2BLLA

Apo-structure of the c-terminal decarboxylase domain of arna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
330
Chain Sequence
MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVVEHRKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L- Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PROTEIN YFBG
total genus 128
structure length 330
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2bllA02
4CJXA 5K0ZA 3KETA 3PTZA 4J6FA 4JJFA 2C0CA 2X58A 1T25A 1EVJA 3GEGA 5JAMA 3F47A 3ROQA 2AE2A 3UH1A 1LQTA 3FCOA 3AOEC 1RWBA 3O8QB 4U6QA 4HKTA 1T26A 5U1PA 1KY4A 2CVOA 4A73A 4J4BA 1V0JA 3WGQA 4EEZA 1E7QA 3DTTA 4D44A 5JCJA 2YV3A 1CYDA 3OA2A 1CERA 3JD0A 3ANNA 1BVUA 3I4CA 1RM5A 1VM6A 1ZEJA 2JCXA 1WDMA 4AJ1A 3KB6A 4RPGA 4JIGA 2D4AA 3PHIA 5AXAA 2RIRA 5HTOA 4IS3A 3C7DB 4BKRA 1GR0A 3NTOA 4H15A 4CM8A 3FTNA 3RUFA 3VH3A 1EMDA 3HDQA 4DREA 1OFGA 1SMKA 2PZMA 2X0IA 3GVXA 1UZNA 3HFGA 2C20A 1W0CA 4KUEA 2YUTA 5TIIA 1DB3A 3KYDA 1ISMA 1WW8A 4L0QA 3VPHA 1PR3A 2VUTA 1P1FA 3GA0A 3IKVA 2AHRA 4TRMA 2A35A 1M2WA 1Y8RA 2AEFA 5AOVA 4FB5A 1PZFA 1LQUA 2DKNA 1I3LA 4FN4A 3T4XA 2J3KA 1ZK4A 2C7GA 4TVBA 3JYLA 3GZ4A 4YJFA 4CLEA 1OOEA 3RROA 1HSZA 4TVOA 1MG5A 4HP8A 1SB9A 5U4QA 4A10A 3JSAA 1ZK3A 2EF1A 1QR6A 4UVEA 4XIYA 3I9OA 3GUCA 4FBGA 4E2ZA 2X9GA 3VZSA 3OICA 1Y1PA 3U0BA 3V8BA 3ZWXA 3TN7A 4XYMA 4FC6A 3RQSA 4GPD1 1AHIA 3EUWA 3I4FA 3JQGB 3TZKA 2CDCA 1D1TA 5BR7A 3ENNA 4GX1A 5BNTA 4ZU3A 4ZVVA 5JDCA 4OYRA 3FNEA 3GMSA 4RVDA 1VPDA 3AY3A 5C7LO 2A4KA 3GH3A 3HWRA 2Q46A 3OEYA 5EERA 1O94A 1B3RA 3B1FA 4XYGA 1Y9EA 4WCFB 1KVQA 4J1NA 8LDHA 1VL8A 1JDJA 3NT2A 3PIIA 3DDNA 1EK5A 4KTVE 2NU8A 4P4LA 5T8KA 1PSDA 1JA9A 1RM4A 2J5KA 1X0VA 1B2LA 1MX3A 2CD9A 3DAFA 3QIVA 2NUAA 2H6EA 3D7LA 4EJMA 3AJRA 4PLPA 1PGOA 5COQA 4M55A 3QHAA 1G0OA 2A94A 2Y05A 3D64A 2PNFA 3D4OA 1E7SA 1ZIDA 4DQXA 4BO0A 1VSVA 2Z5LA 4JQCA 4XJTA 4R9RA 1E3SA 4D3SA 3CMCO 3D4NA 4ZQFA 5DNAA 2YQ5A 3G1TA 2P9GA 1B15A 4ND3A 4NG5A 1DHRA 1T1SA 4Q3EA 4B3JA 3AUSA 1M75A 4I1IA 1CWUA 2IZ0A 3ZWCA 4FS3A 4DUPA 4UEOA 4ZQEA 1A4UA 3DAGA 3D3WA 3T7CA 1UAYA 1PS9A 2QRJA 3AU9A 5ADHA 3A28A 3AUUA 2ZTUA 2HRBA 3INGA 3WBBA 1R0SA 2O3RA 2PD6A 4YA6A 3C24A 2X6TA 3OA0A 4BUCA 5TSDA 1YOVB 3QVOA 1JAYA 4IDFA 4C7KA 5THQA 1DAPA 4L73A 2WDZA 3WQSB 3PJDA 2ET6A 1KVSA 5I9MA 4D7AA 3K2BA 5TT0A 4BNJA 3LF1A 4PN3A 3BMOA 1BXGA 4J90A 1LXCA 4DTIA 5BSHA 2YHIA 4OXKA 2Y1FA 3DFZA 4YEDA 3DZHA 4YT2A 5CDSA 3DBHB 3PDJA 1A4IA 5KVQA 4MVJE 3DTYA 2ZK7A 4WGGA 3ASVA 3U4CA 4DIFA 5T57A 3OBBA 2PWZA 3S1LA 3R3JA 4FCCA 5AXCA 3LC1O 4YBZA 4PVCA 4BNGA 3CINA 3ZHYA 4RGBA 3C3XA 1EUCA 5EQDA 1H6CA 1ZJZA 4RZIA 1U4OA 1BGVA 3M2TA 3B1JA 1ZH8A 1P1HA 1XGKA 3PIDA 2PD4A 2VNAA 2G1UA 1N1EA 3OETA 1XWFA 2H9IA 2OHXA 4FR5A 5JDIC 3EHEA 1QYXA 4FJ0A 1SOWA 4NJOA 2J5RA 4EUFA 4MVJM 4Z9XA 5F5NA 3PDUA 4AJ2A 5KOIA 5LDHA 3NJ4A 3ZU2A 4HWKA 2BFPA 4JCOA 3RASA 5C37A 1UDBA 4I5GA 3P19A 1E77A 4HADA 5DOVA 5G4KB 4XGNA 4R69A 5G4LA 1U5AA 1AXGA 4WEQA 1ZKMA 4N7RA 2QG4A 5G2OA 4JK3A 3M1LA 3S8MA 2I5PO 5FEUA 5LDGA 4MINA 3FR8A 4YACA 2NLOA 5ITVA 3H4VA 4MP6A 4BL5A 5KVCA 3RUIA 1Y8RB 1ENYA 2EXXA 3NGXA 4JBHA 4HY3A 4KP7A 4MJLA 5G0VA 1GUYA 4IXWA 5IDYA 3VHRA 3AI1A 3U4DA 3KM0A 2VQ3A 3DMYA 5FWNA 1YWGO 1YL7A 5IXYA 1D4FA 1DC4A 2DBQA 3H5AA 4FIZA 1W4ZA 1RYDA 5HS4A 1NAHA 2C29D 3MJVA 1ONPA 4OQYA 1I2ZA 3B20A 3ICCA 5FI5A 5GY7A 4BNIA 3CEAA 3NX4A 3WG9A 3PFWO 2HK9A 1QLJA 1LUAA 1PJ3A 5TC4A 2O3SA 1NFQA 1NWHA 1Y7TA 2VT2A 4NDNE 2D59A 3KZVA 4R41A 3NUGA 4CM4A 2FZEA 2ZCVA 1T4BA 1GFSA 4YB8A 1HZZA 4RVUA 3ZN2A 3BTSA 1PZHA 1U7TA 1PR9A 2PD3A 4E30A 3PVZA 4DQVA 1IHYA 5G0WA 2QHXA 3MEQA 3WSWA 1LDBA 5DCWA 2Y1DA 4D3FA 2RCYA 3AOEA 1HLPA 3DFUA 2QRLA 2OL4A 2X0JA 4GMGA 3AM5A 1MLDA 5HM8A 4PLCA 4R3NA 2BI8A 1QV6A 1U1IA 1ENZA 1LLCA 2CSUA 2ZCUA 2YQ4A 4IINA 3RUDA 4OKIA 5ES3A 3QVWA 1SEVA 3PWKA 1SAYA 2X9VA 2VRCA 3I9NA 1YQDA 4YXFA 3Q6IA 1E5LA 4HFJA 3BZUA 4UVGA 3BHJA 5JE8A 1KETA 5EESA 1C0LA 4PG6A 4X54A 1GV0A 1U8XX 4BNXA 1K89A 1NNUA 1WLYA 2VHZA 3DAPA 3OM9A 1Z75A 3WTBA 3HDYA 1BXZA 4B7XA 5TGDA 4ID9A 1B8UA 3GK3A 4J49A 2Y93A 1DFIA 4O1MA 2XXJA 3U3XA 5ILOA 1UXIA 1ZO8A 3D4PA 3OJ0A 2GGSA 2XF8A 3QVSA 3NDRA 3BMCA 2Q1SA 4HFNA 4A27A 1G6KA 1M67A 2EP5A 3WIDA 1MA0A 5A9TA 1B8PA 4B4WA 2BH9A 1P74A 1P1IA 5CHEA 2DQ4A 3L6OO 2E37A 4Z3KA 3K73O 1D8AA 4GBJA 4AJLA 4L9RA 1I33A 5JYDA 3DR3A 3RI3A 1ZMOA 1XU7A 4GGOA 3DBHA 1DIBA 1PL8A 2VWGA 4XQGA 4XQCA 1HLDA 2WE8A 3W8DA 5A3VA 3H7AA 1LDNA 4E6PA 1CQJA 3BTVA 4PLTA 1PJCA 3G17A 4XA8A 4DGSA 2Q1WA 4XYEA 3UN1A 4LRTB 4JJIA 1UDAA 3WNVA 3ZWVA 1E3WA 3E8XA 5HS6A 4AJPA 4PRKA 3KEOA 2PGLA 4AL4A 2POQX 2NM0A 3RFTA 3I9JA 4GLLA 1GADO 2V6MA 4Q9NA 4BNZA 1N7GA 4MPDA 2ZB4A 2VUUA 1SC6A 1UXJA 2X4GA 4U6SA 3PZBA 3ZV3A 2YHIB 1M6WA 1NWCA 4EW6A 4G5HA 4HFMA 3KYCA 4WLNA 1P1JA 2OBNA 5CDYA 4B4OA 1VKNA 1XQ6A 4NBVA 3HJAA 3I3OA 3W4KA 2VYVA 4B3IA 2VWHA 4L75A 4WCFC 3H9JA 2GZ3A 4LN1A 3QLJA 4YAEA 1R4NB 4A7PA 4BNNA 3CUKA 1I01A 3UF0A 3EVTA 3N58A 4B8ZA 4OHUA 1BRMA 1NQAO 3KTDA 1IL0A 3PI7A 2GN8A 1I2CA 5JC1A 2AE1A 1PJTA 5FYDA 2WWRA 3MTGA 3UUWA 3A06A 1RM3A 1H6DA 2EKLA 2ZQZA 3GGPA 1Y8QA 4WPGA 1V8BA 2EJWA 3O26A 4GGPA 2CZCA 2NV6A 3ONFA 3QRWA 3GDFA 3H3FA 3AI3A 1P31A 2D3TA 4YT8A 5A9RA 1LEHA 1N2SA 4GVLA 1F0YA 3COSA 1QSGA 4YAIA 4J91A 4NU6A 5EL0A 3JQ8A 3E9MA 3L07A 3RUEA 3FWZA 4F3YA 5CP8A 3GFGA 1E3LA 1WXDA 4J4HA 2UUOA 4R1UA 4GKBA 4ND5A 2GD1O 4EUHA 2QW8A 3BMQB 2ZTLA 4II2A 4D41A 2D5CA 1C1DB 1DC5A 1UJMA 3PYLA 3DZGA 1HDGO 5CAEA 3MWDB 2AQHA 4GWKA 4YT4A 1P3DA 4DLAA 4WKGA 3OIFA 3BTUA 3GUYA 4RVGA 5KTKA 3HE3A 3L4BA 2X7HA 3STHA 3OIDA 5T6BA 2BFAA 3IMFA 3TOZA 2E48A 5TJHA 3FWNA 3H65A 2GNAA 1KVRA 1RYEA 4NBRA 1DC3A 3QWFA 2J3HA 3AOGA 4BGIA 3DOOA 2JFHA 2Q4EA 2R6JA 2PGJA 4Y8VA 1M66A 4O63O 1ULUA 3AY6A 4HUJA 4RV9A 4OGWA 4O0LA 1W6UA 3SJ7A 4YRAA 2UVDA 3I1JA 4U0JA 3GT0A 3JQFA 2PH3A 1ISGA 4W6ZA 3PYMA 3GY0A 4WJZA 4DLLA 1MB4A 4I9HA 4XB1A 3MOGA 3S55A 2IZ1A 1HE2A 3PGJA 4BKUA 5F1OA 3EYWA 2HLPA 3GPIA 4BGEA 2AQKA 3NTRA 4W9NA 5AVOA 4UULA 4TKMA 1GCUA 2CY0A 5CPFA 1F17A 1B7GO 2Q99A 4H7PA 1EFKA 4MIYA 4MVJF 1SOVA 1KEPA 2JAPA 4IJKA 8ADHA 1VKOA 4IDCA 1EZ4A 3ANMA 2VUSA 3CTMA 2JAHA 2ILTA 1DPGA 2I66A 3UCEA 4CQLA 3MJTA 4XWYA 4DC0A 4WUVA 4CLDA 2PGDA 2Y1OA 5TF4A 1ID1A 2Y66A 4IQGA 4MVJG 5COAA 3K31A 2WYUA 5JY6A 1UXGA 3GR6A 4UVIA 2GPTA 4CM4B 1A7KA 1IOLA 1YQXA 2G76A 1YO6A 3BMOB 1E92A 4YYZA 1IZ9A 2EP7A 3JQ9C 4CLHA 1D3AA 4BNHA 2VRBA 3GVIA 4CMGA 1R15A 1QMGA 5L7YA 1SB8A 4DL9A 5IDWA 4QSMA 5AXBA 3PHLA 1E6EA 2VZ8A 3F3SA 2C54A 4GX5A 4HX5A 4E12A 5A4DA 1GY8A 1XEAA 2GR9A 5JW6A 5HRUA 3T4EA 5JMWA 1T2CA 1T2DA 1O6ZA 3WYBA 3ORFA 3Q3CA 3IQDB 5B1YA 2P91A 3FNHA 1NXQA 2B36A 1VC2A 4MVJA 4PLHA 4XYLA 2JCVA 3WLFA 4FQ8A 3BYZA 1HEUA 2GYYA 5F1KA 1LDMA 1NR1A 4BNYA 1GQYA 1TB4A 2Q49A 4JLWA 1F06A 1XELA 4DA9A 4GX2A 3PK0A 2AQIA 4W7IA 2EGGA 1C0IA 2H63A 1LU9A 2ZYDA 4HXYA 4B3HA 4LVCA 3ZU5A 2IYPA 4XR4A 2OOSA 4XZ3A 4YWJA 1YL6A 3H5RA 2I9PA 4FGSA 4PG5A 3IKTA 3LT1A 1G1AA 2GLXA 3KUXA 3V5NA 3ZV4A 5BSGA 4NH4A 4D42A 2WE7A 4L4RA 1T4DA 2Y1CA 4UUMA 4UUNA 4Y6RA 1R66A 2QZ9A 3C7AA 2R00A 3QA9A 1SZJG 3KXDA 3CIFA 3ZW8A 3JV7A 1GAEO 4NMHA 4DPMA 4U8GA 1T2FA 3ZGYA 3E48A 4TKLA 1F12A 5JO0A 2PLAA 4IIUA 4OM8A 4TWRA 3SEFA 4BGUA 5BSEA 3KSUA 3PHJA 3HN7A 4MVJH 4BMVA 3FNGA 3EK2A 1HL3A 1E3IA 1KS9A 4OXNA 4QTZA 3RUAA 5ICSA 2FR1A 4J1QA 4DYDA 2W4QA 3GMDA 3QY9A 3E9QA 2PY6A 3W6ZA 4R3WA 5T8KC 3WMWA 3PPIA 3KEQA 3X2EA 3VPSA 2GUGA 2HKIA 2DU8A 2RH8A 4H3VA 3ZCXA 4CV0A 3JQ6A 3OJFA 4MOWA 5JCJD 4IDBA 2P9EA 5JMPA 1ADBA 1ZCJA 1WP4A 3WGIA 5KJ6A 2OFPA 4LMPA 1DFGA 1Q0LA 5I7VA 5H81A 2IEBA 3ETDA 2GN6A 2OXIA 2FMUA 3GNSA 3G3EA 4IMPA 3FSRA 1A71A 1PGJA 2ZYAA 4PG4A 4E4YA 3R3SA 2Q45A 3LT4A 4OOFA 5IZCC 4RVHA 4CM9A 3DWFA 5KJFA 1SPXA 2DLDA 4DMMA 4R1SA 4HBGA 4R9SA 1YONA 4LK3A 3AUTA 1HSOA 2VHWA 2FSSA 4NFSA 1PS0A 1PQPA 2OGUA 3DQPA 1I3KA 4IZIA 1Q0HA 4RF4A 2RHRA 4GAEA 6LDHA 4L4SA 3N74A 4KQWA 3PJEA 4E21A 1O9BA 3OP4A 1X13A 4NBTA 5IN5A 2B35A 1CJCA 3ADPA 3GHHA 1R6DA 3LQFA 3NJ8A 5EN4A 2QRKA 3ZWWA 1IB6A 1VL0A 1Y81A 2GERA 3WGYA 1ZK2A 1TVEA 3RWBA 1NQOA 3L6EA 2XPCA 1EQUA 3DBRA 4BQPA 2VZ0A 4YTEA 3FI9A 4J0EA 1QKIA 2JD1A 2D8AA 3KOUA 3QSGA 3WLEA 1GTMA 1C1XB 2NSDA 3UCXA 3VPGA 4WK6A 2FWMX 3FR7A 1MGOA 5B12A 1H94A 3NT4A 1XQ1A 2I65A 2FZWA 4XGKA 4OSPA 2V6GA 1ONOA 1WDKA 1R4MA 2BF7A 3W6UA 4D45A 2C5AA 5KJEA 4KMSA 1PS8A 2WSBA 3HDJA 3PFFA 4OMUA 1GQ2A 4CM6A 1K6IA 2OO5A 3CZRA 1NVTA 4JP2A 5JLAA 2UDPA 4QEDA 2E6UX 3WX0A 5IDXA 2G5CA 3VKUA 4ALJA 2Y1GA 2W2LD 1XSEA 4RLHA 1Y8QB 2ZJ0A 4PLZA 4CQMD 4XRGA 3SC4A 3ZHBA 4E2YA 3AU8A 4DPKA 4FFLA 4XDZA 3PEFA 5BSFA 2YV2A 3VTZA 2O23A 2B4RO 3FHLA 3IC5A 3SX2A 2HDHA 2HK7A 1U3VA 1Z45A 1ZSYA 1OC2A 3ZHZA 2BFOA 2AW5A 3PHHA 5L53A 4CQMB 4C7JA 4PLFA 1I32A 3JCZA 4U0KA 4KDFA 2W90A 1AN9A 3AWDA 2DC1A 1X1EA 4Y9DA 5TNXA 1LJ8A 2E49A 2VWPA 1PIWA 2CNBA 4MVJD 1H9AA 1R37A 2YV1A 2DTDA 2YFHA 4IM7A 3Q0EA 2OP0A 1LSOA 3D5TA 2R2GA 2FN7A 2DUWA 1T1RA 1B8VA 2QIOA 5CEFA 2HMSA 5I7EA 4E31A 3TZHA 5A06A 1JKFA 4AJIA 1Q0QA 3JD3A 4J7XA 1C14A 5L45A 1E7MA 4RDIA 4XGIA 3VH4A 5TJ9A 2GF2A 2X1HA 4UUPA 5CEJA 4QO8A 4BNLA 5JC8A 4D3DA 3BMNB 2VN8A 4IQ8A 3Q9NA 3F46A 2DTXA 2O4CA 3FF4A 3ZU4A 3INTA 5J23A 3HHPA 4BMSA 3FPLA 3WQRA 4Z9FA 2NVUA 1QYVA 3DBVO 3W8EA 3CZMA 4YAKA 3OJLA 1S6YA 5I9LA 1JVBA 3WIEA 4PZEA 1EUZA 3HN2A 4ZD6A 3TZQA 2EJVA 3VKVA 4BKOA 5IXSA 4LSWA 3GGGA 1WVGA 3BMQA 5FFFA 1AHHA 1NQTA 4J1TA 1V3TA 4WLFA 4CMBA 4BO1A 3O9ZA 1E7YA 1RJWA 3LC7O 4AJJA 3E1KA 4OSOA 3KHUA 2V65A 3RBXA 4GSKA 2X22A 5AYVA 4DBVO 1LDEA 1O95A 2JFFA 4F6LA 3V1YA 1GL3A 1T24A 3I83A 5JBIA 2Y0CA 2F1KA 3X2FA 4LISA 3DO5A 3FBTA 5IFLA 2WD7A 1YB1A 4KUHA 4R5MA 5MDHA 1E0DA 1PL7A 1HTBA 4QECA 2CVQA 4BGVA 1DJNA 3IAHA 4F6CA 1DDOA 2EERA 3ZHXA 3RBVA 3OF2A 4N18A 1AUPA 1GCOA 1CQIA 1WMAA 2GSDA 2VHVA 5ENDA 1BXKA 1O0SA 4AJKA 3SBOA 4ALKA 4NQZA 4HV4A 1PX0A 4P8RA 1LSUA 4XX0A 4CUJA 2YFQA 1R0LA 3TNLA 4S3MA 1R12A 4RVFA 1FDTA 3DZFA 2TMDA 2Q1TA 4FJ1A 1H0KA 1Y5RA 4NNJA 1B0AA 4MKRA 1NHGA 4AJEA 1ISIA 1BWSA 1LA2A 2I3GA 3JTMA 3AFNA 1YBAA 1QYDA 1X7GA 1XYGA 2O48X 3DC2A 1YE3A 3SLKA 3WGGA 5ICMA 1MP0A 2X5KO 5MGBA 3K92A 2BFMA 1C0PA 1DIHA 4BNTA 1PWXA 2VTDA 2B5VA 3LF2A 4PVDA 1TI7A 1A72A 3I5MA 4LMRA 1DLJA 4J9UE 1C0KA 4AJNA 4FD3A 4M1QA 4DMLA 1EDZA 1EEHA 4TZTA 1N9GB 3S2GA 4FOOA 4I5FA 5JSFA 2UYYA 4YCAA 1JTVA 2JHFA 1Q7CA 2YW9A 4BO6A 1IPFA 4NJMB 2I99A 5JY1A 1QV7A 3ST7A 3GDOA 2V6FA 1MXFA 2X9NA 3NV9A 1LNQA 3MWEB 4XD2A 3N7UA 3V1UA 3JQAB 1EBUA 2AG5A 2DBVO 5L3ZA 5CFZA 4LVUA 3ZV6A 2ZJ1A 4BNFA 5A1TA 2E82A 3VZQA 1BW9B 4CPDA 4J16A 1NPDA 3B1KA 3WJ7A 1NR7A 3WQQA 5BQFA 1E7WA 2NVBA 3KRTA 5B4TA 1MC4A 3F6YA 1P9LA 4FGWA 5BT9A 1LC3A 3TSCA 3ZDFA 3JQ7A 1DIGA 2DBRA 3D3EA 2WYWA 1WZIA 4L76A 2CF6A 4IY1A 5KVVA 2O50A 3NDJA 4S1VA 2O7QA 1LLDA 1E5QA 1WAMA 4JX8A 1CDOA 4B4UA 1H2HA 1PJQA 4K1LA 3ZNOA 2X8LA 4QT0A 3EAGA 3TRIA 4ZICA 2ZB8A 2HUNA 1WPQA 3Q1LA 1IUKA 1KVUA 1SNYA 2NU7A 4NJMA 3U9LA 5ENVA 1I8TA 3ZNNA 3D0OA 2PZJA 3KBOA 4W99A 3VZRA 4IZHA 4A5OA 3ZW9A 1IYZA 1HYEA 5ITWA 2HMUA 1BXGB 1UUFA 1LSSA 1A9YA 5L7WA 2W98A 2PZKA 3WJAA 4IBOA 4YQZA 5THKA 1KERA 1EVYA 3CH6A 3GHYA 7MDHA 4CM3A 3P5SA 1DJQA 1LLQA 3VZPA 1TT5A 2VNSA 3RC2A 3JQBA 5BNIA 1GYRA 4M49A 4CMEC 4RZHA 1QRRA 3WR5A 1DFHA 4Z0TA 1NVGA 4XB2A 3IS3A 2IXAA 2VZ9A 2GO1A 4BOYA 1IZ0A 4QFCA 2PK3A 4IJVA 4NFYA 1BHSA 4WLEA 2AEJA 4Z3DA 3RJ5A 3OJEA 3S2FA 4D43A 4DBZA 1CEQA 3F5QA 4GL4A 4UEKA 1OC4A 2YY7A 3HUDA 1LX6A 3ABIA 4MVJI 2F00A 4GKVA 1QP8A 1ZK0A 1E3WB 1P1KA 5C5IA 4W7HA 1GPJA 1ADFA 2QYSA 4K28A 4IS2A 3H8VA 4DYVA 2WD8A 4IJUA 3C8MA 2R00C 1V35A 5K6AA 3TQHA 3JQ7B 1I3MA 1ENOA 2FSVA 5BNFA 1E1LA 3HDHA 2W2KA 3C1OA 1EVZA 2FP4A 3FN4A 4EJ6A 2Q1UA 1FDVA 3GZNB 1GD1O 3T7EA 4IJWA 1K3TA 4XIJA 1BW9A 3O38A 4RQUA 5A04A 3Q2IA 1NBOA 2NTVA 1I30A 3EZLA 3ROKA 1P1RA 3LZ6A 4EITA 2X5JO 5KJCA 4WOKA 4KWIA 4YRDA 2NWQA 3DHNA 1Q7BA 4NI5A 4CM7A 5KJ1A 2YJZA 3OH8A 1LTHR 3OIGA 2BRUA 2BI7A 3DBLB 2PA3A 1VJ1A 4ZGWA 4LGVA 4JBGA 1Y6JA 3DHEA 5GZ3A 4Q3NA 2CFCA 1CETA 2D2IA 3VPFA 3MZ0A 2XXBA 3GFBA 2EEZA 2NTNA 4R68A 4NZ9A 5HWSA 5KVSA 1HKUA 3C85A 4LRSB 4BV8A 1YQGA 1K6JA 3JYPA 3LVFO 3GNQA 1HDCA 1QYWA 5EJ2A 3WB9A 1LC0A 4YPOA 3MJSA 3G49A 4TMFA 1Z7BA 3SXPA 2NNLD 5I7FA 2B4QA 1BDBA 1X1TA 1UP4A 3CSDA 4XJSA 4GH5A 2PKRA 4Y98A 4CM9D 4HFRA 2OZPA 4KWHA 4JGBA 2YDXA 3ZI0A 2ZTVA 4IDAA 1J6UA 2WM3A 2HMVA 3E6AA 3UFXA 1XCBA 3OQBA 3JYQA 5IZ4A 3FRJA 3RJ9A 1HYHA 1LRLA 3L9WA 4N54A 2GRAA 1HDXA 1ULSA 4BNVA 1H2BA 1PJLA 3F5SA 3H2ZA 3WFIA 1YB5A 1KYQA 6ADHA 5HBRA 1EQ2A 3KLPX 2EW2A 4ZRMA 5A02A 2BLLA 2VCYA 4DPLA 4K26A 1G0NA 5DN9A 4AJHA 3RAJA 3ZH2A 4DIBA 1Z73A 1VJ0A 2EHDA 4M89A 5DBIA 2X0NA 3ZZNA 4XCVA 3DZBA 1YRLA 4BO5A 1OZAA 2CMDA 4KOAA 3U4HA 3E03A 5I7SA 1AE1A 1E3JA 1I2BA 2I6TA 5EMHA 4D0SA 1NASA 4CM8B 1P45A 4Z6KA 5IN4A 4RPHA 2Y1EA 3HSKA 3I9MA 5EINA 1K5HA 4E5NA 2OORA 4CQLB 9LDTA 1I36A 1W8DA 1DAOA 4Z9YA 1JU9A 4BNKA 2RAFA 1O89A 3PZRA 1HDYA 4GVXA 4AG3A 1FJHA 4MP3A 1BVRA 3FD8A 5DCUA 5TT1A 4QO7A 2HO5A 1WDLA 3PRJA 2JKVA 1HE5A 1XIVA 2YHUA 1JW9B 3L4SO 4RQTA 4Q39A 1ZXLA 3O8QA 3PWZA 5F5LA 3WMXA 2IE0A 4J9VA 1TT5B 1YJQA 4RPLA 3HG7A 4EBFA 1XLTA 2HRZA 1HWYA 3JD4A 4YT5A 1OAAA 3JD1A 3PLNA 4MVJP 2O2SA 5DBGA 1XHLA 1E1MA 3H2SA 3GQVA 3ZU3A 2HU2A 3DB2A 1VI2A 2BGKA 3QP9A 1YXMA 5KNLA 1GQQA 2D1YA 3VTFA 3BAZA 3BMNA 5TS3A 5G0UA 4TSKA 3WNQA 5CG1A 4OQZA 3A4VA 1JWAB 1H6BA 4ONEA 4YVFA 5IZCA 1H5QA 1PEDA 1QLHA 1VL6A 3DZKA 4IQ0A 4O6VA 4KZPA 3RIHA 4YR9A 3U5TA 3PXXA 3RVDA 4ZQHA 1Z6ZA 4W82A 5IJZA 2Q3EA 1M76A 1SEPA 2VYNA 3EVNA 5ER6A 3CXRA 4O59O 3WDSA 3EW7A 4PLVA 3D5QA 4BMNA 3GC6A 4I08A 3AW9A 2X5OA 1PWZA 3LK7A 2HMWA 2FR8A 4OIMA 5GMOA 2ZIZA 3NDIA 1BMDA 1YKFA 1PZEA 3ROPA 1E1NA 2B5WA 3NAQA 3EMKA 1X15A 2DPHA 2GASA 2GDZA 5FI3A 2DUUA 5DDIP 3BHMA 1EK6A 2WD7B 4CM1A 1NP3A 3QWIA 1VLLA 1ADGA 5JCXA 1H6AA 2GZ1A 3OQ1A 3WICA 4R01A 4WECA 3JQAD 3JQGA 1ISJA 4Q3CA 3A1NA 3ON5A 4OL9A 3ZWYA 4WOJA 1ZBQA 2VHYA 3GAZA 1GPDG 2VRCD 5JNLA 4WASA 1PQWA 1KOLA 4FFNA 5C3MA 4MIOA 1KEWA 3NEPX 3G1UA 1Q1NA 1MG0A 3QWHA 4HNHA 4U5QA 1UAGA 1UP6A 2LDBA 4FC7A 2J5QA 3KSDO 4ESOA 4U7WA 1H9BA 2PFGA 4CV1A 1ISFA 1U5CA 2IRWA 3RC9A 3W4JA 3WXBA 5DF1A 2DVMA 2Q50A 3IUPA 4ZQBA 4NBWA 1JKJA 3IJRA 3JYOA 2EIHA 3I9LA 3KSZO 1DIAA 3WWYA 1ONNA 3R6DA 2D5AA 4C4OA 4CV2A 2JJYA 5C7IO 5L4SA 1B16A 1GYQA 3D3WB 4Y67A 2ZB7A 1NVMB 2I67A 3JQBC 5F3RA 4AJ4A 5KCZA 4RORA 2DAPA 1HT0A 2VWQA 3PLRA 3MOIA 1GEEA 2Z95A 4E3ZA 4UAGA 4M87A 4F46A 4PZCA 4GI2A 3RUCA 3A14A 4K9DA 2EWMA 2HMTA 2LDXA 4IGEA 4ZA2A 4AFNA 1I5RA 4CMHA 3VVBA 2B0JA 2BD0A 3GAFA 4JXKA 1KEUA 4BB5A 3PYXA 2HJRA 3L77A 3JQDA 2BGMA 3UXYA 3P7MA 1ML3A 3QWBA 2OBYA 1B3BA 1RM0A 4N5LA 1CF2O 4OXYA 1MXHA 3JD2A 3RD5A 4ITUA 1F8FA 1LI4A 1ZJYA 3GZNA 4EDFA 1LDGA 5KKAA 3TPCA 1E6WA 2V6BA 4YAJA 2O3JA 4YJGA 1L7DA 4YAGA 3BXXA 4ND2A 3U49A 1I24A 4CUKA 3IL2A 4TRRA 2X86A 4FOSA 3DEYX 3R1IA 5T67A 3ROMA 2QZZA 2C5EA 1CRWG 3U09A 1ORRA 4EGFA 4DVJA 2O3UA 2EG9A 2DFVA 1QXSA 2C2XA 4A26A 2NQTA 1O8CA 3BMCB 3F1KA 4ROSA 3E9NA 1A9ZA 2NU6A 1CIVA 1GV1A 2P9CA 4N5NA 4PCVA 4XQEA 4DWVA 1JVSA 4NHEA 4R51A 4ZQGA 3B70A 3NT5A 4TZKA 4DLBA 2AA3A 1A5ZA 4N5MA 2X23A 4CR8A 4KQXA 1R16A 4BO9A 3H9UA 1MFZA 4P22A 4NK5A 4L4XA 3IUSA 1U2DA 4E33A 1UZLA 3PP8A 1Y5MA 3WWZA 2CF5A 4CODB 1E7RA 1IE3A 2VOEA 4IDGA 4B79A 2C7VA 5JXWA 4WE3A 2PH5A 1EDOA 2BGLA 3S2IA 1XDWA 1R4MB 4FPXA 1N1GA 3ULKA 3UW3A 3WSVA 1PGQA 5I8WA 4J43A 4MIEA 3U4IA 5LC1A 3V2UA 2Z1MA 2P2SA 4EYEA 1PGPA 3PGXA 5H82A 4UUOA 2CUKA 3HZZA 3TDKA 1UDCA 1C1XA 4IMRA 2VYVD 2Y67A 4BO8A 2IODA 4E32A 3WBFA 1XR3A 1GEGA 2NACA 3I9KA 4BKPA 4J2OA 2UUPA 4DRYA 1U3UA 2EGHA 3PQEA 4PRLA 2FPIA 2AQ8A 1YDWA 2PKQO 3VAZA 3QW2A 3ONDA 1ZW1A 4IIVA 4XKJA 2B83A 2ZKLA 4YQYA 1LRJA 2O2YA 1GDHA 1VJTA 4BB6A 4D46A 5GZ1A 2G17A 3OMLA 3QV1A 4JP3A 3OJOA 3ADOA 1TXGA 3DMTC 5F21A 4R1TA 4WLVA 2AMFA 3DZIA 2G82A 4JROA 4II3A 4TROA 2W2KB 3OHSX 5DT9A 1E6UA 1X7DA 2FHSA 3WTCA 3NKLA 1NFRA 4YJHB 1K0UA 1F8GA 3WGOA 2NADA 1W73A 3G79A 3NYWA 3JQAA 1KEVA 3MJCA 4R1NA 3E82A 1DO8A 3RC1A 1E1KA 4CMCA 2DFDA 1HETA 4P4NA 5H83A 1K6XA 2VOJA 3H9QA 3LU1A 4LCJA 3W1VA 5EPOA 4R54A 4UVHA 3GNTA 5CG2A 1TLTA 3PQDA 3LLSA 5TQVA 4E2XA 3DBLA 2CDBA 4R4JA 4KDEA 4E5YA 3LSYA 1T2AA 3K8ZA 5ILGA 3UKOA 4NR0A 5KKCA 3GEDA 1PGNA 1B14A 5B37A 1J49A 1GZ4A 3KLMX 3AFMA 4ZJUA 2Y0EA 1UZMA 3RFVA 2EW8A 4CMEA 5DBFA 2P4HX 3F4BA 3IP1A 4ALIA 1A7AA 2SCUA 4QQRA 5L51A 2VT3A 1KBZA 1U3TA 2CVZA 3WOHA 3EZYA 1T2EA 2I3AA 4E5KA 1NAIA 3H9GA 4MKXA 3TL2A 2JHGA 1NPYA 3LT0A 5DZSA 3I52A 3INRA 3KO8A 3UAGA 4OH1A 2J3JA 2JD0A 4IDEA 4WNIA 3VVCA 3RC7A 3AM3A 3QWAA 2OUIA 2P68A 3ZWAA 4I9UA 5CEEA 3IOYA 1YVEI 4RO0A 2FR0A 4OOEA 4BHTA 4IDDA 1HE4A 4RL6A 3M6IA 4PG7A 4GWGA 5G4KA 1J5PA 1H93A 5EQFA 1XG5A 1BDMA 2J6IA 1SCUA 3K96A 1PQUA 4ND4A 3WFJA 3CPSA 4I5EA 3GEMA 1X7HA 3H9EO 2IDZA 1IPEA 3GOHA 3VPXA 1TA4A 2RHCA 3IIEA 3TF5A 4DIOA 9LDBA 4I9NA 1V9LA 3V2HA 1HDOA 5CDUA 1VRWA 5T64A 2Q2VA 4I5DA 1FXSA 1NX6A 1PU2A 2XOXA 3ITDA 1DXYA 2Q4BA 3WYEA 2UV8A 3MJ4A 4J4TA 3UHAA 3RUHA 5KWEA 1HE3A 4EI2A 1U9JA 4OAQA 2CDAA 1NPTO 1ZEMA 2HCTA 1KY5A 2FPGA 3EGOA 4W9NC 3ZWBA 4OO3A 3ZWMA 4B8WA 4BQRA 3GGOA 3OEWA 3MJEA 3AY7A 4K6FA 3ZV5A 4AICA 5JAQA 2RBEA 3L9XA 3TJRA 2Q2QA 3AK4A 4CV3A 1ENPA 3VOSA 1NM5A 4PG8A 4PLYA 1ZUD1 1D1SA 4RPKA 4ALNA 4GSLA 1EE9A 5B4VA 3OECA 1Q7GA 3TZ6A 1J0XO 5DULA 5DP2A 4G2NA 4BO3A 1YS4A 4O5OA 4I8XA 4FJ2A 5A05A 2DM6A 4Q3DA 3QVXA 1YBMA 1HDRA 4JJGA 2UAGA 1V3UA 3SVTA 4CLRA 1KC1A 3O03A 1PZGA 3MTJA 3H6KA 4YJGB 1QG6A 1YB4A 3FPCA 4LW8A 3TZCA 4AVYA 5L7TA 2BHLA 1K2WA 4FFPA 4M86A 1ZNQO 1PJ4A 3CE6A 1GZ3A 1I10A 1EUDA 3RBZA 4ALMA 3ZNQA 4ILKA 2Y99A 5A03A 2VTEA 2Y68A 3KYDB 1DC6A 4IXTA 1SBYA 2J3IA 1ZVMA 3AUAA 4GX0A 2GCGA 4CLXA 2GN9A 3CMMA 3UVEA 4QX6A 3UICA 3JQFC 1YOVA 1B26A 1Z74A 3KV3O 1D7OA 2PV7A 4XYBA 3W4IA 1U28A 4XDYA 3TOXA 4PLWA 2PZLA 1U3WA 1XA0A 4BNMA 1GU7A 1BG6A 3L0DA 4CMJA 5L95A 2C07A 1U2GA 2OP1A 2WTBA 3JQCA 4DQUA 5F1PA 1KC3A 1JQBA 1NHWA 3E5RA 3E18A 2PKQP 2ZATA 1NTOA 3F1LA 1KIFA 3AI2A 5LCXA 3ZNPA 4F45A 5A5EA 4JNKA 1YJ8A 5K9ZA 1VSUA 1WZEA 2D0IA 4RDHA 4PLGA 3HADA 5AXDA 3NGLA 1UH5A 1EFLA 1UXHA 2EV9A 4NPCA 3PJGA 1U8FO 3DZJA 2FRDA 4EEXA 4G65A 3IDSA 4UREA 3HB5X 3K9QO 1EE2A 3KYCB 2IYOA 4YDRA 5FF9A 5L4LA 4KTTE 2WMDA 1Q2XA 2A92A 3P2OA 4H16A 4BNUA 1S7CA 3O4RA 1UP7A 3I6QA 4NIMA 1VE9A 1SO8A 1X0XA 2DTEA 1PJ2A 4YJFB 3Q11A 4BKQA 3OFSA 3HFSA 2EKPA 4JN6B 1GUZA 4E0BA 5K6AC 4Q3BA 3ONEA 1OMOA 2NVUB 5JFOA 1AGNA 5JYEA 1L7EA 4LCEA 1XU9A 5C7OO 2BKAA 4E5MA 4E13A 3AM4A 5TLSA 1KVTA 4YJHA 3JYNA 2JFGA 3WS7A 3D1LA 4YJDA 1YBVA 4NU5A 4TQGA 4ALLA 4Z0PA 4ND1A 5TX7A 4TRJA 1IY8A 3F4LA 1HF3A 5JPIA 3OSUA 1TT7A 3PJFA 2FPPA 4D79A 4PIVA 1WNTA 3K6JA 1GYPA 3GVHA 4URFA 4Z0HO 1JWBB 3EDMA 2HJSA 5L4NA 4BS9A 1MV8A 3QJ5A 2P5UA 1DIRA 3ETEA 3GRPA 3JQEA 2ZYGA 3NRCA 2DBZA 2DT5A 3R0IA 1ISHA 5EIOA 1LDYA 1JKIA 3VDQA 1FF9A 2BELA 3RKRA 4R16A 5DOZA 3E5MA 3G0OA 1JLLA 5G0SA 1M6HA 2IEDA 5JAZA 2P4QA 4CLOB 1MUUA 1FDUA 3RU9A 3ZWNA 5KIAA 2TMGA 1OI7A 3V2GA 4CUZA 5A5FA 4QXMA 1C1DA 1DRVA 1JN0A 4UEJA 4J7CA 3DONA 4P4GA 3GN1A 1MFPA 4XR9A 4HNGA 1RPNA 4FFMA 3DMTA 3K30A 4IPTA 4CMIB 4QFDA 3LC2O 3C1AA 3FTPA 3JQ8B 5U9CA 3MCVA 4LSMA 5IAAA 5AQ1A 2IZZA 4CR6A 1TEHA 2GN4A 2C59A 3GF4A 3KYBA 3SJUA 3GPDG 2H1SA 1BTOA 2G0TA 2ZQYA 4MP8A 4MO2A 4PFJA 2E4AA 2ZTMA 4RPJA 4WNCA 2Q2WA 3L4BC 3S2EA 4RJTA 1FMCA 1FDWA 5JDIA 3NTQA 4WCDA 3K5PA 4ZHSA 4J2HA 1N8KA 3DOCA 2H5LA 5JAIA 3RKUA 4E2WA 1PTJA 4CMAA 3EY4A 2JCYA 4YRBA 1C3VA 4PGFA 3FNFA 1LSJA 4D0RA 2Y0DA 3C1TA 3VC7A 3I23A 1UXKA 1HXHA 1IHXA 1YH3A 1N5DA 2B69A 3GG9A 3VH2A 4IGFA 3H3JA 5JS6A 1MC5A 2V7PA 1WWKA 3LDHA 4DC1A 1HZJA 2XAAA 2WJPA 4P38A 4NK4A 5A9SB 1U7HA 4EZBA 3KVOA 2O4UX 2VHXA 1DRWA 4BNWA 1WMBA 1ADCA 3GRKA 1HYGA 3BTOA 4GQAA 2B4TO 4CM5A 3V1TC 4K6CA 1LLUA 3BIOA 3PQFA 2FOIA 2HQ1A 2PR2A 3L6DA 3DHYA 4NFHA 1P77A 4XEHA 2AG8A 3VDRA 1ZMTA 2JD2A 3BHIA 2YYYA 1AXEA 3UCFA 2Z1NA 4RLSA 1E3EA 4J3FA 1DLIA 4B4VA 5IF3A 3FBGA 2QX7A 3ITKA 4J0FA 5CDGA 3SLGA 5B4UA 1PJBA 1X14A 3GVCA 1N92A 4CL8A 4CMIA 1J4AA 4ZRNA 4MKZA 3P2YA 3M1AA 1A27A 2P5YA 1R0KA 4UVDA 4CQMA 4W4TA 5COBA 4EUEA 7ADHA 1N9GA 3UGKA 1DSSG 3WGHA 5ER9A 2C2YA 5IG2A 1NFFA 3HNPA 3ZWOA 3JQ9A 5GZ6A 1LRKA 1R4NA 2A9FA 4GLOA 4FFOA 3Q9UA 2NQ8A 1EBFA 2J8ZA 1ZSVA 3QE3A 1DBVO 5G0TA 3M2PA 3GDGA 3WYCA 2QQ5A 1FK8A 3PHGA 1NYTA 4J7UA 4WLUA 4G81A 1YL5A 1QORA 4CMKA 2JL1A 3RCBA 2YZ7A 3GN2A 4WCFA 4L74A 1U4SA 5TRTA 4WLOA 4ZN6A 3I6IA 1I3NA 3IP3A 1Z82A 2PTGA 4CLRB 1LBEA 3DXFA 4L8VA 3GVPA 4A2CA 3UOGA 3WGTA 2NTJA 4FW8A 5JO9A 2C82A 4AJOA 4J1SA 1GUFA 1RKXA 1ARZA 1UR5A 2GZ2A 4RCVA 1F14A 2O7SA 1EVIA 4FFRA 4CR7A 2HSDA 3U62A 4RF3A 3ENKA 3IJPA 4PZDA 1ZFNA 2HK8A 5L9AA 3GG2A 1PL6A 3ASUA 1V3VA 1YGYA 1ZXBA 4RF5A 1DHTA 3TFQA 3ZWPA 4JBIA 5CPBA 1ZZEA 4RVSA 5A9SA 5DCYA 3HQ4O 1DRUA 1FDSA 4RF2A 1DEHA 3CKYA 2NU9A 4EJ0A 5I8ZA 5L40A 2WEKA 2RH4A 1DOHA 2W8ZA 2I76A 1L1FA 2EKQA 2NVWA 2FY8A 4E5PA 3ETGA 3RSHA 4MDHA 1V6AA 4A03A 2YDYA 3TL3A 3H5NA 2HAEA 3TWOA 2AEMA 1IULA 1YDEA 1O5IA 4GMFA 3TFOA 3HB4X 1Y9AA 1P0FA 3B6ZA 3RFXA 3GLQA 1OBFO 3DOJA 5I9NA 2BMAA 4B7UA 1PJSA 4KUGA 3DBRB 1QYCA 4BO4A 4CLOA 3C7CB 4BVAA 5A3JA 4Q3AA 4BO7A 3LT2A 4NBUA 2IXBA 2DPGA 3ICPA 3LLVA 3SC6A 4M54A 2ZB3A 5IDQA 4M8SA 2WYVA 1ZSNA 2OMEA 3DL2A 1P44A 4CL3A 2X0RA 2O3QA 5JDCC 1P33A 1JAXA 4WEOA 4BIIA 2QYTA 1GZ6A 3EC7A 4Y6PA 2VYND 4A0SA 4B7CA 4BO2A 3F9IA 4BV9A 2AXQA 1ZK1A 5DP1A 2O3TA 3OQ6A 4OJNA 5HA5A 4Y6SA 4IUYA 4QUKA 3VH1A 4INAA 4FDAA 5CDTA 3QVTA 3W8FA 3WGZA 4R5HA 1I0ZA 4XRRA 1HRDA 2B37A 3Q2KA 1NQ5A 4OKNA 4TRNA 3A9WA 3LYLA 4FSHA 1N7HA 1XKQA 3QQPA 1P0CA 3K2EA 3RU7A 1BSVA 3PWSA 5T5QA 3BA1A 4XQ9A 2W2LA 4DXHA 1Z7EA 1HDZA 3ANLA
chains in the Genus database with same CATH superfamily
3KETA 2JI7A 4XARA 3PTZA 4G6ZA 1P6XA 2C0CA 2H1CA 3JZMA 4JJFA 3H5TA 3ZZ1A 4AF8A 4DLYA 3SBEA 2XNHA 5JAMA 1GVNB 1K7SN 2R6R1 3ROQA 3LA8A 1IN4A 3BWDD 3L7NA 1G21B 1EFUA 1KK2A 1KO4A 1OLSA 3N8IA 3O8QB 2I6XA 2PMFA 3QFFA 3S3TA 2GM5A 1KY4A 1ZM7A 3OIVA 4V24A 1OB5A 1P61B 5H70A 1V0JA 1GGFA 1XZEA 2VSYA 1E7QA 3I92A 3WGQA 4M1TA 2NXCA 1OFVA 5C34B 2ATCA 4QSHA 1CYDA 4DUZB 2XIJA 3OA2A 4DUGA 1CERA 1N2JA 3BD8A 5AICA 3JD0A 1U8ZA 3EZ9A 1BVUA 4JBWA 2CVFA 2FPRA 3IVAA 1HMYA 3ZZMA 4GDFA 1XXLA 2V7BA 4MR9B 4DCNA 3G9UA 2QPLA 1SVMA 5B3JC 3KB6A 2FZKA 3AX6A 4JIGA 1QG0A 1J23A 1UJ2A 3EG5A 4R81A 2XUDA 3PITA 1UBLS 4IS3A 3TOVA 5KQLA 3VOBA 1KDPA 1E66A 2Q3JA 2OT3B 4H15A 2F8LA 4QAQA 3FTNA 4LJ9A 3RUFA 3LGSA 4LRUA 3EVAA 4M7RA 5BV8A 1HYBA 4HEHA 3H13A 4EMSA 1R8QA 2IP2A 3CXUA 3B8HA 4HB4A 4LXXA 2HL6A 4NPHA 1OFGA 2YN0A 4OHCA 4QJ5A 1CS0A 4BVHA 2C20A 3HEMA 5ALMA 1AUOA 4RLQA 2K5UA 4ENUA 1ID8A 4RZ2A 1DB3A 1B73A 2JIMA 3ZVNA 1KY3A 3WE7A 1P1FA 3M6FA 1H22A 3IKVA 3KWFA 4L9SA 2IQIA 3T1HB 3FOZA 4MRRA 3KQNA 4OQQA 4FB5A 2JRLA 3D6MA 2FG5A 2B8NA 3CV3A 2AIRA 2ZUUA 4L3WA 4LNAA 5ICFA 4HLDA 4KYIB 1GKUB 2QN6A 2BM0A 4IIBA 1ZK4A 3GIWA 2C7GA 3TLYA 4TVBA 1SXJB 3LOPA 4YJFA 2P2LA 3QM1A 4PPFA 5FV7A 1OOEA 2C58A 4UFPA 3Q9SA 3TW4A 3ZHTA 5JADA 4PCUA 1G98A 1HZZC 2O2DA 2B3DA 5AKXA 3SIXA 4LHYA 4A10A 3JSAA 1PR0A 1ZD1A 2XQKA 3EIXA 1MJGA 4G5OA 1J7KA 2PGXA 4N6OA 2XYQA 4TTQA 3GUCA 4R98A 3R9KA 3EXFB 4C4PA 4YPVA 2B1QA 4ICIA 1O77A 1RAFA 4RGQA 1U1FA 1ZVJA 1VHQA 3OICA 4LVNA 4AYWA 4QGBA 4N0PA 4ZHQB 3PC8C 3AH8A 3SF8B 5KB3A 1G8SA 3JQGB 4LZLA 4P9NA 2RHBA 3ENNA 5BNTA 4HNQA 1PR6A 3Q40A 1NUHA 3N2EA 4XVRA 4DNOA 5JDCA 4K9QA 4RVDA 3GXOA 5EZ6B 3CRVA 1VPDA 3AY3A 2AH5A 4Q3LA 5CR9A 3UB2A 4AX4A 3EQ6A 1GGEA 2Q9BA 4LC9A 3TDMA 1V8ZA 1W8IA 4C6TB 2VATA 2EC5A 1JH9A 1Y9EA 3LX8A 4WCFB 4G24A 1KVQA 4QOEA 8LDHA 4JEHA 2Q3HA 3HM9A 3NHWA 4WT7A 3DDNA 3CJQA 3ELUA 3FI0A 4P4LA 4P83A 4L0CA 1EVLA 4FI3C 2MR6A 3AEXA 1SWVA 3CNOA 4JU9A 3FNQA 2GCOB 3Q4GA 5DWQA 5IAEA 5T8KA 5A1JA 4ZYTA 4JFAA 3N0WA 5FXMA 1G21A 1JXMA 2EFEB 2QNRA 1X0VA 2P90A 1YZ3A 3NYIA 1MX3A 3Q7TA 5GQSA 3QIVA 2WJWA 2H6EA 3L0BA 2JAWA 4MKIA 5ALDA 1V71A 4NOJA 3WL5A 3VU1A 2A94A 2Y05A 3PF9A 1ORIA 3U7HB 3E9DA 1Y4SA 1AMNA 3IEMA 2FN3A 1BCSB 4LJ7A 4XJTA 2PE5A 3QMMA 4KQCA 4MITA 1Z37A 3LLCA 3I8XA 1XC7A 2O2IA 3N6VA 5BR8B 3U4QA 1XE3A 2RGCA 4IKEA 1DHRA 3MLAA 1W0KA 3A6DA 4MKFA 4JZKA 3PEVA 2ZSDA 4MGHA 3ZTTA 2QTVA 1CWUA 4DUPA 2BKUA 2INGX 5LWHA 1A4UA 1CDZA 3DAGA 2A2ZA 4RKFA 3T7CA 4A8JC 1PS9A 5IX8A 3A1UA 3STXA 3A28A 3V4FA 4CG0A 4DR1B 2E7ZA 1W19A 1USGA 2ZTUA 2HRBA 3INGA 3WBBA 4JYZA 4D9EA 3NBFA 2O3RA 4FE7A 2J0VA 2HYIC 2I7XA 2X6TA 3OA0A 1XTSA 4WMLA 3I5XA 4RL4A 4TL7A 4R2HA 1G59A 3OOJA 3I12A 3F5MA 3UB3A 2AJBA 2H5JA 3CRZA 5DM4A 5A6SA 5KSWB 1XPUA 4KR6A 2D54A 3PJDA 1R27A 3PJRA 1KVSA 5I9MA 1SCDA 1UK8A 3AR2A 3EHDA 2JPDA 4G5YA 3ZI7A 2ZREA 5GGYA 1E20A 3LF1A 2YNMC 3EF3A 3BMOA 4KN5A 4ARZB 1YS2X 4J90A 4AZ3A 2IOYA 1LXCA 2ZJBA 3UAOA 5BSHA 4US1R 5BY2A 2RGWA 4GIBA 4BECA 2QPAA 2QDKA 3DFZA 3LUDA 1EXNA 2EKDA 2C04A 5BV0A 3VVMA 3X0DA 3DBHB 5GTDA 3F6SA 3NWOA 1E3DA 3FSEA 4LDRA 4WGGA 1PD0A 1CJSA 2PKCA 2YOHA 4LQ4A 3B2NA 3FOFC 5DU2A 1FYXA 2P6MA 2PWZA 2HWWA 3R3JA 3VR1A 4XUGB 3DVAA 1OA1A 3LC1O 4YBZA 1E5DA 3AHEA 3T35A 4R7GA 1H6CA 3DDZX 3INNA 1U4OA 3M2TA 1NRIA 2B1IA 3B1JA 2C61A 1KOFA 1P1HA 3H97A 3DH0A 4FYVA 3OCVA 2VNAA 2ZT5A 1N1EA 1TZ2A 3QW4B 3MRVA 1SUIA 3KYIB 4NJOA 2BM1A 2V54A 4FI3F 4YP7A 1RZUA 4V03A 3T3PB 4GZ6A 1WM1A 5HDBB 1TE2A 4HWKA 1OWNA 1U5BA 2BFPA 1KJIA 1SPBS 2VEDA 2WUFA 2ONZA 3HBAA 5E4YA 5E0KB 2CN1A 5K6TA 3KQHA 4LGMA 3IAAA 2JGMA 4QTYA 2XKBA 3MT7A 5BN4A 3MRSA 3H1BA 4YJ2B 2B7CA 2Z4RA 5G4LA 1Q57A 1R4AA 2QSUA 3NC4A 4L28A 1J8QA 4OLHA 4WEQA 5JASA 5JNRA 4U7FA 1ZKMA 5LMUB 5CA0A 3RRMA 2ZSBA 4BXOA 5HF8A 1Y6QA 4TMTA 5HX7A 4Q9LA 3TAXA 2AK3A 5ITVA 2ZRIA 3TZLA 1A8SA 4Z9BA 4WKNA 4BL5A 3FH0A 4M1SA 1OWLA 1XO1A 1JLRA 2P30A 2VF8A 3G2OA 5JCZA 4QT4A 1C9EA 3IRUA 3DHWC 1NVVR 2ZYHA 1PDOA 1YR1A 4JBHA 1ZYUA 1RW4A 4HY3A 4H9GA 1GUYA 4QA9A 5DCLA 3UK2A 1BE0A 2QBYA 4OLBA 1TYZA 3VHRA 1US8A 4RK0A 5GOTA 4AUKA 1BWPA 2OK8A 2ETVA 1YL7A 2XWBF 4KVGA 1D4FA 1W4ZA 3PNPA 2HW8A 2QLBA 4BJHB 2AN9A 4TWZA 1RFGE 3QPAA 3B53X 2AUMA 3MJVA 4UHBA 4BP1A 1P2BA 3ICCA 7GPBA 1J1UA 4ZFNA 4D8TA 5FT9A 3ZVKA 1AO0A 3PFWO 1K88A 4ZRDA 2R7KA 4PGHA 1QLJA 1TNDA 5IC6A 3EPLA 1DBPA 1MDFA 5ARDA 3ZBUA 4AU1A 5EJEA 2O3SA 1H3EA 5HZMA 1XEWX 2VT2A 3GEPA 3O94A 1CULC 4NDNE 4LHEA 4RK4A 1Z6AA 4YRKA 1G8YA 3MMNA 2IHTA 2J30A 4RNCA 4R41A 2CD7A 3M9WA 2J48A 2WJ6A 3O0DA 1VB3A 2FZEA 4O2RA 4QHTA 2AR7A 4CM4A 3OM0A 3IDZA 2AUTA 3FB1A 3UQYS 2BFDB 2J08A 2J0UB 3C5HA 3OP1A 4FM9A 3RS2A 1UKYA 2ZAGA 1LW7A 3DWGA 5D2CA 3PD7A 2XMRA 1O0CA 4WZAB 4DQVA 1J99A 1IHYA 2G36A 1VECA 2W2QA 1OHHD 1MO4A 3AVXA 1U3GA 1ZA2A 2CHEA 3JAKB 1GR1A 3O73A 1CQJB 2WAYA 5TQ0A 2X0JA 2QE7D 3BCHA 3RSCA 2I6FA 4EVQA 3KQKA 3NRJA 2QN1A 1GAWA 2BI8A 4IIJA 3AESB 4Z54A 1KZ1A 1ULAA 1V8DA 4FLMA 2VPYA 4B6RA 2QXYA 5K4AA 2YQ4A 1TTHA 4OKIA 2P9TA 4PO1A 5ES3A 4C7MA 4KV9A 1L4MA 3K0KA 4OTZA 1SEVA 2WF8A 2PUEA 2X9VA 3E5NA 1ST2A 4OB7A 1RLMA 1T9AA 2WA2A 3Q3VA 4MUBA 3F74A 1MPXA 4BNXA 1UPUA 3LPLA 4KWEA 1HFEL 2VP3A 4CIBA 3WLJA 2AI1A 1DGQA 3TNDA 3VR6H 1CY8A 3HDYA 5CTJA 5J4VA 3MMXA 4REQA 1TQ8A 2GBFA 1Z2PX 4UU7A 4YMSA 4GP7A 1B8UA 4MX8A 3V8NA 3TIVA 5HFNA 5AW4A 2Y93A 2DULA 4L2IB 2PBRA 4UAJA 2XXJA 4CMHA 4L0MA 4WOBA 1S2MA 2YRXA 4EIWA 3EC1A 1ZO8A 2GGSA 1VMAA 3UG7A 5H1YA 1JMKC 1GUBA 3GA5A 1N2CA 3QVSA 4MQBA 3L40A 3T3GA 1GT91 1HQCA 1HT3A 2Q1SA 2H52A 2X19A 3IVCA 1L4KA 4MEAA 3RQIA 5KPDA 2G04A 1SVNA 3BJEA 1MA0A 3D2CA 2C2ZA 4P35A 3CT6A 4B4WA 1V7QA 3M8KA 2DQ4A 3A6EA 1BCRA 5FWXA 4Z3KA 1WABA 4L4UA 4EJ2A 4YV7A 2PU7A 1XQXA 4AJLA 4YMTA 1GZ5A 1QVWA 5JYDA 3DR3A 4W1QA 1I0IA 3RI3A 4DAOA 5I7OA 2FN4A 3FBWA 1ATIA 1ZIOA 2OV8A 5JHGB 3E84A 1A8UA 2ODNA 3LNCA 4MV9A 2LD4A 4UBKA 5CNKA 4D9HA 2IBSA 2GPJA 1GTSA 1X70A 3L93A 4QOGA 3H7AA 4QOIA 4P0PB 4HK4A 1LDNA 1QYRA 2Z43A 3HR8A 2NPOA 4PLTA 1IDOA 3UG6A 4LRTB 3ZOZA 4GVPA 5GJWC 4C7VA 3ER8A 1CUXA 1E3WA 5BN5A 3PFKA 2O8EA 3K6KA 4ZT6A 3GMIA 4AL4A 1DXOA 2HGZA 3AV0B 2A0WA 1F2UA 4GNRA 2X3YA 4L5YA 4RD0A 3EXHA 4MQFB 2V6MA 3P9SA 1G17A 1N7GA 4CKEB 1QU3A 5CJ2A 3PE3A 1Q1EA 1X8KA 4UNNA 3GLFE 1Z25A 1BXRA 2H9YA 3EFOA 5DGDA 2Z6QA 3VUFA 2YHIB 4EW6A 3V4ZA 5DRTA 3VYWA 1DRJA 3OZIA 3CVVA 1SC4A 2O7RA 2CLDX 5LP6F 1WBBA 3W4KA 2D2FA 2W0MA 4JP8A 4B3IA 5JXHA 2JGNA 5JQGB 2VWHA 1YAJA 1I1OA 2GZ3A 4X1IA 1S9HA 1F5SA 3KKPA 3QLJA 4YAEA 3W04A 4B43A 4BNNA 4KE9A 1I01A 2ZB2A 3R6LA 3BWBA 1P7WA 2F17A 521PA 3N58A 4ZO6A 1NQAO 2G9QA 5K8TA 3PI7A 1NDHA 2RHJA 3VNVA 1T8SA 1Q14A 1RZRD 2ABWA 4J6EA 2COEA 3EXAA 3C3CA 1H1LB 3GJ6A 4O5AA 1SG9A 2PZAA 2WWRA 3JQRA 5DB4A 4F4IA 5A62A 3TPFA 1JEDA 4ZK2A 3UUWA 4BJ3A 4Z7NB 10MHA 1H6DA 2EKLA 5CH3A 2YRFA 3WWCA 4Q01A 3H84A 3DTVB 4GGPA 1XTKA 3CQ9A 3IEPA 3ONFA 4G23A 2GD2A 1LEHA 1N2SA 2HQBA 3FKJA 1DUVG 4WRRA 4ZI5A 3HEBA 3FG9A 1S2DA 4ESEA 3H4TA 4KXYA 4PYRA 1ZJJA 4YAIA 1TC2A 1XMVA 3ETHA 2O06A 2NUPB 2HV8A 3RUEA 1Z2CA 3WLIA 1ZGAA 1EB9A 4IFEA 2V0GA 4K9SA 5CX1B 1FYEA 3NKVA 1K7XB 1OYVA 4CU2A 1W2WB 4MCHA 4R1UA 4II2A 1TGVA 4X1KB 2E5FA 2FRDC 2WOOA 1M1NB 1LWNA 1EAMA 5EWMA 5D01A 1UJMA 2VPZA 1PFUA 2Q3MA 3T7IA 4BLQA 4KXXA 5BO5A 3PIRA 4JC4A 5CAEA 4QL3A 1V37A 2VP9A 3OKPA 1KGSA 3HLYA 3RWMB 3E3LA 4DLAA 3AJ8A 2WNIA 3BTUA 4YH1A 2AC2A 3HE3A 4B3CA 1OXUA 4EMTA 4HPJB 5G41A 3OOYA 5T6BA 2IWHA 1DELA 2J31A 2QI9C 3WMEA 5C8ZA 1XZ8A 3FWNA 1Q7RA 2GNAA 1E0JA 3UJ7A 1DC3A 2BGUA 4FNMA 4TUYF 3W8NA 3PDWA 1KHTA 3R44A 2IF0A 2J3HA 3QG1A 3AOGA 1KZHA 3UYLA 3DOOA 4R9UC 4ZI7B 3FETA 2PGJA 3PNMA 4ZT5A 4Z4CA 1M8KA 4OGWA 3QPDA 1VMKA 2FZ5A 3A05A 4YQEA 3NLLA 5BMVA 2R7AA 3DEJA 2WINI 1T6XA 3KSAC 1KJ8A 2JIZA 3HYRA 1CUGA 4U0JA 1JSRA 3JQFA 3LY7A 4RETA 4TQAA 1TD9A 1G55A 4WJZA 4EGQA 3GY0A 5CB6A 3LIIA 1LWOA 3L0OA 2TS1A 3BXFA 3TL6A 4I9HA 4DLLA 4TS4A 2NAPA 3OIWA 3QZUA 4H3KB 1TVKB 1Z4IA 2IZ1A 2IIVA 3ACCA 5C31A 1NRWA 2L82A 4N0EA 3DOEA 4BKUA 5IYZA 1IVNA 3ABZA 1WJGA 2GJSA 1B6TA 5ADUS 3FCYA 4HT3B 3GPIA 3KQQA 2AQKA 1Z15A 4W9NA 2J0QA 4RTKA 1VL2A 1PLJA 1PFWA 1SBZA 4JLOA 3EY9A 4XQ0A 3QLUA 1PR1A 5JHHB 1RVDA 1F17A 5CPFA 1IOZA 1ODLA 4D8YA 2DPMA 5JJLA 4MIYA 1XVIA 4MVJF 1N6RA 2NUBA 4QATA 3ORQA 1EZ4A 2BM8A 3ANMA 4RJIA 4B4DA 4B3MB 2CHQA 2HWXA 2JDID 2ILTA 4YCMA 1S2LA 1N77A 5M3BA 3VMFA 5FCDA 2OKCA 1MAWA 3D7SA 3DAOA 3ND9A 2IX9A 4CLDA 4D9GA 5LVAA 1LV7A 4ME6A 2Y66A 1IXRC 1B1AA 1OV4A 4MVJG 2P0YA 2QE7A 3KWLA 4R1OA 1JDUA 2WYUA 3G5AA 4GKJB 1P4HA 4UVIA 4E51A 4CL0A 3IV9A 1O6FA 4UATA 4MUHA 1IOLA 4UM8B 1QPZA 4RZ3A 1E1CA 1B74A 4YYZA 3PHBE 4YP5A 1AKQA 4BNHA 4LOKA 2AXPA 2VRBA 5TQ2A 1WEKA 3GVIA 4DLTA 1R15A 5F4ZA 1EWVA 1X1DA 5L7YA 2PYDA 3OQHA 3NJRA 5HFAA 2WDPA 4F2PA 1KARA 3G2PA 1V45E 3F3SA 4GX5A 4HLUC 2PMCA 5EMKA 5A4DA 4MA5A 1U0HC 3OD5A 3NASA 4BZPA 5HRUA 4UZEA 4G1BA 1T2CA 1RPTA 3JATA 3T3NA 3WYBA 4TMWA 1MOZA 4TPKA 3PS9A 3A3KA 2VRWA 4Q24A 2XB2A 4LZWA 4MVJA 2YHBA 1D7AA 2N47A 4PLHA 3X44A 4XYLA 2HR1A 1YHNA 2HLDA 3FE2A 2P1RA 5KOJB 2CNWA 3FUTA 1NR1A 4U3JA 3B36A 3VR3A 2Y3IA 3DE1X 3FYCA 3G0BA 4WL0A 1XRNA 3GLIA 3AUKA 2HDWA 3MPOA 3PK0A 4JDUA 2AQIA 2X0KA 4MLDA 1CNMA 1T6BY 5I9TA 3SN6A 3B6EA 4FHZA 4QUJA 2NZVG 4FBMA 4JLUA 3T4PA 5K2OA 4XR4A 2OOSA 3P4XA 4TX1A 4YWJA 3U7QA 5JCPA 5DHQA 1Y5LA 3IKTA 2OCBA 2OUKA 1WG8A 2GLXA 2VNKA 2FK8A 2ZE7A 3I04A 3Q10A 3M6WA 5BSGA 3ERCA 1EX7A 1J22A 4UUNA 3Q3GE 4ZHQA 3MQFA 3AEYA 1R66A 3HGQA 3G5TA 2ZJZA 1B00A 2FRVA 3PD1A 5T7BA 1TKCA 2B9EA 1XVAA 3AI7A 2AG1A 3TRJA 5KC9A 4CEHA 3SM9A 3KFVA 2N3ZA 2WT4A 2JZNA 4IILA 3HXOA 2J07A 4ZOLF 1T2FA 3S4YA 1Y9DA 4M3NA 1F12A 5KINB 4B6PA 3LK6A 4IIUA 4MB0A 1R5JA 1KO7A 4PGAA 3VDNB 3O3CA 4ZV9A 2J7PD 5MF6A 3KSUA 3MSXA 3AJAA 2VA9A 4BRSA 2X2PA 5HK9A 1N6KA 4M1YA 3KXLA 4Z4FA 1SFRA 3S5JA 1YACA 4BWVA 4BMVA 2ISQA 3FNGA 5GJBA 4BE4A 1P0MA 3W9UA 1E3IA 1KS9A 1QHSA 3FYUB 4NYIR 1X19A 2BKLA 4OXNA 3WL4A 4BMCA 4PS1A 2JGLA 1QGDA 2HJHA 2ZWVA 5REQB 3PE6A 4M9QA 5A5VA 5KYUA 3DLHA 4JHLA 2AFIE 1KYZA 1TA0A 4M4SA 4HDRA 1I1HA 4QYWA 4R3WA 3DCJA 3HA3A 3IKLA 1JALA 3X2EA 4OMFG 3VPSA 3AM1A 5HJ7A 3PUYA 1Y9ZA 2RH8A 2DU8A 2G6TA 4H3VA 1DBIA 4YP1A 5JNSA 2Q5CA 4E5DA 2JJQA 3IILA 4P7JA 2YH2A 4R05A 3UJDA 4JVNA 3KJGA 4OA8A 2QN2A 4JLAA 4UASA 5TQ2B 1UQRA 1Z8FA 4P0QB 1A77A 1LS1A 5H81A 5HOEA 5AW5A 3OLQA 5FTJA 2CMKA 2PZEA 3ETDA 3R23A 4HGOA 1FS6A 1JYFA 1SHZA 1SRRA 2W8BB 4RSMA 3HXMA 2PSJA 3EIQA 4V0LA 1GTJ1 3CS3A 1DG9A 3OEED 3GNSA 1ZU4A 4M1WA 3C3KA 1P5ZB 2QTRA 1AX9A 3TLGA 3IYLW 3LT4A 3W2EA 1TJNA 5F33A 2JK1A 5KYTA 2HYDA 2CUTA 3ZCTA 1MNQA 2WFLB 2BMVA 4C7BA 4EHBA 4NBLA 3H19A 3GJ4A 4R1SA 4EB6B 1O08A 3ILVA 4JLBA 4JGIA 4ZU6X 1Q7TA 2UVQA 3GV0A 3H6GA 3ZCSA 4ZC1A 4GMKA 1EZZA 2ACWA 1HPLA 2XGSA 3DQPA 1TEVA 5BQ3A 1OJ7A 2G7MC 3OZTA 1COZA 1UJCA 1NATA 1OXTA 1Q0HA 4F7DA 3JWHA 4X61A 3LCRA 3FOAA 3GO4A 1A9PA 4GAEA 3IT3A 3L7MA 4JT8A 2ZPAA 5K0LA 1G6Q1 3AJ9A 1M3SA 4L4SA 3F6EX 1OBOA 2QVYX 4IIEA 4KQWA 1ZOIA 3ZEIA 2GZHA 3E2PA 3OP4A 1X13A 2B35A 3ADPA 4JLVA 4LI0A 5LMZA 1GG8A 1V1RA 4YCBA 1NF8A 3OY7A 3LQFA 3PEUA 1OE0A 3LWBA 4PANA 1XL0A 4POAA 4PYKA 4WOPA 1KFBB 3P0FA 1Q84A 2F67A 1VL0A 3Q6MA 3H4IA 1N0HA 5FUQA 4KB5A 3UM9A 4IOMA 3L6EA 1ICEA 3QMPA 5LM3A 3K4HA 2IV2X 1IJKA 1JEEA 2WNSA 3GEEA 5DSZA 1UOPA 2XTMA 3FI9A 3PXUA 4J0EA 3W2IA 4NF2A 4FTWA 1XT6A 1DC8A 2D8AA 1Q1QA 3K9FC 3WLEA 3LYAA 4ARIA 2EX1A 3DDWA 5LLTA 4X93A 3AHIA 2IX3A 1XTTA 1JLLB 1MGOA 5SY9A 1IAVA 3UMSA 5B12A 3QEAZ 3NT4A 2I65A 5JNVA 2VUIB 2QUBA 2V6GA 1ONOA 1R6TA 1WDKA 2HU8A 3S7TA 3TRHA 4D45A 4BEBA 3LJKA 4DNXA 1PS8A 3PFFA 4OMUA 4MRMA 1NU8A 3DEFA 2VTBA 4CM6A 1EE1A 1K6IA 1L6RA 3ZY6A 2F3UA 2IWRA 4JP2A 1UM9B 3JVVA 4YAWA 4FUQA 2P1DA 3CCFA 1RXSA 2WIJA 1CUEA 3BJIC 3WX0A 3RYFA 4C3OB 4HDRB 4LRWA 1XDDA 3LE8A 2P79A 1XSEA 4R2LA 5TR9A 5C52B 4PLZA 5L3SA 3B52X 3AU8A 1V16B 2QDXA 1OPRA 1J2JA 1ZGCA 4Q4AA 3PEFA 3LY8A 4J76A 4RADA 4XDZA 1W59A 1JRLA 3PC8A 1VRCA 3DB1A 3IMCA 1AQNA 3RAGA 3ZLAA 3FHLA 4IFBA 1VGVA 1TYBE 2FZGA 2W4IA 1DQRA 3A1VA 2HDHA 3C3AA 1CZNA 1B76A 3M81A 5JXJA 5FX2A 2Q3LA 3KFXA 5E1OA 1OZGA 2A0XA 5L53A 2ZR8A 2OZLA 4WOCA 4C7JA 2OE2A 3GLFA 2H3HA 2A9OA 4DIEA 3ILHA 1AN9A 3IMKA 2CFSA 1GGMA 3AWDA 2P8JA 1E0AA 5EHZA 1Y6RA 5F73A 5FI0B 3AJEA 3TM4A 5ES4B 1E98A 2CNBA 4PXSA 1R37A 2YFHA 3NCHA 2C4TA 1I6WA 3E3OA 4IM7A 1QG4A 2OP0A 2RHHA 4EGCB 3QEJA 2FZCA 2FN7A 4HJRA 1NG9A 3IUBA 2M32A 4C0LA 3G0CA 7YASA 5I7AA 5TMBA 3JRNA 5YASA 3S2SA 1RQRA 2DUWA 2NZ2A 5H68A 1Q5PA 4IH1A 1L5KA 2PR7A 4G8JA 3CURA 3V46A 5CEFA 2VTVA 3G8CA 1GAXA 2Y77A 3II6X 3FFTA 5U4XA 5BV1A 5L45A 1CQIB 4J7XA 3N2IA 3GWGA 3AV3A 4DXAA 4Z51A 3OF5A 1XNRB 2AMJA 1X8XA 2GF2A 4QDJA 4OXRA 5DHTA 1UT8A 4GO1A 4RLFA 1ZGJA 2C95A 2CHGA 3AKYA 1JBQA 3K9WA 3MJRA 4D3DA 4U2BA 2REQB 3UB4A 1IZYA 1D4OA 1XP8A 1FQWA 1P73A 2JGEA 3BMNB 3OPYI 3PFHA 4P3KA 3T95A 3IGFA 3F46A 2O4CA 2ZULA 4HAIA 4RV5A 2X76A 5J23A 2P65A 2QR5A 3VKWA 3NAMA 5AHOA 3HHPA 4EYKA 1SU7A 4YNBA 4JBNA 3ZLTA 1G42A 4OCZA 3DBVO 3RWBA 2WWXA 4TYYA 1YJ5A 3UMVA 2WFMA 3LECA 5I9LA 4O4JB 3L8ZA 1M8GA 3HVKA 1EUZA 4IJ6A 3T12A 3W5UA 2XUQA 4UNPA 1OWMA 4F3CA 1H9CA 3WLOA 2VUHB 4RHEA 5IXSA 1JZQA 4GDMA 1BMFD 3OOSA 5AI9A 1KNXA 2GN0A 4GT1A 5DHRA 2W00A 2HUPA 1Z4MA 3BMQA 1QU2A 4J1TA 5LIPA 3BFXA 1IDN1 4L2IA 3ZQ4A 4RIIA 1P75A 5AI6A 4QE3A 3B3AA 4RIHA 1K4YA 3R6WA 4AS1A 2B8JA 2W71A 3QKIA 2ZITA 3SXJA 5A4IS 3Q7IA 4R8RA 1UC8A 2C2MA 1N0UA 2ZRCA 4HNTA 2XRFA 1USKA 1YFZA 1EDDA 2ZRQA 3DVAB 4MWOA 4U2KA 1H2AS 4UHCA 3UAXA 2Y0CA 1TZBA 3B8EA 2ZBFA 3NWEA 1UMBB 1EHYA 4GM1A 3U13A 2ZZMA 3FBTA 4IL5A 1JZTA 2WD7A 4ECAA 5IFLA 4KUHA 3BDIA 4R5MA 1EK1A 4NECA 2A5DA 1HTBA 3QFTA 4GZ5A 4QECA 1RPZA 1MHTA 2PBFA 3D7KA 5HKOA 2EERA 1G6HA 2Q2NA 1QFYA 1WU8A 3HB9A 1ONSA 1KYTA 3RBVA 2CLHB 4HN4B 1RTTA 2MSWA 4UW9A 4URXR 3L43A 4W5RA 2HB6A 2VYQA 3MIIA 3FWPA 1SK9A 3SQOA 3KB1A 3O0TA 3VO8A 1GCOA 2W6JA 2Y1XA 3H11A 4TMVA 3TRKA 1WMAA 4HQOA 5CCEA 2XUJA 5IYZB 1BXKA 1D07A 2HMYB 4AJKA 1ECJA 3W90A 5LKAA 2FZVA 2I3BA 3A4TA 4X63A 1PX0A 3ITEA 4YRZA 3TJZA 4G89A 2D00A 4CUJA 2YFQA 5AHKA 5TE9A 1QANA 4HDKA 4MS1B 3E70C 4S3MA 3QJGA 3TNLA 4DMHA 1V11A 4EO4A 3ZL9A 1FDTA 3NVMB 4KW7A 3BN3A 3GFQA 2PKYX 2Q1TA 1P19A 2QMEA 5SZHB 3IR6A 3KAJA 1I9GA 3VSEA 1FMJA 4X3CA 4NNJA 3ICQB 3UWSA 4NDAA 5B1HA 4IIXA 1OHHA 4CG2A 4QYMA 5LFAA 1OBHA 2AZTA 2V9PA 2YZNA 4JT9A 1LA2A 1X7YB 2O2HA 1NN5A 3CKLA 3JTMA 3LPAA 5J9FA 1NG1A 1QYDA 1VBNA 1XYGA 1VSBA 2O48X 5FOQA 2PUGA 3DC2A 6AT1A 4TWJA 4W5JA 2ZIGA 5ICMA 2IJGX 2QQGA 3WIVA 3UXHA 2BHSA 2R11A 1RHQA 4UPVA 2IYTA 4CN9A 3ODGA 1R0CA 2PLRA 1C0PA 1DIHA 4BNTA 1Z0FA 1TO1E 1G21E 4EGJA 3RE1A 1BYUA 4PVDA 1EFVA 3OE5A 1AC5A 5TVKA 3HYTA 4KACA 5EE9A 4AJNA 3WV5A 5B3KA 4G63A 4UBLA 3HSSA 4DMLA 1NR5A 1QJCA 1JA1A 3CH4B 1ULTA 1NMEA 1VL5A 3P0IA 2WUVA 3FPSA 3BIJA 3TAUA 4F4JA 2IZ7A 4I5FA 5I47A 5JSFA 4YCAA 1GG9A 1ZRHA 1ZM4A 2JHFA 1Q7CA 1TDJA 1YZHA 4QDUA 1TMKA 3CLRC 3IOMA 3CVYA 1HNWB 1QV7A 2JAUA 3EXG2 1G20E 4JP1A 4AN4A 2V6FA 4ACAA 1ODFA 4POOA 1MXFA 1TO2E 3NV9A 4HNSA 2LW7A 3N7UA 5M2QA 2CFTA 3JQAB 2DBVO 4LVUA 5T4BA 2CLFB 5EWLA 3ZV6A 4FE3A 2ZJ1A 4I8DA 4ND8A 4Z2AA 2E82A 1JNYA 1NKVA 4J16A 1I4EB 3X1DA 1NPDA 3B1KA 3WJ7A 4C88A 4D4IA 1SCBA 1VFNA 3WWPA 1W5AA 1E7WA 3MT8A 2JARA 2ODPA 1EK0A 1TKBA 4GXNA 1MC4A 3R5JA 5LZ2A 1G1MA 5AW0A 1O97C 4GICA 1WSAA 5CFLA 3EUFA 1Y4ZA 3SQWA 2BMWA 1PSWA 3FHJA 4LBYA 2WTEA 3DL4A 3GW8A 3IP9A 3JQ7A 1RXYA 4L50A 2PUFA 3DSRA 9ABPA 4IY1A 1YJAA 3TW8A 2W0SA 4JMPA 4XPIA 3H99A 4N3GA 1CR2A 4S1VA 2XOEA 4LFCB 2O7QA 3REOA 2HOQA 2MIIA 2PL3A 5BURA 5JH7F 1NN3A 4QVIA 4S1WA 5CT5A 4IAOA 4B4UA 1H2HA 3G7NA 1PJQA 3I2IA 5ITSA 2PUBA 1RRCA 1QAOA 1UANA 2X8LA 3SS9X 3WDMA 1C1HA 3TRIA 4ZICA 4GM4A 2AT1A 3Q1LA 4C0WA 2G8LA 3V33A 3KP1A 3HKCA 1KEEA 1C8LA 1I8TA 4MH0R 1QO7A 3BIWA 4H08A 4X71A 2PZJA 3KBOA 4I1UA 5E7QA 2JLAA 4H0CA 5C0OE 4MR9A 1NDQA 3ED1A 2C2BA 2JATA 3LX6A 2K2WA 3ZW7A 1S7GA 5ITWA 1HYEA 1XD2A 4HTFA 2HMUA 1ESEA 2E4YA 1A9YA 3IELA 2W98A 6GPBA 3EF1A 1IEVA 3GXBA 5FPTA 4E46A 2XZDA 3GLFB 4HLUA 5THKA 5GV7A 1EVYA 3GHYA 1W4BA 4DR5B 3HR7A 4TV9B 3SYMA 1NI3A 2X3UA 3DMFA 4KAAA 2BP7B 1DJQA 1O96B 4KPYA 3ER9A 1XALA 2VNSA 1G8FA 3RC2A 2H29A 1Y1KE 1Q17A 4O4HF 3O8OB 1IG0A 4M49A 4CMEC 2C7PA 1O7JA 5A4JA 3NZEA 5LJLA 1CUWA 1T3ZA 1H4SA 2Z9DA 4AG6A 3RNOA 2ILVA 3IS3A 4FYKA 4C7OA 4YRLA 2VZ9A 2EW1A 5GONA 4BOYA 5DXFA 1NSTA 4QFCA 5BQPA 4IJVA 4KH0A 3NBXX 1BHSA 4L5IA 4NFYA 3ZTYA 3EGEA 4D43A 1YHYA 4KFRA 4LV8B 4DBZA 4EA8A 2W6CX 4B40A 1Z39A 4EJSC 4O25A 1K7YA 1B0ZA 2YY7A 3DVSX 3A4LA 3HUDA 4RMNA 2IUTA 1CSEE 2RG1A 4AUMA 4G9BA 1V8OA 2F00A 1ORDA 4MVJI 2YV5A 1COWD 3CB2A 2WUEA 3OM1A 1E3WB 3STTA 1P1KA 2XHEA 4BC0A 1AK9A 3PXEA 1UJ4A 2PX2A 1GPJA 2D7CA 3N7TA 2LKCA 4IGAA 4L8YA 1QH0A 2CBZA 4DYVA 1U1CA 4BMPB 2D4HA 2RGGA 3GRRA 3SVLA 1T3GA 3MC1A 4LYJA 1M33A 3TQHA 1I3MA 5A4FS 1ENOA 3O1IC 3RUPA 2FSVA 3HVUA 5BNFA 1KMCA 4DKXA 5KU1A 4X90A 4BASA 1JVNA 3HCNA 2FP4A 5ALRA 4EJ6A 4INPA 1VE6A 3CEJA 1JDSA 1Z2AA 3T7EA 2AFVA 3DE0X 4XIJA 4AMVA 1U0NA 3MUOA 1SURA 5HMLA 4BP3A 3R9IA 3Q2IA 2NTVA 3PC4A 1Q15A 3K5WA 5EZSA 3ROKA 3SR0A 4LXIA 1Y1SA 2HF9A 5KJCA 3HRHA 4K7JA 1V6CA 3CZCA 2NWQA 3LL7A 2C8LA 4TLMB 4WOKA 4U8HA 4IDHA 1ODCA 2MSKA 4JI7B 1HORA 1S2IA 3PQ5A 4J3JA 4FEGA 1LTHR 3OIGA 5HBGA 1DG1G 5IPFA 2HU5A 4LOJA 4JI8B 1VJ1A 1BVHA 3EYAA 4LGVA 5CJJA 5GZ3A 2CFCA 4CCSA 1CETA 1K1EA 3NPAA 1QCDA 1TMYA 2JGDA 3OZSA 4HNAB 4MR8A 3T4UA 4BCDA 1M2NA 1OAKA 2ZUWA 4FS8A 2IU4A 1D6JA 1BJTA 3SG0A 1RKBA 4YC7A 4F4HA 1YFLA 2X2OA 3C98A 4MV3A 3WLHA 5HWSA 4QOHA 3TI7A 4ARCA 4TN5A 2V5UA 2JI8A 1DEKA 1NJFA 3JALB 4KKVA 3LVFO 1NBMD 1J42A 3JW8A 4E3WA 3EOAI 1QYWA 4P92A 1G5IA 2A0FA 2ZBPA 3TSAA 3CB4A 3EGCA 3L04A 5I7FA 2NNLD 1P0QA 4DAEA 4MB2A 4QQFA 3AL3A 4ZI7F 3J81k 2H7VA 4GH5A 2PKRA 4XJSA 1KJNA 4Y98A 3U44B 3CPHA 2X8JA 4U63A 4X62B 3FWYA 3A10A 4KWHA 3ZKWA 1U63A 3ZI0A 2BBTA 2O1SA 2ID7A 2ZTVA 3GLUA 4JH0A 5FOSA 3T7AA 1N2BA 1MRSA 1G16A 3LCVB 4NU8X 3SMVA 3W1EA 1QP0A 1Q22A 2CVHA 1ZY2A 2D0DA 3WK5A 5CD9A 1SOMA 4PF1A 1JECA 4XX0B 4JJ6A 3KQPA 3L9WA 5I7UA 1ULSA 3QLVA 5CB8A 2GH1A 1H2BA 1T0HB 1XZJA 3H2ZA 3IUNA 3TS1A 3WFIA 2I8CA 2QN8A 2H0QA 4DEXA 1EM6A 3QXJA 1PFGA 4W5NA 3SFVA 2EW2A 4M1MA 5IJ0B 5A02A 5K3FA 3N2NA 4U2CA 4K26A 4AJHA 4TOIA 3MBIA 2C5SA 2RB4A 3MWGA 4DIBA 1UKCA 1X1BA 3F71A 3L1KA 2CXTA 3ZJ4A 2EVWX 3ZZNA 2DFLA 2CJXA 1JEAA 2QX6A 1IBRA 4HDMB 4XCVA 1YRLA 2Z8YA 1E2BA 2J3QA 2C9DA 5FA6A 5JBQA 4KOAA 1NI4A 3U4HA 2PBLA 1AE1A 4UXIA 4AZ0B 4KXLA 2IPLA 1XCMA 2DFPA 2AMLA 3G6WA 1LF5A 5K03A 1OLSB 1NASA 1VBMA 1P45A 1WX1A 3RIXA 4CM8B 3L6CA 4Z6KA 4EA6A 5IN4A 2Y1EA 1NVFA 2BFNA 2TMYA 1K5HA 4E5NA 9LDTA 4CQLB 2Q29A 1B8NA 4MGEA 4NCIA 4UM7A 4Z9YA 4BNKA 3IX7A 3SJAA 1O89A 3ZK7A 1HDYA 1L7NA 2R1ZA 3HU3A 4RY8A 3KSRA 2R48A 5C3UA 1FJHA 2PL5A 1EESA 4RSRA 1GL7A 4MP3A 1R6AA 4L5CA 2I4TA 2PVCA 4OQPA 2IP4A 4B8YA 5TT1A 4DIDA 5JSHA 5ETJA 3M6UA 1TM5E 2QIPA 2VP4A 4DIKA 1XIVA 2YHUA 3OC6A 1FDRA 1JW9B 4KSBA 4Q39A 3D8NA 2YZ2A 3QFHA 1KE2A 1Q95A 4NRDA 3QOWA 3WMXA 3NR2A 1JB1A 1GSOA 1PL0A 1CW2B 4I4LA 5H9VA 1XLTA 2HRZA 3KL2A 3W06A 1HWYA 3B3JA 3JD4A 4UUBA 1P39A 3V3TA 3TD9A 3VJRA 2RHMA 4C29A 1KH3A 4I55B 4G1CA 4BP8A 3H2SA 3T54A 1JHYA 3GQVA 2WSYB 5EXDA 3ZU3A 4XLZA 5EJGA 3W79A 4MR8B 5GIPE 2GM9A 1ZBDA 3MVEA 1Z5PA 1C9JA 4GI7A 4IIFA 2QBYB 3D7RA 2P3SA 1L7QA 5IKXA 1MB3A 1P6QA 3L1IA 4D0NA 3AVTA 1QWSA 5TS3A 2VHEA 1GNTA 1RYZA 2PX6A 3JRWA 2XGJA 3M82A 4JI6B 2FW1A 1JWAB 3A4VA 3IDOA 1JMVA 4ONEA 1FFXB 3QA3E 1H5QA 4UHDA 5AJZA 5H80A 3UGQA 3DE5X 3C8UA 1VL6A 3KPUA 4CDGA 4IQ0A 3A2KA 4Y2PA 3A32A 3RLFA 3GUHA 3PXXA 3NHKA 2HRRA 4NL4H 1LPPA 3VHQA 4EQ6B 1CF4A 3L79A 3LD9A