2BLLA

Apo-structure of the c-terminal decarboxylase domain of arna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
330
Chain Sequence
b'MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVVEHRKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN YFBG
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L- Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 128
structure length 330
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2bllA02
4FPXA 1LQTA 2YHIA 3H9GA 4HP8A 4BNVA 5HS4A 5CPBA 1PGPA 4XQGA 4CM7A 2DBRA 4CMCA 4BGEA 5G4LA 4I5EA 5G0UA 2QYTA 1BSVA 2EKQA 4IDEA 4PRKA 5IJZA 5L4NA 4HX5A 4CMHA 2VT3A 4MVJI 5BNTA 1XCBA 1ZK0A 2CVOA 2NSDA 3HDHA 5BNIA 1R15A 4ND1A 5CFZA 2JCXA 1E1LA 4ZQHA 1M67A 3EW7A 3GUYA 1IULA 3WICA 1I3NA 1JDJA 5JC8A 4YJGB 4J49A 5ES3A 1IB6A 1LU9A 4WEOA 1CF2O 1YKFA 3KYCB 3E82A 4I8XA 3JYOA 1JKIA 1JWBB 3E9NA 3I4CA 5DOZA 1J0XO 3VC7A 1E5LA 3ZWAA 2TMGA 4F45A 2BMAA 4OQYA 4U7WA 4RF4A 4QUKA 2B69A 4HV4A 1T2EA 2X4GA 3WJ7A 2QX7A 3AY3A 3JQEA 3JTMA 2VYVA 4KUEA 4ND2A 3I9MA 5JS6A 3S2FA 2NUAA 4WLUA 3ULKA 5IDWA 4RVSA 3BTVA 3OA0A 1H9AA 3DB2A 1BW9B 3QVOA 3ZHZA 4PLTA 4ITUA 5JCJD 1LI4A 2CY0A 2NADA 3PWKA 4XGKA 3D4PA 3ADOA 1KEWA 3H9EO 2O4CA 2P5UA 3WGQA 3KO8A 1KY4A 4UAGA 4BNJA 4KUHA 5EQDA 3GG2A 1JVSA 2A94A 4N7RA 3ABIA 4Z0HO 4FS3A 3TDKA 1F17A 2B4QA 2DUUA 4AICA 2FN7A 4NK4A 4A5OA 3C85A 1KVUA 1QORA 2OBNA 1SCUA 2IYOA 4MVJM 4XDYA 3OSUA 1GQQA 3R0IA 1KVTA 3R1IA 2BELA 5JDIA 2HLPA 2ZB7A 2HSDA 2CDAA 2HMSA 1EE9A 1YL5A 1KVQA 3A14A 3JQFA 2EWMA 4QXMA 3E9QA 1KC1A 2I65A 2ZJ1A 4OM8A 4PLYA 3COSA 4YJGA 5DP2A 3OHSX 1GYRA 1PJLA 4KWHA 1GUZA 4PRLA 1VE9A 2EW2A 1YE3A 1U7HA 4DXHA 4RVHA 4Z9XA 3KTDA 5TRTA 3DWFA 4IDGA 3I6IA 4PG6A 3K30A 1WMBA 3EVTA 1CYDA 3HFSA 2IYPA 1XU7A 4BS9A 3VDQA 4DQVA 2FOIA 2RHCA 1M76A 1H6DA 2BLLA 4GQAA 4K26A 5ITVA 1S7CA 5BT9A 3RUAA 1P44A 5IN5A 1BW9A 2PH3A 2NTJA 4BO3A 2HAEA 3BHIA 1ISIA 4HY3A 3K8ZA 2RBEA 3A06A 4GWGA 1BTOA 1T2DA 4NU5A 4GI2A 5CG1A 1LLCA 4BO5A 1M75A 3CXRA 4FSHA 4ZD6A 1JLLA 1G0NA 1GUFA 4QEDA 3G1TA 3WLFA 1GCUA 3OA2A 1QYVA 3ZU4A 4OXYA 5K6AC 5L51A 1A9YA 5G0VA 4CQLA 2C7VA 2G82A 5EESA 2H6EA 3DMYA 1UXGA 3UGKA 3EVNA 3L9XA 1A4UA 3QP9A 3ZWWA 1I24A 4RL6A 5DBFA 2V6GA 3WGHA 5GZ1A 1GADO 1QKIA 2QRKA 3D3WB 3GMSA 4KP7A 5F1KA 2VNAA 3ANLA 3DTYA 4OO3A 4MIEA 4L9RA 3PIDA 3CEAA 4GX0A 2YFHA 4J2HA 3ZU3A 3DEYX 2ZJ0A 4MVJD 3BMOB 2Q2VA 3PXXA 3CSDA 1HDXA 3CIFA 2E4AA 3D4NA 4GX5A 2PK3A 4WECA 4ZN6A 1Q2XA 3F4BA 1RJWA 3DHYA 5HTOA 1E3WA 3MJEA 4G2NA 2Q4BA 1J6UA 4R41A 2O3SA 1K6XA 3H9JA 4Q39A 1QMGA 3LC2O 1C1DB 4IINA 4CMEC 3NT4A 3OQ1A 3GT0A 1PJTA 2DU8A 2Y1FA 4CJXA 3RBVA 4A0SA 5TIIA 4PIVA 3GF4A 5THKA 3HB4X 3E6AA 1PQWA 2NWQA 1NFFA 2XOXA 1LSOA 1GQYA 3P2OA 1OI7A 5CPFA 2PD3A 4RVDA 1UDAA 3ZN2A 4KQWA 1I33A 4W99A 3BIOA 4P8RA 5B12A 5K9ZA 3FRJA 3PDJA 1Q7BA 3OFSA 4Z0PA 2G76A 4M54A 1BMDA 3VZPA 4UEKA 1IHXA 3RSHA 3TL3A 4XB1A 4AJLA 4B7CA 3D3EA 3VVBA 1DLJA 2RIRA 4FB5A 5JDCC 5L9AA 3BZUA 4O6VA 4WLFA 2JKVA 2YQ5A 1VC2A 2P9CA 1UZNA 1VLLA 2ZIZA 2NNLD 3MJ4A 3WSWA 3RC1A 1FDVA 3OJOA 3AUUA 1GZ3A 1U2GA 4DIBA 2Y0DA 4LRTB 5JCJA 1YB1A 3AOEC 3D3WA 4HBGA 2Q1WA 3TWOA 1QV7A 1C0KA 5GMOA 5TJHA 2TMDA 4D45A 1KETA 1KVRA 4DMMA 3H2SA 3DZJA 1X14A 3S1LA 1A72A 4BMNA 4GX2A 1PL6A 3ICPA 1Y5MA 4D42A 1RM0A 1YDWA 4CM8B 3C3XA 3RUIA 1YH3A 5TT1A 2R00A 1PGJA 3I4FA 4YT4A 3S55A 3GR6A 1ZW1A 2LDXA 4LMRA 5JSFA 2D4AA 1RPNA 2F00A 3T7EA 2P9GA 3WB9A 1ZJZA 1V3UA 2C07A 4TKLA 4WLOA 1B2LA 1HE5A 4PGFA 5B1YA 2YV2A 3NKLA 3RUHA 5G0SA 1Q7CA 4IDCA 3K2BA 3DZFA 5KCZA 1E6UA 1K2WA 3JQDA 2PY6A 2D1YA 1F8FA 1E77A 1M66A 2P91A 4IXWA 2VWHA 3U5TA 2ZKLA 2W2LA 4WUVA 3KBOA 1C0PA 2B36A 2NVWA 3B20A 3S2EA 3ROKA 4AJKA 1T1SA 2GN4A 3AI2A 2JAPA 3NTQA 4RF3A 3C7DB 1TB4A 4XYLA 3SXPA 1X0VA 2E6UX 1XU9A 1CJCA 2DFDA 1YOVB 2G0TA 2DTEA 1ZCJA 3KHUA 4YJFB 5F21A 4MVJH 3KLPX 2Y1OA 4ILKA 4OH1A 1SPXA 4L4SA 1VJTA 3NUGA 3AUTA 3ST7A 3ZV5A 4EYEA 1GZ4A 3VVCA 4FJ2A 2RH8A 3ORFA 5ICMA 2EERA 1ADBA 4E5MA 4JCOA 1SMKA 3RCBA 4BKRA 4S3MA 3ASVA 1XSEA 2FSVA 1BG6A 5IXSA 1P1HA 4YA6A 1JAYA 3P19A 4TRMA 3JD4A 4LCJA 1F06A 2O3UA 5ENDA 4JXKA 1NPDA 3IP1A 4NR0A 3IQDB 4OL9A 4U5QA 5FEUA 4B7XA 4BO1A 2YQ4A 2GN9A 1EMDA 1PZGA 4OSOA 4TRNA 5DULA 1DXYA 1EBUA 3CMMA 5JO9A 5I9MA 4DLAA 5MGBA 3P7MA 4I9NA 3PRJA 1BGVA 3PZRA 4YAGA 5K6AA 1PL8A 3UCFA 1HZZA 4R9RA 3GGPA 1EUDA 1HRDA 2LDBA 3VAZA 4E32A 4JJIA 1NVMB 1NPYA 3P2YA 5CDSA 4MVJA 3H5NA 4NFHA 5ADHA 1O9BA 1P45A 3IOYA 3NDJA 2JL1A 4RZHA 3O4RA 2PA3A 2X0RA 1HL3A 1HSOA 1NPTO 2J3IA 4AJNA 4CV1A 3WMXA 4QFCA 4N5MA 4TSKA 4DGSA 2Q4EA 1ZO8A 1U5CA 4U0KA 2A9FA 5T67A 3DQPA 4MKXA 4OIMA 1PZHA 3AK4A 1Y6JA 4R9SA 1NQ5A 2OP0A 2FZWA 3BA1A 3GNSA 4KUGA 1ZH8A 4FFMA 5KJFA 3FWZA 2BF7A 2ZTVA 4CMEA 2YW9A 3JQ8A 3NYWA 1C3VA 3QWFA 4YR9A 1VSVA 5IDYA 1RWBA 4JP3A 4RJTA 3WOHA 2IEBA 3V1TC 3OJEA 4CV0A 1R12A 4CLRB 3JSAA 2EHDA 3KYDB 2J3HA 1E92A 2FPPA 4BO6A 1EDOA 3F4LA 3D64A 4XZ3A 1N8KA 4PLVA 1XDWA 3TL2A 2A35A 4D7AA 3ZNQA 2B4RO 1Q0QA 1U5AA 4NMHA 1Y9EA 5KVVA 3GZNB 2ZQZA 2H1SA 1ISJA 2CMDA 5TNXA 2C5AA 3QV1A 3AU8A 5JDCA 2DQ4A 2YZ7A 4TZTA 1B16A 4DIOA 1I01A 2H63A 3K9QO 1GYPA 1VJ0A 3C7CB 3HB5X 4XB2A 4K28A 3EMKA 2Q46A 4RPKA 3AOEA 3B1JA 4NBVA 1W0CA 4KWIA 3W8FA 4BNLA 4LW8A 3ZWNA 2VWGA 2XF8A 4WGGA 2WE7A 4YPOA 4CLOA 4LISA 4EDFA 3GK3A 3FTPA 1AHIA 3F3SA 4YT5A 5JCXA 4PZEA 3WMWA 4AG3A 3PGXA 4CMIB 2YDXA 1DBVO 4BGIA 4E13A 1LDYA 1DHTA 5TQVA 2HK9A 2Q50A 3IDSA 3F5QA 5G0TA 3ZWOA 4IMRA 1R6DA 1Z6ZA 5H83A 5GZ6A 2AQKA 1UJMA 4UEOA 4DUPA 3UKOA 1I2ZA 1GL3A 1O5IA 3FN4A 3LQFA 3KYDA 3RBXA 2EG9A 4J7CA 4GMGA 4BKOA 1P1FA 2FR0A 5JE8A 3K92A 2Y0EA 1NP3A 5IF3A 4I9HA 2X86A 3QVTA 1SB9A 1XA0A 4QO8A 4Y6RA 4NHEA 1EK6A 2DM6A 4RORA 5F5NA 1E7QA 2VQ3A 3BMQA 2EJVA 5F5LA 3JYPA 3OIDA 3QA9A 1D3AA 2GO1A 3GFBA 3GZNA 3GRPA 4Z3DA 5EIOA 1WZEA 5TF4A 4CM4A 1KBZA 5CEEA 4FDAA 1E3IA 4RDIA 3U62A 1GPJA 3KLMX 2AEFA 1ZVMA 5A9SB 1MXFA 2DTDA 3GAFA 1OFGA 4IJKA 4JLWA 3RU7A 1N92A 3W4KA 1E3JA 3A9WA 3ZDFA 4BNMA 3NTRA 5JAZA 3C1TA 4DVJA 1P0CA 4FCCA 1A71A 4K6FA 3UICA 2C7GA 1ID1A 5C37A 1M2WA 3WGYA 4R51A 1HE3A 1JWAB 1NVGA 3OEYA 4NBWA 4FFLA 4CMIA 1X1EA 5KVCA 4IXTA 1LC0A 2ZYGA 3WNVA 2AHRA 2A92A 4D44A 1N7HA 3JQGB 4ZQGA 2VOJA 4CODB 4NJOA 2YHUA 2EW8A 1CQIA 3FBGA 2NVUB 4E5PA 4L73A 1RM3A 3QJ5A 5HWSA 4DPLA 4JJGA 2ZQYA 3WFJA 4PLHA 4QO7A 2YUTA 5ILGA 4CQMD 3L6DA 3AFNA 1TT7A 2OHXA 3F6YA 1SEPA 4W9NA 2QW8A 1ULSA 4K6CA 3GRKA 3QWBA 3PVZA 4QX6A 1GQ2A 4M89A 4XQ9A 3IKVA 4YCAA 2IE0A 2VHZA 4FOSA 1F0YA 4ZJUA 4YT8A 3UXYA 3DOJA 2BGKA 5EPOA 1XELA 3ZU2A 1PTJA 3ETEA 3R6DA 5A04A 2I9PA 4W7HA 1PGNA 1YQDA 5G0WA 1NWCA 1IYZA 5IN4A 2IDZA 3DMTC 3K5PA 1Y7TA 2BFAA 2EGHA 3MJTA 1NR1A 3SJ7A 1P77A 3HQ4O 1KIFA 3JQAD 3FD8A 2AQ8A 4PZCA 2VRCD 1BXGB 4Z6KA 5LC1A 2HDHA 3DDNA 4BNYA 1AXGA 1T26A 3D5TA 2OOSA 2UVDA 2JD0A 2VWPA 1MFZA 2GASA 3GDOA 4E5YA 4AJEA 3H7AA 1DHRA 2PKQP 4OAQA 2PD4A 3FF4A 4DQUA 4IMPA 2CZCA 2JFGA 4BO7A 4WCDA 4I5GA 1NYTA 2YFQA 3UN1A 1NHGA 2NVUA 1W4ZA 2IXAA 4GSLA 5ITWA 1XYGA 2X8LA 3QVWA 3GVIA 1MUUA 5F1PA 3M1AA 4HXYA 3PWZA 2PGDA 3U4HA 2WYUA 3V5NA 4C4OA 1ENPA 3KYBA 3TOZA 1ENYA 1Y8QB 4E5NA 4YRAA 4FQ8A 2W90A 5GY7A 2XXJA 4YB8A 4XDZA 1PSDA 1NQTA 4E2WA 3F46A 3VTFA 5CEJA 3ZV4A 1JVBA 2QQ5A 3KV3O 4YAIA 3INTA 1PJ3A 4CUJA 4JX8A 3E18A 3IS3A 4HFMA 1FDWA 4RVGA 1T4BA 1DLIA 4Q3DA 4WPGA 1VPDA 1LRLA 4OKNA 3V2HA 3C7AA 1HE2A 3OF2A 1V3TA 3QE3A 2E37A 1WPQA 4DTIA 4EJ6A 3CPSA 1R4MA 4NFSA 1GZ6A 4HKTA 1X13A 4CQMB 2NV6A 2PTGA 2BGLA 4IM7A 3H8VA 3VPGA 1YL6A 2Q1TA 5EN4A 1T4DA 3LLVA 2C0CA 1U3WA 2SCUA 2NLOA 3LVFO 3VPSA 1BXGA 1T2AA 4MJLA 1IPEA 4ROSA 1DFIA 4EITA 3L6EA 1GYQA 2EGGA 3PFWO 4CLEA 1LSSA 1IHYA 3BYZA 4CPDA 2QIOA 4RPHA 4G65A 1N1EA 1KYQA 4FW8A 4RV9A 3FWNA 3PHJA 4ZVVA 2NQ8A 3JQ7B 2YYYA 1ISFA 1LJ8A 2E48A 5DZSA 3WYCA 4EJ0A 3EDMA 3DZHA 4BB6A 2Q99A 4R3WA 2DBQA 4MPDA 1E1MA 4MVJF 2DT5A 4F6CA 2VT2A 4TMFA 5AXBA 3RUFA 1U3TA 4XYGA 3TSCA 1Y8QA 4M86A 4WNIA 1ENZA 1N9GB 2O2YA 4OJNA 2Y1GA 4CLDA 5IXYA 1ISMA 5G2OA 3BMNB 2HRBA 1KEPA 1UP7A 1AHHA 1XQ6A 1E1NA 3PHIA 4J16A 4XX0A 4IQ0A 5ER6A 2VYND 3EZYA 3K31A 3DC2A 1SZJG 2VHYA 2JFFA 3CZMA 2O7QA 2Y1DA 2C2YA 4KMSA 3ZH2A 3TFOA 1JU9A 5KJCA 2Y67A 5A02A 2DTXA 4D0RA 5BR7A 1JTVA 3H5RA 1YB4A 2VHXA 1ADFA 3ZWPA 1FJHA 4FC7A 3SX2A 1PJ2A 1ONOA 2AXQA 1PIWA 2J8ZA 4CQLB 5B4UA 3B1FA 4CQMA 2AEJA 1C0LA 1IZ9A 2Q2QA 4MDHA 3GN1A 3U0BA 3WYBA 1UP6A 4R16A 4Q3NA 1CWUA 1YONA 5MDHA 1JA9A 5DF1A 5DCWA 4DC0A 2B35A 3GVXA 4R5HA 3TJRA 3AFMA 3RROA 3VHRA 2I3AA 3RUCA 3V2GA 4EW6A 3JQ7A 4CMAA 3WGZA 3WQRA 4F3YA 4WASA 3GNTA 4GH5A 3OJLA 1YRLA 3W4JA 2J3JA 3QQPA 3ZWMA 3GUCA 1E3WB 2AE1A 2OL4A 3GVPA 2UAGA 5C7LO 5TC4A 3FNFA 2J6IA 1LDEA 1HDGO 1SC6A 5DDIP 3EGOA 1FXSA 3E8XA 3FTNA 2VRCA 3JQAA 3GEGA 2B4TO 2HJSA 1HE4A 2QG4A 3DMTA 3LC7O 2C20A 3PIIA 1N9GA 4B4VA 3AI3A 3LK7A 3D5QA 3W1VA 3BMNA 1YQGA 1N7GA 1FF9A 3GY0A 5JLAA 1MG0A 2GNAA 1E3EA 2PFGA 1NFQA 3Q0EA 1U2DA 3Q2KA 4ONEA 2YJZA 4E21A 4ID9A 3N74A 4QTZA 3PI7A 1EK5A 3GPIA 1E3LA 4O1MA 5COBA 4J1TA 4I1IA 3NDIA 3DAFA 1LA2A 2W2KB 3D4OA 4B3JA 4DBZA 1HXHA 3F1LA 3NJ4A 4Y9DA 3GEMA 2JHFA 3U9LA 3ZWXA 3W6UA 3NT2A 3VTZA 9LDTA 3DL2A 4NU6A 2FPIA 1TEHA 1UH5A 1R0KA 4ALNA 1N1GA 3DONA 4OQZA 2GZ2A 3O9ZA 4DA9A 1ZEJA 4RGBA 1T25A 1DDOA 3OP4A 4XCVA 1FDTA 4IZHA 3TRIA 1UDCA 5JXWA 4BHTA 2Y66A 3DBLA 3AW9A 3PGJA 4ALJA 2ZCUA 5C3MA 2CUKA 5TGDA 3WX0A 3H3FA 4ZQFA 5JMWA 1CEQA 5IZCC 4TKMA 1WLYA 1VKOA 1QR6A 4ZRMA 1I10A 4PZDA 3OIGA 3PLNA 3ZHBA 1UXHA 5KJ6A 2I67A 4NPCA 1KS9A 3EUWA 4Y67A 3RUEA 3SLKA 1H0KA 3VH4A 1UXKA 4WEQA 5A9RA 1JW9B 1K5HA 4IQGA 5LDGA 2H5LA 4J1SA 2PKRA 4C7KA 3MCVA 4YTEA 3DZGA 3GEDA 3IUPA 4YBZA 3T4EA 3N7UA 2X6TA 2HUNA 2NACA 1GAEO 2VUSA 1E1KA 4MINA 5U4QA 2DUWA 2VUTA 2EEZA 2Y1CA 4PG4A 3TZKA 2O23A 3SLGA 4IDDA 3HZZA 2EF1A 4KTTE 5H81A 3WGOA 1HDOA 3GDFA 2P4QA 3I1JA 1NAIA 3AI1A 4IDAA 1VSUA 4Q3AA 1Q0LA 5CDGA 1UZMA 2W2KA 1ZSNA 4DQXA 4PG8A 4E0BA 1K0UA 4AVYA 1ONPA 3R3SA 2ZB3A 1HEUA 4N5LA 1QSGA 3GAZA 1QLJA 4QECA 5CP8A 3VOSA 3Q6IA 3E9MA 2VYNA 2UUPA 3L4SO 4BNUA 2JD1A 1A9ZA 1HDCA 2CDBA 4TVBA 4WJZA 3RBZA 1BDMA 3AJRA 4BB5A 4BO0A 4DYDA 5KTKA 2OMEA 4JP2A 3Q1LA 3T4XA 1UUFA 3HSKA 5KJ1A 2PR2A 3MWDB 2VOEA 1LDMA 1NHWA 3PWSA 4P4GA 2CDCA 1B15A 3FBTA 1B0AA 3GZ4A 4J0FA 3FNHA 4B4OA 2X0IA 4EUFA 4GVLA 1O6ZA 5DN9A 1XHLA 3I9OA 1H9BA 1R0SA 3FPCA 4DL9A 3VZQA 3AY7A 3ZGYA 3ZV6A 5HM8A 3CUKA 2NVBA 2VZ0A 4IGEA 5COAA 1ZMOA 3WGTA 1DSSG 3W8EA 1E5QA 4XQCA 2QRJA 1LEHA 4YAJA 1WVGA 4GLOA 4AJJA 4M49A 1KEUA 2X22A 3HADA 1ZSVA 3HJAA 4Z9FA 1A7AA 4BMVA 1T1RA 2HK7A 2O3QA 3UUWA 1SOWA 1Y5RA 2D8AA 2EKLA 3KEOA 3H9UA 3Q3CA 3O8QB 3VPHA 1JQBA 4ND5A 3DBRB 3JYNA 2X9NA 1MC4A 3KVOA 1E6EA 4UUNA 4D0SA 2GR9A 3L0DA 3RI3A 3LT2A 4D46A 4FGSA 1J4AA 1G6KA 3OEWA 3JQ8B 4NI5A 3MTJA 4N5NA 3ICCA 2ZK7A 4M87A 4W4TA 2J5KA 2D59A 4B4UA 3ONEA 1YO6A 2PWZA 4D3DA 2PD6A 4P22A 2FP4A 6ADHA 2EP5A 1GD1O 3OJ0A 3JV7A 2ILTA 3LT1A 3RJ9A 3X2EA 3HWRA 4HWKA 4LN1A 1L7DA 4INAA 4JK3A 4YAKA 1PS0A 5DT9A 5FWNA 4ZA2A 1ORRA 1NQAO 4FFOA 4IQ8A 4PG5A 4CM6A 5L95A 1MFPA 4WE3A 2OXIA 4R1SA 2NTVA 3L9WA 3SJUA 3EYWA 1BDBA 3UCXA 5KNLA 5KVQA 3AUSA 2NU7A 4DC1A 1P0FA 3WIDA 3Q11A 5TX7A 4FFPA 1ZK3A 2HU2A 1R37A 2Z1NA 3HNPA 2B83A 4F46A 1D7OA 1I36A 1YJ8A 1ZJYA 2PLAA 4B79A 1ZBQA 3SC4A 2WM3A 4RLSA 4E2ZA 4EZBA 3QWHA 4WCFC 2O48X 2PZLA 3BAZA 2A4KA 5C7OO 1HZJA 5TSDA 2O2SA 4JBGA 4XYMA 4CLOB 4JNKA 4E3ZA 2WDZA 3FI9A 1GFSA 1AN9A 4JJFA 4K9DA 1WDKA 4HNGA 1F8GA 3DZBA 1HLPA 4RDHA 3EY4A 3I83A 2OUIA 2J3KA 3O8QA 3WGIA 3KSZO 5T6BA 1ZUD1 3DBRA 4WLVA 4NG5A 4W6ZA 4UUPA 5T57A 2ZYAA 5CDTA 2JCVA 2AG8A 3F47A 3HN2A 4I9UA 3W6ZA 2P5YA 3IIEA 5LDHA 5AXCA 2VRBA 3MOIA 1H5QA 2GPTA 5DBGA 5A5EA 1NTOA 1XLTA 5DCUA 1IPFA 1GV1A 4U0JA 1DRWA 5U9CA 3WYEA 4DLLA 1ADGA 2G1UA 2I3GA 2JJYA 1G0OA 3NRCA 2BFPA 1M6WA 1WWKA 4MKZA 4AJIA 4YT2A 1X7HA 1XQ1A 2W98A 1BWSA 5DP1A 5EQFA 5IDQA 1SOVA 3BMQB 1PR9A 3MWEB 5BSHA 2FZEA 2V6BA 5FF9A 4ZHSA 1KOLA 2EV9A 3JD0A 4CM4B 2RH4A 5B4VA 1V6AA 4YRBA 3UAGA 3ITKA 1TA4A 3RIHA 3TZCA 4WLNA 4BL5A 2PGLA 2AEMA 3QVSA 3PZBA 1DIAA 2C5EA 2DBZA 3E03A 2Q2WA 1LX6A 1LDBA 3OMLA 4L74A 4OYRA 1Q1NA 3FCOA 4RF2A 3F1KA 2ZATA 1I8TA 3ZNNA 2DKNA 4MVJP 2PZMA 1B3RA 3TOXA 5IDXA 3ZW8A 2VHVA 3LT4A 2VCYA 4L4XA 2DPHA 1VRWA 1Z7BA 4YACA 1PS9A 3CINA 2Y0CA 5BSEA 5I9NA 4IY1A 4AL4A 4WK6A 4I5FA 4O59O 4IPTA 1PJBA 4J90A 5L7TA 1D4FA 1QXSA 2P2SA 1XGKA 1OC4A 4DPKA 4O63O 2V65A 4YVFA 2YDYA 5A05A 2X5JO 4FOOA 3E5MA 4WLEA 1ML3A 2C2XA 4IIUA 5I7EA 4LK3A 5IG2A 2OFPA 3LDHA 4EJMA 3GHHA 3FNEA 3I6QA 3ZHYA 4OHUA 1BHSA 1OMOA 4K1LA 1AXEA 1P1IA 1LC3A 1ZZEA 3H9QA 2PV7A 5I7SA 4R1NA 5JAQA 4Y6PA 1OOEA 5IFLA 5BNFA 4AFNA 5DBIA 4QQRA 1ZFNA 4A10A 5A5FA 4NIMA 3WG9A 4GL4A 5L7YA 2HKIA 3I23A 1EUCA 3VZRA 1DPGA 4QFDA 3HDYA 3DBHA 3JD2A 3ZHXA 2X58A 3H4VA 2O3TA 3GH3A 2HQ1A 4W7IA 3AWDA 2CVQA 4ND4A 5JNLA 1SNYA 3RUDA 1VL6A 2HMUA 5FYDA 3C24A 1NAHA 1YBVA 3PJFA 2BH9A 4J3FA 4W82A 4CM3A 4UUMA 1V35A 1U7TA 4G81A 3GA0A 1DC4A 2ZCVA 3DFUA 2GN8A 1A27A 2D3TA 2YY7A 3UVEA 3WNQA 1U1IA 3GGGA 2OP1A 4JBHA 3LC1O 3GDGA 1O89A 1PQUA 4CM1A 1I32A 3WJAA 5HRUA 2PKQO 2FR8A 1HF3A 3V2UA 1PJCA 4R1UA 5H82A 3NGXA 5A3VA 4CV2A 1HDYA 1ZXLA 3LF1A 5CHEA 1QLHA 4YJDA 3FR8A 4BO9A 2B5WA 5I8WA 2BRUA 4OGWA 2QZ9A 1B8VA 5HS6A 3GVHA 2AW5A 2CSUA 1T24A 1DC5A 1D1TA 5ER9A 1Y1PA 1ULUA 4XWYA 2YV1A 4RZIA 3U4DA 4EBFA 1HDRA 1PWZA 3NTOA 4XYEA 1LSUA 4WCFA 1BXKA 1I2CA 2VUUA 3L77A 4IUYA 2R6JA 3M2PA 4J0EA 2F1KA 4EI2A 1QYCA 4BVAA 1OZAA 3CZRA 1U8XX 3E1KA 3DBVO 4CUZA 4EGFA 4H7PA 3BXXA 2JAHA 3O03A 1EVZA 5ENVA 4ZU3A 3CTMA 1VL0A 4R1TA 5JAIA 1B8PA 2VTEA 3PYXA 4U6SA 3HE3A 1YDEA 3G0OA 4RLHA 1ZK1A 3I9NA 2X1HA 5T8KC 4NJMB 3JQ9C 2OO5A 4CR8A 4E31A 4ALKA 1TI7A 1LRKA 4FJ0A 4BGUA 4TRRA 2BFMA 3BTSA 3NGLA 5TLSA 4R3NA 5L4LA 3U49A 4A26A 4IBOA 1R4MB 4XEHA 2WYWA 1XIVA 1PGOA 3FNGA 4IDFA 2I99A 4UEJA 3L6OO 3SEFA 4B8ZA 3IAHA 4RO0A 2I6TA 5G4KB 2W4QA 3QY9A 3H2ZA 1SEVA 3A28A 4GGPA 4GLLA 4KDEA 3OM9A 3G79A 5KKAA 4CR7A 2Z1MA 3IJPA 4KQXA 1BVRA 1GV0A 4JBIA 5I9LA 4NBUA 4YEDA 1K89A 1R0LA 1R66A 5F3RA 2X5KO 5IZ4A 2Z5LA 1T2FA 1P1JA 1O94A 1PZEA 4TVOA 3ITDA 4D41A 3RKRA 1AE1A 4M8SA 2FY8A 3LT0A 3NV9A 1C1XB 3K2EA 3ONDA 4NBTA 1V3VA 2WD7A 4MO2A 5FI3A 3RQSA 3IKTA 2X5OA 4ZQBA 3DZIA 4PLWA 3ZZNA 4PLGA 1UXJA 4IS3A 3VKVA 5B37A 4BO2A 3S8MA 4BUCA 2I76A 3RASA 1LSJA 3JQBC 2WWRA 3I9KA 3QWIA 5L7WA 1AGNA 3VH2A 1K6IA 3K73O 5KIAA 4B4WA 4BQRA 1Z82A 1WZIA 5COQA 4BNFA 3TNLA 4GGOA 1ZMTA 2PH5A 4BOYA 2AQHA 4YYZA 1X1TA 3ANNA 5AOVA 2AE2A 1E7RA 5J23A 1RM5A 3DOCA 3MZ0A 4NJMA 4O5OA 1L7EA 3KXDA 1I3MA 4A03A 5KOIA 3RWBA 2FWMX 4F6LA 1MP0A 1ZK4A 3ROMA 1ZK2A 2WTBA 4L8VA 1RKXA 4J7UA 1HYHA 4H3VA 5T5QA 1SAYA 1Y8RA 4UULA 3QLJA 3G49A 5JY1A 1L1FA 1Q0HA 2JHGA 4JQCA 2NQTA 4LCEA 2JCYA 1HLDA 5G4KA 1XG5A 1GEEA 1X7DA 5HA5A 3OJFA 5EERA 3OETA 4II3A 4IDBA 3DFZA 3RC7A 3PYMA 3WSVA 3WWYA 5A4DA 4YXFA 3KOUA 1QYXA 1CETA 3VPFA 3WFIA 2NU6A 3CH6A 4DMLA 3ZWYA 4PN3A 2NU9A 4R69A 4II2A 3O38A 5FI5A 7MDHA 1Z7EA 4XR4A 1UDBA 3G17A 1QYDA 1Z75A 3VH3A 4Y8VA 4OXKA 1I3LA 1VM6A 1P31A 4Y98A 1C1XA 1GU7A 1U4OA 1EVJA 4GKBA 3WQSB 3JQAB 4PCVA 3DHNA 1P1RA 2Y99A 3KEQA 3V8BA 3WLEA 1MLDA 2POQX 1PX0A 4QSMA 4D3FA 5CEFA 1NASA 1DO8A 4E4YA 1MX3A 3U09A 1DFHA 2D5CA 1E7SA 3DAPA 3PYLA 2CFCA 4L0QA 4BV8A 2GCGA 1WAMA 1D1SA 4A73A 5CDUA 3F9IA 3PQFA 1LLDA 1LUAA 4OMUA 3WIEA 1EFLA 3EZLA 4H15A 3ZNPA 1I0ZA 3U4CA 4CMKA 1RYDA 4JN6B 2FR1A 3RC9A 1PR3A 1PJ4A 1YBMA 4DRYA 3OICA 4JGBA 4E5KA 1EEHA 3ENNA 4XQEA 4RQUA 3ROQA 1IL0A 3E48A 1ENOA 4B8WA 2DAPA 3TF5A 1Z73A 3MJVA 1PJQA 1PL7A 1LRJA 2Y1EA 3JD1A 2Q3EA 1FMCA 1WNTA 1ZSYA 1H6BA 2O50A 3GLQA 1CQJA 2IZZA 1RM4A 1H2BA 1DAOA 2R00C 3ZWBA 4EEZA 1ARZA 5L3ZA 3DBLB 4AJHA 3GNQA 1FDSA 3O26A 4ZRNA 1E0DA 2AG5A 3FSRA 4S1VA 1B26A 4FGWA 4BO4A 1PQPA 1LLUA 2Y93A 4PLPA 4P4LA 1QYWA 2AMFA 5T8KA 3JQ9A 4IJWA 3UFXA 3UOGA 3IL2A 1RYEA 3MOGA 4XYBA 4YDRA 5TJ9A 1T2CA 4NFYA 2O3JA 2VWQA 1KY5A 1Y81A 4LGVA 1B14A 1O0SA 3HDJA 4BQPA 3BHMA 3PQDA 3JYQA 4XJSA 1U9JA 3DAGA 1P1KA 2GYYA 3DR3A 2V6FA 2IZ0A 4Y6SA 4BNKA 5A9TA 5TS3A 3KYCA 1EBFA 3PLRA 3ZNOA 2B37A 2W2LD 4NZ9A 1TT5B 3TZ6A 1PJSA 4M55A 2WSBA 1HTBA 4AJ4A 3ON5A 4J1QA 4I08A 2DPGA 3MTGA 4J7XA 2YV3A 5JYDA 2BKAA 1GEGA 4Q3BA 5L45A 4E2YA 1TLTA 1PWXA 1W6UA 5DOVA 3B1KA 4UVGA 5BSFA 4J2OA 3AM5A 1OAAA 4BNGA 3KRTA 4CMJA 4UUOA 4IGFA 1S6YA 4OSPA 3JQBA 3FPLA 4JIGA 5A03A 4MP6A 1XWFA 3GG9A 3ZWVA 2BFOA 4UVHA 5AYVA 4XIYA 4KTVE 2HMVA 4Q9NA 5ILOA 2DLDA 3AOGA 4LSMA 4ESOA 3VZSA 3WBBA 2C59A 1GY8A 1JKJA 2ZB4A 4RVFA 4MP8A 2GZ3A 1NM5A 4B3HA 1A5ZA 5JO0A 4DLBA 3A1NA 2WYVA 4FR5A 1E7MA 1KERA 1UAGA 4O0LA 2B5VA 2FRDA 4BMSA 4DPMA 1PEDA 4E30A 4FD3A 4CLHA 4RF5A 2DC1A 4BKQA 5JBIA 2NM0A 3PEFA 1LBEA 4WNCA 4BIIA 5L53A 1KEVA 1CERA 4QT0A 4PG7A 1C14A 2AQIA 3EC7A 1UAYA 3HUDA 3GC6A 1TT5A 5KWEA 2P68A 3UF0A 3BMCB 1DEHA 2E49A 2XAAA 2GSDA 3UW3A 4CM9D 1A4IA 4UREA 3S2GA 1NX6A 3QIVA 1X7GA 2Q45A 2Z95A 1TVEA 2XXBA 3PPIA 1QG6A 3IUSA 4MIOA 5L40A 4BKPA 3VDRA 3KETA 1KC3A 3ENKA 3ONFA 3PQEA 3UH1A 1V8BA 3I9LA 3L4BC 2X7HA 4KDFA 4XA8A 2FPGA 4XRRA 1YQXA 3PHHA 4BO8A 1E7WA 4NDNE 2WD8A 3D0OA 1DC6A 1EVIA 4FIZA 1LDNA 2GN6A 2OBYA 3NX4A 1H6CA 3ETDA 4RPGA 3BTUA 3H3JA 1ZKMA 1LXCA 1EFKA 1PS8A 1YWGO 3RVDA 3TZQA 4DWVA 4NQZA 2IXBA 3C1OA 4Z0TA 3VH1A 1BVUA 2J5QA 1LDGA 2QRLA 3D7LA 1XKQA 3G3EA 3MJSA 1DIBA 4GKVA 5JMPA 4XR9A 3KSUA 5A1TA 3GHYA 1LQUA 1DRVA 5JC1A 1O95A 2UDPA 2C29D 3PP8A 4R01A 3BMOA 3C1AA 2X0NA 3LU1A 1DIGA 1N2SA 1FK8A 4J9VA 1I5RA 4GWKA 5C5IA 3EAGA 4YQZA 3JQCA 5EMHA 5JYEA 3H5AA 1CIVA 3JCZA 4LRSB 1MGOA 2UYYA 4OOEA 4WKGA 1I3KA 2WMDA 1IY8A 1H94A 1HYGA 3PK0A 3F5SA 2HK8A 1U8FO 3BMCA 1C1DA 1IZ0A 2BI7A 2VHWA 4ZQEA 3PDUA 3PJGA 4MVJE 2I66A 1MG5A 4MKRA 3WTBA 1ZXBA 3B70A 4X54A 4WOJA 4TROA 1V0JA 3QRWA 3INGA 4YJHB 4MVJG 4MIYA 1H6AA 1Z74A 5A3JA 4L76A 4HFJA 4U6QA 4L4RA 3WBFA 5K0ZA 1MV8A 1NQOA 1Y9AA 2IZ1A 2BD0A 1UZLA 3HN7A 3IC5A 5JPIA 3WDSA 5TT0A 1GDHA 2FHSA 3ANMA 1K6JA 3NT5A 3I52A 4B7UA 2OGUA 4RCVA 3V1YA 4J91A 3VPXA 2O3RA 1NVTA 4JROA 4HFRA 1JAXA 4R4JA 4J4TA 4J43A 2EJWA 2HO5A 3LLSA 2IODA 4P38A 1NXQA 3ETGA 3PTZA 3I9JA 2V7PA 3WGGA 3FR7A 2D5AA 1HKUA 1HYEA 3M1LA 4R5MA 1YXMA 1SB8A 4P4NA 1JKFA 3JYLA 4E2XA 4L75A 3OBBA 2ZTMA 1B8UA 4CM8A 4J4BA 5CDYA 3ADPA 3GMDA 4TWRA 1YVEI 3OQBA 1VKNA 4AJOA 3PHLA 4YAEA 4A27A 1W73A 2X0JA 4B3IA 2X23A 3WR5A 3B6ZA 4YWJA 5IZCA 1IOLA 2GUGA 1H93A 2I5PO 3CE6A 4FFRA 4R54A 1N5DA 3RJ5A 3HFGA 2XPCA 1WW8A 5AVOA 1U4SA 6LDHA 1VJ1A 2GLXA 3HDQA 4YJHA 1HWYA 5T64A 3KSDO 4GX1A 4RPJA 1DJNA 1G1AA 1PZFA 4UVEA 3GGOA 3PJEA 4N54A 2JFHA 4PFJA 5HBRA 4CR6A 4YRDA 1D8AA 2O4UX 4GBJA 1SO8A 3C8MA 4I5DA 4W9NC 4HFNA 5BSGA 4ALMA 2BI8A 4BV9A 4ZGWA 1V9LA 3TQHA 4CM9A 4DYVA 1YOVA 4J6FA 4CMGA 4AJPA 3I3OA 4PLZA 1DJQA 3WWZA 4NH4A 4YJFA 9LDBA 3CKYA 5JW6A 2Q1UA 3VKUA 1EE2A 1F12A 4IJVA 3AM4A 2HRZA 2QHXA 1DFGA 5AQ1A 3ZW9A 4BNXA 5GZ3A 1YB5A 3MEQA 1DRUA 2CNBA 1UP4A 3PFFA 3DBHB 3RD5A 5C7IO 2PZKA 4GPD1 3G1UA 2WEKA 4GMFA 2QZZA 2CF6A 1IUKA 4Z3KA 2JD2A 3V1UA 3R3JA 3X2FA 4MP3A 3RFTA 1J5PA 2Y05A 3ZI0A 3NAQA 3RFVA 2FMUA 2PZJA 3AY6A 4CL8A 3LF2A 3WS7A 5KVSA 4LMPA 4E33A 1DAPA 8LDHA 1CDOA 3L4BA 3DXFA 1F14A 1XR3A 2PGJA 2ZYDA 2BHLA 4BNNA 3DHEA 3RFXA 3LSYA 5L4SA 2V6MA 3AUAA 4TQGA 4XGIA 2GGSA 5EJ2A 3FHLA 3STHA 4CM5A 1VL8A 1JN0A 1Q7GA 4J4HA 1CRWG 3RAJA 4HADA 1GUYA 3A4VA 2G5CA 4EUHA 2UUOA 3NDRA 1Z45A 2QYSA 2IEDA 3OH8A 1GTMA 2DBVO 1ZNQO 2HCTA 4KZPA 4LVCA 4DIFA 1U3VA 1EVYA 1U28A 2OZPA 4NK5A 2NTNA 4IS2A 3KUXA 4Z9YA 3SC6A 1VI2A 1HETA 3SBOA 1QP8A 2E82A 1WDMA 4FC6A 4CL3A 1TXGA 4NNJA 5THQA 3LZ6A 2EKPA 4WCFB 1AUPA 1PGQA 5LCXA 2P9EA 5JAMA 1GCOA 4D43A 1EQUA 3K96A 3KB6A 4U8GA 1B7GO 2W8ZA 3JD3A 4BNZA 4D3SA 1MB4A 2C54A 3GFGA 4CV3A 4XKJA 1X0XA 1NWHA 3WQQA 1YL7A 3HHPA 5AXAA 1X15A 1XEAA 4CLRA 1IE3A 2BGMA 4A2CA 1K3TA 4GVXA 3W8DA 4UVIA 1NFRA 2HMTA 1MXHA 4GAEA 4WOKA 1YJQA 4XIJA 4HNHA 4LSWA 4N18A 3U3XA 1YGYA 4J9UE 4AJ2A 3OECA 3P5SA 5U1PA 2CF5A 1LNQA 1B3BA 2ZTUA 2HJRA 5ICSA 4TRJA 5EINA 1P9LA 3RC2A 2CVZA 2GF2A 1OC2A 2B0JA 4NBRA 4A7PA 3AU9A 4C7JA 4RPLA 2DVMA 3BTOA 2EIHA 4PLFA 1EDZA 4H16A 5I8ZA 3WXBA 1EQ2A 3I5MA 1P74A 3ZV3A 4PVCA 3KZVA 3QVXA 5F1OA 1GPDG 1ZIDA 3RKUA 1WMAA 2D2IA 4M1QA 3H65A 4DREA 1DC3A 1HDZA 2IRWA 1WP4A 1WXDA 2GZ1A 1SBYA 4KOAA 3M2TA 2WD7B 3NEPX 1ADCA 2CD9A 1O8CA 4PVDA 5EL0A 1UXIA 2VYVD 1P3DA 1UR5A 3EK2A 3TPCA 3DTTA 5CAEA 3D1LA 3RU9A 1ISHA 5AXDA 3ZU5A 2VNSA 1BRMA 1NNUA 3INRA 4FJ1A 3GVCA 2GRAA 1P33A 2EXXA 1QRRA 3GN2A 4IIVA 1PU2A 3GPDG 1OBFO 3N58A 1DB3A 1NBOA 4ALLA 1R16A 2H9IA 2Q1SA 3HG7A 2PNFA 2G17A 3PHGA 1R4NB 2RHRA 4FBGA 3TZHA 4YQYA 4TZKA 5JDIC 4J1NA 3H6KA 3W4IA 2O7SA 2GERA 4G5HA 1GR0A 1Y8RB 1DIRA 3JQFC 3UHAA 2Q49A 3GQVA 3PJDA 3S2IA 1E7YA 1YS4A 4IZIA 5KKCA 1MC5A 1ZEMA 4R68A 5DNAA 4BNWA 5B4TA 3AM3A 3Q9UA 4LVUA 4XGNA 1I2BA 1C0IA 1E3SA 1E6WA 3QSGA 4BNTA 4E6PA 2UV8A 4AJ1A 4OKIA 1FDUA 5A9SA 2VZ9A 3L07A 5JFOA 1QV6A 3Q9NA 1MA0A 2R2GA 4EEXA 5I7FA 4BKUA 1KVSA 2YHIB 2OORA 3K6JA 4GSKA 3T7CA 1WDLA 1W8DA 3ROPA 4XD2A 3TFQA 3ZCXA 1NR7A 2VTDA 4ZICA 1HSZA 3JQ6A 4CMBA 5I7VA 2HMWA 3EHEA 2WJPA 4CLXA 3U4IA 2P4HX 8ADHA 5KJEA 3IMFA 2ZTLA 1EUZA 4D79A 3BHJA 2AA3A 1LLQA 2FSSA 2WE8A 5IAAA 5FFFA 4PLCA 3DO5A 3UCEA 2ET6A 4XRGA 4HUJA 3IP3A 2VZ8A 1ISGA 5DCYA 5A06A 1A7KA 3JQGA 7ADHA 3SVTA 3M6IA 3DZKA 2VN8A 2D0IA 3IJRA 1LTHR 3KM0A 3E5RA 4EUEA 3Q2IA 3TN7A 2NU8A 1R4NA 4BNIA 4BNHA 2RCYA 2ZB8A 4MOWA 4IJUA 2X9GA 3QHAA 3ASUA 3OIFA 3DOOA 5CG2A 3QWAA 3QW2A 4BGVA 4URFA 3CMCO 2DFVA 4ND3A 1M6HA 4OOFA 4Q3CA 2GDZA 3ZWCA 4DBVO 5BQFA 4RVUA 3WTCA 1DIHA 1YBAA 2C82A 2GD1O 2X9VA 2Y68A 1BXZA 3GOHA 4E12A 3NJ8A 3OQ6A 4UVDA 1J49A 2EP7A 1DOHA 4OXNA 1H2HA 4FFNA 4RQTA 5JY6A 4XJTA 4FN4A 4ALIA 1HT0A 4CUKA 3MJCA 1EZ4A 1U3UA 1I30A 4Q3EA 2J5RA 3LYLA 2RAFA 1ONNA
chains in the Genus database with same CATH superfamily
1LQTA 2BLNA 5K4GA 1FEZA 1PGPA 2OXCA 2M6KA 4XQGA 1B0ZA 2W93A 2DBRA 4FWIB 4GPTA 4YPFA 2RJOA 5G4LA 2D1FA 4CMCA 1KDZA 5L4NA 2VJDA 1BSVA 4IDEA 4PRKA 2GWRA 3RF6A 2PX0A 4HX5A 1W46A 1XCBA 2CVOA 2NSDA 2VJCA 2R0QC 4R8MA 5CFZA 4HTAA 1U02A 1U0JA 3GGCA 2R8XA 4DJAA 3AIMA 3FG9A 5HDBB 1J8DA 3W9YA 3GUYA 4CG0A 3OFND 1EFDN 4CIWA 3H1FA 5FDFA 4ZT7A 5ES3A 5LYJA 2W6NA 2DZDA 2HH9A 3ZE1B 4MLDA 4WEOA 3USZA 3KYCB 4UJ3A 1VG1A 2ZUBA 2OHOA 2VO1A 3QOYA 3O8NA 2FLKA 3DMHA 3UKJA 5AUNB 3RVJA 3I4CA 3HB9A 4F45A 3C3WA 2BMAA 4OQYA 3TKLA 4QUKA 2VCEA 3BOSA 3G2NA 1D0VA 3ZEAA 1UZUA 4B3FX 1CJSA 5FOTA 1U4NA 4OI4A 1T4MA 1J07A 1WKCA 1AQLA 1M5TA 1SBTA 1U2GC 1P4AA 2C0PA 1EB8A 2PZBA 3S2FA 4WLUA 2HA4A 4UNRA 1O3YA 3ULKA 1OZ0A 4JUFA 4L51A 1I51A 4WY5A 2VKTA 1BW9B 1SBHA 2VA8A 2B8EA 2BDEA 5KAPA 3RTAA 3N2NA 3ZHZA 4BZQA 2OBXA 4MI3A 2PUHA 2CY0A 1VIYA 2XMZA 3PWKA 3CF0A 5H7XA 3C5EA 1T9DA 3ADOA 3H9EO 1BH2A 4A82A 1HFWA 2N9UA 3KO8A 5I7HA 3V2IA 4HLUA 4KUHA 4UQOA 5EQDA 5BSUA 4BFVA 4N7RA 5BWNA 3DYBA 4W6QA 4WOBA 2FW1A 4Q9JA 4FS3A 3JY6A 2Q7OE 1NGSA 2GPNA 2B4QA 3E58A 3PFHA 2HFJA 1ZLYA 4PYLA 2DUUA 2WF8A 5AVKA 1MEOA 3VR6D 3CUVA 4NK4A 2IWRA 4IH4A 3O6VA 5FCDA 1WUJS 3IP7A 5EMMA 2YZ2A 4YLEA 5B53A 1IBSA 2CNKA 2ONZA 4MVJM 3OSUA 4YV2A 1RLOA 2H2FA 4LVOA 1DXHA 2R1VB 4CF7A 3M1YA 2YWRA 4KHPB 3WHIA 4C0WA 3BFPA 2HLPA 4Q6BA 2I3ZA 1OE0A 2HSDA 3RE1A 3V8NA 2D62A 1JNXX 3WNDA 1EE9A 3UW1A 1KVQA 3HKDA 3FUXA 1T8YA 3UXEA 1JVNA 3IPRA 3JQFA 4D9FA 3KD3A 1HY3A 3KFLA 1JYEA 1QH1A 3FNRA 1OX6A 2Q5FA 2GTHA 4TS3A 5AJHA 2XQKA 2ZJ1A 1DKLA 1UDRA 1MO3A 4RIIA 4FS8A 2RHDA 3B51X 3OHSX 1P17A 1GYRA 2EF0A 1PJLA 3TX2A 4JLDA 1YS9A 1KQPA 1L8OA 2EW2A 2GJSA 2II6A 4GG1A 1BKSB 1NBWB 3B1ZA 2BTQA 1E99A 2UKDA 4B75A 4RVHA 1U1CA 3G7NA 3C8HA 4Z9XA 2QTVB 5TRTA 2VPXA 4EVRA 1A96A 1EK0A 2PL1A 1VBMA 1H2WA 3I6IA 4B3GA 2XSZA 3TKYA 3EVTA 1CYDA 4TMXA 3AIIA 1XU7A 3JRWA 3CG0A 4KOEC 5HKKA 121PA 1Z28A 3HEAA 3VDQA 1ICIA 2RHMA 5KBYA 5KYUB 4ZTUB 5C8YA 1WIWA 1JJ7A 1M76A 1H6DA 1WJGA 2MR6A 3QEJA 3RG2A 1ESDA 2PIAA 4IW3B 3L4JA 3SF8A 1YZHA 3R76A 4DQLA 4HH1A 4LBWA 5IN5A 2PH3A 4AZSA 1P4JA 5ADUS 5JH7F 1QIMA 1JTEA 3DXYA 4O4IB 4HYEA 4YRMA 4GWGA 3RG8A 4ETNA 1OJ7A 2P3LA 5JBNA 4PINA 3R9XB 4LV5B 1LLCA 5D3MA 3V7FA 2E6KA 1WG8A 1JPUA 3L7IA 2DFTA 1JLLA 3NG1A 5J1TB 5DNYB 1GUFA 4TYWA 2QJRA 3G1TA 3WLFA 4LYYA 3N59A 3HU3A 2Y0BA 5L51A 4H4DA 5DASA 4BWVA 2BBTA 4A9AA 1X42A 3HYCA 4KXXA 5EESA 5EIFA 1KO5A 1OX5A 1YB6A 1UXGA 4F56A 3UGKA 3G6KA 5LNK1 3QP9A 2NTEA 1W85B 3OPVA 1R9MA 3FPBA 4HEJA 3VU9A 4PX9A 5HUJA 2NNWB 3N0WA 1TUIA 2HD4A 1W76A 4RL6A 5DBFA 5DLQC 3TUJC 1N25A 4YRQA 4ARVA 5GZ1A 5J1SB 2Z1DA 4L9RA 4M0DA 4GX0A 3ZQKA 3NIFB 5KOHA 1UK7A 3GBPA 3DEYX 5K0JA 3MQFA 2DH6A 4MZXA 4MR8B 4Q9IA 1O57A 2Q2VA 4FE7A 4HF7A 2PUBA 3RANA 3PXXA 4WECA 1HDXA 1QC5B 2F8LA 3PX2A 4DBLE 2PK3A 1T8UA 1G2QA 3ZCPA 3DHYA 4M9SA 4V1CA 2ZXUA 3MJEA 2FN9A 3O91A 1MDFA 4G2NA 2H3HA 4MROA 3AB7A 4HUTA 2PMFA 4X6YA 3W7VA 3INYA 3H9JA 3IYLW 4NENB 4Q39A 1BZYA 1YQQA 5FORA 2O8DA 3IXLA 3JVVA 4WESB 4ZJYA 3NT4A 1E66A 4I5IA 2XKJE 1GOTA 3KG2A 2WJAA 2ATXA 3NRJA 3NLLA 3U9SA 4G0WA 4OM7A 4B3CA 2XCIA 2Y1FA 3OLZA 4NECA 4CJXA 1RRFA 3FHJA 2IXTA 4L28A 3OFNA 2CFRA 2RGCA 1NBMD 5AKLA 2XEDA 3UUEA 5KHOC 3P2OA 2X4DA 3ZN2A 4E22A 1NZJA 3IO5A 1YHYA 1IZYA 5AJXA 2P3OA 5KWIA 3LHDA 5I3ZA 3MOSA 1R7RA 2QJOA 1USVA 4P6VF 3MM4A 4Z0PA 3AF1A 4F3TA 1ZGGA 1XZNA 5AK6A 1BMDA 3VZPA 5ETJA 4R8KA 3TL3A 2NAFA 1FFXA 4XB1A 5AM4A 1JLRA 4KXQA 4LI3X 3VVBA 2O5VA 3DL4A 1J70A 2A0KA 4KXMA 2RIRA 3FJYA 2VJMA 1O2DA 3AT1A 4O6VA 1BHJA 1YDMA 1ZINA 2JKVA 2JEZA 1VC2A 2PSJA 3CZAA 3OZSA 4V24A 4X41A 1NY5A 1UZNA 1VLLA 5M3BA 1TUGA 1PNVA 1Q0RA 4FLEA 1T1GA 4Z1OA 1DJLA 2B1IA 2QP9X 5H02A 4R71A 4ZYZA 2FLVA 3F8WA 3PGA1 1X8XA 1MIHA 4LRTB 4UHEA 1YB1A 3UMBA 4YCSA 2X6QA 2EX4A 3TWOA 2E0IA 1USWA 4KDCA 3EOBI 4IXDA 5GMOA 5JJCA 2XNDD 3M6WA 2TMDA 4D45A 1KETA 1GL6A 3W5VA 2XVZA 5IT9A 8MHTA 2C4NA 3DZJA 1X14A 1WR8A 3S1LA 3K6KA 4GMDA 1Y4SA 4BMNA 4QJ3A 4YRTA 4GPEA 3QXSA 4KQIA 2VDKB 3NC1C 3JASA 3EFOB 1TZMA 5IULC 4B8YA 3QPVA 1YH3A 4ISCA 5EZ6B 3E1SA 2O19A 4COKA 4H3SA 4TT8A 3QU7A 4NCIA 2AXEA 2WT9A 4Q1VA 1V8FA 1WE2A 4LMRA 3DVLA 1SBIA 4K6GA 3RS2A 3SQDA 2B82A 3UK2A 3FE2A 4UFPA 2Z3WA 5C31A 4KO1S 3WB9A 5J40A 2OM6A 5IVKA 4TKLA 4UBLA 3L8MA 3MGBA 4ASUD 5DBOA 1SZDA 2QPLA 1HE5A 1SBNE 5B1YA 1A1VA 4NEHB 2PE5A 3CNBA 4Y2SA 3T94A 4M8KA 2IEAA 4L3OA 4ZYWA 2I2WA 2JLRA 3EH1A 3OJWA 3S1AA 4AROA 1NV8A 5KCZA 2OFXA 3RKSA 5FL3A 1B6GA 1CE8A 1H5NA 4IXWA 4ETMA 1T1JA 4QFMA 2V45A 3U5TA 1I80A 3VO1A 2R8RA 1W59A 2ZRHA 2YYSA 2VDWB 4IHJA 1K4KA 4G4SP 2B36A 4HGRA 1BOOA 4R2WA 4RPCA 4AJKA 3AI2A 3H42B 1WRBA 5HOQA 2WP8J 3UWOA 3B8HA 1L5HA 4MUMA 4BFUA 5JQWA 2O2ZA 2HWKA 3FPHA 2DFDA 1QWSA 2W2NA 3NXSA 2WUEA 5EQTA 1GRVA 3VR0A 1M8KA 2LGJA 4QEZA 5JT1A 2VHJA 1UBJS 1V2GA 3OZXA 4YJFB 4X1OA 4DCOA 3CWQA 3IAXA 5F21A 1B0UA 3KLPX 4ILKA 4OH1A 2BFBB 3C4JA 3OZTA 1SPXA 4FI3F 1FP1D 4BJHB 4GP9A 3ZV5A 1UPUA 2IYVA 1XV5A 4MW9A 3II6X 4QVIA 1FSSA 2WVAA 5HOEA 4QOIA 3ILXA 2XX3A 4Z0NA 2WT4A 3KWJA 1M2HA 1ADBA 2C94A 5JPCA 4E5MA 3LDFA 2O54A 2AC4A 3GPBA 3STUA 1VIMA 3AUFA 4LJ9A 2JLYA 2CZGA 3RCBA 2ZM5A 5KDDA 1IHUA 4FCWA 2VJQA 1ZN8A 4IFBA 5BV2P 3OI7A 3P19A 4M7RA 4MW5A 2Q3CA 3IRVA 3JD4A 2O2HA 3NWJA 3TW6A 4ECEA 4MZDA 1F06A 4FZVA 4OL9A 1YS2X 1ZONA 4B7XA 2PVCA 1ZDMA 1PR0A 1IJKA 2JAUA 3IR5A 5DULA 3B3GA 5HSGA 4KDRA 5I9MA 2OWEA 4A6PA 5MGBA 3PRJA 1DO2A 3UCFA 2VHCA 2VS1A 1BMQA 4NYMR 5JD4A 1TUBA 4R9RA 3GGPA 3LPDA 4E2FA 4JJ6A 3N76A 3VAZA 1LS6A 3G0GA 2C78A 1W5EA 2WSSD 1G7RA 1ZNZA 1U0SY 4OFZA 1X8JA 5JROA 3I6ZA 2M98A 4RZHA 1JFSA 2AFHB 4C0LA 2G67A 2PA3A 2LIVA 1HL3A 4BIMA 4EH1A 4DJTA 5C5CA 2J3IA 1M1YA 1Y1QA 2WFAA 3EF1A 4QFCA 2WP0A 2HLHA 4TSKA 3SZRA 1W5SA 1M6EX 2HSZA 5B3JA 3CCBA 2A9FA 1LV8A 4HGNA 5D3KA 3WHLA 4F6RA 2ECOA 5BO5A 2AN9A 5BV1A 3AR5A 4LJ6A 4EJ2A 4WADA 2I3DA 1IRIA 5TPWB 1NQ5A 1GGHA 2G4LA 3MB8A 3KVYA 2LCQA 5KJFA 3FF1A 2D1QA 1YVRA 5AICA 3WLOA 2J07A 2YW9A 1PTJC 1B73A 1USKA 2OV1A 3JQ8A 3OP1A 3IBSA 1RXCA 5EWMB 3QWFA 4PX5A 2PT7A 3L7DA 1RWBA 4RJTA 2H4FA 3V1TC 3CH5A 3DOFA 3DM5A 3IT2A 3IT3A 4RZQA 3L0YA 4CV0A 5EP2A 3JSAA 2EHDA 1X7YA 3CLRD 3LLUA 3T4PA 3NBYC 5TR9A 1KTIA 3R4CA 1YUMA 3OOHA 3V32A 1S3FA 2AI1A 3F4LA 3DTVB 2I2CA 1MW9X 1KZ4A 1BHQ1 4PLVA 5AWFC 1EXVA 3TL2A 1QE0A 4Y1RB 1ZU5A 4U7DA 4MAFA 3CWCA 3FCEA 4C0KA 3Q8XB 1L1RA 3C3AA 1Z33A 1XALA 4HNAB 4JELA 4NMHA 1Y9EA 3A4YA 1ISJA 2ZETA 2CMDA 3FFWA 4URUR 1N2BA 2X8WA 5TNXA 1B6RA 1KJJA 2F64A 3FYHA 3L6UA 3QV1A 4JNCA 2YZ7A 4IUCS 4XGRA 1I01A 3LW7A 4UM7A 3K9QO 2XNDA 2PKYX 3L6RA 1YAHA 1W2WB 2PRYA 3C7CB 3N05A 4K28A 4RIHA 5ALLA 3IA7A 2QZPA 2XNHA 2I71A 4DKJA 4E14A 2QBYA 3AOEA 1GU1A 1XQYA 4C4AA 1W0CA 4DIMA 2YOGA 4BNLA 4D02A 4JUBA 1RLTA 1JP7A 2XF8A 4WGGA 2R60A 1XMQB 2GO7A 4EHNA 2FFQA 1JDBC 3GK3A 3FTPA 2DOKA 1UZAA 4KO8A 4OXQA 421PA 1Q20A 2EZ4A 1TMOA 3ZY5A 5IC6A 4YT5A 2Z0MA 3IQZA 1A9XB 4HGOA 1YMVA 4ZREA 2VZLA 3ZXXA 4AG3A 3PGXA 1NW6A 1XA3A 4GW3A 4ASUA 4DRXA 5HX7A 2QRNA 2YDXA 1KDTA 3SYNA 5F76A 1LDYA 4HRYA 4UDNA 2QTLA 3F9RA 4RHYA 1E9AA 5TQVA 4AECA 1XC7A 2HK9A 4HVLA 3IEXA 2VNHA 4NEQA 4RD4A 4FGZA 1I7PA 3ME5A 2UZ4A 2C88A 4QXOA 13PKA 1NXWA 2KI5A 2IPAB 4AUNA 1WETA 3VO9A 2WAAA 4DUPA 5IHXA 1YR7A 3UKOA 1I2ZA 4U63A 3VNUA 1QCZA 5DX8A 3BXGA 3GLKA 3EIQA 4NULA 3A26A 4J7CA 4JXXA 1NI4B 1NU8A 4RTRA 4DLVA 5JE8A 2VIIA 4Q3KA 5EXTA 1R0YA 4O2BB 4I9HA 1FNNA 1FC0A 3QVTA 4O33A 4QXPA 1XA0A 4Y6RA 5I01A 4NHEA 1EK6A 3QMPA 3ZJUA 2P9HA 1ID8A 2IYFA 4TKVB 1H3NA 4YCDA 5HGXA 1W2GA 1ZICA 5FB3A 1W1UA 2EJVA 2AXPA 2GAJA 3AYXB 3AR6A 5C51B 1D3AA 3LD9A 2GXQA 3P2EA 2W2QA 3A6FA 1WZEA 3MVEA 1NULA 1HM5A 1RI1A 2WSLA 2KBEA 3A70A 4E5SA 5ERGB 1XZEA 3HN6A 1G7SA 1GPJA 1C1YA 1OU0A 2WABA 4CZ2A 1UPCA 1QP4A 3KLMX 2AEFA 1ZVMA 3GAFA 2FU5C 4JLWA 3K6SB 1N92A 1XD9A 3VX3A 2AK3A 1XZCA 2PL3A 2M1ZA 1X74A 1BHO1 2BWJA 2Z5VA 3B78A 3NTRA 1ECLA 1WZUA 4UD2A 4RD6A 4LXGA 2HL6A 3C5WP 3EA4A 1DTSA 4FCCA 4GOKA 4X64B 3K2IA 4V03A 5C37A 1D1QA 2Z5FA 1VSBA 3TRFA 4G0VA 2IYRA 4OHWA 4TS1A 2P2ZA 4JI2B 2Z3VA 4IUDS 2GESA 4EJSA 1DZIA 3OHMA 1RRMA 1TQHA 1PR4A 1ZOOA 3M82A 4LJYA 1Q77A 3PJRA 2ZYGA 1HG0A 5KWSA 2GLTA 2CXOA 1A2QA 4G0PA 1M3SA 2LNDA 3JQGB 4RS3A 5DE3A 4I6JA 5ALMA 1D03A 5GGXA 4NJOA 3C2QA 2AJCA 2AMVA 4O2LA 4ZFNA 2WZCA 2XGJA 1V25A 3FBGA 2WSSA 5HTKA 2W4IA 2A30A 1AJEA 1MRZA 1PZXA 2W4MA 1NI5A 1NZDA 1UKYA 1V1JA 2AJLI 2JI9A 5C34B 3TQCA 1ND6A 1HE8B 1L9KA 4RK4A 3RYHA 2W83A 4YRLA 4G36A 1CS0A 4GWLA 1H22A 2XKBA 3OEHD 2PZFA 3HJUA 3PD7A 4JJGA 1GTG1 4YBRA 2ZQYA 5LZ5A 3K2QA 1IN4A 4QHTA 5CD1A 3L0ZA 5FL7D 3DEIA 4CQMD 4F38A 2ZJ3A 2FETA 4YP7A 1K5DA 2RB4A 3D6UA 3AHEA 5BR8B 3HBLA 4GBED 1XKLA 3MCWA 2C31A 2JEOA 2AOXA 2OHXA 1Z6PA 3LPCA 1T3SA 1SEPA 4NMLA 3PV0A 4TLCA 4K6CA 4DC9A 2HY7A 4QLAA 3U31A 1GQ2A 3UT5B 1YDGA 3VC1A 3JW8A 3RSCA 1ORIA 1LPMA 1QK3A 5IKPA 3VOAA 2JGRA 2WIFA 2ZXFA 3LYAA 4ZJUA 2FV8A 2R6HA 4P86A 4RA9B 1Z38A 1RIFA 2JKZA 4TL9A 4INJA 3UXYA 1H5UA 5FV4A 4LYAA 5BT8A 2W2XA 3B3QA 3SICE 1NXPA 1IYZA 1QHYA 2IY8A 3D8SA 4FW9A 2B7CA 4CQLA 3DMTC 2RHLA 3REQA 1SUIA 4D0GA 3HCEA 5BYKA 3MJTA 4FMDF 3SJ7A 3DMRA 1O58A 3JQAD 2AQ8A 1RHUA 5FA5A 4MV1A 1ZMBA 3QLVA 5LC1A 1T6YA 3CRRA 1RKVA 1H1TA 1SU8A 1P6XA 2VI5A 4OJQA 1AXGA 1HC7A 1XWIA 1U2DC 4G1FA 2F3RA 2VWPA 2GASA 4PFQA 3COPA 4E5YA 4A8JB 4KVZA 2AX4A 2F9LA 4ZVSA 1FXWA 4MJXA 3CW9A 2HV8A 2PUTA 3Q7IA 3LQ2A 3FF4A 3PX7A 2R751 1ZGCA 3TDNA 2ID8A 3FYCA 4DQUA 5A6VA 1XRNA 3GFPA 4OCZA 1WUKS 4JI8B 2YFYA 2BHTA 4U6NA 1YIDA 2RG7A 2R9VA 1NRXA 3BD8A 3CV3A 5AI0A 1U2EA 4JI3B 1NHGA 1MZVA 2AF3C 2XDQB 1W7AA 1MKYA 4JLKA 2I62A 3QVWA 4IMIB 3DO8A 3UAYA 5KI6A 4HXYA 1VLQA 4QIHA 1TECE 4XARA 2J3MA 3U4HA 1V47A 1ENPA 1CIJA 1J20A 1JQAA 1ENYA 2GBCA 4GMHA 4QU8A 4FLMA 2ERXA 3TOZA 4CIYA 3GLIA 1DKRA 4IHJF 2CE7A 3KSRA 5BVHB 4YJ2A 1S2IA 3BWEA 1SCDA 3I2KA 1N5MA 3AEKB 4I14A 4KQ1A 4A4DA 1PSDA 3BWCA 2GFQA 5JNVA 3CNNA 3VTFA 4CDRA 2C9OA 4BV2A 4RHEA 2BTEA 2E21A 2HV9A 2X4IA 2QQ5A 1GKYA 2ZB2A 4EYSA 3MTDA 4RIGA 5KQPA 1D4AA 2ZUCA 1RLJA 4KI7A 3IS3A 1ZAKA 4U7GA 1BS2A 3GMTA 4UTZA 1QAOA 1IXKA 2YC2C 3A05A 1T4BA 3A32A 4RVGA 4IEFB 3VJLA 1BXRB 3K0EA 4F21A 3SDZA 2CHUA 2UU9B 4NL4H 2RC6A 1NM5C 3QKIA 3O1LA 3C7AA 1P1CA 1UWCA 3K0HA 3RRBA 3UUFA 3QE3A 3CZ9A 2C9YA 3OF2A 2V55B 4JL6A 3GV0A 4OBXA 4OHFA 1BDJA 1G2PA 4WGFA 1R4MA 1FSZA 4HAOA 4B40A 1KK1A 5DEOA 4EW1A 3FOZA 4MGHA 2Y9PB 2BGLA 4XUEA 1NMQA 4IM7A 5M04A 1GSOA 4IXNA 3A3PA 4PR3A 1UT5A 3LLVA 4DIDA 2D1RA 4EQ6B 2NLOA 3LVFO 4ZHQA 5C2JB 2UYOA 4MJLA 1IPEA 4EITA 2CMGA 1GT6A 2EGGA 1KXJA 1F51E 3QNUA 4R6WA 4I50A 5EWJB 3WLAA 1H2XA 2H7YA 2RAVA 1SHTX 1SXGA 2YHBA 4RPHA 5EE9A 2VNJA 3F49S 4FW8A 4RV9A 1V37A 2NQ8A 2WLSA 1RJ9A 1JI0A 2YYYA 3D1VA 5DM4A 2DHEA 4H27A 4RYLA 3D0RA 5DZSA 2IUUA 5KYNA 2F3SA 4FGJA 3Q0TA 4FKMA 1G9SA 1T6NA 1VPVA 2FK8A 1VKJA 4MH0R 1XTRA 2JBHA 2DBQA 2JEYA 4JIMA 3WVNA 3CVUA 3DE0X 1Z6QA 3IB6A 2OTCA 3K0AA 3QUCA 4H59A 1Q0SA 1GZHB 4H0NA 4LY0A 5JEEA 5FRDA 3E3MA 4Z99A 2CEKA 3RUFA 4MCIA 2KQUA 3TSCA 4QUAA 2FPXA 3DE4X 2CLHB 3M5CA 2AMLA 1KI7A 2VTKA 1GG8A 3FCAA 4CLDA 2H31A 5LQCA 3HEMA 2QLFA 1GITA 2WUGA 1KEPA 3FGPA 2BFWA 1UP7A 1NVWQ 4M9QA 2CNOA 5JS8A 2PV0A 2R3SA 1E1NA 3QHQA 1S9HA 2WHYA 4J16A 4PR0A 1CUHA 1KZ1A 4YALA 5FIUA 4QPZA 4JEHA 4HWGA 1N6IA 2JZOA 3KOZA 5EE1A 5BV7A 3VO2A 2XTAA 2PUGA 3A2MA 3CZMA 4A2QA 1FVFA 2CHVA 1X1QA 3ESCA 2C2YA 3P0FA 1XCLA 4KMSA 4LAFA 5HF8A 1MR3F 4GU5A 4DFDA 1QS0B 5J4VA 1DJMA 1M7GA 3WA7A 4HYTA 2IYWA 4ERXA 4FBLA 3OEHA 2DTXA 3G8AA 4DLZA 3V97A 2EKZA 4CF6A 4G1EB 3ZWPA 2A59A 4FC7A 2OHVA 3FH0A 4ZTBA 4J3NA 3MUFA 2Z9BA 2V58A 4CQLB 5FL7A 4MHTA 4CQMA 3WOVA 1PR1A 1C0LA 2JLZA 5IDXA 1HBJA 3GO4A 2MWMA 1IZ9A 3RARA 1ZGAA 2C04A 3WYBA 1BN6A 2MSKA 4ARZB 4B5LA 5BUZA 5LOVF 1QGZA 4YO7A 3D43A 1CWUA 2MJLA 3A6LA 4Q3NA 4C5CA 2DHDA 4LMAA 3WL4A 1O6CA 1L7OA 5KOYA 4R3UC 4DC0A 1Y7HA 3I6MA 4J6EA 4PNEA 3OE4A 2I3AA 3NYQA 2EIXA 3RUCA 1OH8A 1CUWA 1SIOA 3AXTA 3B8EA 3HXPA 3LYUA 1JZQA 3RTCA 3WGZA 3WQRA 3UV7A 4F3YA 4LHZA 1QH8A 4QE3A 1Q14A 2IC5A 4UNNA 5KNCD 5AVZA 5B64A 3GRUA 4YRIA 5IFKA 3P0EA 3GVPA 3L6BA 2YRXA 4DSZA 2Q5QA 2YVUA 1MBZA 5TC4A 1QRTA 4QFBA 5E7JA 4QDKA 4U2GA 1FTGA 1ZJWA 2J6IA 3EMBA 2DP4E 4MARA 3V4PB 1LDEA 1HDGO 2NO9A 1QHHA 3EGOA 3JQAA 5FWAA 2VT6A 3K1JA 2J59A 4RM2A 5G53C 3PFBA 5LP1A 1HE4A 1XZJA 1NJ8A 2YY6A 2V59A 4P0TA 4ZT3A 2JRCA 3FTFA 4PRYA 4TWJA 1P73A 4MPPA 1JPNA 3VRHA 1NJ5A 3W1VA 5JLAA 1JT2A 3R6LA 1M1NA 4ZMBA 3V4LA 4GKJB 4PC3A 4F86A 4UNIA 1Z2PX 3Q2KA 5FP0A 4AS3A 3OMXA 2YJZA 4E21A 1FOEB 4L6CA 4ID9A 1DAIA 5CA1A 1PK8A 2HRCA 1ZITA 1EK5A 2G25A 1NSYA 2WPNA 3JARA 1DQPA 4G41A 1Y7IA 4TYQA 2OHGA 3KUDA 3BGWA 2CLFB 4O1MA 2GMWA 4J1TA 3W2EA 4B2LA 4ARCA 1K27A 3NDIA 3ESQA 4CDGA 1GPNA 4B3JA 1U63A 1DCFA 3LBAA 3NUQA 1VMKA 1XL1A 3R6TA 3I6YA 3GEMA 4L0DA 2ACKA 2JHFA 1TRKA 1FDOA 1SD1A 2WWTA 1FTQA 2ZPAA 3O7MA 4EL0A 4N41A 5IABA 3MJFA 1NJ2A 5DI9A 4RTLA 3H4MA 2XYQA 3PL1A 3RLFA 2GZ2A 2VXCA 1KJWA 3DPIA 1YI0A 3LCMA 2ECKA 1K7EB 2G06A 1YU9A 1QIIA 5SZIA 1FDTA 1UDWA 3ISJA 5EIBD 5KNBH 3BG5A 4ALJA 2ZCUA 3OZDA 5C3MA 2PRKA 4L1KA 2D8MA 3H3FA 1VYHA 3SHOA 2NZ2A 1E6KA 1QX3A 3PR3A 3STYA 4DV1B 4OX9Y 5IZCC 4ZRDA 3ZQJA 1W0KD 2SBTA 3L0OA 3DOHA 3FPFA 3E3LA 3NM6B 4OQLA 4RBNA 5TMBA 4E7OA 3C39A 4J94A 1SFRA 1VKOA 4DSOA 5BW8A 4TX1A 4ZRMA 4IDUB 4MS3B 1KQNA 1IY2A 3ESDA 1P75A 3CUUA 4NPCA 4FVTA 4E07A 3EUWA 2JLUA 4MQUA 1KH3A 3MA0A 4P93A 1AH2A 1H0KA 1N0WA 5K1ZA 4WEQA 1J25A 5JS7A 5A9RA 1TAUA 1JW9B 1DELA 4IQGA 4JL5A 2J9RA 4NNOA 5LDGA 1A95A 1WXEA 3HV0A 2VHQA 4IVNA 4J1SA 1TIBA 1VE3A 4C7KA 3GEDA 1RP7A 1RWVA 4LXXA 1KNQA 4P80A 4DDKA 3CUEF 2NACA 3R0XA 3EISA 4B7ZA 2FJPA 1BYUA 1DJPA 3ESXA 4QLOA 2Y1CA 2EEZA 3ZY6A 2W22A 2DWCA 5HZHA 2ETXA 2WFLA 5CYFA 2N46A 5MF6A 4YRRA 5K3FA 4M98A 4WL0A 3HZZA 3CVOA 3DVAA 3RS8A 1Q19A 2RHWA 1PQYA 1DIOB 3U2QA 3R5HA 5CXQA 2N1MA 4FHEA 4CGZA 2PMDA 3I1JA 2PRZA 4K9NA 5JVDB 4EY5A 4ED9A 5F77A 1K8YB 4Q3AA 5LQKA 1SG6A 2AS0A 3A8TA 4MCJA 4ZXFA 4Q82A 3MK31 4ENPA 1CUDA 1ILWA 1GG5A 2W2KA 1RBZA 1L8AA 2E4WA 4PG8A 3QFSA 10MHA 4E0BA 3ND9A 4AVYA 1V3QE 1ONPA 4UZSA 3R3SA 2ZB3A 3C3DA 1JQ3A 4MS4B 4QXAA 3T3IA 4NCBA 5CH3A 4QVGA 2VEOA 1AKYA 2VPTA 2H92A 3MJRA 1QSGA 1VB3A 3I2YX 5JXHA 5CP8A 1QLJA 3J81k 1Y8CA 4N0PA 4QTUB 3ZD7A 3T1QA 1CUEA 4GZ3A 2YMPA 4PF1A 3M3DA 3SS9X 3BD6A 3L4SO 4E46A 3IBCA 4XOIA 2HXSA 2QUZA 1VXOA 1Z5PA 2JD1A 5DISB 2C2HA 3C3YA 3A4LA 4KN6A 3QX9A 5JH7B 3Q4GA 4QATA 1X7WB 1YR6A 3RBZA 3LFTA 5JZ9A 2WWVD 2AK2A 2WZDA 5I48A 2GXAA 3OHPA 3Q1LA 5ERYA 3ETJA 3T4XA 4F5EA 3DSRA 4R9VA 4CDMA 1TCBA 3KSMA 4C05A 4HQFA 4ZO7A 1L7VC 3NPMA 2H1WA 3PUKA 5KJ1A 5I3CA 2VOEA 1LDMA 3A11A 3BL5A 4PZZA 2CDCA 1XT6A 3GZ4A 4D9BA 3DFMA 1ZKDA 5F9FA 4RM3A 4HAVA 2HT1A 2IS1A 5DJ5A 4LXHA 5DN9A 4X7BA 2L19A 1OLSA 1XHLA 3I9OA 3JVIA 4TKZA 3NHPA 4DMFA 5KTNA 3O3CA 1QU2A 4DL9A 3GUHA 3R75A 3VZQA 1PJAA 2PLRA 1NW3A 3S5UA 3U44B 1PT5A 4MQ6A 1PAUA 3ZV6A 4F11A 1O54A 2NZWA 3QXXA 4AT1A 4HDSB 5COAA 1IK6A 2I2AA 1Q84A 4MHOA 2DHRA 1NXTA 2C3UA 4XQCA 1YVDA 5KNCA 3KXPA 4ZVKA 5IUNC 3AJEA 3P27A 2X22A 1U2QA 4M49A 1U0BB 2ZROA 4K0KB 1KZ9A 3O90A 5AJWA 1SOWA 3K0BA 3TPFA 4M6WA 4B85A 3KEOA 2H54A 3Q3CA 5IJ9A 2PMCA 3DOEA 4KU4A 1JQBA 1PEKE 1GQOA 2XADA 1NN0A 3JYNA 2XKKA 3S8YA 2WIDA 3L84A 2GR9A 3LOQA 3Q15C 1UKBA 3GJ7A 3L0DA 5KDLA 4D46A 4FGSA 1T3GA 1ULZA 2IU4A 5BOSB 1G6KA 4DG5A 3WAJA 1NURA 3MTJA 4OPMA 4TXLA 1PUIA 2ZK7A 4W4TA 2J5KA 2QZ4A 1JPVA 1JILA 4KQ2A 2MR5A 1FSGA 2GB4A 3DLHA 4EG8A 3OM1A 4L5JA 2J6CA 2OB1A 4P22A 3BICA 1V43A 1X39A 3OJ0A 2YICA 1XJWA 1DQZA 3JV7A 3LT1A 4OHXA 2WOOA 1QANA 4W1QA 5EWLA 2P3SA 3DQQA 3OOJA 2ZT7A 2WIKA 1ORTA 1L7DA 4YDSA 5EIHA 1EFVA 1UM9A 2O2EA 1MB0A 1FYEA 1UKEA 2HIGA 2QAGC 1TC1A 1RHMA 4X85A 1XOIA 4XE5A 3K7EA 5DT9A 2JIDA 2GLUA 1KFEB 4IQ8A 5L95A 4CM6A 4EA7A 1G66A 1T9HA 1MFPA 1A2KC 2ZR9A 5BUCA 2NTVA 2ODBA 2PFSA 2JH3A 1W35A 4MRMA 3SJUA 4EZIA 1I94B 1HX7A 3TLXA 4LJSA 3HCCA 1PRYA 5TF0A 1ODCA 3FXAA 1SXPA 5SZJA 4PTLA 2NU7A 1VCIA 2QR3A 4AUEA 4LJKA 1N6NA 4BVBA 4ZHQF 1YNSA 3B6JA 4TYPA 1D2MA 2A0XA 2ZITA 4NS1A 4P7KA 2WG0A 5CHYA 1R37A 2K7FA 3HNPA 2B83A 5CXUA 3GLGB 5KZMB 1BE8A 5BSVA 4I50F 4UBMA 4B79A 1WPGA 4JKOA 3D54D 4KMMA 3SC4A 3U4QB 3A6ZA 3AH8A 3T99A 2CHFA 1W0KA 2O48X 2PZLA 3NWBA 2A4KA 5C7OO 4S04A 3EZGA 5JANA 2BM8A 1GG9A 1HZJA 4XYMA 5CB4A 4E3ZA 3REGA 2WDZA 3FI9A 4H7FA 4RY2A 4FNOA 4AN4A 4K9DA 1M2OB 2PX5A 1GGJA 4L22A 2NUPA 4CNBA 4BZZA 2DT8A 5TEVA 5CVVA 1GJRA 4RDHA 1V5IA 3KTFA 2IUTA 2GBLA 2OCPA 3F74A 1RZ3A 3VFDA 2Z09A 2J7PD 1TK3A 2AFHE 2YIVX 3IA2A 2PX6A 4OFXA 3RFCA 4NG5A 1WU8A 1AQUA 4KFRA 4HC4A 4W6ZA 2FEWB 1GNSA 3TB4A 4QD3A 4MGEA 1NYRA 1E9BA 1T9ZA 3W6ZA 3L0PA 3V42A 1KI2A 1SQFA 1BFDA 2FUG6 2OQ2A 2P69A 4NJEB 1DCKA 3C6MA 2W2MA 3VUEA 3AF3A 4KV9A 5HNKA 1RI4A 4N8DA 1UMCB 1XLTA 2RGWA 3E27A 3M9XA 4O08A 1E4VA 4UCQA 3UZUA 3D8UA 3GH1A 4YAFA 2I4OA 3AL0C 3EVCA 3TINA 3PE4A 4PS1A 3Q6NA 4M7OA 1BE1A 1Z7WA 1EIZA 1G0OA 3NRCA 3OU2A 2LW7A 1F2TA 1FMFA 3HBJA 4Q21A 1JJAA 2B2NA 4M37A 3FYDA 3WLQA 3M89A 3LVBA 3TW0A 1GL9B 2PN1A 4PXSA 5IDQA 1S89A 4F85A 1SOVA 2UVPB 3EEYA 3EZ6A 4KQGA 1PR9A 1TA0A 3P26A 4LHSA 4PZLA 3JALA 5A4FS 4BZWA 3QMWA 3HKCB 2A0UA 1O94C 2ONKA 2I8AA 3JD0A 5HKLA 2IYTA 1V6AA 3QUAA 1BFUA 3ORYA 1PZMA 2OCIA 2PGLA 1Z0AA 3LZDA 3LPMA 1ZM9A 3EQ6A 3OLCX 3PD1A 3QVSA 4BWYA 3OQMA 2DBZA 1W5TA 2X3UA 2Q2WA 4HDQB 4YCJA 3I2GA 1E5DA 1VHQA 1T5SA 4NHOA 2XUKA 1ECJA 2C9MA 2Q1XA 3AR4A 2ZATA 3FCOA 1I8TA 1XYVA 2DKNA 4RF2A 2J9FB 1NYLA 1ZD3A 5TV2A 4AU1A 4KPFC 1XK6A 2XLBA 3ZTYA 3BEOA 3BL8A 3LT4A 3QHPA 1SULA 4EHKA 1KNXA 1TPYA 2DPHA 1WMDA 2CLDX 3KAKA 3L7MA 1X2BA 5HP4A 2X0KA 1J9ZA 5BSEA 2ROQA 2VJYA 1JMKC 4LX0A 4B6GA 2P41A 4BDSA 2P4SA 1R0BA 3IQGX 4RA6A 2PLNA 4WK6A 3V4RA 4J90A 1RMYA 1Q1EA 1ETUA 2ZULA 2NOAA 1OC4A 2IUFA 2V65A 4C2BA 2YDYA 1QP7A 3PI6A 1FSFA 1I6LA 3P71T 3CKMA 1DARA 1IQUA 4M1TA 4C6RA 2ZVDA 5A5VA 4WLEA 3FX2A 4LZLA 4UFOA 2C2XA 2G9RA 4D9KA 3DBIA 5JWOA 1CQIB 3F2VA 3U61B 1C9DB 1Z8NA 2QENA 3K8OE 4HDRB 3LQYA 4V0LA 3BD7A 3ZZMA 3HSYA 1Z5NA 1Z8HA 4ZK6A 1CYEA 4HB0A 2QVBA 2A4MA 3MBOA 5IEBA 2VJOA 1YUNA 1QQ5A 5FTWA 5CA1F 1JHDA 1SC1A 1OMOA 4RVOA 4D8YA 4K1LA 2C7RA 4TSRA 1AXEA 3FVWA 4ARUA 5ELLA 4IGIA 5I7SA 4O25A 4R1NA 3K70C 1YZUA 5JAQA 4FT4A 1VOTA 4XVHA 2O06A 4YI5A 2W2OA 4I2VA 4Q48A 2OC9A 3TD9A 1ZFNA 1KDYA 1A69A 3COYA 4GL4A 4PHGA 2ZRAA 4U39A 2HKIA 3SF0A 4MW2A 1MQSA 4XD7D 3G89A 4QOGA 3OF3A 1TVCA 2XUQA 4HPWA 3DBHA 4AZVA 3L6CA 3ZHXA 1Y9JA 3EJ6A 3OVMA 4KXFB 1LGYA 3GH3A 4XPIA 2HQ1A 6ABPA 3UHPA 5LP6C 4NU8X 1RTTA 4GP6A 3ECSA 4OIFA 4Y1FA 2XCOA 2HMUA 1RJFA 4WD3A 4J3FA 4W82A 1BEUB 2B3TA 4W5RA 1ZJ4A 3CH7A 4GP7A 4UUMA 4DMHA 4JT8A 1V35A 3BD9A 4DR6B 1NC3A 5D51S 4JLOA 3TLGA 1POXA 2D3TA 2YY7A 3UVEA 2GT1A 1U1IA 3ROFA 4YV7A 3LC1O 1W4CA 4AWXA 4WVFA 5F73A 1UC5B 2LCIA 5C53B 1D1PA 1I32A 1NT2A 2GN0A 3Q9LA 4GPIB 1P7PA 4V1CI 1O96A 2XDWA 4MLPA 4RFSB 3GLHB 5EJ8A 1T8WA 5CRIA 4Z7JA 3ZKWB 1ZXLA 2C8VA 1F38A 3H0CA 1QLHA 3LF1A 1V71A 4NVRA 5AVQA 5CLHA 5CCBA 4HLQB 5I8WA 2FDCA 4OGWA 2QZ9A 5HS6A 3CVVA 3D1JA 3OCJA 2G1PA 1WB5A 2WWIA 1IHPA 2QNRA 3N5KA 1A50B 2CK3A 2Q4DA 3AUYA 3GGDA 4Z49A 1WB6A 1Y1PA 3A1UA 3I01M 4XWYA 3GJQA 3DEZA 4KXWA 2EFDB 2D3WA 1A8UA 3R24A 4RZIA 1VP9A 3C6QA 4P4SB 2PRJA 4S0ZA 3G2MA 3GYBA 3QKTA 5D84A 3ESBA 3EWIA 2XD9A 1RAAA 1AUVA 1QF7A 4XYEA 1W49A 5JAUA 1LSUA 3L49A 1EA5A 1BXKA 4ZQIA 2VUUA 2C4UA 4KK3A 2NXEA 3NHAA 3UO8B 2EBFX 4BVAA 1D2CA 1W25A 4D0LB 5B1DA 3CZRA 1E4EB 4L9WA 3NIDB 2J7PA 5A5DA 5JYBA 3AJ9A 4EGFA 3BXXA 4ZU3A 5A71A 1GGKA 4K6KA 3EDYA 1RJEA 2NMVA 4MR7A 4E7PA 3WJ2A 1KJ8A 3AG6A 1F5SA 2B2XA 4AUMA 3OD5A 1YDEA 5AVJA 3V6LA 3Q8MA 4XWKA 2X1HA 4OLFA 3VO8A