3A 3E6AA 4N5LA 4YAIA 3EVNA 2NUAA 3MJCA 2GASA 2B0JA 4J4HA 3HHPA 2I6TA 1IULA 4PGFA 1KY5A 2IE0A 5KTKA 2RHCA 1ZEMA 2W90A 4CQMD 3L4BC 1V9LA 1X1TA 2CSUA 2V6BA 3G3EA 1MG0A 1H5QA 2DPGA 1ZK1A 2UUOA 3HWRA 2AG8A 4XB2A 5U1PA 3VKUA 2VT3A 3CUKA 4CQMA 4GX0A 4GI2A 3QJ5A 2O3UA 5L7TA 5GZ3A 1GL3A 3G17A 1F14A 2UDPA 4WCFC 4II3A 4E5YA 3ZWCA 2Y0EA 3LLSA 4FFPA 4J2HA 1EVIA 3R6DA 3FBGA 4ND3A 1MLDA 3IS3A 1BW9B 2X9GA 1N9GB 3KLMX 4MKXA 2CVQA 3BMNA 4GPD1 1ZW1A 4P22A 5EINA 3JQBC 4YAEA 1RM5A 1CWUA 3VC7A 1SNYA 5JC8A 3DEYX 4LMPA 3C1TA 2YV3A 1WDMA 4XYGA 4IDBA 2IRWA 1TI7A 4DC1A 1NPYA 1E3SA 4TZKA 4IZIA 4JNKA 2OOSA 2X4GA 3CSDA 3ASVA 2BGKA 5F1OA 3ZN2A 5KOIA 8LDHA 2VQ3A 4JJIA 5IXYA 1ENPA 1SZJG 1TT7A 1YOVB 3DBHA 3NV9A 5T6BA 3UXYA 4BNKA 4YAGA 1PU2A 3RC7A 3DAFA 3DBLA 4IUYA 5DBGA 1VPDA 4OJNA 3S2FA 1ISIA 4B79A 3JD0A 2HUNA 4A7PA 4UVDA 1TT5B 1GQ2A 1YRLA 1ZK3A 3DBRB 2I65A 4PCVA 2HJRA 3QLJA 2VNSA 3MCVA 2ZTVA 2Y1CA 2GERA 1LLCA 3PJFA 4MVJE 2O3SA 3TZ6A 3D3WB 3SJUA 4YR9A 5JC1A 5CDYA 1GYQA 3BTOA 2OHXA 1WZIA 2WJPA 3G79A 3AI1A 5C7LO 2AQHA 2Y99A 1V35A 3BMQA 5T67A 4R51A 5C7IO 5ILGA 3ZWBA 1ONPA 4RORA 1P1JA 1U3VA 2P5YA 4MPDA 3OHSX 1EFLA 1Q7BA 3WOHA 2X0RA 4BVAA 1M6WA 8ADHA 4DPLA 1PS9A 4YWJA 4P8RA 3PGXA 1GQQA 3E9NA 1R4MB 1D8AA 2OMEA 2Q49A 2WYWA 3GRPA 2VOEA 2B4RO 5HRUA 2PNFA 3U0BA 4IINA 3GZNA 1PIWA 1A4UA 1U8FO 4UVGA 5G0VA 4B3JA 2BFPA 2NVWA 3KYDA 3R3SA 4Q3CA 5B1YA 1GCUA 4YDRA 1U5AA 2BF7A 1P44A 4J3FA 6ADHA 3A9WA 4WUVA 2VHYA 3K5PA 4EITA 4E0BA 3DFZA 5B4VA 1P77A 1EMDA 3ETGA 3D4NA 3GEMA 3OJ0A 4A73A 4BUCA 1C0PA 3EVTA 3OEYA 5L40A 4YT5A 1ADGA 2BD0A 2FR8A 4BNYA 4EW6A 5AVOA 2G82A 1EVZA 1HLDA 1BWSA 4KP7A 4WLUA 5KVCA 1LUAA 5L7YA 2YQ4A 4NJMB 3H5RA 4CLRA 2B5WA 3VKVA 1HYEA 5JMPA 4JP3A 1UDAA 4NMHA 1V3UA 1VJ0A 1FDVA 1R66A 5DP1A 3PHIA 5IXSA 3SJ7A 1JW9B 4ZJUA 4LCJA 2OXIA 3L77A 1KY4A 4MVJG 4DMMA 1LX6A 5AQ1A 3K31A 2V6MA 2P2SA 3W4IA 2O7QA 4Q3NA 4TKLA 3FTPA 2R6JA 4RVSA 3ZGYA 1NNUA 3OSUA 5A02A 2QG4A 5BSFA 1XQ6A 1MUUA 3ITKA 4QQRA 3NDIA 3PGJA 4RDIA 1XELA 4YRDA 1H94A 4J7UA 3AOEA 2IYOA 5CP8A 4XR4A 2BHLA 3BMCA 4E32A 3JQAA 4OOFA 3I83A 1LQUA 2WD7A 2Q46A 1ZSYA 4E13A 4KQXA 5KKAA 5JPIA 3DB2A 4CM4A 2J3JA 4WK6A 2XXBA 2GN8A 5KVQA 1NR7A 4QTZA 4NQZA 4JJFA 3PFFA 5ITWA 1PL6A 3DTTA 4J7CA 3HB4X 3WGGA 4ZICA 3STHA 3U49A 1EVYA 3OQ6A 1MX3A 1P1IA 3AUTA 1GZ4A 3IQDB 2EP7A 1ISHA 1JVBA 3ZWNA 1N7HA 4D42A 1B3RA 5B4UA 4TRRA 4K1LA 4WPGA 3LT2A 3ENNA 5L4NA 1PWXA 3I52A 1I3LA 2W98A 4E30A 1KS9A 3D64A 1AGNA 3K73O 1H6DA 3LT0A 4J90A 5DP2A 1X0XA 1LI4A 4KWHA 3S8MA 4AG3A 5DNAA 1PSDA 2ZTLA 2ZYGA 4YVFA 3WBBA 4QEDA 5ILOA 4DWVA 3CE6A 1VRWA 1J5PA 9LDTA 5BT9A 4CLHA 3RD5A 4D44A 4D3SA 1BSVA 2NTNA 2PKRA 4D7AA 1YVEI 2Y67A 1CYDA 3DZIA 1GADO 1NFRA 1DAPA 4I8XA 1JU9A 4INAA 4NDNE 3W6UA 4HFNA 3DOJA 3JQ7A 2DUUA 4B4OA 2V6GA 2XAAA 3DC2A 4J43A 1EZ4A 3KRTA 1EK6A 3PVZA 4RF4A 4CLOA 1CDOA 2DBZA 2Y0DA 4JN6B 3VH1A 4DREA 3S55A 1PQPA 3TSCA 3U09A 2X5OA 4OSPA 4XQEA 1QG6A 1DIAA 4XWYA 3GUYA 3WJ7A 1WMAA 3ST7A 4J9VA 2UVDA 4IXWA 1HSZA 1T2DA 4IJWA 4XIJA 5EQFA 2DBRA 4W9NA 1X7DA 1XQ1A 3KBOA 1A7KA 1E3LA 3AFNA 1WDKA 2EWMA 2VWGA 4R41A 3JYPA 4LSWA 3OH8A 4M54A 1P1HA 3ANNA 4MP3A 1T2FA 3H7AA 5JDIC 5IDXA 3LT1A 3OBBA 4CLXA 3PQEA 4CJXA 1GFSA 2VHVA 4EUFA 3PWZA 4FW8A 3PIDA 4CM3A 5F1PA 3GG2A 3I9JA 4R69A 1OI7A 4CM8A 3EY4A 1XU7A 3BYZA 2AXQA 2EHDA 3JCZA 4LVCA 3DBVO 1QYXA 4QFDA 2CD9A 4NBWA 5CG2A 3L6OO 4O1MA 3SC6A 2FHSA 4MVJF 2R00A 1ARZA 1RYEA 1ZJYA 1U28A 1I36A 5CPBA 3I4CA 1KEWA 4J6FA 1LQTA 2PTGA 3N74A 4IDAA 4XYEA 5DN9A 3QQPA 1B0AA 3GF4A 3VTZA 1A71A 4Q3BA 4A10A 1E5LA 2C54A 4UEJA 5TIIA 1WP4A 1JDJA 1PJQA 3ADOA 4OXKA 1QYWA 3Q2IA 2FRDA 2ZQZA 4IJVA 1OAAA 5JCJD 1K5HA 1X15A 2Q2VA 4R9SA 4Z3DA 4I5GA 2C7GA 3ZV3A 1BW9A 2I66A 3AM3A 4CMEC 2NWQA 2QHXA 4RO0A 1UP7A 1HE4A 3WYBA 2E48A 3JQBA 3VTFA 3RSHA 2RIRA 4GVXA 1HDXA 1Z74A 2QRLA 4GLOA 4A03A 4YPOA 4PRLA 1AE1A 4DUPA 2Q99A 3ROPA 4A26A 3AM4A 2AQ8A 2JCVA 5TRTA 2QQ5A 3LQFA 4Y6RA 2IYPA 4TVBA 3I9LA 1IZ9A 1E7WA 3EC7A 4BNMA 2D1YA 1MC5A 4CMAA 2YHIA 3OETA 4CR7A 2RBEA 4IDFA 2J3KA 4J4TA 5EJ2A 4OQZA 3SLGA 3DZHA 2WYUA 3INGA 3V2UA 1EE2A 1G6KA 2EF1A 3RBXA 1EBFA 1YOVA 2VWQA 4LISA 2VWPA 1K2WA 3L4BA 5I7VA 2I9PA 2SCUA 4LCEA 3ZV4A 5HTOA 3B1FA 3DWFA 4QFCA 2X9VA 2NQ8A 5JAQA 3E9QA 1T4BA 3VVCA 4WKGA 5ES3A 1DBVO 2PK3A 3D3WA 3WFJA 2D8AA 2OZPA 1WMBA 2CMDA 3DZJA 4D0RA 1ZFNA 1P74A 1WAMA 1NPTO 4QO8A 1LC3A 1KVRA 1CQIA 1CJCA 1FXSA 1VSVA 4DQXA 3O03A 2Z1MA 3IJRA 2D3TA 3MZ0A 3WMWA 3NTOA 2GZ1A 1NPDA 3K96A 1P45A 1CEQA 1QR6A 1PZFA 2JHFA 3RC9A 1DHTA 4NU6A 1GEGA 3Q11A 4CM7A 3C1OA 3D4PA 5H81A 4CUJA 3AW9A 1JVSA 3MOIA 4QT0A 1HYHA 4UUNA 1XA0A 5JO9A 2P4HX 3DOOA 3IAHA 3JQ9A 1UXHA 1DFGA 4ALNA 3ZWMA 3TRIA 4TRMA 2Z5LA 1IZ0A 1C1XA 1GCOA 3AM5A 3NJ8A 4RZIA 2FR1A 4BNZA 4CM5A 1WXDA 3FTNA 3LZ6A 1MB4A 1VL6A 4HX5A 1LDEA 3JQ8A 4GGOA 2DBQA 5AYVA 3FWZA 3PRJA 3I6IA 1G0NA 2J5QA 4R16A 1ZMOA 3KUXA 2R2GA 5TNXA 2HU2A 3LDHA 1DOHA 3HUDA 3KOUA 4LW8A 5F3RA 4M1QA 1Q2XA 1G0OA 4EYEA 3MJVA 1CERA 2D59A 2VRCD 4YQZA 4WNIA 1U2DA 2W2LA 3JQ6A 5TJHA 5L51A 3JQFA 4ALKA 3DO5A 4CLRB 3QVSA 4R4JA 5U9CA 3WGYA 3KEQA 1NXQA 4RQUA 3RUFA 5IZCA 1PJCA 4R1NA 3ZU5A 4Z0PA 4BGVA 3GA0A 4BO3A 4CV3A 4N54A 3UH1A 3OMLA 2J8ZA 3D5QA 2CDAA 2YYYA 4PLVA 3H9QA 4RLHA 3VZPA 3BMCB 1O5IA 4KOAA 5GY7A 5JCXA 3H65A 4FGSA 2AW5A 1XU9A 5K6AC 5KJFA 1GR0A 4GX1A 2ZKLA 3K9QO 4ND1A 4UUMA 2X22A 3KVOA 4R1SA 4G5HA 1J4AA 3FNHA 4A0SA 4Q3EA 4I9NA 1TEHA 1XIVA 3VVBA 4DIFA 5JAZA 5CFZA 3IL2A 4JBHA 4CM9A 2AQKA 5B37A 1XWFA 3F6YA 3TZHA 1LXCA 2PFGA 1Y81A 3ZWWA 5L3ZA 4H7PA 1ZSNA 1GV0A 4D79A 3NGLA 4RLSA 4DYDA 1F8FA 1E7SA 3GDFA 4ZQFA 3PIIA 2EKLA 1N2SA 1TLTA 4R01A 5TT0A 4E5MA 4ND4A 1EK5A 2NQTA 2W2KB 1UAGA 1P33A 2JHGA 4R3WA 4WJZA 2C20A 2DFVA 3E9MA 4FC7A 1H6CA 4BKRA 3CMCO 5L4SA 2A35A 3CZRA 3NTRA 1HE3A 3BHMA 1LBEA 3GN1A 4MOWA 4JROA 4CMBA 2D4AA 2ZCVA 3KSDO 3RKUA 3L4SO 1ZJZA 4GSKA 3QSGA 3TFQA 3WNQA 1F17A 2Q4BA 2NTJA 3F3SA 1IPEA 1H93A 2RH4A 4XDYA 5DBFA 2CZCA 1ADCA 2E82A 1C1DA 2HK9A 5BNFA 4R5HA 2VZ8A 1LLDA 2FN7A 3TQHA 3RAJA 1YDEA 2DKNA 3ZV6A 1PS0A 1OC2A 2FZWA 3F5SA 4E4YA 2O3TA 4ZN6A 4MP8A 1Q0QA 3OF2A 3JQ7B 4Z3KA 3JQDA 4E6PA 4DIOA 3CH6A 1W73A 3DBRA 5JY6A 4IM7A 2X5JO 3LU1A 2UAGA 3OP4A 3KETA 1IHXA 4L4XA 3Q1LA 1YL6A 4EI2A 3U4HA 4BQRA 1PTJA 2EERA 4OKIA 2IODA 1RPNA 1ADFA 4R1TA 5JAIA 3S2IA 3ZWOA 4WE3A 3GFGA 4OM8A 5G2OA 1XLTA 2EJWA 4UUPA 1SPXA 1JA9A 3OJOA 3VH4A 3FHLA 3WSWA 5FWNA 4L8VA 3FD8A 1E92A 4XX0A 4D3FA 3V8BA 1HL3A 2WMDA 1YH3A 3JQAD 3D5TA 1ML3A 5B12A 4DIBA 4PFJA 1QLHA 1KC1A 4GSLA 4CV2A 3GEGA 1YXMA 1VKOA 1Z7BA 1NAHA 3ZI0A 1MV8A 1C0LA 5IG2A 1WVGA 1KVTA 3KHUA 5TQVA 1H2BA 3QWBA 2X58A 3B1JA 3WYEA 5HM8A 4NU5A 3GLQA 3H9JA 3QY9A 3GGPA 4RZHA 1DRWA 3PK0A 1DIRA 1QMGA 1A9ZA 3GEDA 4BL5A 1J0XO 5L4LA 1EUDA 5GZ6A 4LN1A 4BO5A 4DPMA 4PG7A 1I3KA 5DULA 2W8ZA 1DFIA 4N5MA 4W99A 1E3EA 5JFOA 4EDFA 1QP8A 1MFZA 1ZO8A 4PLGA 4JP2A 4GQAA 1HETA 4BNTA 3C8MA 1OMOA 2BGLA 1AXEA 1O6ZA 4RVUA 1F8GA 2NM0A 4YJFB 5TX7A 4GMGA 5LCXA 5H83A 2Z95A 2A4KA 3AJRA 3HFSA 2B4TO 3MJEA 1ZMTA 4IBOA 3OM9A 4EEZA 2PZLA 1LC0A 4XYLA 3BXXA 1JKFA 1UH5A 1SBYA 4Z6KA 1ZSVA 2H9IA 2GF2A 3HG7A 3OA2A 2HMUA 2YFHA 5JO0A 1WZEA 3QV1A 1GY8A 1QYVA 4CR6A 2PGLA 4QSMA 1EDOA 3PHJA 4P4GA 4U0JA 1J49A 5FF9A 1GUFA 4AJIA 4MINA 1K6JA 4IDEA 1CRWG 4U0KA 2A94A 4Z9YA 3PLNA 2V6FA 4XGIA 2Q2WA 2O23A 3DZGA 2BFMA 2Q3EA 1ADBA 4P4LA 1D4FA 4MJLA 1XHLA 3O38A 3FNGA 2X0IA 4QXMA 4RL6A 1PZEA 2J5RA 3AY6A 3KLPX 1U9JA 1XG5A 3LYLA 4D41A 4IPTA 1XEAA 3NGXA 2WD8A 2PKQO 4BO1A 4OQYA 2HMSA 5IDWA 4N18A 1R4NB 4TSKA 1I2BA 3BTUA 5DDIP 1A9YA 1LDYA 1LDGA 1R0LA 2YDXA 4KQWA 4DQVA 4B8WA 1YE3A 4BNUA 2GGSA 1VLLA 5A5FA 1DXYA 3JQ9C 5EMHA 5ENVA 4II2A 4WOKA 5G0UA 3AWDA 1VI2A 3DONA 4EJMA 4ZQEA 2PKQP 4PIVA 3ZHYA 3UN1A 4HUJA 1NM5A 4MDHA 2GN6A 2F1KA 3IIEA 3EYWA 3KYBA 2JJYA 3ANMA 1ZK4A 2CVOA 2NU6A 3EGOA 3IUSA 3VHRA 1A27A 3T7CA 4K28A 3IUPA 2DQ4A 4A5OA 5KKCA 1U8XX 1R0KA 3W1VA 4LRTB 4XEHA 4XGKA 1A5ZA 5F21A 3F9IA 1L7EA 1MP0A 3GVHA 4EGFA 1BXZA 4URFA 3V5NA 1YB1A 4E3ZA 1ZXBA 7ADHA 1C1XB 1C0KA 4ALLA 1ULSA 1VSUA 3RJ5A 4BGIA 3BTSA 4TZTA 1ZH8A 2W4QA 4HP8A 3DHNA 4Y98A 3FR8A 1EUCA 4BO9A 5GZ1A 4FN4A 4CQLB 1E7QA 1Y7TA 3JD3A 5CEFA 1E77A 1BVRA 3RU7A 1ENOA 1ZIDA 1UXKA 4BQPA 2VWHA 1E1NA 2NVUA 4BNXA 4B3IA 3BIOA 1D7OA 4JK3A 5HS6A 4NFYA 1D1TA 2Q1UA 3ZNQA 3WNVA 5DT9A 1KBZA 1ZK0A 3WGIA 3Q9UA 2J3HA 1P3DA 1WPQA 3C7AA 3F47A 3G1TA 1T1SA 2O3RA 4R54A 4WEQA 3RI3A 4I9HA 1QSGA 1TVEA 1NVMB 2EEZA 1PJSA 4N7RA 2JCXA 1NQTA 2WWRA 4NZ9A 3H9UA 3HB5X 2VYND 2X0NA 4XZ3A 1MXHA 4GL4A 4IDCA 4GWGA 3PQFA 3WLFA 4F6CA 4CM8B 1NVGA 3HE3A 3HSKA 1U2GA 1OZAA 5A04A 4WCFB 1DC5A 4GVLA 3GAFA 5CPFA 3L6EA 1EFKA 4M8SA 4MVJP 5ICMA 2Q50A 4NBVA 1E7YA 4ILKA 5DBIA 1HDZA 3CKYA 5A1TA 4ZVVA 4I9UA 2A92A 1Z75A 2DTEA 1KVUA 1Y8QB 3LF1A 2IDZA 5JMWA 2ZB7A 3GQVA 3AI3A 1GUYA 1LLQA 1VL8A 1DRUA 2VN8A 3KEOA 1ULUA 3I9NA 4GH5A 4HNGA 1ZBQA 4J1TA 1JLLA 4PLHA 4DA9A 3Q6IA 3PWSA 2FPIA 1YB5A 1B16A 4BNWA 5LDHA 3AU8A 2BH9A 3HFGA 1LEHA 4Y6SA 3D1LA 3JQGB 4PLYA 1RM3A 3E1KA 1ZKMA 4TMFA 3RVDA 3ZNPA 5TSDA 1ONNA 3WTBA 4PZDA 2O4UX 2RCYA 1NBOA 3FI9A 3NDJA 3S1LA 5MGBA 1PJ2A 1P0FA 4FJ1A 3RUHA 5JAMA 4WLNA 3PJDA 4G2NA 4Y8VA 4A2CA 3BHJA 2NV6A 4BNHA 4ID9A 1KC3A 1IPFA 3S2EA 3GVIA 2VHWA 4PZCA 3DHYA 4B7CA 3CXRA 1KVSA 2OL4A 3DMTC 3X2FA 2DVMA 3CMMA 4XYMA 4OOEA 3PJGA 3I23A 3CINA 3A1NA 3WFIA 3E8XA 2VYNA 1PR9A 2P5UA 3OFSA 5BQFA 1C1DB 1FF9A 3ZWPA 3FSRA 4NI5A 4RQTA 1CQJA 4OMUA 1JN0A 4LK3A 4D43A 3QWHA 2FR0A 1O8CA 2QIOA 2QRKA 4NBRA 5KIAA 3UAGA 5CAEA 5ENDA 2HRBA 4BGUA 3JD1A 2TMGA 1I33A 1B2LA 3C24A 1LSUA 4YJGA 3E82A 1P9LA 3GHHA 4Y6PA 4TKMA 5EQDA 3WX0A 1Z6ZA 4DLLA 3FN4A 4ALIA 1S7CA 4F46A 3VPSA 3WWZA 3GRKA 3RUEA 3TOXA 3I9OA 1LDBA 2FP4A 3GNTA 2X7HA 3WS7A 2QX7A 3U62A 2GN9A 3NDRA 4YACA 4RVDA 1E3WA 1AXGA 4JBGA 3WJAA 1VM6A 2QYTA 3I3OA 3QWIA 1Q0LA 1NVTA 1X13A 4J0FA 5DCYA 1JTVA 3RFTA 4XRRA 2YHUA 2BFAA 4U7WA 3INTA 1LLUA 3BA1A 3PDJA 2O50A 1X14A 3VOSA 2CDCA 2WSBA 3JYNA 2EGHA 3BMNB 3DQPA 3B20A 3R3JA 4W82A 3VPXA 1KETA 5FFFA 4MVJM 3ZWVA 1HXHA 4Y67A 3B70A 1YB4A 3WB9A 3H9GA 3JD4A 4UULA 5FI3A 1EVJA 2IZZA 2IXAA 3C1AA 2YDYA 4BNVA 4FCCA 2POQX 1Y8RB 3DDNA 3T7EA 1VL0A 4JGBA 5A9RA 1Y9EA 1DC6A 4RVHA 4CMJA 4RF2A 5JNLA 2QW8A 2G5CA 1CF2O 1DAOA 1SCUA 3QVWA 1HKUA 1FMCA 2Y1FA 4KDEA 4S1VA 4XJSA 1I01A 3WIEA 1UZLA 1FDSA 2G76A 1IB6A 4BB5A 4E33A 2NU9A 1IHYA 3AOGA 3I5MA 3ADPA 3GY0A 3WSVA 4DRYA 4YRAA 3PHLA 3N7UA 4L9RA 3RUIA 4Z0TA 3C7CB 3IP3A 1VJ1A 5CEJA 2BRUA 1S6YA 2HK8A 2HJSA 4XQGA 3GDOA 4KTTE 3OJLA 3ZH2A 1HLPA 3HDJA 3DFUA 3GT0A 3ONDA 3SXPA 3GR6A 2H5LA 4LGVA 4QUKA 3V1UA 5AXAA 5T5QA 3O26A 3SBOA 3BMOA 1I0ZA 1P0CA 4HADA 1Z82A 1E1LA 1V0JA 1M67A 2CUKA 4IQ8A 2BELA 1RJWA 3OQBA 4BO6A 2OBYA 1D3AA 3EHEA 2NNLD 4LSMA 2WYVA 1RYDA 4CR8A 3A4VA 2FOIA 4MVJA 4ZD6A 1YO6A 1KEUA 1LRLA 2CFCA 4RGBA 4B4UA 3PP8A 1EBUA 3I9KA 5ITVA 1VE9A 2VRBA 1LU9A 1UDBA 1U1IA 5ADHA 4GMFA 7MDHA 1GYPA 1R4NA 1O94A 1MFPA 2I67A 2OORA 1K6XA 3ABIA 5JY1A 4QX6A 1YDWA 3DL2A 5DCUA 3RBZA 1EUZA 5TGDA 2X1HA 2WDZA 3PWKA 1QYDA 3RIHA 2JD0A 2AMFA 4DXHA 1GTMA 3DAPA 4WNCA 4Z0HO 1J6UA 3GGOA 3C85A 2IZ1A 2PZKA 5CDTA 2EG9A 3RC2A 3EUWA 1DFHA 4ND2A 5L45A 3AY7A 4I1IA 4MP6A 1R6DA 2BI7A 3P2OA 2ZATA 4YJHB 4CLEA 1V6AA 1KVQA 2A9FA 4RCVA 3JQCA 1QRRA 4HKTA 3MJ4A 3GAZA 4XQ9A 3V1TC 2HMTA 4OHUA 1SMKA 1ISJA 4AL4A 3ORFA 1GYRA 1PL7A 3TZCA 2J5KA 2C0CA 4HWKA 1B26A 2C5EA 1DRVA 4FD3A 4YBZA 3LSYA 2BMAA 1MC4A 3MEQA 4PG4A 3KM0A 2C2YA 2CF5A 2C07A 3IOYA 1DHRA 5HS4A 3GH3A 1DSSG 3ZWYA 3EMKA 3C3XA 2AG5A 1UZMA 2PD6A 2C59A 3PZBA 1WW8A 2GR9A 4NIMA 5G4LA 4BV9A 5I8ZA 2C82A 2WE7A 2VZ9A 1MA0A 5A03A 1QKIA 1BGVA 1X7GA 3OEWA 4CMKA 1RWBA 4DMLA 3FNEA 1Q1NA 3WGTA 3CTMA 5KJ6A 4RF3A 4BNJA 1UAYA 1W0CA 4UVHA 2HCTA 3EDMA 4CM4B 1K6IA 1GZ6A 2RAFA 4IJUA 2DM6A 1OC4A 3HN2A 2OP1A 4XCVA 4PVDA 2ZJ0A 4DC0A 4DGSA 4ZGWA 5JDCA 4JJGA 4JCOA 3GVPA 4CPDA 4I5EA 1TA4A 1F0YA 2VOJA 4DBVO 3E03A 4AFNA 1M66A 5K9ZA 1HDRA 2FZEA 1W8DA 3D3EA 2YY7A 2AEJA 3W4KA 1QXSA 4ITUA 1ID1A 4BHTA 2XXJA 2AA3A 1TB4A 1X1EA 1HTBA 1YQXA 1YJQA 1LDMA 2ZTMA 3JQAB 3ZDFA 1WLYA 3QWFA 4OAQA 1KOLA 4BIIA 4WGGA 3ONEA 1DPGA 4BKOA 5G0WA 3PYMA 4NFHA 4AJJA 2EKPA 3KXDA 4CODB 3C7DB 3JTMA 1GD1O 4N5NA 5K6AA 4UVEA 5I9NA 2ZYDA 2C5AA 5EESA 3PXXA 3LC7O 1T1RA 5LDGA 4ZA2A 1ZNQO 3VH2A 4XD2A 3DAGA 3L6DA 3WWYA 2E49A 2C7VA 3UW3A 1B8VA 3F46A 2GCGA 3DBHB 1M6HA 3QHAA 4BO4A 2Y0CA 3ULKA 1T24A 2JAHA 1BVUA 3PI7A 6LDHA 5F1KA 2X86A 2RH8A 3EAGA 4PRKA 3OICA 3IC5A 1ZXLA 2GZ3A 1BDMA 1Y6JA 1YS4A 9LDBA 1O9BA 4WASA 2EIHA 4PLZA 1A72A 3TZQA 1DJNA 4BNIA
chains in the Genus database with same CATH superfamily
5AJHA 1M2NA 4ND8B 1YQGA 3L41A 4RVCA 2BEUB 2GHRA 1OOEA 1NYTA 2FXIA 2EXXA 4PCAA 4BFVA 2XZLA 3HBJA 3FYDA 5ER9A 5HZGA 1B1AA 1U4OA 1Q6YA 4H0NA 3ONFA 5BVHA 5LJIA 2WQ6A 3KV1A 2XF8A 5TQ2A 4TQGA 1VLQA 2ZS9A 3BK2A 4YPFA 3W3AA 4E5VA 4BGPA 3CKLA 1J0EA 2QLMA 3TUIC 4BLSA 3W5JA 8OHMA 4QRDA 1A9PA 2VS1A 1NWHA 3H9EO 5HWSA 4TV8A 3UJ8A 2NSHA 5IEBA 2AUTA 2PS3A 2NSDA 2PQ6A 1EQ2A 2BT4A 4HLNA 4MKHA 5KJCA 3N0TA 2WPDA 4MKZA 3UAVA 2PR2A 5JI3E 1QV6A 1XEXA 1YJXA 1GPJA 3G8CA 4IS2A 4ZMBA 4CUZA 3RABA 4IO0A 1NQOA 5AM0A 3U40A 4UPVA 4PC2A 1C3OA 4U6QA 5GQSA 4C4OA 4D9BA 1V48A 2A5GA 3NHWA 3T34A 1SIBE 2YWJA 1YZVA 2ZSJA 4GOKA 2YWXA 4WIAA 1SVSA 3ZZUA 4LX8A 2GXSA 4W5QA 2VCYA 3GYGA 1U8EA 2Z98A 4QRHA 4PGMA 1M73E 3O8QB 4QVIA 2ZB8A 5DGTA 3STXA 2P9CA 1FNDA 2VTDA 1Y6RA 2R48A 1OBOA 1P4JA 2QTNA 3JZIA 4PSUA 2RKWA 4RJIA 4B7UA 4GX5A 4BVLA 4J29A 2UZ4A 3TQTA 1YL7A 5TS2A 4BXOB 5EC8A 3JD2A 5EYPB 1NJ6A 2CDBA 1A88A 5IEJA 4YO7A 3HUUA 3ZLJA 1JHRA 4PYOA 4BMSA 4I3GA 1R0XA 2RKBA 3H16A 4HDAA 4GDFA 3BSWA 4I2VA 1JHZA 3DEAA 9GPBA 1SZCA 2VXCA 3OA0A 4D26A 3AEQA 3IPCA 3PYLA 4FS3A 3ZD9A 4ZVPA 4F5ZA 2IVFA 4O33A 4G01B 3OCYA 1TUBA 1I0LA 2OXFA 5DCWA 2FU5C 1NQAO 3WNCA 4YR7A 3NAMA 1RRPA 5C2JB 4MV4A 3MRVA 1B23P 3MGCA 2XZDA 2YWRA 1QHSA 3ZDEA 1E79A 2YNMA 3EEIA 3KTDA 1O5TA 4JLBA 3RE1A 3O8OB 4EHBA 5C32A 3GAMA 4B6OA 1UXGA 2ZYVX 3AIIA 1OX4B 2CNBA 3MTBA 5JYDA 4DDTA 4J9UE 5J43A 1ZG3A 3STUA 4OIMA 5IZCC 3HZZA 2PUHA 2NTVA 4GNKA 3U4DA 4UTRA 5JZSA 5DM60 1X94A 1E7MA 4ZQBA 3VPDA 3X2EA 4PLPA 3QVOA 2G1JA 3QYAA 4O4LB 5IJ0A 2HMVA 4I50F 4B8YA 5IKMA 5K0BA 1UJ5A 1JFFA 2CNLA 2V7GA 3HJTA 1OX5A 2QROA 4DCSA 1C81A 1BN6A 1EUYA 5CYGA 3QEKA 4ALJA 2MMCA 5HE8A 2W6QA 5KNLA 1AN9A 1A4RA 4WZAA 4BVFA 1H8EA 4CYMA 1PR6A 3AH8A 3AIKA 3CLUD 1SD2A 2C94A 3LT4A 3QUSA 4Q19A 3UYKA 1PT5A 3NVDA 3NHZA 1I6WA 3B6EA 1JIVA 1WNFA 1N2CA 2O0LA 1A9SA 5C5EA 2XF2A 5AKIA 5B3LA 2LZ0A 3L9WA 4Q4AB 4PLFA 3WK8A 1G6OA 1KYIA 3NATA 4M9RA 5JXWA 3GNQA 4KQKA 3NHPA 5A06A 5ALVA 5K05A 1X1CA 3RIXA 3UT5A 1AQLA 3LECA 4RETA 3R24A 1IUOA 2P2NA 4QUJA 1LF5A 2AC4A 4PZUA 2P2GA 5EI5A 1RQGA 4E1VA 5BRJA 4KG7A 5DE3A 2P1ZA 4KGXA 3FOZA 1MABA 1YU6A 4MQEB 4BVJA 1FTSA 2VBCA 1P9WA 1UKEA 2P9GA 1FDIA 3BEOA 4OAPA 3VKFA 5H9WA 1U2DC 3AL2A 5F78A 3ZL9A 4B9AA 1EHCA 2JAUA 4J0HA 1XCBA 2O7VA 1U65A 4WSOA 2X42A 3AW8A 3JVUA 1UFQA 3QE0A 3ZIUA 3EQ2A 4PBSA 1U7WA 3SIRA 3TW8B 3SX2A 2EBWA 1PTKA 4X1YA 3KOMA 4Y2PA 1CIPA 3T52A 2JJ2A 3NPMA 1WMDA 1W8IA 3AERB 3JYHA 4RH1A 4RXTA 3WGJA 4L0QA 2C77A 1T10A 1SURA 3F8WA 3TEMA 4RTLA 3KYCA 1OF1A 1QFMA 1VKHA 2JI9A 2QTZA 2WK1A 5KSYA 4G9BA 4C0QC 2XIJA 3HN6A 4PPGA 4PBTA 4DR3B 3FY4A 4HV4A 4YRNA 4OH1A 2VHXA 5F64A 3RNOA 3RUCA 1PFYA 2XTMA 5BP7A 5JJ5A 4PO1A 3RH0A 1ISSA 1J07A 1LRKA 1JKJA 2NXJA 4WA7A 4PHFA 4X85A 5ECWA 2D2FA 4CLOB 3LD9A 2OK8A 2Y1DA 1WDWB 3DG9A 4GM1A 5COQA 2FSPA 2IYRA 4FHCA 5TMPA 3KFXA 3I28A 1X7ZA 2WM3A 2BGJA 1IRXA 3L0PA 5CHEA 2J4CA 2XVMA 5G0TA 2IA5A 1DAIA 1EUQA 4NBUA 4HXYA 1RMQA 1U3UA 2BR3A 3ROMA 1T1EA 3IBFA 4MPPA 2DOKA 5IVPA 1I7DA 5FNVA 3ETEA 3KV3O 5IDQA 4UEQA 4LQLA 4EHAA 4XSHA 5HDBB 3CHYA 3GLKA 3IEVA 1E0SA 4KZPA 1DX6A 3JQ8B 2JNWA 1M2WA 4D9CA 2ZDGA 3EHDA 2I78A 2VDMB 5JW6A 4GW3A 2IYUA 3GMIA 2Y6VA 4L6CA 4GYJA 3H1EA 4E12A 7REQB 5KYXB 4JBLA 1UT5A 4AJEA 3PTAA 5C5DA 2W00A 3RDPA 1PHPA 4HATA 4L75A 1Y5MA 5A7FA 2FWMX 4G5XA 3WKAA 1TCCA 4EJ0A 3VOBA 1VMKA 3NEAA 3A10A 4EZIA 1IZZA 1FYVA 2XVAA 2GD2A 1TFRA 1GPYA 5E9AA 3R77A 4JL8A 1VHQA 2ET6A 3ZE8A 1W5TA 2QRJA 4AN1A 5JLAA 3WE7A 1RBQA 1XVUA 4UATA 3QI2A 2HLHA 3EBOA 4MA0A 2I4OA 4AVYA 3LUAA 2WM8A 1R37A 3IMKA 1WHTB 5DHRA 4ARUA 4WCVA 5C46F 1VL2A 3SYLA 4RA6B 5ERGB 4BRSA 4ANFA 1O95C 4BVEA 3JSAA 1KJYA 1D2CA 1OBCA 2QTBA 3KSAC 5H82A 1E32A 3AR8A 3NTXA 3PQ2A 4M36A 2PWPA 5G1PA 4C4ZA 1EU1A 5CTAA 2X6TA 3MT0A 5KAMA 1A4IA 5KYTA 4C0BA 2WVJA 2YJTD 3ZKAA 4D4GA 2Z6QA 1E6WA 2VSQA 4HGQA 5FA5A 4E3WA 4JD5A 3TNYA 2PGOA 2RB4A 4PSVA 2R8ZA 3PGA1 1G8SA 1L7QA 3ZE0B 5BO5A 4ZPXA 4YROA 3CNOA 4XB6B 3P5SA 1WXWA 3CEMA 4R05A 4RKYA 1XA3A 5HE9A 1C3VA 2YICA 3WSTA 5DNWA 2BR5A 5KWEA 1OLSA 4WD3A 5JDCC 3TINA 5K3EA 4TLMB 1J39A 3R0VA 5K8UA 3J7AC 3ZGLA 3BL8A 5EPUA 2R6HA 2OB1A 3KT6A 4IMRA 4B3FX 3R8CA 4KPUA 3U0VA 1Z2AA 2YWHA 1NUHA 1VG9B 1O03A 4OSOA 3R8XA 1ZA2A 1E0KA 4UEWA 4LA4A 2ZB3A 4NFSA 1NFFA 4CIXA 2HYDA 1PG5A 5THQA 4Z8XA 1W581 1K66A 1QF7A 1T2EA 2AN9A 5I7SA 3D6TB 4RY0A 3SHQA 4CEJA 2QTMA 5KNCH 1BYUA 1RHJA 1WX1A 1GUBA 1SFRA 1UM9A 2EKQA 2PPVA 3SEAA 2JRLA 2FPLA 4V1CI 4MUKA 2H16A 2FZGA 3ZCQA 4RJKA 5AI4A 2P0EA 3WV4A 4GBJA 5HGXA 1DADA 2JLWA 2B36A 1IC6A 4J1GA 3ZZNA 1W4ZA 1IOZA 1VHJA 3BIJA 5IDYA 1DZIA 4DLNA 3FPLA 4Q37A 4F06A 5K8TA 2PUCA 4KLAA 4TYQA 3T1QA 4N9QA 2QT0A 4MI1A 2AMVA 2QU7A 3C7KA 1TF5A 4ND8A 2Q4TA 5ES4B 3G2JA 3RYFA 3FW1A 3CEPB 4X6YA 4WOPA 2ILTA 3IBGA 4BN5A 3SDBA 2F1HA 3IIIA 2ISSD 4EO4A 1Z5VA 2XQIA 3I01A 4XTRA 1C7ZA 1PW5A 5THKA 5LB4A 2FUG6 2I22A 5BVHB 3QVGA 3GP8A 621PA 4BQQA 1FFSA 4D4IA 2C88A 4TOIA 3FVQA 3U31A 3ZX5A 3JRNA 3BQ9A 3W8DA 3BUSA 1YU9A 1HDOA 1MG5A 4AJLA 5CCBA 1SU7A 1OI3A 3Q3CA 4B43A 3BPSA 3LGXA 4DMHA 4I19A 1NY5A 3AK4A 1ZJ5A 1IM5A 1UUFA 2H0AA 2MHCA 4IDGA 5CH3A 5EA2A 4C22A 3KR1A 5K99A 1LTHR 1YE8A 2L17A 1AK1A 3ACCA 4Z4CA 1TIPA 2FYTA 2H8GA 1P0PA 2V54A 4V24A 3GFQA 4X8LA 3RTDA 3BS4A 5L3QB 1YVDA 5AUPB 3IFSA 3QXGA 4QXRA 3ZXSA 2HMWA 3A58B 5BRNA 1TMYA 4DXAA 4EY8A 2FLKA 1E5QA 1KPHA 3I05A 4CQMB 2ZYTX 4OL9A 1HE5A 3B3FA 1V47A 2JATA 5AJTA 5YASA 3QEAZ 4PHGA 1FUKA 3TZKA 5L3VA 4UTOA 1FDOA 2WUGA 1LJ8A 2A57A 3O47A 4GKVA 4J0QA 4GXQA 4YAJA 4MWBA 1YBAA 1OWOA 3O8QA 2BIFA 3ESYA 3GIWA 4NCNA 1XNJA 4KIWA 3HYSA 1CZHA 3M2PA 5DX0A 1IXKA 3VDRA 2FI1A 4GX2A 3RVPA 1S5PA 3BOSA 4NBTA 1E18A 5ERYA 2YW9A 2ZJ4A 1J2TA 1UDCA 2DLDA 3OZEA 4PV7A 3VH3A 1CS4C 3H42B 4RIFA 5FUBA 2JDIA 2HA7A 4HJRA 4B09A 4AQYB 3IPAA 3K2QA 4LXUA 5EQTA 2OC4A 1A9XA 1Y1QA 4Q4LA 1NGSA 4A91A 1F1BA 4M1TA 1C1HA 4X1IA 3H2ZA 4AWXA 2Z3VA 3N8DA 1TUBB 4FE7A 4N76A 2QR2A 2OFWA 3CPSA 1ZOOA 3K9CA 3TFOA 1UK8A 5K09A 2YC2C 3BZUA 4A0GA 5JHGB 4U2GA 3D5EA 4JJZA 6Q21A 2Y1EA 4GNRA 4AJ4A 2O8EA 1T0IA 3DKRA 4WJLA 4HH0A 4KFSA 4ZIRA 3HCCA 1ORVA 2B1IA 5BR7A 4M49A 2GNPA 4UZEA 4XLTA 4U3JA 1QHEA 2A8YA 5JOQA 4UVIA 1XTRA 1R12A 4GXRA 5EWMA 4R1UA 5AXBA 1XDZA 4EUKA 3KLOA 3LTNC 2A78A 3WL8A 3UICA 4PG8A 1ZVMA 4FGUA 3KVRA 1AMUA 3C8ZA 4OJQA 3M6MD 3WR5A 3MAJA 4HTAA 1FFAA 3W5SA 1JFFB 1KI8A 4JNCA 8GPBA 1CRPA 5ALNA 4XYBA 5A71A 1YBMA 3E8SA 1RXCA 2HDWA 2H7VA 3LX8A 4ZRMA 1FPQA 1FYDA 1Q2UA 2CL0X 1CX9B 2NZ2A 3LP8A 4R9RA 5F73A 4OQEA 1Y8ZA 4TT3A 5TY0A 2HJGA 3LY9A 5FUXA 1VLZA 2AC2A 4JSRA 4J6EA 3DXZA 1FTQA 3CPJB 4GECA 4RANA 5G0SA 5GINE 2PU5A 5BNTA 3TG2A 1SY7A 3QEJA 4F1KA 1GU1A 4Q4AA 3H8VA 4PW0A 1N1MA 3B5EA 3BWCA 3DPUA 1M2FA 5DGCA 3CPHA 3UUGA 1W0KA 4Q7LA 2NUPA 3Q3JB 4QOEA 4R81A 3RG8A 3M34A 3WQSB 3ME5A 5H4GA 1YZNA 4JLAA 1JIIA 1P9RA 2C7RA 3ERCA 5JV5A 4TMYA 4YJ3F 3X1XA 3VGPA 2ATXA 2RDMA 1RW4A 2XPCA 4ODIA 4RFVA 1MQAA 6AT1A 1PGPA 1IATA 4RQAA 3ZX4A 4GMDA 2CUNA 4DWOA 1Z39A 3EA5A 2J4DA 2PD3A 3N6XA 4JV5B 1LY1A 1CF9A 1UXIA 2WE8A 5J2UF 3X43A 1R8JA 3EQZA 1L4GA 2CFIA 2QUBA 3GFBA 3SSOA 1LS6A 2VJMB 1RWXA 4EF6A 3DZBA 2LKCA 5ALQA 1H0KA 1DKRA 1C9DB 4YXWD 1IL0A 4IF4A 1Z45A 2DX7A 1HT2E 3CX7A 3H5AA 1Z6XA 2VNAA 3QI7A 4DDMA 2O59A 4EA7A 2H0RA 5A0TA 3E35A 1JFVA 3CLUC 3TLJA 1EGHA 2I6UA 3HCFA 2ZIFA 3W34A 5ESRA 1RD4A 4U7DA 1T3TA 4GIBA 4LJAA 1OB2A 2A0WA 4J7XA 5A7GA 3ZHCA 2Q5JA 4V3BA 2DFPA 3TLCA 5TS3A 3OSZA 2M9MA 4LOAA 4LGYA 1EUCB 2WMOB 4MJ3A 3OIVA 4V3CA 1DEHA 4GSYA 1IEVA 4KQFA 5JH7B 5HP4A 3ZJTA 2WJ6A 3PXCX 9ATCA 1DPFA 1SC6A 2W6CX 1QRTA 4JI2B 3UW1A 1RLOA 2AE2A 2MSCB 4BO7A 5GIOE 2XCRB 2JCGA 3TSWA 1T9BA 2JGJA 4XOUA 2HQ1A 2COEA 3D9QX 1X7YB 4FBMA 4N0QA 3RJMA 1OWLA 2RBGA 3QBVA 5FPHA 1U90A 1YR7A 4A2QA 1DKLA 2JCYA 4IMPA 4TL7A 5D6NA 3QWAA 2UZAA 3K8YA 3NR2A 3GLUA 3QEMB 4LOJA 1Z7WA 3RQSA 4F6LA 4RXMA 2NUTB 4MH0R 4W9RA 2VUSA 3NT5A 5CRIA 4EEXA 2ZG6A 3CF6R 3R3VA 1BMFA 2AN3A 1Q44A 2Z2IA 5F52A 4HUTA 3I5XA 4KL8S 4ZO4A 3KX2A 5BXQC 3QPVA 2Q2NA 3C6BA 1JKXA 3JV7A 2BI4A 4F60A 2JVIA 4WDRA 2QQ0A 4D5EA 1YZHA 4KAFA 1QH8B 5HFJA 1N5LA 1MQ9A 2HSDA 2VRCA 1AKMA 2HPAA 5K0EA 5HNKA 4NCHA 5ERXA 2CZQA 4R2JA 4TT3D 5FPTA 7REQA 1PCXA 3RHSA 3ZHBA 2EWWA 2WKSA 3PC8A 1E3IA 4IV5A 3R5KA 4JYPA 4DS3A 3VR4D 2BKUA 1ZJ6A 4ND7A 1V8ZA 4R68A 2NO7A 2XUIA 3EDOA 1ECGA 1UPXA 4CMIA 1XALA 3ILVA 4Y2UA 2PGXA 5J63A 2Q3FA 5ICSA 1VKNA 1Q7CA 4HNSA 1OGJA 2YWFA 3DT8A 3FPCA 4ZVOA 4BPRA 3MRXA 5LUAA 3NIBA 4IYJA 4OKNA 5ELLA 1W52X 2JIQA 5C31A 3TL3A 4DCUA 4YJ3B 3GFVA 3S5JA 3TN7A 3G2KA 1K4MA 4YEDA 2Z1DA 4U7TB 3PVCA 2P0AA 4RLFA 4JB0A 3V2GA 3GOQA 5C1BA 1IUKA 5AM1A 3KR2A 2QS9A 2QE7A 2QUZA 4JY7A 4WLVA 4ZCIA 2VTEA 1F8YA 3HRHA 1CZKA 1BTOA 1XWWA 3K1JA 4II7A 3ROKA 4LDZA 1K06A 5C1PA 2QZZA 3GLTA 3MINB 3PD7A 2R6GA 3PLRA 3QW2A 4ZVTA 3WISA 4DUYB 3M9LA 1H3FA 5D7NA 2VJOA 2AOVA 4EB6B 4J0EA 2VL7A 3LYUA 4HSGA 3L0YA 1ISFA 3UBTA 4J16A 2G80A 4Y1RB 1XDUA 4Q39A 4Y30A 3MHPA 4CGYA 2DB3A 2V7PA 3UMSA 3CX6A 4IIBA 5B7PA 4HXFB 1E7RA 2PRKA 3AR7A 2VLBA 3BFKA 3ADCA 3BN3A 4FINA 3QOYA 5LBTA 2Z56A 1NYRA 2P62A 4QASA 3HP7A 1U9YA 4PVCA 5AI9A 1UZAA 2PRSA 1XTSA 3P8ZA 2EV9A 1O08A 3JASA 3AUAA 1RLJA 4YIKA 1SUEA 5EE9A 3LBAA 3O94A 4C7JA 1N6LA 3F7OA 4V1CB 3GJ5A 5CLLA 2AKEA 1IDOA 1ZGHA 1BFDA 3O9ZA 4LXYA 3RSGA 4JFRA 2BPOA 4WOJA 4HG2A 4B6GA 5B53A 1V3VA 3EH1A 3ZK8A 3NI2A 1PQWA 1ZWLA 4H1UA 3G7UA 1QKJA 3PQ7A 4PG5A 2GLXA 4CG0A 3G2QA 2ZRIA 2W6MA 1P31A 3NYRA 1LBIA 3MS4A 5ALXA 4YJGB 3WDSA 1AOXA 4YMHA 2I3DA 1HR0B 4UUAA 3C4JA 3E8MA 4PEVA 3VRHA 3OIDA 3OCXA 4CIYA 2ZYSA 1J8DA 1SEPA 3IP8A 3KQOA 3QLUA 4IJMA 3SKVA 3T3IA 4PYRA 1KP2A 1I3NA 1YOBA 3FWPA 3H5NA 4FDLA 2C4WA 3WRVA 3OJEA 3NNSA 4KJXA 3KJFA 3WKEA 4OGLA 4ARZA 3KQNA 2ASVA 3BCUA 4KU4A 4Z51A 3I58A 2XDWA 2CK3A 2ECKA 4K8RB 3QVGB 5FP0A 3G2NA 4XA8A 2WNIA 4GKBA 4R3UC 3ZS8A 1QBKC 4MVJD 2H2IA 5J1TB 1AA9A 1CETA 1YNSA 3UVEA 2FEOA 3FDIA 821PA 1DC3A 3GRZA 5A7HA 5FWAA 2PLNA 3RSZA 4YRLA 4W5NA 5IJ9A 2EFDB 5FBQB 3VO8A 5FAKA 2AYYA 2BP7B 2YV1A 1NLFA 3G0GA 3QZUA 5DOVA 1DIOB 1KYQA 3WQRA 2IEYA 3IAEA 3MQFA 3IUMA 5SY9A 1EFPB 3THXB 2QUIA 4JB8A 4O4LF 5EIXA 3DLHA 4PLCA 1YMQA 4QGHA 2WJYA 4BMPB 5IAAA 2H06A 1FTYA 2VAXA 2PMFA 3NTLA 4GUDA 4XM0A 4BDTA 4E2ZA 4MUHA 5HBRA 4B47A 2H1OA 1D1PA 4W5RA 1QRUA 2GESA 5JIBA 5BOSB 2O8DA 2A84A 2K87A 3AR4A 3G82C 2FHPA 4PX9A 5HIKA 2QVGA 2Q5QA 4MTLA 1HSOA 2H0QA 1F7UA 2LXNA 3T4UA 2XUAA 3NWOA 2WG0A 1Y9JA 1Y1SA 5LFAA 4C88A 1F7VA 3A1VA 5FWXA 3KQQA 2IV2X 3H99A 2WHEA 3VZRA 4I1SA 4CF6A 3SQWA 2FEXA 4IG9A 2DHQA 4M88A 1K6MA 2LVBA 1EFHA 2WKQA 1G3UA 4JYMA 1TA9A 1KO8A 2ZJFA 3EG9A 4R2IA 1Z6QA 3JYOA 5HF9A 2KWIA 3RC1A 2A7QA 3SC4A 3CSUA 2MJLA 1KRXA 4CMGA 1RRGA 3KAPA 4KDFA 3SSAA 1NIPA 2DQSA 1P7YA 4UEOA 3QHQA 3U44B 2OLJA 5FI1B 1PGOA 3K35A 4RA9B 2ZIWB 1JXOA 1XCMA 3BSSA 3IPXA 2DPHA 4BZZA 1THMA 4Q01A 3QE2A 4NONA 4TTSA 5IBRA 2AKAB 2VPZA 4MV1A 4P5EA 4Q1VA 4ESVA 1R9NA 4BO0A 2Y3IA 3TMKA 3AY3A 5KVVA 4AF8A 1IWOA 3CR3C 1Y5IA 4Z8YA 3ZOZA 2AZTA 5L3SA 4ZVKA 1Z8HA 2WMNB 3VU3A 3GJZA 2JLAA 1JI0A 3RKSA 1XCPA 1EA5A 1BDJA 3OAAA 2YUTA 2WSYB 1J2JA 2VBIA 1G64A 4UUOA 5E2IA 1C4XA 2A3RA 2AN5A 2JGDB 2YOHA 5H3LA 2ZJ1A 5AVUA 1VMDA 1Z22A 3UT0A 4G63A 1GPDG 1OXTA 3CLRC 3E3LA 3L0CA 3OIYA 1DCTA 3WRYC 4WBXC 2DP4E 4AURA 3K53A 5CFLA 5EHZA 5AIAA 1U6JA 4MCAA 4TS1A 3SHWA 3FOEC 2PT6A 5BMVA 2GSDA 1S7GA 2FCAA 4K3UA 3SR3A 4MKRA 1DCKA 2P3SA 4J4BA 4RIHA 1QGED 1N32B 1A76A 1FS4A 3LRTA 2XE6A 3I4LA 2I1WA 3N0WA 5HMMA 3U6KA 2ORED 2DE0X 2WU1A 4RADA 3RANA 1LI5A 4K9DA 4IIFA 2ZRLA 4FWBA 2JJQA 5AMXA 5FI5A 3CUEF 1I7LA 1IOLA 2P9HA 4IQ0A 4FYIA 1PWZA 2B83A 2VJQA 1SBNE 3L04A 2FY8A 1MV5A 5F5LA 1NZFA 1F0KA 2YJNA 2H65A 3L9XA 3VZCA 5AUOB 1ODTC 3CUUA 1O95D 2ECFA 4W1RA 3I45A 1JDBC 3K4QA 4PAWA 4Y3UA 5TQ0B 4BU0A 3G9ZA 4S05A 5FWYB 3KFVA 2GEDA 4C2TA 4QU5A 3FYSA 4WFJA 4Y2TA 3RTEA 4ASUD 4X24A 2IK8A 2AFRA 2ZCUA 1W4CA 4Q4HA 1RM4A 1NBIA 2X23A 4EGSA 2Y1OA 1RZUA 3R7WA 3TTVA 3BVPA 2VT7A 1SUPA 4D82A 5IKEA 2BM9A 3BORA 2P4QA 5AOVA 2ZPAA 2Q4DA 4IFIA 4NMLA 1K88A 3L0IB 3QLVA 5IAJA 3WL3A 1KERA 4ISBA 3IR7A 2C8JA 4IZ6A 4LZAA 2G7ZA 5TGZA 3RYIB 3CV3A 3PDWA 3K92A 3O90A 4LXHA 3T4EA 1ZH4A 4AT1A 4P53A 3UEOA 1W35A 2CXTA 2JJ8A 3EZFA 4DOMA 1OH6A 1X7WB 1U2TA 4IXTA 5F12A 3DKKA 1CQJB 1UP6A 3O75A 4B6FA 1NY6A 3P0IA 2HHAA 4ENRA 1SUSA 2D1RA 1S8AA 1PLJA 1OYWA 2FFHA 1A9RA 4QDUA 1WW2A 1FX1A 3E9YA 1DVRA 4TLCA 3ZK9A 3AXTA 4PN7A 4HFJA 2JD1A 3F5QA 4XUGB 4H0CA 3MWDA 3NCHA 4OI4A 3U7HB 3NRBA 2ECQA 4J2OA 1N78A 4IJSA 2RGEA 1GL6A 1RS0A 2YRXA 3K9NA 5FL7A 3ZHTA 2K7FA 1U9ZA 4HUQB 4O4JF 5JI2E 4KLRA 3RSLA 5E8RA 4OXNA 2FPMA 3QKRA 5MFZA 2OHHA 3CIFA 3LBNA 4BX9A 4ZV7A 3VMMA 4RCZA 5LZ7A 2JG3A 1FNCA 1B0ZA 1KI4A 1W6UA 4JT2A 1K0UA 4L8LA 3H11B 5FTNA 4Y0NA 4PONA 5SZJA 4PO8A 2QDXA 2OBNA 2G07A 3WGLA 3OESA 4F5DA 4RTNA 1RC1A 3ZY4A 4AICA 5BQ5A 1TXGA 2GPTA 3AJAA 3E0QA 3GEEA 4N5LA 4ZK2A 1SXHA 3A4NA 3EVNA 2JK0A 5G53C 2KBEA 2R7KA 2GASA 1BX1A 1G2OA 4UMDA 3FHJA 1K4KA 4J4HA 2IZ6A 4A2WA 2BFNA 2ZUEA 1QH1B 1Z8FA 1ZI8A 3FVRA 1V45E 3QF4B 4FGZA 3K8OE 2J30A 3KTFA 4HGPA 4P4SA 4OLBA 2W90A 1BKDR 1NBMA 2E4XA 1X1TA 4Q00A 2Q5HA 2CSUA 4IVRA 4DWJA 4Q6WA 4P2BA 2UVPA 2VT3A 1NBMD 1V4NA 4GX0A 2ETXA 4GI2A 4RX1A 2Q1YA 2O3UA 1VCNA 3LCVB 3DM9B 3U26A 1ZD9A 1LZLA 5GZ3A 4WCFC 5LQRA 4I1YA 1ZHFA 3FPGA 4QJ4A 4DV2B 4E5YA 3STVA 1CUXA 4Z49A 2AKYA 1XDBA 4XXHA 2HHLA 3VOTA 1EVIA 1RAGA 2C42A 2FGKA 4YCBA 2RHWA 1BW9B 1PHRA 3EY9A 2J59A 5IAGA 4O4JA 1DQYA 1N9GB 4J8PA 1VGQA 2ZRDA 2EZ9A 4URVR 1ZJJA 1X1DA 1CR1A 2CVQA 2GSWA 1KEZA 2GK7A 4B3MB 2RGXA 2VF7A 3JQBC 3RREA 1JTEA 3C8UA 1RM5A 4RZXA 1YUNA 3IT2A 1LLFA 1VRVA 1ZIXA 2BFEA 3OOJA 5CYPA 1CUDA 1VHTA 2FWRA 1ABFA 4Z4FA 4YMWA 3C1TA 4DARA 1RKVA 4ZOLB 2B94A 1C9EA 5D5HA 3D8NA 4IDBA 1HE1C 4CF3A 2RJ3A 1ZICA 2GBPA 4DC1A 1NPYA 1E3SA 2GTHA 4CCYB 3M7IA 4TZKA 5KYWB 3RYCA 3IE1A 2BHSA 2R6FA 3SF0A 1DI0A 2IX9A 3CSDA 5AJXA 1WZNA 2BGKA 2VZLA 2X4LA 2GPWA 2YOGA 4I1PA 4TKVA 2NV2B 3WQBA 4OB8A 3PFCA 2ANCA 3DUFB 4CT5A 3K9FC 4JJIA 2CMKA 5J4VA 3AVOA 4MWZA 1P7VA 3DBHA 1TK9A 4X66B 1V6SA 5J47A 4TLLB 3RC7A 1Y7IA 1QIHA 1IRIA 3L46A 1W0KD 2PGIA 2Z43A 1U0FA 4XFJA 3S2FA 3GLIB 2RG7A 4FYKA 1NXTA 1Q1GA 1QWOA 4GYWA 3T9BA 4PS1A 3TKAA 1SCIA 3EFOB 3QLJA 2VNSA 2MSEB 1RWPA 2WF9A 1KJWA 4C2BA 2Y1CA 2D1QA 2JASA 4H27A 4X5OA 4ARSA 3OP1A 3D3WB 2GN0A 3EGXB 4NZMA 2FFJA 5JC1A 2QMUA 1GYQA 3GFTA 5LOVA 3GEBA 2ZJ7A 4ME6A 2C9CA 5C7LO 2BMEA 4M9UA 4PPFA 5E7QA 3TSYA 2L82A 2VPWA 3LGSA 1UQUA 3AHFA 2GM9A 5T67A 5IUJC 1WXGA 1BC5A 2Q3HA 1L9KA 1AVTA 1BE0A 1P7PA 3ZWBA 2WVAA 1P1JA 4KR0A 2P5YA 3R7AA 4M7RA 4XIGS 4UU0A 4BLQA 3HO1A 4HSEA 3PX3A 2RK3A 2YVAA 5A0FA 4A82A 4DPLA 3EIEA 1TKBA 1WSWA 3PGXA 4D96A 4P58A 2UXCB 4DLTA 3C3MA 4M0FA 4D6PA 2C9MA 1XPJA 1D8AA 3I6MA 3GRPA 4YQFA 1G17A 1I7PA 1XRJA 4FUTA 4RKFA 4QLBA 5HRUA 3U0BA 5KWIA 1A4UA 4UVGA 5CFMA 5G0VA 2BFPA 1JPUA 3GQBB 3W6OA 3R3SA 3IQXA 4GZ3A 4B4KA 1YQ9A 2QYHA 4UDNA 3AYXB 4MQFB 4R2XA 4YDRA 5D5QA 5CA1A 1L4LA 1IHUA 1ZMBA 1G5PA 2RE8A 4XEUA 2B4KA 3L8HA 4ZGGA 4WUVA 5LPNA 2Z8XA 1LK5A 3TQSA 2QB5A 1SD1A 2F1OA 2X15A 4JGIA 4K87A 3QPBA 3T7SA 4AKGA 1EMDA 3D4NA 3OJ0A 3SYNA 4D9HA 1C0PA 3WK7A 3ZCVA 2W83A 4XM2A 5LNK6 3BBPA 1DBWA 3A9CA 1RHQA 4BMOB 5IJ0B 4DT1A 1HFJA 2WKPA 3CNNA 1QPGA 2NX2A 2NAPA 3IHKA 4MV7A 4BNYA 4EW6A 5K8CA 2X7JA 2D0OB 1HLDA 1I9GA 3ENWA 4ZOLF 1E0JA 1SBZA 2B6HA 2F9LA 3AEQB 4FDMA 4O25A 3EDCA 3NBQA 4WLUA 4P7KA 1CUIA 3HR4A 3ROZA 3MLBA 3S68A 2FKNA 1U28C 5J4HA 3UYLA 2B5WA 2ZSHA 4PSDA 5ITZA 5JMPA 1IFXA 4NMHA 2ODBA 5IK2A 2VQEB 5A6VA 1VJ0A 1R66A 5IT5A 4QPZA 5DNEA 4W7SA 5IXSA 1G7RA 1JW9B 2W4IA 2Y4OA 4KQIA 4LCJA 4ZJUA 4MVJG 4DMMA 5IXJA 2V6MA 4NVRA 1Z5GA 4G4JA 3R5XA 3W4IA 4KSYA 5AVSA 2VK1A 2YWCA 3ID6C 3U13A 1NJSA 1X8XA 3L7NA 3SU8A 3OSUA 3WLKX 2ZRFA 3M70A 1SQ5A 1O9HA 1XQ6A 2WC1A 3ITKA 3NDIA 4RDIA 4KO4S 3AIMA 1H94A 3DF9A 4IWNA 4J7UA 5DW0A 4AMZA 4F4HA 5HSGA 1Q95A 1GFWA 1OXSC 1YZLA 1XJCA 4X90A 2WNSA 2Q46A 3EDRA 4E13A 2DERA 2IHUA 4A36A 4KQXA 2C3PA 1MO3A 5KKAA 3DB2A 1G7TA 1NLZA 2AVNA 2PYZA 4CM4A 4JJ8A 5KVAA 2O2JA 5LM3A 4R1PA 4QTZA 1AJEA 3WO1A 4JJFA 3PFFA 7AT1A 5CDFE 2YN2A 5ITWA 3UJHA 3I1IA 3DTTA 4ZO9A 4J7CA 1NNLA 3AERA 1G2QA 4ZICA 2EZTA 4LDPA 5FLYA 3STHA 1RADA 1EVYA 3EZNA 4CIDA 3V4FA 4PFKA 5CFRA 1FX0A 4QOJA 2ZUCA 3HGMA 1MX3A 1BH2A 3AUTA 4YFVA 3D1VA 1ISHA 1NF8A 2GN1A 1V39A 3IOEA 3IOCA 5FQOA 3ZWNA 4Q6BA 4D42A 3QENA 4G5FA 2J67A 4EX7A 3OJCA 5K0GA 2D5IA 3MBOA 2IW3A 3SZGA 3U61B 2QRVB 4ZZ1A 2IUEA 1CNMA 3QMVA 4RK7A 4WJKB 4N82A 3WBJA 2J48A 3FMFA 5L4NA 4R8MA 3EARA 1RJ9A 4KN8A 4TUYF 1RABA 1JNYA 2K2WA 2PU7A 1NVEA 1X7ZB 1U8ZA 2OK7A 1HH4A 1LI4A 2IX3A 4WQMA 3S8MA 3AJEA 1PSDA 3BGDA 2ZYGA 1D2MA 3MPUA 4DDWA 4QEDA 4WT7A 3PENA 1OLXB 5ILOA 1TFUA 4DWVA 1L7AA 2AX3A 3VKHA 4IKEA 1A5SB 4C5AA 4Q9DA 3M6AA 9LDTA 5BT9A 2W4MA 5FOTA 4DILA 2Q6TA 4S1TA 2OR3A 1UWKA 1MRNA 2VDOB 3JWHA 2PKRA 2NTNA 5KX5B 3OEEA 2PSFA 3DZIA 3WYGA 3W6UA 3PNSA 4NDNE 1VSQA 4MAMA 2B1QA 1O6GA 3UMBA 521PA 2YZNA 1HYBA 3SM3A 1M1ZA 1AX9A 3EEYA 5B3AA 3TTSA 2A1UA 4J43A 3FTQA 2HCRA 3DCIA 1MJHA 2JKYA 2V97A 1EK6A 3FTDA 4PQYA 5UKDA 1UBCA 4JN6B 2W0MA 4Q18A 4KVAA 1OYYA 1YRHA 1P2BA 2BKVA 3SZUA 4C7VA 2IZ5A 4XQEA 2OILA 1P29A 2XYPA 1WV0A 1U2EA 3ZPXA 2GZSA 4XWYA 2R86A 3SR4A 5M5BA 4MHTA 4QU9A 2KSQA 1TMOA 4IXWA 1CB7A 4N12A 3T1OA 3IEMA 4WACA 4FMBB 4Z53A 5EQFA 2DBRA 5FOUA 3OCZA 3MQ4A 3TIXB 4UOQA 1JPJA 2TS1A 3AFNA 2QXYA 1ZHHA 5EZYB 2EWMA 5JQGB 4XX0B 4R41A 3JYPA 4RTRA 4LSWA 2KQUA 1BS1A 1XBTA 3LH5A 4LNUB 5JDIC 5IDXA 4C2AA 2I7VA 1D8TA 3B3AA 3H11A 4MQUA 3UWMA 3DT9A 3N2NA 1P6QA 4CJXA 4WADA 1THZA 5BWNA 3SKYA 1ST2A 3BH7A 4HX2A 1G291 1EFTA 3KLBA 3MYRA 2YS7A 5FHQA 2KLBA 3SD7A 1FDRA 3VNAA 3ZIAD 1OI7A 1FIUA 4CM8A 2JAXA 4RABA 4UMEA 5KYNA 1BN7A 1RAFA 2BGWA 1C1YA 1C7FA 4B7ZA 1WCIA 2PS1A 4AZVA 4OL0A 1KO4A 4U2EA 4G5GA 1C29B 1ABBA 1RRFA 1KOJA 1ZPDA 1H4TA 1CE8B 5ARDA 1RYEA 4M60A 2V55B 3AESB 1DOZA 1EP1B 5TQVA 2GDJA 1AGYA 2X2OA 1LQTA 3N74A 3U48A 2VVTA 2XXAA 3QQPA 4P84A 3G2IA 3NHUA 3CS3A 4ARAA 1DV2A 2NSYA 4FKBA 4Q9JA 3VR4A 4DIDA 2I9KA 1PJQA 5DK4A 4ZOBA 1PD0A 1TKRA 1QYWA 2AXEA 3Q2IA 4MI3A 4MGYR 2KHZA 1OAAA 2C95A 4MEAA 1O2DA 2DF8A 4QE3A 3HBLA 3T5AA 2Q2VA 2AXPA 3PDIA 4QHSA 1NVUQ 1TQ2A 2PO5A 3PNVA 4H9GA 3QELB 1T4CA 4RVOA 1DS6A 4XM1A 5DBOA 3FDXA 3WK5A 2FEKA 2QI9F 2FA9A 1Y0BA 4EH1A 4RO0A 4V02A 3HYTA 5EEGA 3WYBA 2E48A 1KDYA 4UFPA 3JQBA 1U99A 2UKDA 1L0BA 1WVMA 4GVXA 3RSHA 2ANBA 3NBZC 1KAGA 2YX1A 1U81A 3LPMA 4QBHA 3SXUA 3TRKA 2IE8A 4DUPA 3OO1A 3RS7A 1PDOA 2ZRMA 2BSAA 4DQDA 5TRTA 2VDPB 1RXVA 1EFVA 2QAJA 1TYEB 2IYPA 1G66A 3CFYA 2D1YA 2VTBA 2ORVA 2RB5A 1CKEA 3RHFA 2GAIA 3HO6A 4KVGA 2PRJA 4UAVA 2O5RA 2ZUTA 1UJ6A 4BZPA 3FWKA 4R2WA 1JBEA 1DKQA 3C5VA 4KYIB 5EJ2A 4R1OA 1M2KA 3DZHA 3L4JA 3INGA 1EFCA 1IY9A 2A9OA 2V45A 4RJLA 3JPYA 2X13A 2VJKA 5DHFA 5CAEB 2IH5A 1K2WA 3F5FA 2I9PA 5B55A 4TM8A 1XX6A 1EGVB 1CFJA 4X3CA 3PXBA 5E0KB 1NNSA 1R4ZA 1RWKA 1SCBA 2NQ8A 2IF2A 3N5CA 5JAQA 3H17A 1D2HA 3R3XA 5K0LA 5JJLA 3WIVA 2EEPA 3D3WA 3WFJA 2D8AA 2OZPA 3EGXA 4TSRA 1YQWA 2CMDA 2PAAA 3QTBA 4RZ2A 4Q9HA 5ETJA 3RVRA 1GVHA 3C7TA 1JR3E 1KR2A 3QFSA 1WAMA 5TPZD 4URXR 4FM9A 1BCRA 1GFIA 3MELA 1XYVA 2A1IA 4KRGA 2WT8A 2XMSA 1XVVA 1CQIA 1CJCA 5FBVB 1XLVA 5EZ6B 3O03A 1GNPA 3OOEA 2Z2YA 4LY9A 3GW8A 3UG7A 3NTOA 4X7PA 5HHTA 3F9CA 1NPDA 2X1VA 1E2MA 1GAQA 2XJ4A 1BJKA 2DCMA 3A9UA 2B4YA 2ZLBA 1MRSA 1JQDA 1PZFA 3TJMA 4C6SA 3A1DA 4KREA 4CEIB 5C8YF 1LD3A 1GEGA 1SUWA 4CM7A 5HQ3A 2JIOA 3BWVA 3D4PA 4NXMB 2FZVA 3OZDA 4NENB 4DQLA 3MOIA 3K70C 1HYHA 3JAWA 4RGVA 4Z7JA 4JXXA 5LXTB 4HHEA 5A1JA 1N7JA 3ENVA 2QMYA 2CCJA 3DGEC 2ZVDA