2BLLA

Apo-structure of the c-terminal decarboxylase domain of arna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
330
Chain Sequence
MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVVEHRKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN YFBG
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L- Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
total genus 128
structure length 330
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2bllA02
4RDHA 2BFPA 2O50A 2FSVA 5A9RA 2NU7A 3DZHA 3AU8A 3HUDA 1ZK4A 1NQ5A 1YL7A 5EJ2A 3QLJA 2FP4A 3I3OA 3NYWA 4GSLA 1I24A 3MTGA 4DQXA 4TVOA 4IGFA 4J1SA 4I5DA 3JQ8B 4U6QA 4Y6PA 3GNTA 4LMRA 3F46A 3MJSA 1Y6JA 2QZZA 4AFNA 3CPSA 3DL2A 1B2LA 1ISGA 1SPXA 1PQUA 3VPGA 3RJ5A 5IZCC 1OAAA 2G17A 3Q0EA 4KDEA 5ENVA 3VDRA 4YVFA 4D0SA 4HFNA 5F21A 3ZH2A 3W4JA 4XZ3A 1O8CA 3BMQA 3IJPA 1C1XB 4R54A 3GVXA 3I6IA 5A04A 4XR9A 4PLTA 1X15A 3A06A 1V8BA 3GHYA 3JD0A 4M86A 3RAJA 5JDCC 5I7VA 4YT2A 4YQZA 3I23A 2AEJA 2PK3A 3GFGA 1GV1A 3A14A 3LZ6A 4JK3A 4NDNE 3ZHYA 1JKFA 3CZMA 4PG7A 4IJUA 1GD1O 5IN5A 3ZW8A 1NASA 1VM6A 3JQDA 4IJWA 4YAGA 2PFGA 4GMFA 1GCUA 4MP6A 4RPKA 5DP2A 2V65A 1UXGA 1F06A 4BMSA 1B16A 3M6IA 4BB6A 4EITA 3GEGA 1H6AA 1T4BA 3H4VA 5CEFA 1YBAA 3RUIA 2ZCVA 4E6PA 5L7TA 2O2SA 1LEHA 3DWFA 1GUYA 3Q2KA 5IZ4A 4GGPA 2BI8A 4MVJA 4YXFA 2PWZA 3DBRB 1DRWA 5EINA 3HWRA 3O26A 3Q1LA 4BOYA 1O5IA 3RFVA 1L7EA 1DLJA 3WFJA 3ONEA 1KVRA 3P5SA 1GQQA 5IXYA 2EXXA 5IF3A 4J43A 1ZCJA 1HDGO 2QRJA 2Y1EA 4KWIA 2XOXA 4GVXA 4M54A 2RH8A 1JVSA 1K2WA 1PGNA 4IINA 5BSGA 1GPJA 5KKCA 2AG8A 4A73A 4S3MA 3CMCO 4NBWA 3RWBA 4XCVA 3BHMA 4KP7A 3AM4A 4FFOA 1AUPA 1A27A 3Q9NA 2HK9A 3U62A 3JQAA 3ZWVA 1HF3A 3PP8A 2JHGA 4CUZA 1WLYA 2Y0EA 3TZCA 2Q99A 4B7XA 3I9LA 4II2A 3UHAA 4NFYA 2XXJA 4RPGA 4GWKA 4CMGA 5KVVA 1BG6A 2E48A 2FPGA 4ZA2A 2W2KB 2I66A 4MIOA 1SEPA 1V9LA 3H6KA 3LT4A 1DIBA 1I3KA 4NJOA 1E77A 4NPCA 4Q3BA 4FFNA 5CPBA 2AE2A 4N18A 4RPJA 3E82A 2BRUA 1DFHA 2POQX 1LA2A 3ASUA 1YQDA 4HXYA 1SO8A 3WXBA 5ES3A 4YA6A 2LDBA 4YQYA 2Y1GA 2ZYAA 1JKIA 4YDRA 5G4LA 3JQ7A 2AXQA 5L9AA 3TSCA 2EP5A 3L4BC 1X7DA 3K30A 3IMFA 2VHZA 4PGFA 4BO7A 2XAAA 4RCVA 4YT8A 4DUPA 3FD8A 1R4MA 3IIEA 3H9GA 4OYRA 4Y6RA 2XXBA 3OQBA 3DZKA 1F8GA 4L9RA 4DYVA 4KZPA 4LRSB 3ASVA 2CF6A 3OQ1A 2NU9A 3WGYA 4K1LA 4FPXA 2RAFA 4YJGA 2F00A 5JAQA 1KYQA 4J9UE 3OECA 3RC7A 1GL3A 1PEDA 4YBZA 5DT9A 5G0UA 3VHRA 3HADA 3VZQA 4WLOA 1XYGA 4AJ4A 3BMOA 3SVTA 2C7GA 3FRJA 3L77A 2HSDA 1LRLA 3MJCA 2DFVA 3L9XA 3RBZA 1RPNA 4XYGA 1XU9A 1I0ZA 3DAGA 4M87A 1RKXA 3WOHA 5ITWA 1HE5A 4XQ9A 3R0IA 3O8QB 4Q3CA 1PS0A 4BB5A 4O1MA 5DCWA 4TSKA 5A1TA 3JD2A 1GEGA 3DEYX 1AHHA 4U7WA 4G65A 3UOGA 3UCXA 2O3QA 4EEXA 3D4OA 3IUSA 3WR5A 1R15A 1IYZA 1FDWA 1C0PA 2BFOA 3I9NA 4CR8A 4BNJA 1ZK0A 4D46A 2JL1A 4AJKA 4XB1A 3SX2A 1GV0A 1MG5A 1P3DA 3ST7A 4NR0A 4ND5A 3ANNA 4P38A 1PJ2A 2ZIZA 3AK4A 4R1TA 2WYUA 4XRRA 3ZGYA 2I6TA 1PGOA 4A26A 4YAKA 5L3ZA 4CODB 1DIHA 4UEKA 4KWHA 1EE9A 4HNGA 3VH1A 5KNLA 3I4CA 2X0JA 5JYDA 3K5PA 1C1DA 4P22A 1E6WA 1UJMA 2DBVO 3PYMA 2C29D 4EUHA 2X1HA 5EN4A 3QA9A 5JAZA 4LVCA 3IKTA 3HDJA 4ZQFA 4Z3DA 1Y9AA 3H9UA 2B37A 4P4LA 4RF4A 2HU2A 1NVMB 1E92A 1UZNA 3PIIA 4BNKA 4RVDA 1B15A 3IOYA 1ZMTA 1T4DA 3JQFA 4IXTA 3ZWXA 4E3ZA 1A5ZA 3DOOA 3W1VA 3JQ8A 3BTUA 1SNYA 1T2FA 1KETA 2ET6A 1FDSA 4BHTA 4IM7A 4MVJG 4R51A 2VT2A 5JY6A 4EGFA 1G1AA 2J3HA 4PLVA 1Y5RA 1HDCA 1ZUD1 1GYRA 1RJWA 4DTIA 3AY6A 3ENNA 3GRKA 4BL5A 1RM5A 1E3WA 4E12A 4DMLA 3UN1A 5CFZA 3IDSA 3RJ9A 3WGOA 1SMKA 4UUOA 4QO8A 2CVQA 2I99A 2V7PA 3PYXA 2JFFA 4D0RA 1PJCA 1XIVA 2X23A 5K6AC 1ONNA 2OBNA 3MWDB 2XF8A 4YAIA 2HMTA 3G3EA 4CUKA 1V6AA 1NFRA 2QRLA 2J8ZA 2WEKA 1PS9A 5C37A 3ETGA 3EUWA 4O5OA 3NDRA 3PI7A 3UAGA 2JCYA 4DBZA 3ITKA 5LDHA 2D5AA 4BKUA 3C8MA 3CEAA 4AJJA 1X13A 5LCXA 3ZWAA 4TWRA 3ANLA 1LLUA 2G76A 1QV6A 4BKQA 1IUKA 1VC2A 3AOEA 1HWYA 1AE1A 4IMPA 3S8MA 2WE7A 1KC1A 4B8WA 4CLEA 4XIJA 3O03A 3ZI0A 1V3VA 2NWQA 4PRLA 5DZSA 3RASA 4WE3A 1KVUA 3UUWA 4Z3KA 2WWRA 3IP1A 7ADHA 1YJQA 3QE3A 1YOVA 2OL4A 3DMTC 1EVYA 4QXMA 4LVUA 2Q1UA 4YRDA 3EAGA 4CLRB 1DB3A 1EVIA 3ZU2A 2FRDA 4XA8A 3UW3A 2JD0A 4BUCA 4XKJA 4B79A 3DHNA 2EIHA 3GN2A 4RQTA 4FGSA 5CG1A 2VHXA 4N54A 2DU8A 4ID9A 2X0NA 5U9CA 3PHHA 4J7CA 2VYND 1JN0A 4CQMB 3DBHA 1MX3A 3DHYA 4FSHA 2FR0A 4IQGA 4FC7A 1ZEMA 2IE0A 4PLFA 4W9NA 3OBBA 3S2FA 1YGYA 3BMCB 3FPCA 3JQBC 3K73O 3KUXA 3QWAA 3R3SA 1ULSA 2VN8A 4NQZA 2W2KA 3G49A 3UXYA 4NBUA 2TMDA 3FBTA 1H2BA 2RIRA 5F1OA 1XEAA 3KBOA 3NTRA 1R0LA 3GGGA 1DC5A 1CWUA 3DOJA 4J4BA 2VHVA 2HJRA 1KVSA 3D7LA 2X5KO 4IUYA 4IY1A 4I5FA 1YDEA 4PVDA 3KEQA 3HQ4O 3A1NA 1DFGA 5T8KA 1RM0A 3WG9A 4L4SA 1QRRA 3LU1A 5I8WA 1QLJA 3WLEA 4FW8A 4OJNA 1TB4A 3QQPA 3FCOA 4OSPA 3ZZNA 4E5YA 2B4RO 3LF1A 2RH4A 4KUGA 1B8PA 3FI9A 2JCVA 3BTOA 1IPFA 3QWBA 4N5LA 4TMFA 4CV1A 1VL6A 3T4XA 2R00A 3PRJA 3KZVA 3PJGA 1LX6A 5A5FA 4DL9A 4A27A 5L40A 1BDBA 4L75A 3VPHA 3NTOA 1ISMA 1EQUA 3TRIA 4YRAA 1QYVA 3LT1A 4D43A 3DXFA 2FSSA 3K9QO 4XYBA 3CZRA 1TEHA 5IFLA 4EJ0A 4B4WA 5A02A 4EW6A 4IBOA 3PK0A 4PFJA 2B5VA 3DAPA 4RJTA 3BMQB 4FC6A 5TGDA 2H9IA 2P9CA 3NJ4A 3VPXA 2V6GA 4RORA 5MGBA 1RM4A 1EZ4A 2D5CA 3B1FA 5A9SA 1T2EA 3F1LA 1JLLA 1VKNA 4G81A 3WYCA 3EHEA 5JAIA 3L07A 3MJVA 4XX0A 2IEDA 3JTMA 5ER6A 1ZK1A 2NVBA 2B35A 3LLSA 1C0IA 1W73A 3UCFA 2BGLA 4OMUA 3H5AA 4TRRA 4Z9FA 2X9VA 3NGXA 1MLDA 5L7WA 4D42A 2UUPA 1B7GO 2BFAA 2JCXA 1BRMA 3DDNA 4UUPA 1W6UA 5JMPA 1E3LA 3U9LA 9LDBA 1IY8A 4FOOA 4UVHA 4B3HA 3WWZA 3U49A 4CMAA 4FFLA 5JXWA 2AHRA 3HDHA 3ZDFA 4E4YA 3K6JA 2J5KA 1KEWA 4OOFA 3RROA 4CLDA 1H93A 3FTPA 2G82A 1DDOA 1PJQA 2X22A 5IDXA 1P74A 3OH8A 1MG0A 3QRWA 5EMHA 4W82A 1I33A 2UDPA 4MO2A 4AL4A 4H15A 2RCYA 4Z9XA 3WSWA 3C85A 1FK8A 4BQPA 3CH6A 3PLRA 3JQAB 3H5RA 3ADOA 3KRTA 1E7RA 4NH4A 2G0TA 5H82A 3FNHA 2VYVA 3E9MA 1Z74A 4FQ8A 1ML3A 3ONFA 5TS3A 1YKFA 5H83A 1SCUA 2JHFA 4C7JA 4IS3A 2EW2A 2ZKLA 2V6FA 4OL9A 4OKIA 4M8SA 2VRCD 1LSJA 2FPIA 3ZU4A 1XELA 4URFA 3AM5A 1BSVA 1J49A 1GUFA 1N7HA 4MKRA 5CEJA 3T7CA 1X7GA 2OXIA 1MXFA 4JBGA 2OZPA 3MTJA 2WMDA 5CG2A 1H6BA 4X54A 5AVOA 4AJIA 1QMGA 1MGOA 2IZZA 3JQ7B 1CQJA 4RLSA 3DTTA 4YCAA 4DMMA 4F45A 2UVDA 1QSGA 1DLIA 3AFNA 1KOLA 5KVSA 4DPMA 2HMWA 5HWSA 2GLXA 3ZWMA 4HY3A 1R4MB 3N7UA 3W8EA 3WSVA 1U7HA 1NVGA 3I9JA 3G1TA 3OIFA 2ZTVA 2GCGA 5TNXA 9LDTA 5F3RA 3T4EA 1I2CA 1NFQA 2I67A 1ONOA 2EJWA 5L53A 5B4UA 4BNLA 4YJGB 2QIOA 1H0KA 5C3MA 2OBYA 3H9EO 4D44A 3V2HA 2Q50A 3F5QA 5DOZA 3VZRA 3BMOB 2A35A 4BNNA 3AI1A 4ALMA 3TF5A 1ENZA 4Z6KA 3FBGA 1XKQA 1T1SA 3L4SO 5IZCA 4WLNA 4WASA 2EWMA 1NPYA 4ND2A 3QJ5A 3ROMA 5AYVA 4AG3A 4CM5A 3I9MA 1R16A 2JFGA 3EK2A 3RVDA 3R6DA 1TVEA 3ULKA 3JYLA 1LQTA 2PLAA 5JMWA 2NTVA 3OJEA 3S1LA 1GUZA 4XWYA 5JDCA 3VDQA 2R6JA 4FR5A 2Z5LA 5I7EA 4R3WA 2Q4BA 5TJHA 4BMVA 1BGVA 3TFQA 4KQWA 1I8TA 3JQCA 4W7IA 4NU6A 1E1MA 3KEOA 2QYSA 3B20A 1PX0A 2OFPA 4TQGA 2YQ4A 4ZQGA 5L95A 3PQEA 1XWFA 5AXAA 1PGQA 4KTVE 2AQ8A 3WTBA 2DC1A 3OQ6A 5A9TA 4DPLA 4QT0A 2PD3A 5MDHA 1I3NA 1XR3A 3ICPA 1N7GA 3KOUA 1OZAA 5FF9A 1E1KA 3GEDA 3EMKA 4ZRMA 2VOEA 1BXZA 4NG5A 3GAZA 4UEOA 3WFIA 5AXCA 4RZIA 1K5HA 4MINA 4YT4A 2Y0CA 5TJ9A 1M6HA 1ID1A 4GH5A 1UP7A 2D3TA 2WE8A 5DNAA 3GT0A 4TROA 1EVJA 4JP3A 3B1KA 4BO4A 4BNUA 1I36A 1X1TA 4FIZA 3OJ0A 1E7QA 1JWBB 3KLMX 3TZ6A 4A7PA 2DT5A 4EJMA 4BV9A 3X2EA 3V8BA 4UULA 1LJ8A 4KUHA 2VZ8A 3SJUA 3FNEA 3BMNA 1HT0A 5COBA 1PS8A 3LC7O 2NADA 4KQXA 1NHGA 2QRKA 1ADBA 2DFDA 1YXMA 4JNKA 3VVCA 5AOVA 4FN4A 4WCDA 3CE6A 4CLHA 2IXBA 1LRKA 1SOVA 5CAEA 2Y66A 1GAEO 4DPKA 4OHUA 1C3VA 1ZFNA 1UP4A 4E0BA 3LLVA 4N5NA 1XLTA 3I5MA 1YB1A 4UUMA 3FWNA 1E3WB 1QXSA 2Q46A 2D8AA 2VZ9A 2WDZA 5L45A 3ZWNA 3HSKA 4QFCA 1NM5A 2ZYDA 1HLDA 4OOEA 3P2YA 4J3FA 1R6DA 3PPIA 3IJRA 3PDJA 5DOVA 3E5RA 3WYBA 3DBVO 4BNVA 3CTMA 3L4BA 2BD0A 2WTBA 3NEPX 3OEWA 4ESOA 3ZV6A 1WDMA 2D59A 5BNFA 1H94A 1GTMA 1R12A 2R2GA 3HJAA 1NR1A 3LC1O 3EZLA 3MCVA 3LYLA 2Z1NA 4YAJA 1VJ0A 4IZIA 1Q0LA 3OM9A 1C14A 4DQUA 1VE9A 1A7KA 2VRCA 1Y8QA 5BNTA 2CSUA 1E7WA 3TOXA 4HKTA 1DIGA 2HQ1A 1XCBA 4LW8A 4DQVA 4HP8A 4CL3A 4Y8VA 2OMEA 1PJSA 4AJPA 1LUAA 2ZQZA 1NPTO 1DIAA 2W98A 1FDVA 2Y93A 1YOVB 4JBHA 1B26A 3PHJA 1ZKMA 3FPLA 3RFTA 3ORFA 1O6ZA 3DZBA 2PH3A 3W4IA 4R41A 4YR9A 1P77A 3MEQA 3P2OA 3KVOA 2DTXA 3GVCA 5T67A 4DA9A 5HTOA 5ICSA 2WM3A 4NBRA 5JE8A 3VZSA 4GAEA 1WWKA 1DHRA 3GDFA 4NFSA 1NWCA 3VZPA 1U4OA 2D1YA 3JQEA 4IDCA 1EFKA 3OJLA 1JAYA 2O4CA 3G1UA 3DBHB 1QYDA 5JCJA 4WLFA 2TMGA 3H5NA 4RF3A 2DQ4A 4CQLA 1HDXA 3GY0A 3RI3A 3INGA 3FN4A 1YH3A 1NYTA 2AE1A 3E1KA 3RQSA 1YONA 1OFGA 4WGGA 1DO8A 4E31A 4RVHA 3U0BA 4DVJA 4R9RA 4AJHA 1WXDA 1OI7A 5TT0A 2NNLD 3KYCA 3I9OA 2HO5A 3H2ZA 4EUEA 3RC9A 3ZU3A 3OA2A 4GQAA 1G0NA 4TKMA 4WEQA 3ZNNA 4E5NA 2O3SA 3WBFA 2O3JA 1JDJA 2GO1A 3HE3A 3EYWA 2JAPA 3F47A 2P5UA 4QFDA 4CM3A 4PLHA 4B4VA 3AI2A 5ER9A 5BQFA 3QVSA 3L6DA 4W99A 4BNWA 2B69A 1CIVA 3ANMA 1M6WA 1Z75A 4IDAA 4B4UA 1P45A 1RWBA 3OEYA 1D3AA 3KO8A 1YQGA 1QR6A 2HMUA 3DB2A 5KIAA 4PZDA 4KUEA 5KKAA 3KXDA 3SJ7A 1MFZA 3B70A 4BO6A 1JQBA 4BQRA 1K6JA 5G0SA 1ZSYA 3BTVA 1LU9A 4WJZA 1U1IA 1XQ1A 1B3BA 3RKRA 3OFSA 4Z9YA 1Y81A 1WW8A 1EVZA 2J5QA 4L4XA 1UUFA 1HDOA 2WD7A 4CM6A 4F6CA 1QYCA 4EI2A 2C2YA 5KVQA 4AVYA 3DZGA 2AMFA 4Q39A 5IDWA 4R4JA 2HKIA 3ADPA 1ADGA 5A9SB 3GUYA 4JJGA 1CRWG 3ZWCA 4HADA 4BGIA 4WNIA 3ZV3A 4WCFA 1ENPA 1D1TA 3P7MA 4BKPA 5HS4A 4BGVA 1YWGO 2OORA 4RL6A 2GRAA 4YYZA 5K6AA 3TDKA 5A4DA 1UP6A 1DXYA 3NJ8A 3L9WA 4R1NA 1WNTA 5KTKA 3VTZA 3JQ9C 2ZQYA 3X2FA 3BA1A 4JIGA 4F6LA 1K0UA 4IJVA 2Y1OA 3AOGA 2QX7A 1PWZA 2RBEA 2GF2A 3DAFA 4K6FA 3WIDA 1Q0HA 4WLVA 1ZH8A 1IB6A 5GY7A 3TN7A 4XYLA 2H5LA 3OIGA 1U9JA 3GK3A 4HFRA 1H2HA 4R5HA 3RC1A 3AUUA 1G6KA 1DRVA 1WAMA 4IDGA 4PRKA 4PZCA 4OQYA 4EZBA 1U5CA 2GR9A 3JYNA 3WJ7A 5KJ6A 4FFMA 4UEJA 4DLAA 2UV8A 5C5IA 2VOJA 3UCEA 3ZNQA 4UVIA 1T25A 3DMTA 2W90A 1XA0A 3M2PA 1T26A 5HM8A 4XGNA 3KTDA 3OA0A 4JN6B 4CM8A 4I9UA 4A2CA 3O9ZA 1I2BA 3UH1A 1LDNA 2SCUA 3DZFA 2YV3A 4PIVA 2OHXA 4XR4A 3D4PA 4K6CA 2GN4A 2P4QA 5G4KA 4EEZA 1J6UA 5C7LO 3GPDG 3P19A 5I8ZA 1PWXA 4CUJA 5DBIA 1GQYA 2IXAA 1EMDA 3KYDA 3AWDA 5GZ3A 1UZMA 5ITVA 4HV4A 1MV8A 3VOSA 4BV8A 4DGSA 4DC1A 1LBEA 1A71A 1KC3A 1P9LA 1Y5MA 1GYPA 1WP4A 1N1GA 1PZHA 3EZYA 2G5CA 1N8KA 4FJ2A 3JQBA 4J7UA 4M1QA 2ZB4A 1U7TA 4JXKA 3PGJA 4R68A 4YJFB 1WZIA 2NU6A 1HKUA 1EK5A 5A5EA 1Y9EA 1PGJA 1SB8A 2EHDA 3SBOA 4WCFC 2EG9A 3HDQA 4CMKA 1UDBA 1U2DA 2VRBA 3AUTA 4AJ1A 3Q6IA 6LDHA 1WVGA 2NACA 2FMUA 3QVWA 1PL7A 4BMNA 2FHSA 2HRBA 4I9NA 4IZHA 1IOLA 3MJ4A 1J4AA 1KBZA 3WQRA 2CMDA 4DIFA 5CDTA 2VYVD 3MOGA 4YJDA 1U3VA 3GVHA 5CDUA 1DC6A 4L8VA 1LI4A 5TX7A 5G0TA 4AJNA 3LC2O 4BNTA 2PGJA 1E3EA 2NVWA 3FR7A 3CIFA 3NKLA 4Y98A 1E7MA 2NTNA 1UZLA 2O7SA 2Q4EA 3JCZA 3GVIA 3LF2A 3HZZA 3RCBA 4W7HA 3VAZA 3GAFA 3RC2A 5THQA 2O3RA 5FI3A 1GZ4A 4IJKA 5CEEA 3Q2IA 5BSFA 1WPQA 1LDYA 1UXJA 4FJ0A 3WGQA 2JJYA 1QP8A 4W4TA 3GHHA 2BELA 1UDAA 1DC3A 5KJFA 1ADCA 3BYZA 1HTBA 5EQFA 5FEUA 1NQOA 1AXEA 2NQ8A 3F4BA 3R3JA 2VQ3A 2VTDA 3B1JA 3GH3A 1EUZA 4IIUA 1M66A 3G79A 4BO5A 1NTOA 2IZ1A 2C5AA 3GN1A 1FXSA 1VL8A 2Q45A 1HE4A 3F9IA 3OICA 1EBUA 3U4HA 3KV3O 1A7AA 1LRJA 1XGKA 2ZJ0A 4ZQHA 3SXPA 4BO3A 1DOHA 5J23A 3S55A 1ZXLA 1ZNQO 3PJDA 1LDGA 4GWGA 2HK7A 4DXHA 3PTZA 2J3IA 1HYGA 3EY4A 3CXRA 3K31A 3UFXA 1P31A 4FFRA 4J2OA 1S6YA 1P1HA 2GASA 5C7OO 1X1EA 4DIBA 3BZUA 5I7SA 3SEFA 3M1AA 5TIIA 1YQXA 3H3FA 1N92A 1IHXA 5TRTA 3STHA 3SC6A 4JP2A 1U3UA 1U8FO 3JQGB 1VJ1A 1E3JA 2AQIA 2P9GA 3EDMA 4WNCA 3AUAA 3ZNPA 1PL8A 2I76A 2DM6A 3SLKA 1M67A 1P1KA 1N9GA 2A92A 4MVJM 3BMNB 5KWEA 2JD1A 3PHIA 1M75A 2IZ0A 3A28A 3PZBA 1PL6A 3ZWBA 2Y1FA 1Q1NA 3MJEA 3E48A 1LTHR 3ETEA 1C0KA 2HJSA 3AU9A 3GR6A 4LISA 5C7IO 4E13A 3NT5A 2FR8A 2VWQA 2BFMA 4MDHA 1PGPA 1UXIA 1V3UA 3VH2A 3PFFA 4L74A 1T2DA 4NNJA 1NAIA 2I3AA 4UVGA 1JWAB 1WDKA 1HSOA 3TL2A 1E7SA 5HS6A 1VJTA 4B3IA 1LDMA 2HDHA 3QHAA 1E5QA 4G2NA 4J0EA 5EESA 1GFSA 2YYYA 3EVTA 1TI7A 3UVEA 5A3JA 4ZJUA 1P0CA 1QYXA 3DC2A 4UVEA 3K92A 3PFWO 4NZ9A 3SLGA 5H81A 4N5MA 1KY5A 2VCYA 4TRMA 2PZLA 3S2EA 1KVQA 4PZEA 4CMHA 3ZNOA 2Y99A 3UF0A 1YE3A 3JYQA 3W6ZA 2O4UX 3O4RA 4C7KA 4E32A 3WJAA 1LNQA 3VH3A 1XHLA 3IQDB 3TZKA 4DLBA 4ND1A 3PQFA 1MP0A 3GEMA 4RVGA 5JAMA 3PXXA 1Y8QB 1OMOA 3OETA 3RUEA 1EE2A 3H8VA 4CLOB 4ZICA 5JLAA 1H9BA 4BGUA 1H5QA 3JYOA 4CMCA 4D3DA 4IQ0A 1LSOA 3ZCXA 5COQA 1HZJA 4HX5A 2B0JA 3BHIA 2J6IA 4GBJA 3LT0A 1HRDA 3TZHA 4OH1A 1PJ3A 4GMGA 1NWHA 1AN9A 4ZHSA 1P33A 3RIHA 1PQPA 3M1LA 3INTA 5F1KA 3QSGA 3G17A 3MOIA 4E2ZA 4RDIA 5BNIA 5I9MA 2BLLA 4J2HA 4GKBA 2AG5A 5FI5A 1BDMA 1RM3A 4ALIA 3TFOA 1OC2A 3DBLA 3ITDA 1ARZA 4BNFA 3NX4A 4U8GA 5HA5A 4DLLA 5TQVA 2I5PO 2NV6A 1CDOA 3DMYA 2ZB7A 1VI2A 3A4VA 3FSRA 4CMEC 3DFZA 1MA0A 1WMBA 1JU9A 4CQLB 4KTTE 2WD8A 2FZWA 4O6VA 5L4NA 5DF1A 4R69A 2QG4A 3F4LA 5DULA 4I9HA 2V6MA 1SEVA 3RU9A 2CDAA 1Q7GA 2LDXA 2PZKA 4TVBA 2EKLA 1HSZA 2C59A 4MVJF 4J1TA 5TF4A 4HWKA 1J5PA 1HLPA 2P9EA 3KYCB 3U5TA 1KY4A 3N74A 3WGGA 2EJVA 2P4HX 2DVMA 4XEHA 3W8DA 1LDEA 2I3GA 4L76A 1DJQA 2AQKA 2PH5A 4YEDA 1ZO8A 4RVFA 4YJFA 3GMSA 4H16A 4QTZA 5FFFA 3WGTA 1GYQA 1GZ6A 2X4GA 3IUPA 1SB9A 1YS4A 2NLOA 4MOWA 4MKXA 2Z95A 3AUSA 4LCEA 1D4FA 1VSUA 2GPTA 1IPEA 1ZJYA 1MXHA 1NVTA 3BXXA 1I30A 5G2OA 1D7OA 3I4FA 1BXGA 6ADHA 3RUFA 3ZWPA 3WNQA 5JCJD 3BHJA 2NTJA 2D0IA 2FWMX 1O89A 3C1AA 3C7AA 4UREA 3VTFA 3D4NA 1I3LA 2JFHA 4TKLA 5GZ6A 2PKQO 3ROKA 3GG2A 2W2LA 3TQHA 5JO0A 4P8RA 4FD3A 2VTEA 2EERA 4YRBA 5A06A 4GLLA 5I9LA 3JYPA 4UAGA 2GZ1A 1MFPA 1P0FA 1UXKA 1UDCA 3HB4X 8LDHA 2E4AA 2WD7B 4W6ZA 4AICA 5JDIC 2ZCUA 4E5PA 1Q7CA 3RBXA 3NV9A 5L4LA 1TT5A 2Q2QA 1NXQA 4XDYA 1D8AA 4BNGA 4D3FA 3QVOA 4OXYA 3WX0A 4GKVA 2GUGA 2QW8A 3OJOA 2PGDA 4MVJE 4QO7A 4ZQBA 4QQRA 5EQDA 4WCFB 3GUCA 4Q9NA 4R9SA 1OBFO 1O0SA 3WS7A 4Z0HO 3QWHA 2C20A 1R66A 1VSVA 2C5EA 1EQ2A 4IPTA 1EEHA 1DC4A 4TRNA 5FWNA 4NHEA 2W8ZA 4RVUA 3JSAA 4CM4B 4E2WA 4YTEA 5TSDA 2GYYA 4PG5A 2EGGA 3O38A 2YJZA 4I08A 1YBMA 3G0OA 3D1LA 5EIOA 3RUAA 3ONDA 3RKUA 3QWFA 1DPGA 1NR7A 4ZQEA 1HYEA 2C07A 3I6QA 1ISHA 4I8XA 5JCXA 3E9NA 4CL8A 5DCUA 2Y68A 1J0XO 3K8ZA 1EBFA 4D3SA 2WSBA 2UUOA 3R1IA 4RQUA 4AJOA 2CF5A 4ZN6A 1AGNA 5IG2A 3E18A 1H6DA 1CJCA 4PVCA 3DO5A 1Q7BA 4B7UA 4BO9A 4ALJA 3JQGA 5IJZA 4CM8B 1TA4A 4QX6A 4YJHA 3PVZA 4GI2A 5LC1A 1N2SA 2BMAA 4CR7A 5ICMA 3VH4A 3DR3A 4ROSA 3V2UA 1PQWA 3W8FA 3WB9A 2AEMA 2Q49A 3NUGA 3VKUA 2CUKA 1KERA 1B0AA 2C2XA 2D2IA 4M49A 5G4KB 5B4VA 4DYDA 5KCZA 4CR6A 1ZJZA 3U4IA 3EGOA 4INAA 3C1TA 3KYDB 4EDFA 2YHIB 4H7PA 4I5EA 3NRCA 2NSDA 3GG9A 3F6YA 4FS3A 5COAA 3KETA 2ILTA 1ZEJA 3VPFA 5BT9A 3PLNA 1KEVA 2NVUA 2X5OA 4K26A 4ZRNA 1KIFA 4PLPA 2JD2A 3CKYA 4WOJA 4ZU3A 4E5KA 3K96A 4R5MA 2VHWA 1DSSG 4L73A 4PCVA 2Q1WA 3PDUA 2ZYGA 4ALNA 1LSSA 3Q11A 1UXHA 1NP3A 1XG5A 1YVEI 4O63O 4WUVA 4D79A 4XQGA 5IAAA 2EKPA 1CF2O 3E6AA 3D64A 1HETA 5B1YA 1E6EA 1E7YA 4JROA 1FJHA 1LQUA 1GEEA 3AI3A 5DN9A 1UAYA 1YRLA 2B83A 2YDXA 2DTDA 4J9VA 4B7CA 2A4KA 1QV7A 1E3SA 1ORRA 2JAHA 4DREA 4QUKA 5IDQA 4UUNA 3LT2A 2YQ5A 1U28A 4ND4A 5EERA 3S2GA 3ETDA 2GERA 3Q9UA 1P1IA 5HBRA 1DFIA 5CDSA 3ABIA 3RFXA 1ENYA 2AQHA 3W6UA 4BO8A 1ADFA 4CLOA 1PZEA 2DUWA 3E8XA 3GGOA 3PEFA 2HMSA 3F3SA 4R01A 2CDBA 3GDGA 1F17A 5ILGA 3EC7A 4BO1A 1I01A 2I9PA 2O3TA 1FDUA 4PLZA 2DPGA 5KJEA 1K89A 4AJEA 3GF4A 1N1EA 3QY9A 3HN2A 2P5YA 1IHYA 1L1FA 4XGKA 1VL0A 3A9WA 1VKOA 4MVJP 4OIMA 5A3VA 2O3UA 4QEDA 2O2YA 2IYPA 4ILKA 3C7DB 4AJLA 2DBQA 3AFMA 3WTCA 3ZN2A 3GMDA 4MJLA 5K0ZA 3GA0A 2IODA 5JSFA 3ENKA 2QZ9A 4EUFA 3FTNA 4NJMB 5AXBA 4BNZA 1B8UA 1ZK3A 3U4CA 3DONA 3JQ9A 4FGWA 1BXKA 1LC0A 1Z7EA 3JQ6A 5F5LA 1ZBQA 2O48X 1EDOA 4BNYA 4R1UA 1D1SA 4K9DA 3ZHBA 2EF1A 1MC4A 4Y67A 1HEUA 1Z73A 4E2YA 1YL6A 2VUSA 1JVBA 3WMXA 1BW9B 1ENOA 2PGLA 3H9JA 1N5DA 1L7DA 4A03A 1PR9A 2O23A 3D5TA 2GD1O 3F1KA 2PY6A 3KM0A 3TWOA 1DEHA 1ULUA 4DWVA 1YDWA 1PSDA 2IDZA 3KLPX 3WWYA 3H3JA 2VNAA 4OSOA 3U3XA 1LXCA 1N9GB 3PZRA 4J4HA 3CINA 1E1LA 3PWKA 3QWIA 1I5RA 3WGHA 1EK6A 1X7HA 5T5QA 2AA3A 4JBIA 4GGOA 1GQ2A 5TC4A 1T2CA 3I83A 1GADO 1LC3A 3D3WB 3GZNB 2ZJ1A 1P1FA 3AY7A 2GN8A 1MUUA 1R4NA 5B37A 1LLQA 1HDZA 1U5AA 3RBVA 2BGMA 4C4OA 3GZ4A 4BNMA 4CM7A 4Y9DA 4GX1A 4FCCA 1NPDA 3H2SA 4GSKA 2X86A 4F3YA 4GX0A 4TZTA 4IIVA 4L0QA 4N7RA 2FR1A 5JFOA 3OF2A 1O94A 4XGIA 1JTVA 3W4KA 1EDZA 3PIDA 4JQCA 1TT7A 1PJBA 1ZMOA 3JV7A 1I10A 2HLPA 3RSHA 5KVCA 3AW9A 2GN9A 2YV1A 4RZHA 4CMIB 4CMBA 4CM9D 4D7AA 1Y8RA 1JA9A 5CP8A 2DLDA 4Q3DA 3PHGA 4G5HA 5JNLA 3ROPA 4J49A 3D3EA 2CVZA 4CV0A 4CM4A 4MPDA 2A9FA 5CDGA 1HDYA 5DCYA 5ADHA 1WZEA 2Y0DA 4O0LA 4DIOA 4P4GA 4TZKA 1PTJA 1ISJA 1DAPA 2ZB3A 4U0KA 4CLXA 2CY0A 4ONEA 4BKRA 1V0JA 3INRA 1QG6A 3MZ0A 5AXDA 2NU8A 1PZGA 5I7FA 2DPHA 1PIWA 2HMVA 2Q2VA 2G1UA 1E3IA 1TXGA 5JC1A 3HB5X 4NIMA 4EYEA 4OXKA 5DBFA 1MC5A 3ZW9A 2OP1A 1JKJA 3KSUA 3IL2A 1GY8A 1P1JA 2EGHA 3DBLB 4A10A 4NK4A 4YT5A 4BS9A 4J7XA 4B4OA 3GNSA 1ZVMA 2J3JA 4GPD1 2B36A 4NBTA 1K6IA 2B4TO 3GRPA 1P1RA 1BTOA 1DAOA 3D0OA 3L0DA 4BO2A 1R0SA 1VPDA 2CDCA 4CV2A 1A9YA 1NNUA 2GNAA 2A94A 5JBIA 3CUKA 3NGLA 3AM3A 4P4NA 1XDWA 3WQQA 4JX8A 1SBYA 1I32A 2YHIA 3HDYA 3KB6A 3T7EA 3FF4A 3ZHXA 1EUDA 2H1SA 2QQ5A 1ZK2A 4PG4A 3AJRA 1LDBA 3BIOA 4OAQA 2DKNA 1U4SA 4E33A 1NQTA 2CD9A 1BMDA 2X9NA 1SZJG 2H6EA 2YDYA 4XQCA 2QHXA 3B6ZA 4ZVVA 5JY1A 1OOEA 1YB4A 4MP3A 3WLFA 4XYEA 1V35A 1IL0A 4BKOA 2Y1DA 3Q3CA 1O9BA 3GC6A 3WQSB 3FNGA 5CHEA 4LSWA 5L7YA 1ONPA 2HAEA 1TLTA 3RD5A 1YO6A 2PR2A 4S1VA 1X14A 3U4DA 3ZU5A 3S2IA 4MP8A 4IDDA 3CSDA 3TL3A 3GOHA 4MVJH 1A4IA 3TOZA 1ZW1A 2XPCA 3V1YA 5IN4A 2OP0A 5DBGA 1HL3A 3DTYA 1BXGB 4R1SA 4D45A 4R3NA 2GDZA 4PG8A 4UVDA 5JS6A 4CMJA 4J90A 1NQAO 3BTSA 3MJTA 3QP9A 1O95A 3DOCA 1C1XA 1HE3A 1OC4A 3OHSX 1QYWA 3WDSA 2OGUA 2VHYA 5JPIA 3K2BA 3WIEA 1SOWA 4WEOA 3C3XA 1Y7TA 4LRTB 4J6FA 1M2WA 2X9GA 1ISIA 1C0LA 1U3WA 2OO5A 3ICCA 3WNVA 1NBOA 2PA3A 3IKVA 2W4QA 1TT5B 5JW6A 4E30A 4CJXA 4WLEA 4J1QA 3FHLA 2CFCA 4LK3A 1P44A 3E9QA 3JD4A 4IXWA 3COSA 3RUCA 2X6TA 4D41A 4BNHA 1PZFA 1GR0A 3PWZA 2I65A 5CDYA 3NTQA 4JLWA 1XU7A 1HZZA 1F0YA 3WYEA 2BF7A 1IULA 1NX6A 1WDLA 4Q3NA 3IAHA 1ZSNA 3DBRA 4J0FA 4IDEA 5F5NA 3HN7A 3JD1A 4XD2A 3D5QA 2VWPA 1KVTA 3FR8A 4J91A 3V5NA 4WK6A 4OO3A 2PZMA 2YZ7A 4LCJA 4NJMA 5THKA 2HRZA 4ALKA 1E6UA 4F46A 1BVUA 4II3A 4QECA 2E6UX 3JD3A 4HNHA 2OOSA 2NQTA 1VRWA 4OGWA 4GL4A 4XQEA 2W2LD 1W8DA 4M55A 1SAYA 3FWZA 3FNFA 2BKAA 3RUHA 2YW9A 2FPPA 1X0XA 2EEZA 4AJ2A 3KYBA 4NMHA 5T57A 5ILOA 2C0CA 4RPLA 4FOSA 2Z1MA 2YHUA 1EUCA 4RLHA 1MB4A 3PWSA 1U2GA 1BW9A 4GX5A 3I9KA 3JQFC 4EJ6A 4YAEA 4RV9A 2QYTA 5EL0A 4E2XA 3GFBA 4TRJA 1LLDA 2VWGA 4FJ1A 3UGKA 1R37A 5T6BA 2Q3EA 3ON5A 4YJHB 3ROQA 4CM9A 1M76A 2DTEA 5GZ1A 5TLSA 3QVXA 2Q1SA 4LGVA 3UICA 3C24A 2DBRA 5F1PA 3VVBA 1XQ6A 3HHPA 3QVTA 4CV3A 4HFMA 2NM0A 1B3RA 4J4TA 1YB5A 1ZXBA 3OJFA 5JO9A 2J5RA 1Z82A 1DBVO 2VUUA 4JCOA 2E37A 1IZ9A 4MKZA 4CMEA 2PV7A 1U8XX 2J3KA 1RYDA 1DIRA 3WGIA 5G0WA 4CM1A 3F5SA 3EVNA 1FF9A 4PG6A 3I1JA 3D3WA 3GZNA 2NVUB 2IYOA 2PD4A 2ZTUA 5AQ1A 4YPOA 4I5GA 1LSUA 1AXGA 1DHTA 3NAQA 4IGEA 4IS2A 3OP4A 1PR3A 1GU7A 2YV2A 2P68A 1VLLA 4RF2A 4NI5A 2RHCA 8ADHA 1CEQA 2X7HA 3NDIA 3NDJA 4WKGA 2RHRA 2GN6A 1BWSA 4MIYA 4CQMD 2ZK7A 3PHLA 4ALLA 1V3TA 4CMIA 1Z7BA 2H63A 3AOEC 3PYLA 1UAGA 4J1NA 3RUDA 3L6EA 3K2EA 1IZ0A 1T24A 3ZV4A 3ZWYA 3C1OA 3TPCA 4DBVO 2HK8A 4OXNA 5A03A 1PU2A 1I3MA 4A0SA 3PJFA 5KJ1A 5TT1A 4JGBA 4XJTA 3E03A 3ZWOA 4O59O 1H6CA 2IEBA 3HFSA 2YUTA 2VZ0A 5DP1A 2CNBA 2BHLA 1B8VA 3HFGA 1F8FA 2GZ3A 1EFLA 4FBGA 3OMLA 1CETA 5BR7A 3O8QA 2IRWA 3UKOA 4LN1A 3V1UA 1QKIA 3GQVA 4KOAA 4Q3EA 3BAZA 4RVSA 3SC4A 5ENDA 1E0DA 5IDYA 3DQPA 2GGSA 4MVJI 1E5LA 2X0IA 1K3TA 1B14A 2ZATA 5K9ZA 5JDIA 3CMMA 5BSHA 2HUNA 3I52A 2PTGA 4NU5A 4H3VA 1X0VA 4JJFA 3IC5A 2UYYA 3IP3A 4W9NC 1A72A 2Y1CA 4B3JA 5L51A 2AW5A 2X8LA 3E5MA 3IS3A 4LMPA 3DHEA 2WYWA 4Z0TA 1W4ZA 1NHWA 4KMSA 1QLHA 2BGKA 4HBGA 4IMRA 3N58A 4BNIA 1F14A 4OQZA 5HRUA 4EBFA 3L6OO 4YB8A 1Q0QA 1UR5A 4Z0PA 4E21A 2OUIA 2VUTA 4JJIA 5CPFA 3WBBA 2NUAA 5G0VA 3M2TA 5U1PA 3LDHA 1NAHA 4CPDA 3WGZA 4FDAA 1CERA 1ZSVA 1XSEA 1SC6A 4A5OA 2BI7A 3QW2A 1RYEA 2GZ2A 5T8KC 4Y6SA 4XJSA 1FDTA 4FFPA 2AEFA 1WMAA 3GVPA 3C7CB 4RF5A 2C54A 4ITUA 1Y1PA 4BGEA 2ZB8A 1HYHA 2EKQA 1YBVA 3NT2A 1BVRA 1FMCA 3OSUA 2P2SA 2EV9A 4ZGWA 1Q2XA 2CZCA 2V6BA 2R00C 3GGPA 4KDFA 3HG7A 3QIVA 1IE3A 1PJLA 4Q3AA 4HFJA 2DBZA 3KHUA 1T2AA 4NFHA 4U0JA 4YACA 5IXSA 1ISFA 2DAPA 3TNLA 4OKNA 3VC7A 1A4UA 1QORA 4XDZA 3EW7A 1LLCA 3ZV5A 1HXHA 4WPGA 3AY3A 2JKVA 2BH9A 2WJPA 4U5QA 1JAXA 1GZ3A 3NT4A 4MVJD 4BIIA 4LSMA 2PKRA 2D4AA 3H7AA 1KEPA 2X58A 1K6XA 2Y67A 3PGXA 3QV1A 5FYDA 4IDBA 4IDFA 4L4RA 1YJ8A 2E82A 4WECA 1R0KA 2ZTLA 2Q2WA 2CVOA 4I1IA 4K28A 3WICA 1R4NB 2YY7A 2X0RA 4ZD6A 5LDGA 4RGBA 2UAGA 1T1RA 4M89A 2GSDA 2DUUA 4MIEA 5EPOA 3VKVA 4DRYA 2YFQA 5B12A 4DC0A 3LSYA 2Q1TA 3JQAD 5A05A 2B5WA 4PLCA 2VYNA 3LVFO 1YL5A 4XIYA 5U4QA 4FB5A 4QSMA 1Z45A 2EP7A 4IQ8A 1Y8RB 3U09A 2VT3A 4GX2A 1G0OA 1GPDG 1UH5A 3RU7A 4XRGA 5JC8A 3H9QA 2HCTA 1ZIDA 3KSZO 2ZTMA 4WOKA 5DDIP 2FY8A 1PJ4A 4E5MA 4BNXA 1F12A 1JW9B 5JYEA 3ZHZA 5GMOA 3GNQA 3LK7A 5T64A 5L4SA 3DZJA 2C7VA 2YFHA 4B8ZA 3TJRA 2F1KA 1I2ZA 2FZEA 2O7QA 1S7CA 2VWHA 7MDHA 1U3TA 4GLOA 4CLRA 5KJCA 3PJEA 2PZJA 1HE2A 3HNPA 4J16A 2FN7A 4BVAA 2E49A 5B4TA 2WYVA 3V2GA 4PLGA 2PNFA 1ZZEA 2C82A 4NBVA 1AHIA 5BSEA 4R16A 1NFFA 1W0CA 3H65A 4YWJA 4WLUA 3VPSA 1HDRA 3TZQA 3DZIA 1PJTA 3GPIA 1CYDA 1DJNA 4CQMA 1BHSA 4PLWA 4U6SA 4BO0A 1KS9A 1CQIA 1GDHA 4RO0A 3KSDO 1Z6ZA 3BMCA 2P91A 5KOIA 2X5JO 3GLQA 1A9ZA 3V1TC 3ZWWA 4PN3A 2FOIA 1E1NA 4RPHA 2VNSA 4GVLA 3WMWA 1H9AA 3PQDA 1GCOA 3MWEB 4NK5A 2Y05A 3GDOA 1KEUA 4PLYA 2EW8A 4XYMA 1C1DB 3DFUA 4HUJA 2PD6A 3OIDA 3LQFA 4OM8A 2B4QA 5I9NA 2PKQP 4ND3A 1DRUA 4XB2A
chains in the Genus database with same CATH superfamily
3JZAA 3MUOA 1IU9A 1FTQA 4KSYA 2BAGA 2ZETA 2O50A 3GLKA 1JZQA 4A0GA 4XAQA 5LL6P 2CNWA 4BY9E 2NU7A 3O3OB 5DHUA 1NQ5A 2P7IA 5EJ2A 3QLJA 5LNK1 3BCHA 5E8JA 2FP4A 4BHHB 5JPDA 5JMTA 4L5IA 4IGFA 2Y0PA 3VXKA 4DWWA 2AKAB 4I5DA 4IJQA 1G3UA 5CDFA 2B2CA 2HNAA 4LMRA 1NGSA 3O90A 2GH1A 1S4QA 3IDAA 2OCDA 5PGMA 4LIPD 3DL2A 1E2EA 1PQUA 2LVBA 2XHZA 1LKZA 4A2WA 2WWFA 5IZCC 1I4LD 5H5JA 1HE8B 1J0AA 3GRYA 3KPWA 5LYJA 5HGXA 5ENVA 3PRYA 1T9GS 1RRVA 4HFNA 3W4JA 1XZFA 1C0EA 3IAS6 2IYAA 3ZW7A 4IRXA 2EFJA 1PCXA 3GVXA 1G20E 4L07A 4FR0A 2AI2A 2GCEA 4OF4A 2VHUA 4OCZA 5CNIA 4PPNA 3EC2A 3EXHA 4IHJF 4B3BA 1EFDN 5I7VA 3MINA 4IWYA 3FOFC 3LHSA 5KDLA 2QVZX 3B1VA 4LPKA 2FNAA 3E70C 1SVWA 1F0PA 2WSIA 2EWWA 2ZJ7A 1T2VA 4QPJC 4WXPA 5JR3A 2ONCA 1BDJA 1ODJA 3FZNA 4PG7A 3PQ8A 3ZUGA 2CSXA 4CCYA 4PHHA 2CFOA 3KQQA 2PFGA 2FOXA 2XMQA 1Z63A 5DP2A 4C03A 2VSYA 5JARA 2Z5FA 1W4CA 3D31A 4WH0A 3M6IA 1KSHA 2O0LA 3KKQA 4FI3C 2NZYA 4NOKA 3H4VA 1YIAA 4R98A 4W6QA 1U1GA 1YBAA 3H18A 1FA9A 5L7TA 1M3SA 2VPWA 4PEVA 4TKVB 1LEHA 2BHNA 4BLVA 1NF2A 1GUYA 3U7EB 1DO0A 2FW6A 4MVJA 2UYHA 1C3OA 2ERCA 5EZ6B 2B4AA 4Q1DA 4YRRA 4JA2A 1DLJA 5IKXA 1YZLA 3L05A 3AVWA 1TC1A 2AYXA 5E95A 1GQQA 5JYCA 2EXXA 1MAUA 4YDHB 1ULHA 4J43A 4LOKA 4QYIA 3GJ4A 4UC0A 1DWQA 4QWMA 5C52B 4JLSA 1QOZA 1Q3KA 2VJBA 1FRVA 1NULA 3RJZA 3AEKA 4WJKB 4E1VA 4E11A 5JFTA 1R9JA 4M54A 2QUIA 2RH8A 1YU6A 2CFRA 3BXHA 4X7RA 3RG2A 4BFTA 4RVCA 1JA1A 4F0JA 5BSGA 1NUQA 5KKCA 3CMCO 2A1UB 2IXEA 1RBMA 1Q1GA 3GX1A 2PA0A 1XK7A 2N9UA 3RWBA 2PRIA 3BHMA 4IVQA 2NW6A 4XCVA 5J4LA 3N0XA 2XCUA 3FOCA 4FFOA 4B32A 4I9GA 5HTOA 1AUPA 2OC4A 2II6A 3I64A 3ORYA 5CA1F 2IY7A 3WBJA 1HF3A 2GCOA 3A1WA 5JBNA 3FFAA 3ONNA 4QEKA 5KO2A 2HBRA 2HU7A 4JC8A 3TZCA 4GPEA 1E8DA 2Q99A 3S7ZA 4TS3A 3EZXA 4WNAB 1IJBA 3ISJA 3H3XA 4GWKA 4RFSA 1TZCA 1G2PA 3CT4A 3N7TA 3SSAA 4F96A 2YN2A 2A7XA 2OCAA 4MIOA 2I66A 5AUPB 4H2DA 5JWOA 1SEPA 3FYDA 4G0PA 3I3SR 2P90A 4JVMA 4TYQA 4X6XA 5FWXB 1DIBA 1SVKA 2V8OA 3LH5A 3OCXA 5M5BA 1QYIA 4C4YA 2AE2A 4N18A 3UPTA 1G5IA 4AECA 1DFHA 2RHOA 1HBJA 2POQX 3KC2A 4OK3A 4F3TA 3D7NA 4HXYA 1A2BA 1SO8A 2HF9A 5IM4A 4F7WA 1J22A 4OLBA 2LDBA 4YQYA 2OQRA 3HI6A 4WERA 1OV4A 1CUJA 1RXYA 1ZC3A 2GBLA 2WBLC 3H2GA 3SJZA 2ZUSA 4C6TA 4D9FA 3TSCA 1Y3HA 2EP5A 2EL9A 2KS6A 3L4BC 5E9WA 3TTVA 5JXHA 2CNLA 3VJRA 4MV5A 3U56A 3W5CA 5DM0A 2XAAA 2HDWA 4PXAA 1MX1A 1IEXA 3AO0B 4OBWA 3TFWA 1E64A 4IRMA 1L4GA 3IKMB 3HA2A 3D4IA 2YBDA 3KJQA 4KZPA 1FOEB 3HYRA 2YJ3A 4MWSA 3ASVA 4LQLA 4BAUA 1LD3A 1E9EA 4IJMA 4TTJA 4Z3OA 5JWHA 4FPXA 2EP8A 2RAFA 1KQ3A 4BGDA 3WISA 1IN4A 1EFPB 1KYQA 3FETA 3R23A 1IH8A 2C31A 3V42A 3R5FA 5C7YA 5KQPA 4YBZA 3USZA 1ZM7A 4YCLA 3SEAA 4EWLA 1LJLA 1RHKA 2NO6A 4F5DA 1QE0A 3T6KA 2JLXA 3QHQA 1GG5A 2L2QA 2DFVA 3D02A 3I01M 2VL7A 3LOQA 3D2BA 1I0ZA 1PR5A 1ZICA 3RT1A 5CFNA 4MULA 3PQ6A 3WOHA 3WHKA 1K4KA 2GK3A 2A1TR 2GF9A 5K6RA 1XMXA 2J31A 4Q3CA 2D00A 1QFMA 4OUDA 4WZAE 5SICE 3I6YA 4BB5A 1YVPA 1PTKA 4OLFA 2JFQA 2PL1A 3EEYA 3L82B 1GTL1 3U40A 3JAMA 1K66A 2ZT8A 4ZVLA 2XJ9A 4UUQA 4UOZA 1W76A 3HKBA 5CFOA 2W6ZA 1AHHA 1T5TA 4U7WA 2JVIA 3UOGA 1UAAA 3CVJA 2AVNA 3K09C 2PCLA 3UCXA 1WF6A 4FTWA 3IBTA 1Y9DA 3HFRA 2CXPA 2P3QA 3Q87B 5D3MA 5AMXA 3ZZ1A 2J3QA 4GM1A 3SYRA 1IQPA 2V1XA 2GK4A 4BNJA 3WLOA 2QUKA 4RD1A 3IX7A 4AJKA 4D46A 4MUMA 4XB1A 4ZYXA 3KEMA 3ST7A 1G6Q1 4QHYA 2NX2A 3LJKA 5LQCA 3DOUA 1U8ZA 2ARKA 1XPUA 3H8SA 2PUVA 4H3SA 2G3YA 2ZSIA 2FMKA 3N05A 1Q91A 2VF2A 1NXTA 2HHCA 4NYMR 1JIUA 1UMBB 3Q7RA 2P2DA 2XE8A 4LY3A 2RB4A 3IO5A 4D0GA 4O4JB 2I6TA 1PGOA 2NXCA 1ECBA 3JR7A 1NKVA 2OHJA 2NUBA 2WF6A 3KJFA 2VQ6A 1BCRA 4LHXA 4YYEA 3MWJA 1QPGA 4X8MA 3U81A 1EE9A 1MPXA 2C42A 4HNGA 2OESA 3NI2A 1VE5A 3NWOA 4XW2A 3ZLTA 4X66B 5FLYA 3GJ7A 1JA0A 3OZIA 4P93A 1JSRA 3HKCA 3IQFA 1E6WA 1UJMA 1ETHA 2DBVO 2HGSA 3Q9SA 4I14A 1PL0A 1FQJA 2HV9A 1MAVA 3Q3HA 4D2IA 1A2QA 4P7GA 3NIFB 1VG8A 2ZSKA 1SU6A 1RC0A 4LHEA 3UBTA 1OX6A 4UU1A 4K03A 4ZQFA 4EHAA 1Y9AA 3H16A 5JNTA 2B37A 2EDAA 4RF4A 3S1AB 1XDDA 2HU2A 1NVMB 3LP8A 3EEBA 4QYSA 2V7VA 3PIIA 4DXDA 3V6MA 4BNKA 1TYZA 3ADBA 3EEFA 3IOYA 1QRSA 2FCAA 3CNLA 1UOEA 3CCBA 1DPFA 3JQFA 4HXEB 2GVDC 3ZWXA 1Y89A 3AVVA 2J08A 3BHNA 4B2PA 3EODA 3GJYA 1BWRA 1QG4A 3OPYA 4LNHA 2Q2NA 3I0ZA 3R5KA 1KH1A 1K92A 4Y9RA 3UB3A 5K20A 3AFHA 2WKQA 3SQOA 2NO0A 1SNYA 2PAAA 4MW0A 2OYRA 2W6JD 1T2FA 3LWBA 5GM2A 2P9ZA 5JD6A 3FOBA 4MLDA 1KDOA 4DLVA 5KJCA 3DKPA 2J3HA 2QL9A 2KMLA 3A4MA 1CRZA 5A3SA 5K09A 1TQHA 4KV9A 5A2GA 2W8BB 1TKRA 1YJ5A 5BMVB 1RM5A 1E3WA 2HD4A 1KP3A 2K7ZA 3UHAA 4D9EA 4DMLA 4IGIA 1RCUA 4RMNA 1N4AA 4N41A 1SMKA 1B8NA 3EMBA 4NV1A 3NVKI 1CBUA 2I99A 3AFGA 3IB3A 4PZ0A 1SZCA 3VO2A 5I51A 3R9WA 1KZ7B 2UZ1A 1Z16A 4K40A 1B42A 1EHYA 3FJYA 3BERA 5CT5A 5JS1A 3MTAA 5K6AC 2P2NA 1LWNA 5FO1A 2Z98A 4KK4A 3THOA 1T1GA 2OBNA 3MWDB 2HMTA 4CUKA 1MJ5A 1B43A 1NFRA 2HJGA 1ISRA 2J8ZA 1FDIA 1M34A 4O5OA 3GLFB 3RYHB 3PI7A 2A5DA 3UAGA 4DBZA 1A4XA 1NBEA 2D5AA 4X63A 3K0HA 2XMRA 1P3Y1 1MBZA 5CVDA 5BN3A 4US2R 3STTA 3ZWAA 3FHCB 4N76A 1IATA 4RYDA 4TKVA 2G76A 3MWFA 4UCFA 3X0DA 1IUKA 1ULTA 1VGRA 3TD2A 1AE1A 3PRHA 3PCTA 3S8MA 2WE7A 1KC1A 2RB5A 1WABA 1ZG3A 1V3VA 1ZIOA 4PRLA 1T9BA 3TCNA 3TSWA 1GT91 3QE3A 4LNAA 3DMTC 5B2ZA 4UTVA 1EVYA 1KFBB 1NXXA 1EWKA 4CLRB 3IKLA 1EVIA 3U39A 3GLUA 5LKAA 3ZDYB 5JXJA 3WFJA 1BFUA 3UW3A 4KH1A 4MZXA 4XKJA 1NLMA 3DHNA 2EIHA 3GN2A 3M70A 3ND8A 4B79A 2WQ6A 4EL0A 4OB7A 1BMQA 4N54A 3PB3A 3T06B 2X0NA 3QHPA 4LYHA 4B6PA 1DXOA 2C96A 1JN0A 2IUTA 3NS7A 4I4TB 3TD9A 3PQ7A 4LF4B 1RMYA 3LUAA 2Q5HA 2ANBA 2LCFA 2XTAA 4D92A 1PVVA 3HY4A 2Q6OA 1N1MA 5AQEA 1UWCA 3BSYA 1P7VA 1RJGA 3FVQA 4PLFA 4WNAA 4TTIA 3VR5D 3OBBA 3VR6A 2GXAA 5KYYA 2ID4A 3FPCA 2BSXA 3JQBC 3QWAA 3R3SA 5DE3A 1KEEB 3G6KA 2IXDA 1XRSB 4ERXA 1GAJA 4NQZA 1G6HA 1V48A 3UXYA 1Y4ZA 5IYZB 5JRJA 4G0ZA 3GV0A 4HC4A 2RIRA 4B3CA 1XEAA 3KZOA 2XVYA 3L7BA 5LP6A 3GGGA 1DC5A 1CX9B 3AF6A 2BMWA 3DE6X 2NXWA 2GZSA 3CR3C 3UA3A 1U2DC 4IY1A 2D7JA 3BJMA 3WYNA 4PVDA 1X87A 3KEQA 3GW8A 2JBWA 3A1NA 4R1QA 1H66A 4Q3KA 2RJ3A 1RM0A 1WOYA 3OCJA 4L4SA 4IV5A 4ND8A 1DGQA 3UKJA 2VTBA 1D4OA 1ZUNA 1O5TA 1DXQA 1RI2A 1VIDA 2OBBA 3HKDA 2WRZA 4KR0A 4OJNA 2A59A 1LS1A 4R6XA 3LF1A 4E5YA 2RH4A 4C88A 4ZCMA 3U2QA 4N5LA 1XWWA 4GHWA 4QBKA 1EXNA 2HQOA 1E94E 4M98A 3T4XA 3OAAA 3K0CC 1ORHA 1NW4A 1BRTA 5M34A 1NIPA 1FW8A 3PJGA 1M1NA 1AZWA 4LDNA 3ZE2B 3EQZA 1U63A 2V0GA 4Y2JA 3V9PA 5L40A 2V3VA 1TZMA 1XVTA 3MS2A 4L75A 5DHRA 4A1FA 1GKYA 5I48A 3F90A 3SZGA 1HEYA 2HYIC 1QYVA 2H51A 1LJUA 4D43A 4TS9A 1EFPA 1XEFA 4XYBA 1L0BA 5DSXA 5IFLA 4Q3LA 3UMVA 3WGKA 4EJ0A 2ZYSA 4C0KA 3QVKA 2QX9A 4IIGA 3PK0A 1P72A 4PFJA 2C0QA 4UBOA 2PSHA 5FTMA 5IC6A 4RJTA 2PDAA 1XTIA 4XSHA 1OB2A 1T3TA 3DPIA 2WTXA 2VCHA 3QXGA 2YRXA 3JVUA 3FCUB 1RM4A 4P5PA 3RK0A 3I5XA 1R6VA 3JASB 3SICE 1EZ4A 2QLTA 3HR8A 2D5CA 3QITA 5C4MA 5KWIA 5A9SA 2GCNA 1OHHA 2PVSA 1U8TA 1W46A 2VLIA 3BB1A 3A6ZA 3F1LA 5E6SA 4UM9B 2UXDB 3M3DA 3ANSA 2CXQA 1EFCA 1I1HA 5JAIA 1NMSA 1YQ9A 4B6QA 3HWWA 2DLCX 1Z6GA 3L2OB 5ER6A 4A92A 2QT0A 1K7CA 4XLZA 1MD9A 3LLSA 4LQ4A 2CHQA 2IYQA 4PHTA 3VYUB 3IT0A 1ML4A 2ATCA 3FFBA 3OPQA 4PHCA 3H5AA 1E79A 4TRRA 3IEUA 5IX8A 2YIMA 4XUGB 3DP9A 4Z9FA 3ZOZA 1S1CA 5L7WA 1EFAA 2UUPA 1B7GO 1ZA2A 1TUEA 4HR7A 4LWZA 3NFRA 3CE9A 4KE7A 4DSAA 1FYVA 1QDUA 5JMPA 3I2IA 9LDBA 5FWYA 3DOHA 2GFHA 3CR7A 3G9XA 1TJ4A 3BBPA 4UVHA 4CI0B 1QGZA 4B71A 2BP7A 2FRXA 2H54A 2WJVA 3CLRD 3FUVA 4V2UA 2NZVG 3VR4A 4LZWA 2AHRA 2QTMA 1WXGA 2JFUA 3K6JA 4E3WA 1GPWB 3TE6A 1UMBA 3GLIA 3OIWA 4GT1A 2WV9A 4LKOA 4OOFA 5ECGC 3O7WA 1RNLA 3ZLJA 3QRWA 3OH8A 3I6ZA 4OHBA 2R6AA 5EMHA 4U2KA 2QORA 3P0RA 4W82A 2QD4A 2OY0A 2I9KA 2MR6A 3MBOA 1C9EA 4Z9XA 3WSWA 1C4XA 4Q4HB 3C85A 5TVGA 4G63A 1IXYA 1QHHB 3OFVA 2G9UA 2M1ZA 1THMA 5KBYA 3EG5A 3G5LA 4JC5A 1LGYA 3PLRA 4RY8A 4M6WA 1E7RA 2P0EA 2G0TA 5H82A 1Z0AA 3LTEA 3TAHA 3IP8A 1FS6A 1QONA 3HVRA 2WHPB 4F2PA 4EHNA 1DEKA 1IZYA 4CF6A 3OBIA 4FQ8A 2JJ2A 1TTPB 1G17A 2HF2A 4B31A 1YKFA 3AHDA 3WLHA 3NWBA 2OB1A 2PWBA 3IUNA 1L4MA 1PN3A 3NEYA 3I1YA 2VRCD 2F1OA 1XDUA 2V9ZA 1LBIA 2XUIA 3OE1A 1ST3A 1F2UB 4RHEA 1KMHB 2G71A 1KO8A 3AM5A 2V4UA 5LM3A 1T5LA 2JI4A 3CVOA 2W58A 4RSMA 1GUFA 1N7HA 2I22A 3WQHA 5IUNC 4MKRA 3V1NA 3QPAA 3EFOA 5K4HA 3R8XA 2OXIA 2ODBA 4TL8A 2WMDA 1KJ8A 3KKKA 1P7CA 1JG4A 3KTOA 4US0R 1IY2A 5EMMA 4MNTA 5AVOA 3CGGA 3SQMA 4AJIA 4NKRA 5TGTA 3EF0A 3JQ7B 4XIFA 1JHXA 4IZ6A 4NZNA 2V7QA 1VHWA 4IUDS 4D8VA 3T4PA 3AFNA 1V6SA 4YUAA 5ITVA 4H6XA 2CLLB 1F4LA 2Q07A 1JHMA 3A0UA 1R4MB 4HY3A 3W8EA 4KI7A 4ARCA 1KMQA 4C7XA 1RYZA 1GG8A 4RVOA 4LY9A 3MWDA 4F4HA 1SWWA 3G1TA 3ICVA 4XEUA 1C9MA 4M1WA 3VKFA 4JLDA 4MS1B 3NLLA 3T4EA 1EM8B 2X9LA 3EGEA 3PDWA 3WL6A 2NPOA 4S0XA 1R5OA 4TSFD 2R48A 4YJGB 3QKWA 5C8YF 1G4UR 1H0KA 4Z9AA 3FWHA 1UFOA 2E9SA 4D44A 3RS4A 2Q50A 3F5QA 3E3LA 3VZRA 4BNNA 4F7DA 3GRAA 2VXOA 1HH4A 1U94A 4OL0A 1UKVY 4G9GA 1YR8A 1XKQA 1RMQA 4TSRA 4DMUB 3R3HA 5IZCA 4QDJA 1SHLA 1ZNZA 1NPYA 4ND2A 3P9CA 1GL7A 1RFLA 3TM4A 5AYVA 5GJVC 2WJWA 2DOKA 4AG3A 3EBPA 4QUHA 1V9SA 2WF8A 1G6OA 4LDAA 5ELXA 5EI5A 4N49A 1YI8A 1KAMA 1SG6A 3JYLA 3O8OB 5JMWA 4DM4A 1CR4A 3R7BA 1QRTA 5TARA 2OAEA 3S1LA 1GUZA 5KYXA 2ZZNA 3BXOA 3G89A 1A3CA 4GI3A 3IO3A 2RONA 4FR5A 4RIEA 4YK7A 5GJCA 1MH1A 3RVOA 1E0KA 3E3MA 3MHPA 1VP9A 4BFLA 1BGVA 1Q1AA 2RI0A 2P65A 4EI7A 2ZT7A 3BD6A 3TQQA 5JZVA 3LQRA 2O5CA 5IF9A 3HP4A 1PX0A 2GWRA 1CY8A 3CT6A 4JT2A 4PU0A 4WHMA 3OP1A 3AEUB 3R2JA 4LYEA 1K7YA 4TTVA 4LYDA 3TOSA 1H2ZA 4KTVE 1DNPA 2AQ8A 2VDKB 5AVJA 4ZK2A 3HO8A 1LPBB 2YYSA 1MOSA 5A4JA 4WXYB 4QT0A 5DX0A 2ACVA 4P82A 5D6NA 3UXHA 4BC1A 2JJ8A 1I3NA 1XR3A 3OX3A 4LC0A 3LOPA 3R6TA 1N7GA 4P3OA 4GBGA 4P2BA 3WKDA 2AEEA 1E0AA 1OZAA 5FF9A 1E1KA 4KLAA 4KXUA 2JFYA 3P0IA 1YCDA 3GEDA 3OE7D 5ECWA 3W9BA 5DGTA 5C5DA 1KRWA 4R1LA 4Q03A 1BXZA 1G7SA 3GAZA 1BQ3A 4NG5A 5HKLA 5JWRA 2BSQA 1R6TA 2V5VA 1K5HA 2IDMA 3LKZA 3WGVA 5TJ9A 2R1VB 2P9FA 3PNVA 1PW7A 1SCIA 2F48A 2NTYC 3M8KA 2WE8A 5J5AA 2ADMA 1QU3A 1V3QE 3GT0A 1EGHA 1Y3DE 1EVJA 1KF0A 1Q50A 1T3LA 3DEJA 5A3QA 2LKDA 4ZU1X 1HNZB 2VDQB 3W0LB 4EW3A 3DLBA 1E7QA 1JWBB 3KLMX 3TZ6A 1M2EA 4A9AA 2DT5A 4JSTA 4KPGA 3OQPA 5EJ4A 1CTQA 3JRXA 4BV9A 1KKLA 4DJ5X 3UK7A 3ZU6A 1XK6A 2Q6LA 3TLKA 4MVXA 4FDMA 2IX3A 3FNEA 4JUAA 2WFMA 2XUPA 4ZT7A 5COBA 3ZDXB 4PTYA 1T5OA 3LC7O 3UJ7A 3FDZB 1P9OA 2I80A 2QRKA 4EB8A 2A0YA 2DFDA 1VKJA 2AN1A 4HB3A 4U4AA 5AKXA 3VVCA 4ZI7F 3C2QA 4BLRA 4QLOA 5C9ZA 4WCDA 3CE6A 3DDOA 4EMSA 5IT9A 1LRKA 1SOVA 2QTBA 4MMZB 3OFJA 2XUZA 4HRAA 4R0NA 4OHUA 4IAOA 5DSZA 5TQ2A 1C3VA 2HXYA 1QGUA 3SBEA 1M1ZA 2ORIA 1JR2A 3I5MA 3I8SA 5BUCA 3E15A 3L8FA 2I34A 5SZKB 2REBA 2QVLA 2VNIA 4DMKA 4IP0A 1Z4LA 4NAUA 1KAQA 2ZITA 4RC9A 5L45A 1NJ8A 3SFZA 3HSKA 3NHPA 4DA8A 4HVTA 3C97A 2HIMA 1EVKA 3H9BA 1HLDA 4OQPA 1Z17A 2OQVA 3ZX4A 3IAFA 2MDTA 4BJ6A 4DHEA 1T1JA 5LDDC 2OA0A 1OT5A 3DBVO 4JP5A 2HRCA 1UOOA 1XLWA 3L4BA 1P5JA 3OEWA 4ESOA 1GVHA 3FDXA 4L8LA 5CBPA 2D59A 1S2DA 5TQ0B 2Q3HA 4EQ6A 3GLGE 4LVOA 1ESEA 3B8EA 1U0RA 3SHTA 4RESA 3WRWA 3EGXA 5JCOC 2ZRLA 1R9GA 4OU5A 3EZLA 3MCVA 1KZ4A 3GEEA 3LYLA 1HFKA 1ZONA 3GXOA 4IZIA 1NJGA 2QRQA 1C14A 4GOJA 4QOHA 1NN0A 4DQUA 1HNXB 1AZSC 4P98A 1A7KA 4BYMA 1Y8QA 1SC4A 4TZ0A 1R0BA 2Z04A 2DHCA 5EJMA 2BKUA 2CXTA 2PANA 1XCBA 3BFJA 4DQVA 2D5LA 4HP8A 2IV3A 4NAVA 3WL8A 2OAGA 4CL3A 3MG9A 1XZDA 4EB6A 4MLCA 1LUAA 1RLOA 2NO5A 1NVKA 4NJEB 4FGZA 2Y93A 1YOVB 3TRFA 2JGJA 4O2AF 1TX4B 3CC8A 2OAQ1 2ZJ3A 3D2CA 3AB8A 1KJQA 3FPLA 1UKAA 3PHJA 4FBLA 3ORFA 4KQEA 3DZBA 4BE7B 3WYDA 2OE2A 3S0JA 5FBLB 1P77A 3CLSD 3GU3A 3MEQA 1L1RA 3P2OA 4K46A 4BVJA 3RFCA 1U0NA 3NORA 2WM3A 1U8EA 3CJQA 2AV6A 2W48A 1NRWA 2BTQA 2IPAB 3KX2A 4P3PA 3WGNA 4UNRA 1NWCA 1FUEA 1QHHA 2PHZA 4AP5A 3GPBA 3JRWA 1RABA 1IEQA 4PBRA 2OGTA 5JNSA 1D6SA 3RSCA 3URKA 1Y8CA 1Z6QA 4L8WB 4CF5A 5CVTA 2I2DA 1T8UA 2HWWA 3K09A 4B48A 1KPIA 3DBHB 1QYDA 3N8HA 3NBXX 5BY2A 1KRXA 3PD7A 4AMUA 2DQ4A 1HDXA 1ZCBA 4X90A 3INGA 3EGWA 4KR3A 1IM5A 3HBNA 1OFGA 1YAHA 2WF9A 3BIJA 4Y7DA 3SJAA 1IBMB 5GIOE 1TTHA 2EARA 4F71A 1FLAA 5TY0A 4RVHA 1PVOA 4RCZA 3U0BA 3PGLA 2O0KA 4DVJA 3HTXA 1OI7A 4P83A 1YR7A 5E1DA 3K71B 2QM0A 1KMHA 1KZ1A 4D9JA 1DU4A 1XZKA 3E2MA 3H2ZA 4X8LA 4MPRA 4CDGA 3WK7A 3HWX1 1NE7A 3A1UA 3ZU3A 4GQAA 4YLGA 1G0NA 2B8TA 3BREA 3MT0A 1CDEA 3LS2A 1X7WB 4E5NA 5AI4A 3WBFA 5K5EA 1GTSA 1JDJA 3HE3A 3NPMA 4M0DA 4Q1VA 1WS6A 3ET4A 5JS2A 3EDYA 3F47A 2NSJA 2P5UA 5AKKA 4BC0A 3EPRA 3CSUA 1KK2A 3AP3A 3OQMA 4ZOCA 5LMZA 5AM5A 5L6MB 3AI2A 1IY9A 1H2WA 3QVSA 4HNTA 4QLAA 3GA5A 3L6DA 3EIWA 2V3CC 2B69A 2FF7A 1CIVA 1SXJC 3MIIA 3QXCA 3ZV7A 4AULA 3AHJA 1CY1A 1RJ9A 3DE0X 1M6WA 1Z75A 4IDAA 2RSLA 3M6WA 3KO8A 3OPXA 2YIJA 2HMUA 3EF1A 1U28C 5ERGB 2AFHE 4PZDA 3R7WA 3HLYA 1XQYA 5KKAA 2OGWA 4YMVA 3JWEA 3SJ7A 2ZVPX 4TPKA 4LTMA 3VI3B 4Z54A 3GJ8A 4Q4AB 3B70A 4HQOA 1JQBA 4WN3A 3O4GA 4Z3KA 1OXMA 4GP9A 3I5AA 2Z56A 1K6JA 3OLZA 4KODA 3Q6MA 1GZVA 3WWPA 5BUSA 1QKKA 1Z35A 2PX4A 3Q7IA 4PSAA 3UMRA 1B3BA 3OFSA 1L7VC 1Y5IA 3V7FA 1B2RA 1EVZA 4L4XA 1UUFA 5IT0A 4PAGA 1UJ6A 3UMSA 5BMOA 3NAMA 4OHXA 1XRRA 3SG0A 1PKEA 3V4PB 4DQLA 4RTOA 4D9IA 3FMGA 1N5KA 1QIEA 2HKIA 2J07A 2GZHA 1AKWA 2HJWA 1ZI6A 2BCEA 2QMOA 2NUPA 3ADPA 3GUYA 3WIVA 4AZ3B 2WY2D 3MRVA 4HADA 3O8OA 4G0OA 3RKSA 4MMYB 4WCFA 4HDAA 4BKPA 5HS4A 2WNIA 5EIHA 4BGVA 2I2XB 1NBIA 4MQ5A 4MYCA 3ROGA 2OORA 5KTSA 2EW1A 3OLWA 2ZJOA 3AONB 3H5IA 1Z6AA 2ODQA 5K6AA 5HFNA 5IAJA 4V03A 1UP6A 3NJ8A 5I7WA 3MPOA 1I6LA 4TWAA 5KTKA 3VTZA 4UXJA 2IWHA 1FC0A 3LD9A 3OAAD 3QEOA 4QBTA 3X2FA 4G9EA 2PSSA 4F6LA 3IV6A 4IJVA 1KJJA 3AEYA 3WIDA 1TUBB 2H1LA 1K4YA 2XNJA 3SCZA 2B6NA 1I7DA 1ZH8A 2AC7A 1ECPA 3E61A 3HXLA 1KKMA 5GY7A 1RC1A 4XYLA 2H5LA 3OIGA 1DQPA 1P8AA 1U9JA 5KQGA 1QRDA 2A30A 1OASA 2KWIA 3EFBA 4QL3A 3IJ5A 4DQDA 1O87A 3KXPA 3HCPA 5KREA 3EE6A 5EJGA 5HCIA 4MUFA 3P4UA 1W8IA 4ZYTA 3DDHA 3EZNA 2AZMA 3IFSA 2H0RA 1U5CA 1P2DA 3ANXA 2A5YB 4FFDA 4D9MA 2R1VA 3IEKA 3N8NA 3DMTA 3W05A 4RZUA 1WRBA 1Z8DA 1RIFA 1E66A 5AKGA 3KTDA 3OA0A 1ZLYA 3OCWA 4IF4A 4J0IA 3QV2A 4I9UA 4GRIA 4L3WA 4XASA 3TINA 5JBQA 1I2BA 3NIWA 3U19A 3U7GA 1CR0A 1LDNA 3TPZA 2GS9A 3O4VA 1QHIA 2GN4A 5G4KA 4C4XA 1C41A 3CRQA 4QHTA 4WESA 1DJPA 3GPDG 5I8ZA 1Y0BA 3KR9A 4H4DA 4ZJYA 4AI6A 2J3EA 3FDZA 1EMDA 3KJEA 4ZXPA 3AWDA 3V8QA 1V1MA 1RQRA 1UZMA 4WADA 4X7PA 4ZAZA 4AO7A 4LXTA 1MV8A 5M2QA 1QH1B 5EEGA 3VOSA 1K7FB 4BV8A 4DGSA 1T6NA 4HZIA 3NTXA 3ZS9A 3RS9A 1X94A 3RC8A 1TVCA 2EOAA 5FXMA 1P9LA 3U48A 1J0CA 1WP4A 2Z0MA 3SSNA 4FJ2A 2O52A 3JQBA 3WGLA 3UMYA 2ZB4A 2HWXA 3NR2A 2P5SA 4CKYA 3GLHE 2ETXA 4X91A 5IH3A 4A6EA 1CE8A 4EHIA 1Z4IA 1DZ3A 4D81A 5BQ5A 4X95A 3J81A 3LRTA 1E6KA 2GN2A 2JGAA 3FMFA 4R05A 4KR7A 3KVRA 5DYWA 3KVYA 2GXSA 2QVXX 1TMGE 4I7EA 2EG9A 2DQSA 1JFRA 3RM3A 5BN4A 4CMKA 1U2DA 2IUEA 5I9SA 4ZGGA 3MXTA 3G9UA 5A7FA 5IW8A 2Y1WA 6LDHA 4FUTA 5MN4A 4TWBA 5C1PA 4JXXA 4F97A 2KQUA 5HZGA 3ZDBA 4H27A 2HRBA 4Y6OA 4QGGA 4I9NA 5FPHA 3GB9A 4KGXA 1J4AA 3GJTA 4JR2A 1NMYA 3AGQA 3EXIA 3T5AA 1G64A 2W6NA 1FRFS 5JASA 3THYB 1F20A 3K0CA 2JJ2D 1U98A 3CURA 3IAUA 1U3VA 4BVEA 5CDUA 1DC6A 1MORA 2E87A 3A4IA 3LCMA 4L8VA 5G0TA 5JCZA 1KYWA 3O92A 2PGJA 1UBTS 2FSFA 3CIFA 5AW5A 3SLRA 5IXJA 1E7MA 3G8AA 2PUBA 1CR2A 4QPPA 3GVIA 2CCKA 3B3QA 1A88A 2IJGX 4QVGA 4BX3A 3OC0A 1N7JA 4MV4A 4RLQA 5THQA 1BH2A 3CZQA 4NJEA 3RSSA 1KWKA 2AL7A 2CZGA 2Q6IA 4Q93A 3SSMA 1G8GA 4FJ0A 3WGQA 5LLDA 3K53A 1TEXA 2QB5A 2QTVA 1YFZA 2RFLA 3WLKX 2CBGA 4ER6A 1NW6A 2LCQA 5AJYA 1HTBA 1FRNA 5FEUA 2QLLA 4X20A 4JC0A 3I1IA 5EOVA 3B1JA 2FSHA 3ND6A 2OB2A 3VYSB 1EUZA 3LYHA 4JB8A 4RL4A 2XA9A 3Q6NA 2E4UA 5I3CA 4BFZA 3ZK8A 2QPTA 4UDOA 2Q45A 4HNQA 3WL7A 3THWB 3OICA 4G86A 5AM2A 3CU5A 4RKQA 2FUEA 2RGEA 1HFJA 1K8YB 2ZJ0A 2E55A 4ZQHA 4BO3A 1YKSA 5HPYB 3NHZA 2HSGA 2HMAA 5J23A 1ZNQO 5CA0B 3ZJVA 3PJDA 4G4JA 1O58A 4QDXA 4EHJA 4EVRA 3ESYA 3N5CA 4BKMA 3CXRA 1RQXA 1RQGA 3QTTA 3Q7EA 1KDTA 1P31A 2H7CA 3BWXA 5C7OO 1P1HA 2GASA 4PQFA 4DIBA 1LW6E 2OLEA 2BHRA 3CUSA 4FDUA 3AIMA 3HUFA 4GS5A 3L8HA 1N92A 3R76A 3STHA 3SC6A 4CIAA 3N39C 2VRNA 4ZCTA 3JQGB 2H2WA 1E3JA 2CNKA 1YRHA 4WNCA 1NSTA 1NG1A 3T3MB 4CWAA 4FMDB 4S1OA 5CLIA 5JVDA 5KWVA 1J99A 1IBCA 1DBIA 4YGYA 3ZNPA 3ZVRA 2DM6A 2WU4A 2PUGA 4COOA 4G97A 1IXSB 4B87A 4B73A 1N9GA 1DL5A 3SQNA 1NVDA 5KWEA 4K9SA 3F9RA 3FSGA 5AK0A 2ZR9A 4ZHQF 3P26A 1IHOA 3PHIA 5E9JA 3ZCRA 2IZ0A 4KLNA 3RDPA 3ITEA 3PZBA 4IFIA 1PL6A 4MUNA 4NCIA 4BQEA 4J0DA 2Y1FA 3ZWBA 1AMUA 2OV1A 1EWTA 4B3MB 5T7BA 1VMEA 1LTHR 3ETEA 3LQYA 4Q4AA 5DLYA 3C8HA 4IILA 2QTLA 1RQ7A 3AU9A 3GR6A 3IR6A 4OK5A 5GONF 5CAEB 5JDIA 1SQSA 3AVUA 4GOKA 4B44A 3VH2A 3PFFA 2AOVA 2WIDA 2ZR7A 4FX2A 4IV0A 3EUFA 4UVGA 3OIVA 3PFKA 3W6NA 5K0EA 1JWAB 3HVUA 3KJXA 1HSOA 3NU1A 4MV9A 5KB3A 2MINB 3LZCA 2O20A 1W30A 3THXB 1BN6A 1DG1G 1EP2B 1A1SA 2AD1A 4B74A 1VJTA 1W88B 1LDMA 3LPMA 3SM9A 1QVZA 4LJ6A 4ZJUA 1TI7A 1NMZA 4BJ5A 4B17A 1CVRA 3IR5A 1XVLA 2BUBA 1JB9A 2GXUA 1UBGA 5E4YA 1YQUA 3JATB 5HDQA 5A1JA 5GWXA 3PTLA 3LPCA 2VATA 1YRWA 2VCYA 1IMOA 2VRWA 3H0CA 2JC3A 2HEIA 3S2EA 4RIFA 1ZL0A 1OQAA 4BLPA 2G4LA 3NWPA 1LK7A 1NG9A 4YV1A 3UF0A 1YE3A 3JYQA 3U7QA 3ERCA 3VX4A 2QJTA 3EQ2A 2WU0A 3O4RA 4YDSA 2AVDA 3T35A 1KI8A 3HJNA 5DB4A 3U80A 5AIBA 4KXWA 3KE8A 1QQ6A 3C98A 1XHLA 3IQDB 3ILYA 3N87A 2ZRPA 2IP2A 3PQFA 4RVGA 4GDFA 2YJGA 3R4CA 3RUEA 3T5MA 4DC9A 1SUIA 1H9BA 4IMJB 5TMBA 3JYOA 3K15A 4BGUA 4D3DA 4IQ0A 4XM1A 2Y2UA 3K9BA 2GESA 5LZ8A 3UTDA 2B0JA 4Q47A 4LJLA 5DNUA 3BHIA 1W2WB 4IDOA 4JBLA 4E08A 5JD5A 2EG5A 4GBJA 3NM5A 1CZLA 1L5KA 3TZHA 1TL7C 2A5JA 3MTIA 3RT7A 5TDHA 2M6LA 4BRSA 5KQLA 1AN9A 3ED1A 3KZNA 4EEKA 2ONYA 1V5WA 1YR2A 5LZ5A 3DUWA 3K6SB 1F0KA 3G17A 4IJ6A 2QWXA 4MB2A 3IPRA 2MYTA 3RYFB 4RDIA 2O5RA 4F8YA 4DV3B 4JJ6A 2ZSAA 4NMLA 1UPFA 4Q1BA 4GKBA 3MFYA 1AKQA 4EUNA 3CO5A 4ALIA 1QGAA 1OC2A 1WDWB 3DBLA 4O4LF 4ZVTA 2O0HA 2XD9A 2AYYA 4IDNA 4F5YA 4L4YA 1Q1ZA 3PR2B 1SR8A 1TK3A 3DMYA 4EMTA 1VI2A 3FSRA 3WLTA 3ZY4A 5HTKA 1QQAA 1KI3A 2OEPA 3L8GA 3WYGA 3CW8X 1MA0A 1QF6A 1JQDA 1WMBA 4Q0MA 3N2GB 4CQLB 1Y9JA 3F3YA 4W1SA 5IVIA 3RRMA 4JT9A 2I3BA 5L4NA 4OQFA 3WV4A 2Z5GA 4BQNA 4NBLA 2AMLA 1M1XB 1O4WA 5AVXA 2EFHB 3D6JA 1RJDA 4LYAA 4TUYF 1SC1A 3TVDA 2LDXA 3W78A 3BH0A 2EKLA 4S1WA 1RI5A 3FYUB 5H0IA 4D0LB 5EAIA 5J40A 2P9EA 3N8IA 1TYDE 1M74A 4FDVA 1RW4A 2VZEA 3ROTA 3N1UA 4MYHA 2P4HX 1BS2A 2VAMA 3MQ2A 2ZRCA 1DMSA 1JALA 2I3GA 4YEDA 2AFIB 3FPBA 4IIFA 2JLRA 1SBHA 2G9NA 4Y6LA 3GMSA 5FFFA 1MJHA 4OQQA 1ZCFA 3E7FA 4QTZA 1PO7A 4TV8F 1SB9A 3OM8A 3Q4GA 3ZI4A 1LPSA 4F21A 2PUWA 5GAJA 4D98A 2QJWA 1K8ZB 5C80A 4QARA 5ULLA 3SVZA 3AUSA 1V8DA 4P0QB 1OFIA 3EG9A 2PCJA 5F52A 1JEAA 3WWEA 4D26A 2A0WA 2QU8A 3N2EA 4MW6A 2A3NA 1TZ2A 1M2NA 3RS8A 1Y4AE 1BXGA 4NCKA 2NUTB 1TW2A 1SCDA 2YZGA 3QUBA 4N9QA 3ONVA 4PF1A 3REOA 3ZDZB 3OZSA 2IBMA 2VDPB 2D0IA 2FWMX 4WVFA 2CLDX 3C7AA 3C1AA 3G5UA 2AMJA 4O1HA 1N57A 3BFKA 5EWLB 2N75A 3LI2A 4N0PA 2IYNA 4DYHA 1R8JA 4B09A 2XWQA 2W2LA 4WBNF 3H5WA 3L7JA 1ZITA 1P7ZA 2R5NA 2H5JA 4IXNA 3D6FA 1MFPA 5K4GA 1UDCA 4XXHA 2G7ZA 3CRNA 2WD7B 4FDTA 4W6ZA 3T1NA 4RQAA 2ZCUA 1HFEL 5JDIC 1Q7CA 2I8CA 2JEYA 3K0EA 4PTZA 3NBKA 4KGZA 5LMNB 1DC7A 3BQ9A 3I1FA 1SM4A 3E1SA 3NV9A 3QU5A 1FFBA 1PDOA 1LPAB 1TEVA 2G0AA 2H57A 1SUDA 2MWMA 1N6HA 2W2VA 4OP2A 3WX0A 4CTNA 1Z0KA 4V0RA 3DEFA 2PGDA 1Z4OA 2R8OA 4MVJE 5LD2B 1UQRA 1VZ2A 1SELA 1I3CA 4N1AA 5EQDA 3GUCA 3F7OA 2M6KA 5SV2A 3WS7A 3KVNA 2C20A 2ZTHA 2IYLD 1YA6A 1JU4A 2CBZA 2AIRA 2UUCB 1EWYA 3BE8A 1OYYA 1NUAA 1UPUA 2C95A 3IPLA 3JPYA 2HHLA 2MMGA 1M8GA 4G56A 2W8ZA 4NHEA 5FWNA 3LWDA 2Y6UA 4CM4B 1Y37A 3ENVA 2GYYA 2B8NA 3CBQA 2EGGA 1WE2A 4POAA 3HCAA 2HU5A 3PD1A 3GP8A 1YBMA 3D1LA