2BLLA

Apo-structure of the c-terminal decarboxylase domain of arna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
330
Chain Sequence
MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVVEHRKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN YFBG
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L- Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 128
structure length 330
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2bllA02
4LVCA 2WD8A 1T2AA 5JDIC 1RJWA 4ND5A 1LSJA 4E5YA 2YV1A 3L9XA 5C3MA 2W90A 4CMAA 3K2EA 4LMRA 1YS4A 3NX4A 4OKIA 5TT0A 2X86A 4L4RA 3AW9A 3KHUA 5TX7A 2Q2WA 1LSSA 2DC1A 4BHTA 4D3FA 2X9NA 1C1DB 1O0SA 1ONPA 3Q11A 1YQGA 9LDTA 1UAYA 1C0KA 3SC6A 2O7SA 3NTQA 3H5RA 3OF2A 4U0KA 3RUIA 1W8DA 2G0TA 3B20A 4YWJA 4JCOA 3RVDA 4LRSB 4UVEA 4RLSA 5BSGA 2DUUA 2Y93A 1ZSVA 2WWRA 1UZNA 3DBHB 2QW8A 4IBOA 1P0FA 4C7KA 1VPDA 1N7GA 2Q99A 1O8CA 4B7CA 1M76A 4HNGA 2ZB7A 3CMMA 4M86A 5TQVA 1AGNA 3ZNPA 3DOCA 4ALLA 2EERA 1E3WA 4JJGA 4K6CA 3CMCO 3E03A 2O3TA 1HDYA 2NSDA 3VAZA 3DAGA 2YY7A 2Q45A 2I67A 3D4PA 4Y8VA 4IZIA 1LC0A 3VC7A 4U8GA 1DIAA 4HV4A 4BKQA 2P91A 1NHGA 1JAXA 3ZI0A 4D43A 5IG2A 2DT5A 2E49A 3QVWA 4FOSA 4LCEA 2WEKA 1PQWA 3GEMA 2Q1TA 2DTXA 2JHGA 4E5KA 1C1XB 1T2CA 1A4IA 4D0RA 2EP5A 2CNBA 5KVSA 3DQPA 3E1KA 3EYWA 5B4VA 5CEEA 1P3DA 2OORA 1NPTO 2Y99A 2BD0A 3BTVA 4GBJA 4ESOA 3HDHA 4RV9A 1NX6A 4MIOA 1GAEO 3LT1A 2NM0A 3FD8A 1DJQA 1P74A 4BNNA 3UGKA 5L7TA 1YH3A 2JD1A 1DJNA 2GN4A 3MWDB 3BTOA 4OXNA 3JD2A 2O3QA 4IY1A 4R5HA 1Q0QA 2D0IA 5IF3A 2WDZA 1N2SA 4IPTA 1DHRA 5EPOA 5JCXA 2WYWA 1Y9AA 1UJMA 1DDOA 1UP4A 1Z6ZA 3KM0A 5G4KB 4HFNA 2C82A 3AJRA 1BDBA 3GNSA 4IIUA 1H2BA 3QJ5A 2NU7A 4G65A 4RCVA 1PQPA 4Y6SA 3U4CA 2X6TA 1GADO 3NTOA 3WXBA 2FSSA 4Z0HO 2YV3A 1Q0HA 1ONOA 4NBVA 1DAPA 4TZTA 5CPBA 4DIFA 3A14A 1TEHA 3VVCA 1ENZA 4MOWA 3UKOA 4DBVO 1SNYA 4Q39A 4E5PA 2G76A 2I99A 3H9QA 2O7QA 3R3JA 4KWHA 4GVLA 5FEUA 1K2WA 1J6UA 3RKUA 1LTHR 4R9SA 1I30A 2CVOA 4GWKA 1B8UA 1I10A 1GTMA 2GDZA 3JQDA 3KTDA 2FR8A 4CMJA 2H1SA 4FD3A 4GX0A 5A5EA 3ICPA 4FSHA 4O5OA 1KETA 5TSDA 4D45A 4NK5A 4PLZA 4ZQHA 5GZ3A 4MVJG 3MJTA 3KLPX 4PZDA 5DN9A 2NWQA 3HDJA 3H4VA 3PFWO 4CUZA 3ZWMA 4PG5A 4XA8A 3KYBA 3X2EA 5JE8A 3E48A 2HRZA 2XF8A 2D1YA 4J2HA 2PH5A 2X0RA 4GGPA 3FWZA 3LVFO 1PWZA 1YB4A 1BTOA 5DULA 3IKTA 4CL8A 3ZWPA 4DQXA 3FF4A 3MJSA 4MO2A 2YFHA 3KV3O 3WJAA 5I9MA 4Q3BA 3HN7A 5F1KA 4XYBA 4RPJA 1DIRA 1CEQA 1BXKA 3C1AA 1UZLA 3WOHA 1FK8A 2EXXA 3INGA 1PGOA 2ZB4A 3D4NA 1DC3A 3MWEB 3PWZA 4DPMA 4P38A 2ZCVA 1K6JA 1PS0A 1ZBQA 2B36A 2OO5A 1WXDA 4ZQEA 2Q4BA 3WQRA 2Y1FA 5A9RA 4O1MA 3TNLA 3DONA 3L0DA 2IE0A 1WMAA 2O50A 2HDHA 2EG9A 4K28A 3NT2A 4I1IA 1P1IA 2FZWA 2P2SA 2XXBA 4HX5A 4J7UA 1DC5A 1RM5A 4UUMA 3RUCA 4AJHA 3AUTA 2GASA 1PL6A 3QW2A 2YQ4A 2AQ8A 1VE9A 3H5NA 3R6DA 4XGIA 4HUJA 4W9NC 2EGHA 5FF9A 4AFNA 2DFVA 1PJLA 4MKZA 1PR3A 3DMYA 3OIDA 3GUYA 4NPCA 3RJ9A 1NVTA 1RYEA 3NAQA 2JHFA 2R6JA 4CM9A 2Y0EA 4O59O 3KSDO 5COQA 1HTBA 2EJVA 1EBFA 1LLQA 3GHHA 4GKVA 4RF2A 3KBOA 4XIYA 3EK2A 3UCFA 4OXYA 4YJFA 1IOLA 5I8WA 4BNUA 3ZNQA 3DDNA 2VHZA 1HKUA 1X15A 1V3UA 1E3LA 4XDZA 2E37A 1BXGA 1H6AA 2GPTA 3MJ4A 2CF6A 3IP1A 3JQAB 5IDWA 3BTSA 1NFRA 1VL0A 3WIEA 2B69A 4J9VA 4J0EA 1GUYA 1I8TA 4J6FA 2I3GA 4BO6A 3E8XA 4RQTA 2HK7A 1VI2A 1VJ1A 5IXYA 3DAPA 3WX0A 2FHSA 3G79A 1E6UA 1EVJA 1D3AA 3G49A 1BGVA 3GAZA 1HYGA 2ZQYA 4IMRA 2G17A 2OZPA 5TGDA 5JMWA 2IXAA 4EITA 4CQLA 2JCYA 3VDQA 2DBRA 4IINA 4GGOA 3OETA 5DP2A 3TJRA 4A73A 3JD1A 4LN1A 7ADHA 3EHEA 1A5ZA 4CUJA 3HDYA 1B7GO 4RVFA 4HFMA 4OQYA 2YYYA 4OIMA 4OGWA 3I3OA 3BMQB 3LLSA 4IJKA 4L74A 1RM3A 2NTJA 2P9CA 3GG2A 2ZATA 1WDMA 2PV7A 1UDAA 3U49A 3WGHA 4YT8A 4CPDA 1BXZA 1HYHA 3GDOA 3L4BC 1YQDA 4XJSA 4XRRA 4YCAA 1Q2XA 2VTEA 4YBZA 4E4YA 4YAIA 2XXJA 1ONNA 3DZKA 4TRNA 4D0SA 1JAYA 2OP1A 3KO8A 4GPD1 3I9LA 1DPGA 2C7GA 4FC7A 4UEKA 4EUFA 2GSDA 1J5PA 1MP0A 3E18A 3GEDA 4GSKA 5KVQA 3TSCA 1OBFO 2G82A 3OJOA 4J2OA 1SAYA 4R54A 1NTOA 4M49A 4Z3DA 2W98A 5L9AA 2AEMA 1P1JA 3C7CB 1YWGO 3AOEA 4WLUA 3MJVA 4UEOA 3GZNA 5JW6A 5KKAA 1KEPA 5CHEA 1U4OA 1VL6A 4YJFB 1GFSA 1R37A 1OAAA 4PVDA 5L51A 4UUPA 5L7WA 2VZ9A 3RU9A 3D3WA 1KVQA 3TL3A 5IFLA 3JYQA 4OH1A 3N74A 3CZRA 4L4XA 2BGKA 4BO1A 3HFSA 1JWAB 3GPIA 5A04A 1H93A 3OQBA 3IP3A 5L4SA 4K26A 2VTDA 4DIOA 1T25A 2E48A 4WASA 3VZQA 1CETA 2O3JA 2DUWA 4JBIA 3WTCA 1MFPA 2DPGA 3KYDA 1CRWG 1N1EA 3GH3A 3PGJA 1U3UA 4JP2A 4CLRA 4PCVA 1CYDA 2WMDA 1UZMA 3NEPX 4P4LA 4RZIA 5A3VA 1XKQA 5I8ZA 1OC4A 1YL7A 4WLFA 4CQLB 1WWKA 1NASA 1Y81A 4IGEA 3GK3A 2W8ZA 1J0XO 1Q1NA 1XELA 3FHLA 1FMCA 4E33A 2YJZA 3ZHYA 1R0LA 2ILTA 5JDCA 3RI3A 2IYPA 4RPHA 1QYVA 4ZQFA 1A7AA 1YBAA 2X0JA 4P4GA 3WGQA 4AJOA 3N7UA 2VRCD 5G0UA 1V3VA 3R3SA 3VZPA 2WE7A 1E7WA 3ZWYA 1PSDA 3ON5A 5G0WA 4BKRA 1X0XA 4DA9A 2X5OA 4D41A 1R12A 2GZ3A 3FPCA 5KKCA 1Y5MA 3JQGA 4FGWA 1QG6A 2WJPA 5IZCC 3R1IA 3GMSA 4FCCA 3QHAA 3INTA 3Q0EA 1PGNA 4OQZA 4KTTE 4B8WA 2A9FA 1TVEA 1FF9A 5T5QA 1P1KA 1B2LA 3WDSA 1O9BA 4NHEA 4OM8A 3PQDA 4YA6A 3KVOA 4YAJA 3WYEA 3OBBA 1LDMA 1GYQA 3HWRA 3I9KA 2NVBA 2WSBA 3AY6A 4CM4A 1HWYA 4ZU3A 4CM7A 4XQ9A 1L7DA 3S55A 1JW9B 2PY6A 5JC8A 4WCFC 2Q49A 4WNIA 1I3NA 4DXHA 4YT5A 3GVXA 3GZNB 1JKIA 5L4NA 1KC3A 4GMFA 2OUIA 3B1KA 2D2IA 2IXBA 2NQ8A 2JFGA 3AM4A 1TT5A 3HB5X 3L9WA 9LDBA 4I08A 3TZQA 1LLCA 4RPGA 2B37A 4RDHA 3ZV5A 3DBRB 4AJEA 4RDIA 4RZHA 5JFOA 4M87A 2Z5LA 1LDEA 2H5LA 4MINA 5CAEA 4URFA 3OP4A 3ZV3A 2TMGA 1CJCA 4H3VA 3H2ZA 3ZGYA 4E21A 4KUGA 5TIIA 3WTBA 5JAIA 3RJ5A 1PGJA 1BMDA 5B1YA 1QSGA 4BNYA 3DZIA 3KYDB 1DRWA 3GAFA 3Q6IA 3ZNOA 1EDZA 2QZ9A 4BNLA 3V2GA 4Z0PA 4IDEA 4CLRB 5JAZA 3V5NA 1T26A 3VPFA 3KSZO 5F5NA 1FJHA 3PK0A 1I32A 4MIEA 4RGBA 1QYCA 1V35A 2IDZA 3RUEA 1NPYA 4F6LA 3CZMA 1OOEA 3EDMA 5I7EA 1ZNQO 5JO9A 3DFZA 4R5MA 5EL0A 3PHLA 2PLAA 4YAEA 3S1LA 1DLJA 3DBVO 4XZ3A 1H2HA 5F5LA 5H82A 5A03A 2PGJA 2J8ZA 1I01A 4BB6A 4YJGB 2JL1A 3KSUA 2D4AA 2QRKA 1HXHA 3QSGA 4YEDA 5ENVA 4WOKA 4OMUA 3GN1A 2H63A 4E30A 1SEPA 5GY7A 3JQGB 3OIFA 1Y8QB 4IQ0A 3DZBA 2AA3A 3H5AA 4CM3A 4CMEA 2OXIA 4DMMA 1MXHA 4ND3A 3AI2A 3FNGA 3HFGA 4ID9A 3MOGA 3AFNA 4R3WA 4BNMA 1N5DA 5K6AC 1UDCA 1EEHA 1E7MA 2VYVA 2OL4A 5MDHA 5CDSA 1NAHA 4FFPA 4CV1A 1B8PA 4I5GA 5DOVA 3C85A 2I66A 3EAGA 3JYPA 5THQA 3PYLA 3TPCA 1NQOA 2HRBA 3H3FA 5BT9A 1LEHA 3JQBC 3PZBA 3TFQA 3Q2KA 4EDFA 2UUPA 3PFFA 1ZMOA 1WDLA 3BXXA 3FWNA 1U2DA 4JK3A 4LRTB 3UF0A 1YL6A 3LT0A 4FFNA 2HMUA 4D7AA 4F6CA 2V65A 2QYSA 1MA0A 3BIOA 3BMCA 4HADA 2XOXA 4AJ1A 2DPHA 3P7MA 2X5JO 1LNQA 2HMSA 1IL0A 3ULKA 4NIMA 5JNLA 4CR7A 3GGPA 3ZWNA 3K92A 2E4AA 5G0VA 2IZ0A 1C0LA 3K73O 4IM7A 1HZJA 2OBYA 1YJQA 1PZHA 2ZTUA 3PIIA 4HKTA 5L40A 4BO8A 1NNUA 3DTTA 1QYXA 3MJEA 4WE3A 4NZ9A 4L73A 1TLTA 1V3TA 1MV8A 1D8AA 3QRWA 3F1LA 2X8LA 4RQUA 1C1DA 1UXKA 2OBNA 2FPPA 3GRPA 3AU9A 1X0VA 4R3NA 2OFPA 1RM4A 4IJUA 3OJ0A 4B7UA 4ZGWA 4U0JA 4IS3A 2JFHA 1KY4A 3QWHA 2PFGA 4D42A 4NBUA 1EE2A 4P4NA 4CMIB 5F1PA 4BGVA 2NU8A 2PA3A 3OSUA 5IZ4A 1NFFA 1ADBA 1M66A 1P44A 4AL4A 5CP8A 3JQCA 3D4OA 3DHNA 1DLIA 3DEYX 3LK7A 1JQBA 4MVJI 1H6BA 3WSVA 2OGUA 5IN4A 1ULSA 4X54A 4CQMB 2Q3EA 1HE4A 1XU7A 4BNTA 2X23A 2BELA 3UCXA 4CM9D 1EMDA 4WOJA 2P5UA 4GH5A 4J9UE 1N8KA 2BMAA 1PIWA 3T7EA 1RPNA 4KUHA 4GX1A 3WMXA 1NWHA 4JX8A 3RU7A 4BQPA 1GPJA 2DFDA 4INAA 1DC6A 3LSYA 3CH6A 4WK6A 5JY6A 1EVYA 4R4JA 4BV9A 1C1XA 4XGKA 3RC1A 2NU9A 1GZ3A 2PZKA 2LDBA 2XAAA 2V6MA 1ZK2A 4NH4A 3RUDA 3M2TA 3VTFA 3WYCA 1NPDA 5U9CA 1Y8RA 4RPKA 3PVZA 5A1TA 1F17A 3BMCB 3UH1A 5CDTA 4GKBA 1KC1A 1IYZA 3FTPA 4O6VA 4J16A 5F21A 5C37A 5I7FA 3WGIA 1P33A 3FNFA 4E2ZA 1BVRA 2VNAA 1WP4A 2O4CA 4J7XA 5G4KA 4XCVA 2JD0A 4TSKA 4TROA 4UREA 1YRLA 5DBIA 4A0SA 1OFGA 1B15A 3AUUA 1GPDG 2EKPA 1YOVB 3ANNA 4DRYA 1GUZA 2HSDA 1RM0A 3RC9A 5G2OA 3STHA 5LDHA 4DLAA 5BSFA 1VM6A 5JO0A 3PHIA 1DSSG 3UCEA 5CEFA 2HJSA 4MP6A 3R0IA 4NNJA 1YJ8A 2GF2A 2GYYA 4B4UA 4K1LA 2HMTA 2FRDA 2VHXA 2VYNA 3ST7A 2B5VA 3E5RA 1FDWA 1BG6A 3JQ9C 4EEXA 3WNQA 1PJ2A 1B14A 4Z9FA 4OSPA 3DMTA 3PEFA 4OYRA 4BNZA 3H9GA 1Q7GA 2B4RO 1VKOA 4CM8B 1SEVA 1M6HA 1Y9EA 3CSDA 5AXDA 2R00A 2O2YA 3I9JA 1ORRA 1BHSA 2Y66A 3D5QA 3DAFA 5COAA 1R4MA 3VH2A 1SBYA 4E0BA 1AUPA 1KEVA 3JYNA 3BYZA 3DB2A 3RCBA 4K6FA 3MZ0A 1E7YA 3EZLA 3KEOA 3CXRA 4QO8A 1X13A 1XDWA 3I6QA 4LMPA 2F1KA 1GEGA 3ZHXA 5FWNA 1ZUD1 1JVBA 2X58A 4Y6RA 3H2SA 3OEYA 2JD2A 3TZ6A 3JQEA 2FSVA 2EGGA 1U7HA 3RWBA 2O48X 4UAGA 4Y9DA 3T4EA 2FOIA 4XWYA 4ZJUA 3GNTA 3JYLA 3NT4A 1PJQA 2X22A 2VZ0A 3I6IA 3EW7A 1ISFA 1EZ4A 1IB6A 2GR9A 3NJ4A 4QT0A 1SMKA 1Y8RB 4I9UA 4J91A 4YT4A 1QYDA 2W2LD 3IAHA 5KIAA 3JD0A 4GVXA 5DT9A 3QY9A 3V1UA 4R69A 5IXSA 3IQDB 3OA0A 1KVRA 3I9MA 4IDBA 1B3RA 4PG8A 1E77A 4PN3A 1R4NB 3RAJA 1ISHA 2O2SA 3S2FA 1GYRA 5CG1A 2I3AA 4XIJA 4XR9A 3CTMA 3MTGA 3OICA 4R1NA 3O03A 1OI7A 5JCJA 2H6EA 4NU6A 1CERA 1DBVO 4PLHA 2W2KB 1F8FA 3C1OA 4OKNA 3LC7O 4JBHA 4DC1A 1GQQA 1ADFA 5HRUA 4XD2A 4B7XA 5ILOA 3H6KA 5HBRA 4XGNA 1HEUA 1W73A 1K89A 1QKIA 3DWFA 1MG5A 3NDRA 2V6BA 1SB8A 1H9BA 3MOIA 3DHYA 4WLNA 3V1YA 5C7IO 1TB4A 3OM9A 5LCXA 3DZJA 3JQ6A 4MJLA 3QIVA 2Y0CA 4N7RA 3GZ4A 2FR0A 3KLMX 4HY3A 1E1LA 1HDZA 1B8VA 3JQAA 1K6XA 1N92A 1E3IA 4L75A 4BQRA 3SC4A 3BMOA 4ZQGA 3GQVA 3H7AA 3CKYA 5ILGA 3ROKA 1Y6JA 1FDTA 4NQZA 1X7DA 2AMFA 3DC2A 1N9GB 2DBQA 5IDQA 4NI5A 3O8QB 4LW8A 1QLHA 1A7KA 3H65A 1JWBB 3HJAA 2BFAA 2D3TA 1H6CA 5LC1A 4DGSA 1R4MB 3C7AA 3K6JA 3OJLA 4B4WA 4BNIA 1GQ2A 2O3SA 6LDHA 3GEGA 3QVTA 1Z73A 2NNLD 1LUAA 2BRUA 7MDHA 4HBGA 4OSOA 3A06A 1D7OA 1VLLA 4WGGA 2GN6A 4YPOA 1NBOA 3D1LA 1A9YA 4IXWA 3W8EA 5B4UA 1YBMA 1X1TA 4MVJH 1HSOA 4DQVA 2WYVA 2UVDA 2B83A 4NBRA 4BUCA 5JAMA 1EE9A 2FP4A 2V6GA 2A35A 1YB5A 4QECA 1H5QA 4YJDA 4HXYA 2PH3A 5CPFA 4E2XA 4GSLA 3BMQA 1YL5A 1KS9A 2QIOA 3VPHA 4R68A 4RVSA 2P4QA 4NDNE 2EIHA 2P9EA 4Q3AA 4BOYA 5EIOA 4WNCA 3AOGA 3JTMA 3G3EA 1LDYA 4WLVA 5U1PA 1EK6A 3GN2A 3SJUA 1HLPA 2CDBA 4KDEA 2R2GA 3JQ7B 4U6SA 1HDGO 2E6UX 1HDOA 3VDRA 1GEEA 1PQUA 1EFLA 3ZWXA 1GU7A 1ZK4A 4EW6A 5F3RA 1IPFA 1HRDA 4O0LA 3SLKA 1Z7EA 3LYLA 2PD4A 3I5MA 3NUGA 2AG8A 4TKMA 1ZIDA 3GMDA 1NVGA 3O4RA 3HQ4O 3NGLA 8LDHA 2NQTA 4YRBA 4AICA 1SB9A 4F45A 2RH8A 3Q9UA 1ISMA 3WWZA 4A2CA 2PR2A 1Q0LA 1QR6A 1UXJA 2IEDA 2QRLA 4W6ZA 3SVTA 3SEFA 3CPSA 5JXWA 1UXHA 1XG5A 1OMOA 2EWMA 2NADA 4EUEA 3OFSA 4J3FA 4B3JA 2POQX 3PWSA 3EC7A 4PG7A 1AXGA 4H16A 4W99A 2HMVA 5TF4A 3BMOB 2ZK7A 4BO2A 1PTJA 4CMEC 3U5TA 2I6TA 3OJFA 4AJNA 4NMHA 2VYVD 3PJFA 3F6YA 3VPXA 4DUPA 3QVXA 2Z95A 2JAHA 1C0IA 3ETEA 5B12A 2YDXA 5IJZA 3D0OA 4I8XA 3U4IA 1HDRA 3GDGA 4I9HA 1GZ4A 2D59A 3V2UA 4ALKA 2V7PA 3VHRA 3OA2A 4M89A 1FDVA 1PS9A 4WJZA 3AI1A 5C5IA 4M1QA 4R41A 1B16A 4EUHA 4BNHA 1E3SA 1PU2A 2BFPA 2CZCA 2YHIA 4JROA 4YJHB 1U28A 4LK3A 1ZSNA 3GR6A 2YZ7A 1EQ2A 3ETGA 4II3A 4LSMA 4BV8A 5JDIA 3ANLA 2I65A 1AN9A 1I33A 2A94A 3I52A 4D46A 2CDAA 2GN8A 1VSUA 1YGYA 3V1TC 2QHXA 4ZN6A 2CUKA 1LU9A 2CD9A 2IEBA 3WR5A 4YYZA 3V8BA 3C3XA 5FI5A 3TFOA 5A3JA 1AHHA 1XA0A 2CDCA 3OMLA 3DR3A 4PZCA 1T1SA 2HCTA 1X1EA 2BF7A 3NV9A 2YDYA 2C5EA 3NTRA 1NQAO 3MTJA 4NFSA 4MP8A 3H9UA 4YRAA 2CY0A 3ADOA 2PTGA 3ZH2A 3WLEA 4I5EA 4XYEA 5AOVA 3SX2A 2EJWA 1QYWA 3CE6A 4JN6B 3G17A 1E1MA 5T8KC 3LT4A 4J0FA 2Q1UA 3ONEA 4I5FA 1OC2A 3QLJA 4M54A 2AQIA 1DO8A 4N54A 4XEHA 4PRKA 3BHMA 5A9TA 2Y1OA 3B6ZA 3B70A 4Q9NA 2RAFA 1P1FA 4TVOA 2Q2QA 4MVJD 4GWGA 2VHWA 4YRDA 4E5MA 1HT0A 3FCOA 4JP3A 5DOZA 4BIIA 3BZUA 4XQCA 2Y1GA 4GLOA 3DBRA 3ZZNA 1XQ6A 4RVGA 2J5KA 4FS3A 1DAOA 2ZTVA 5U4QA 1YKFA 3V2HA 2DLDA 3ZU2A 1PS8A 3M1AA 5TS3A 4UUNA 3SXPA 3GRKA 5EQFA 3S2IA 3Q3CA 4Q3DA 4CMHA 2HMWA 2BKAA 2HAEA 3L4SO 1KY5A 3I9NA 3KZVA 3GVCA 3H8VA 5EESA 3RSHA 4RF5A 1YXMA 3EUWA 4D3DA 1V6AA 2DKNA 1H9AA 5H81A 1KEUA 1HYEA 4FGSA 3B1JA 3I23A 1NYTA 2CFCA 2RH4A 1IPEA 4WEOA 3IOYA 2JJYA 3WGTA 3WS7A 3VZSA 1A71A 2YHIB 4XYMA 3ICCA 5AXBA 2FY8A 3RC7A 2AW5A 2AG5A 4YJGA 2UDPA 3GLQA 5BNIA 3U4DA 3HN2A 1YB1A 5KCZA 3NKLA 2HK8A 4ZVVA 1C0PA 2X7HA 3ENKA 3KXDA 4GLLA 1G1AA 1XLTA 4BVAA 4DIBA 2Y68A 1DIGA 3RC2A 3HB4X 4RL6A 5KJCA 3TOXA 4IZHA 1Y8QA 5EQDA 3LZ6A 1PL7A 4AJJA 3F1KA 4OOEA 4NBWA 5ENDA 2DTEA 4DYDA 2GLXA 3O9ZA 2RBEA 3OQ1A 5FYDA 5HS6A 5IN5A 5DF1A 1WLYA 4E2YA 1W0CA 3PHJA 4FN4A 3U09A 1V8BA 1D1TA 1HSZA 1ZKMA 4CLEA 4EJMA 4R1TA 1E5QA 2WYUA 5KJEA 4EGFA 4IGFA 2W4QA 1U7TA 3MJCA 4CUKA 3WQSB 2Z1MA 4AJIA 4HFRA 3PPIA 4WLEA 4E13A 1CIVA 4YAGA 3QE3A 4Y67A 4CMGA 5T64A 3BHJA 4BL5A 3G0OA 3HZZA 5A05A 3PJGA 1HLDA 2VN8A 1W6UA 3GVHA 1ARZA 3ROMA 1I5RA 4YR9A 4CLOA 1XYGA 3PDJA 4IS2A 4PG6A 3FBGA 4IUYA 4U7WA 4DQUA 4L4SA 1P0CA 1OZAA 3FSRA 3DMTC 3ANMA 4W82A 5DNAA 3MCVA 3I4FA 4BMVA 1PJTA 1LDBA 4DYVA 3ZHZA 4IDFA 2AEFA 3ZWVA 2P68A 3DBLB 1AXEA 2R00C 3DO5A 1U4SA 4QSMA 3LLVA 4AJ2A 4AJ4A 2C2YA 1P9LA 4GMGA 2VUSA 1EQUA 1ISIA 4J1NA 3K9QO 4EJ6A 5H83A 5KVVA 1H6DA 1GUFA 3HHPA 4FIZA 5HA5A 1PJ4A 1IHYA 2NACA 3PWKA 5I9NA 1LDGA 1EUCA 4ROSA 1PJ3A 3RBZA 1UUFA 1LC3A 4CL3A 3HSKA 4FW8A 4PLWA 3TQHA 4B3HA 1K3TA 3UW3A 4JJFA 4PRLA 3ROQA 3ITKA 4H7PA 5DCUA 3KB6A 4ILKA 1W4ZA 1ENYA 1KVTA 3ONDA 1F14A 4W9NA 4B8ZA 1N1GA 1BDMA 1XEAA 4CMIA 2DM6A 3AI3A 1A27A 1S6YA 1SZJG 3T7CA 1GV1A 2Y1EA 4IMPA 3VVBA 4NBTA 1U1IA 4E31A 1ML3A 4ZHSA 3D7LA 3PGXA 1E7QA 1WVGA 4BGUA 2C07A 4YQYA 4BB5A 4TZKA 1E7SA 1K0UA 1BSVA 1ZCJA 3AM5A 4PLGA 1U2GA 4C4OA 1HE5A 3AY7A 4Y98A 4XRGA 2DBZA 2RIRA 4BO7A 3AUAA 4CQMA 4XX0A 4BGIA 4BMNA 4PIVA 4YTEA 4IDAA 4CMCA 4CMKA 4YXFA 1L7EA 1I3LA 1LSOA 5KJ6A 3IJRA 2GD1O 2PZMA 1B26A 3JQ8B 2Q1WA 1ZSYA 4E32A 4OOFA 4PZEA 4ALIA 3DL2A 1LA2A 2IZZA 4DMLA 3ASVA 1VRWA 2DBVO 3JQAD 4IQGA 4C7JA 3U62A 1CF2O 1T24A 3Q2IA 4QTZA 3ABIA 1DB3A 5BQFA 2JCVA 4CLOB 4TRMA 1IE3A 4MIYA 2AHRA 5G0SA 3F4BA 4BNFA 2BGMA 1AE1A 3GFBA 1YE3A 3IUSA 3I83A 3O38A 4KP7A 4TKLA 4GX2A 1ZZEA 2NV6A 4UEJA 1QLJA 3T4XA 2ZJ1A 2PK3A 3ASUA 2H9IA 4J49A 1Y7TA 1PJSA 2ZKLA 2B35A 3ITDA 3Q9NA 2ZTLA 3H9EO 1MG0A 2EEZA 3EY4A 3ZWBA 3ZW8A 4MVJE 4ND4A 1T1RA 1E0DA 1I2CA 1YONA 1YOVA 1C3VA 3ZV6A 1GR0A 3L4BA 3LC1O 3FRJA 2C29D 3F5QA 3GGGA 2DQ4A 1DEHA 1ZMTA 4NJMA 4RVHA 4BS9A 2GCGA 1U3TA 1CWUA 4MDHA 2OOSA 2O4UX 4DWVA 4YAKA 1GCUA 3ZN2A 2PZJA 4UULA 3TZHA 1IUKA 3K96A 5AVOA 5IDXA 1JN0A 2Q2VA 3HNPA 4TWRA 3C7DB 3ROPA 1R16A 4NK4A 2HLPA 3WIDA 3FR8A 1J49A 2X9GA 1WMBA 1R15A 3IC5A 4FC6A 3PHGA 1J4AA 1BW9B 3E5MA 4Z0TA 2WTBA 1PEDA 4JGBA 4JIGA 4E6PA 1XCBA 4CM8A 4QFCA 2VCYA 5IDYA 1Z45A 5G0TA 4B4VA 2LDXA 3AU8A 1NR1A 1V9LA 1NR7A 1PZEA 1GV0A 5ICMA 3KETA 2AQHA 4AG3A 5CFZA 5F1OA 2XPCA 3QWAA 3UFXA 1KEWA 5HWSA 4II2A 4CM6A 2JFFA 4E3ZA 3P2YA 4UVGA 3TOZA 1MGOA 1BWSA 2OHXA 1HETA 1EFKA 4ALJA 2EV9A 3GF4A 1LI4A 3VH1A 3L07A 4W7IA 5JLAA 3NGXA 4ZICA 1K5HA 5T67A 1HL3A 1R66A 1NVMB 1IZ0A 3TZKA 1FXSA 5TT1A 3NDJA 3QVOA 3WJ7A 2PKRA 4QX6A 2D8AA 4H15A 4UUOA 3WBFA 1E1NA 2DVMA 5JYEA 1UDBA 4JXKA 4YT2A 4BO4A 1HE3A 3TL2A 1MC5A 1T4DA 3QP9A 3W4JA 5ER6A 2VUUA 1RWBA 1IZ9A 4BNKA 3DHEA 1I2ZA 1ZXLA 4TRRA 4BKUA 1R4NA 8ADHA 4O63O 4YQZA 2ZB3A 1DRVA 1QV6A 4NR0A 2VRCA 1Z82A 1QP8A 2VWQA 2YUTA 5FI3A 1LRKA 1F8GA 2EW2A 2W2KA 1L1FA 4XYLA 4DTIA 5ADHA 2HK9A 1NFQA 5ER9A 5IZCA 1G6KA 2JAPA 4NJMB 2GN9A 3M1LA 2GRAA 1C14A 2TMDA 3CEAA 4BGEA 1SOVA 2P5YA 1WAMA 3LC2O 1PX0A 3GUCA 4QO7A 5L7YA 2P4HX 1AHIA 4KDFA 4RORA 2FPGA 4XDYA 2NTVA 3KRTA 5JMPA 4J4TA 4WCFA 3F4LA 3E9QA 2AXQA 2DTDA 4XKJA 2J5RA 5TRTA 3RUAA 1QMGA 4G5HA 2PD3A 4Q3NA 5A9SA 4DPKA 1VC2A 1MLDA 2VT2A 1SCUA 3NDIA 4FJ1A 1NQTA 1E7RA 2RHCA 4N5NA 5GZ6A 2QYTA 1LQTA 4GAEA 3PLRA 3VPGA 3AK4A 4XYGA 3RUHA 1UXGA 1BRMA 1N9GA 1JA9A 1PJCA 2NU6A 3PJDA 3NYWA 3O8QA 3AWDA 3K31A 2BLLA 3LF1A 4GL4A 3RFTA 3ONFA 5JC1A 3U9LA 1ZFNA 3KYCA 3SJ7A 2A4KA 3AOEC 5KWEA 5DDIP 2HJRA 4OXKA 5B37A 1UP7A 3JSAA 3RFVA 1BVUA 2NUAA 4GI2A 3WGGA 1DHTA 1MX3A 1NAIA 1CDOA 4YACA 1Q7BA 3QWIA 2F00A 1NP3A 3EZYA 1E1KA 2B0JA 3UHAA 2QRJA 1VJTA 4WKGA 3GDFA 1PZGA 3RD5A 3OEWA 4BMSA 1SPXA 2GNAA 5KOIA 2CMDA 3TN7A 1PZFA 1ISJA 3E9NA 3G1TA 1F06A 2E82A 1XU9A 3SBOA 2ZQZA 1B0AA 4RO0A 2NTNA 3INRA 1JVSA 2FWMX 3PQEA 5BR7A 4F3YA 3VKUA 1A4UA 3PZRA 3JQ7A 1A72A 2IRWA 5C7LO 2QX7A 5T57A 4A10A 5T6BA 4Q3CA 5DP1A 4Y6PA 1R6DA 2RCYA 3A9WA 3GNQA 4NU5A 5BSEA 2Y1DA 4M8SA 1UR5A 1O89A 4BO5A 2PZLA 5KTKA 3D5TA 4TRJA 3E82A 2VHVA 1CQJA 5CDYA 2ZCUA 2YFQA 3F9IA 4HNHA 3ZHBA 5JDCC 3D64A 4BO0A 3VPSA 1ISGA 1I3MA 5K6AA 3VH4A 2ZYDA 4IIVA 3VH3A 4CR8A 1LSUA 4D3SA 2UV8A 4FR5A 3Q1LA 1TT7A 4XB2A 1XR3A 3ENNA 3HDQA 3UAGA 4FB5A 1QRRA 3PI7A 3F3SA 4WCFB 5TLSA 3C8MA 4KWIA 5A9SB 3RROA 4DLBA 1M67A 3ADPA 3AM3A 1HDCA 4IDDA 2AE1A 1F12A 1EVIA 2BGLA 3JQBA 2EHDA 2PD6A 3UOGA 3M6IA 5COBA 5CG2A 4CV3A 4MVJM 1HZZA 4DC0A 3QA9A 4PLVA 3DZFA 5JPIA 4MKXA 1ZK1A 5JY1A 3KYCB 2DAPA 5J23A 1DFIA 3A4VA 4ZRNA 5GMOA 4OHUA 3UVEA 3RIHA 3GG9A 1LX6A 2HQ1A 1YDEA 3L77A 4I5DA 1E3WB 4PLCA 5HS4A 5HTOA 4K9DA 4QEDA 3W8FA 1MUUA 3OECA 5L4LA 5BNFA 4NJOA 4S1VA 4D79A 4YJHA 4J4BA 3JD3A 4L0QA 5AQ1A 2Q4EA 3AFMA 3KOUA 2FPIA 4EI2A 5TNXA 2C0CA 1EBUA 3DTYA 5EMHA 4WCDA 2A92A 4MP3A 3NRCA 4ITUA 3IL2A 2VNSA 2AEJA 5L45A 2DU8A 4KUEA 5CEJA 4RF3A 4CLXA 1NM5A 2VUTA 4XQEA 1GYPA 1XGKA 1X7HA 4E12A 1Q7CA 1Z7BA 3GVIA 5BSHA 1UXIA 4QXMA 1DOHA 2CSUA 4OJNA 3UN1A 1T4BA 4FDAA 4CV2A 1GY8A 4J1QA 1NHWA 3TF5A 4N5LA 1WW8A 1ZW1A 4WECA 3BA1A 4RVUA 5JS6A 4KOAA 1ZK3A 3ZWCA 3C1TA 4J43A 3FNHA 1D4FA 1UAGA 4IXTA 3JD4A 3ZWWA 1KYQA 1R0SA 3C24A 1DC4A 1O94A 3JV7A 1NQ5A 2ZB8A 1IULA 3QWFA 3K5PA 3H9JA 4FOOA 4FQ8A 3W4IA 3ETDA 4EZBA 1QORA 1YO6A 2CVQA 3DZGA 4BNJA 4U5QA 3H3JA 4CQMD 3N58A 3ZNNA 1KBZA 1U8XX 1ENOA 4FJ2A 3U4HA 4UVHA 3GA0A 4W4TA 1JLLA 4Z3KA 1T2FA 4J1TA 2X4GA 2Y05A 3S2EA 1YQXA 4FPXA 3PRJA 1PGQA 1U9JA 3CIFA 3ORFA 4G2NA 5IAAA 1H0KA 1XQ1A 1FDUA 3QVSA 2YQ5A 4IJWA 1TA4A 3JQFA 4IDCA 4TQGA 3WBBA 1SOWA 3RFXA 2GGSA 2RHRA 3WWYA 4P8RA 3EVTA 2GO1A 1GL3A 2X9VA 3LF2A 3WG9A 1YDWA 2BHLA 2HUNA 1X14A 2VZ8A 2NVUA 2BH9A 3DFUA 4Z9XA 2D5AA 4BNXA 4XJTA 1NXQA 4BNGA 5K0ZA 1ULUA 3EGOA 1UH5A 2VOEA 3FPLA 2G5CA 5A06A 2D5CA 3ZU5A 2NVWA 2IYOA 3E9MA 1ZEJA 1JU9A 2B4QA 5KJFA 4FFLA 1MFZA 2J3JA 3UUWA 2X0IA 3QQPA 1I36A 5A02A 3WQQA 3A28A 4PGFA 2VWHA 1YVEI 3HADA 2PKQP 4A03A 4AJKA 3L6EA 4CJXA 3JQ9A 3VOSA 5ES3A 1U5AA 4JBGA 2GZ2A 2J3HA 2X0NA 5LDGA 4EEZA 2GZ1A 1YBVA 2FZEA 4WLOA 3WGZA 2BFOA 1TI7A 2ZTMA 3RBXA 3L6OO 4WEQA 3NJ8A 1T2DA 3S2GA 1EVZA 4LGVA 1Z75A 1G0NA 4PLTA 4P22A 3W8DA 2O23A 4DLLA 3FNEA 4KZPA 1WNTA 4B4OA 4IDGA 2X1HA 1R0KA 4BO9A 1E92A 3HG7A 1MC4A 3SLGA 1P45A 1SO8A 1P31A 3VZRA 5JSFA 5JAQA 1SC6A 4WUVA 2ZIZA 1V0JA 1LQUA 2I5PO 4BKPA 5GZ1A 4ZA2A 3G1UA 2VRBA 3ZWAA 3TZCA 3DBLA 1BXGB 2V6FA 3LDHA 2J5QA 1K6IA 1ZH8A 2ZYGA 4PVCA 5CDGA 5KJ1A 4YB8A 4QUKA 1ZJYA 3O26A 4S3MA 1A9ZA 1T2EA 4R1SA 4ALNA 3L6DA 6ADHA 3NT5A 3WNVA 2FMUA 1I3KA 1UP6A 2PGLA 2W2LA 3TRIA 3UXYA 1DFHA 4KMSA 1ENPA 2VOJA 5EERA 3TDKA 3ZU3A 1WDKA 2B5WA 2NVUB 4DL9A 1Z74A 3VKVA 1XSEA 4Q3EA 2EKQA 4FBGA 3CINA 3BMNA 1ADGA 1PJBA 1ZXBA 2AE2A 4CV0A 4NG5A 1P1HA 3EVNA 4RPLA 1M2WA 3RKRA 4B3IA 5AXAA 1LDNA 3WYBA 2FN7A 3E6AA 2WM3A 3VTZA 3OQ6A 2CVZA 2Q50A 4CLDA 3I4CA 2I9PA 4XR4A 2PKQO 2WD7A 2G1UA 3PQFA 3W1VA 1KVSA 1DXYA 5EINA 3ZDFA 4ONEA 4FFOA 3BAZA 4CM5A 2J3IA 4PG4A 1QV7A 1VKNA 3PYMA 3UICA 2O3UA 1I24A 5BNTA 1N7HA 1HDXA 1IHXA 3JQ8A 4JJIA 1ZJZA 1B3BA 2UUOA 4HP8A 3D3EA 2VYND 3P19A 3P2OA 4GX5A 5EN4A 4AJPA 5EJ2A 1O95A 3FI9A 1E3JA 3B1FA 3COSA 4GQAA 3PHHA 2SCUA 4CM1A 4DPLA 4OAQA 1PGPA 3BHIA 5MGBA 4CMBA 1XIVA 1WZEA 3GT0A 4MVJP 1H94A 3WFIA 5I7VA 4IJVA 4E2WA 3WICA 4PLYA 3RUFA 3IKVA 4J1SA 3OH8A 4ND2A 5I9LA 4E5NA 3FR7A 2BFMA 4KQWA 3WB9A 4ND1A 1VJ0A 3F46A 3I9OA 3K2BA 1PL8A 4Z9YA 3D3WB 2C20A 4YDRA 2I76A 4AVYA 3FTNA 1RYDA 2UYYA 1U8FO 1KERA 2QQ5A 1O6ZA 3GGOA 4QQRA 3CUKA 2Y1CA 3A1NA 2J3KA 3QV1A 5JYDA 5L95A 3FBTA 1M6WA 3KUXA 3WSWA 2Y0DA 3PIDA 3JCZA 3IS3A 2EF1A 3BTUA 4BKOA 4CR6A 2Y67A 4A26A 1ADCA 2AQKA 3I1JA 4CODB 5ICSA 3BMNB 4LSWA 1XWFA 2UAGA 1DIBA 3GY0A 1Y1PA 1P77A 5ITWA 2C5AA 4OL9A 4R16A 1BW9A 1MB4A 1U3VA 1X7GA 1LRLA 1EUZA 4FJ0A 5DBFA 4A27A 2Z1NA 5JCJD 3LU1A 3HE3A 4OO3A 1IY8A 5G4LA 4DVJA 1QXSA 2VWPA 2WD7B 2EP7A 4JNKA 4J7CA 4FFMA 3ZCXA 2GERA 1LBEA 3PLNA 5DBGA 1DIHA 4A7PA 3FN4A 3OHSX 4J90A 4PLFA 4I9NA 1E3EA 2GUGA 4RJTA 2CF5A 1KVUA 4DREA 2Q46A 5THKA 3PP8A 3P5SA 3WGOA 3IMFA 4MVJF 3F47A 4ZRMA 4XB1A 4DBZA 3K8ZA 3WGYA 3ZW9A 1NWCA 1MXFA 3GOHA 4WPGA 2HU2A 3ZWOA 4CM4B 2C7VA 4ZD6A 1I0ZA 5FFFA 1LJ8A 3OIGA 2PGDA 3KEQA 3U0BA 3QWBA 1F0YA 5K9ZA 4ZQBA 1JDJA 2BI8A 1I2BA 3RQSA 5HM8A 4LISA 3PJEA 4QFDA 4R01A 3F5SA 1LLDA 1TT5B 3PDUA 1GZ6A 1GCOA 2OP0A 1WZIA 4B79A 2X5KO 2VHYA 3IUPA 1U5CA 3IDSA 3DOOA 4N18A 4L76A 5A4DA 1ZVMA 4L9RA 5TC4A 4RVDA 2JKVA 2YV2A 3EMKA 3OJEA 1TXGA 3RASA 3ZU4A 4NFHA 1HF3A 5JBIA 4KTVE 1DRUA 3IJPA 4R51A 2HO5A 2PNFA 1LLUA 3JYOA 2O3RA 1GDHA 1LXCA 3GC6A 4BNWA 1JTVA 2ZJ0A 3AUSA 3X2FA 3GVPA 1DFGA 3W6UA 1EK5A 3DZHA 1KOLA 1RKXA 5L53A 1D1SA 4MKRA 4R9RA 4D44A 4G81A 1U3WA 4N5MA 1P1RA 5TJ9A 3PTZA 5T8KA 1E6EA 4PLPA 2QZZA 4XQGA 1EUDA 2IODA 3WLFA 4NFYA 4ALMA 4EBFA 4LCJA 2YW9A 3S8MA 2P9GA 1ZEMA 3W4KA 1LRJA 2NLOA 2Q1SA 2YHUA 3RBVA 4IQ8A 5B4TA 5AYVA 3IIEA 4EYEA 5A5FA 1E6WA 1FDSA 3DOJA 1VL8A 1KIFA 1ZO8A 3GFGA 4MPDA 4TMFA 4CLHA 4MVJA 2J6IA 2HKIA 3DBHA 5KNLA 4JQCA 4J4HA 1GD1O 2B4TO 1JKJA 4U6QA 4HFJA 2ET6A 3ZV4A 2IZ1A 1ID1A 4R1UA 3LT2A 3M2PA 3PXXA 1ZK0A 4RLHA 2VT3A 1CQIA 3WMWA 4A5OA 3AY3A 5C7OO 5ITVA 5DCYA 3GPDG 3MEQA 4JLWA 1PR9A 4EJ0A 3WFJA 2BI7A 2VWGA 5AXCA 4BO3A 1EDOA 1XHLA 1O5IA 4HWKA 4LVUA 2JCXA 3PYXA 3U3XA 3TWOA 1M75A 1Y5RA 2PWZA 5DCWA 5TJHA 5CDUA 1GQYA 2FR1A 5I7SA 3K30A 5L3ZA 1G0OA 2C2XA 1WPQA 2OMEA 2VQ3A 1S7CA 4UVDA 4Z6KA 2EKLA 4FFRA 4W7HA 2C54A 1PWXA 1JKFA 4PFJA 2EW8A 3JQFC 2WE8A 4YVFA 5DZSA 4F46A 4AJLA 4UVIA 5KVCA 3HUDA 4KQXA 3W6ZA 4TVBA 2QG4A 4M55A 3LQFA 4L8VA 3GHYA 2ZYAA 1E5LA 1HE2A 1VSVA 2C59A 4RF4A 4BNVA 3DXFA
chains in the Genus database with same CATH superfamily
3WNZA 4OGKA 2AJCA 4L8GA 3GLIE 4ND5A 5DLDA 2GNOA 2WUFA 1GGMA 2HCRA 1EJ6A 4NTZA 1NXSA 3CWZA 2PUCA 3MHTA 3GU3A 4KIUA 5EJIA 1OTYA 3IVCA 1EUDB 3R7AA 2V54A 4NARA 4C6SA 4D3FA 5JT1A 1C1DB 3Q11A 2VHEA 3KWFA 3TSWA 2JLUA 3K16A 1CEXA 3E2IA 3SC6A 4JSYA 1XWIA 3EY9A 3KZKA 4L5JA 3VU8A 3A70A 4I2VA 4LNUB 2XXAB 4J1JA 2SICE 3RFCA 3RUIA 2G0TA 5JR3A 1W5EA 3IPCA 5K5EA 3INYA 4XFJA 3PC2A 5IAGA 2BM9A 4LRSB 4O4HA 5EMJA 1K98A 5REQB 4CVNA 2Y93A 1WSDA 2QNIA 1LKZA 1QG2A 2QW8A 4MLPA 3BJRA 5AP9A 1W5FA 1VPDA 1B42A 4B7CA 2H1LA 4O4IB 5TQVA 4EY6A 3ZNPA 2YZMA 4WK0B 1EUQA 2A5DA 4TSRA 3R4CA 1YULA 4YMSA 3J81k 1JSXA 1ZWLA 3CMCO 5IARA 2O3TA 4NWIA 1URPA 2YY7A 4C6HA 5K3CA 1U1EA 5ICGA 1K2VN 2F43B 2I67A 3ISTA 5ELXA 3OZBA 1XTQA 1EZZA 2PMDA 1IXKA 3H75A 2YYSA 1IIRA 3HO6A 3UK2A 3HA3A 3KQMA 4BKQA 1SXQA 3EYAA 1JAXA 5IG2A 1Z39A 1XHFA 2DT5A 2EJBA 2W43A 3AEUA 1NQVA 3KZNA 3NIBA 3QVWA 3RKSA 3RVRA 3UV3A 4QPNA 2H18A 2PNJA 1F9EA 5DNYB 3FROA 3N0RA 2IKQA 1F2TA 2DTXA 2JHGA 1C1XB 3OC6A 3RE1A 4E5KA 2HSGA 1A4IA 3ADDA 1MX9A 2VHTA 4Q48A 2EP5A 2QL7A 2QMQA 5TDHA 3B9PA 3E1KA 5B4VA 1N32B 1PNOA 5DV9A 1I7NA 2GEUA 2Q5LA 5CCBA 5KTNA 4KQEA 1D1QA 4ESOA 3HDHA 2ZUDA 3NU1A 4MIOA 1GAEO 1RLIA 1XZDA 2VPYA 2WUDA 2NM0A 3FD8A 5PGMA 1FDIA 1E5TA 2ODNA 1KH3A 1JYSA 2Y4NA 3RV3A 4BLUA 3W04A 2REOA 4A6PA 1V1RB 2JD1A 3H6HA 4JU8A 3LHKA 2AMVA 4UNNA 1NNEA 3MWDB 2AFVA 3WK4A 4CCWA 4I8IA 5I01A 5DHPA 5B2FA 2O3QA 5JYCA 3DP7A 5EP3A 2XADA 3A8TA 3CPHA 1U3DA 5EPOA 1E9FA 3TI7A 3BL6A 1M7BA 1TX4B 3KPJA 2WYWA 4L8FA 2Z6VA 3UXHA 4XUCA 4YHBA 4O02B 4C4AA 5IJ0B 1UP4A 1YZQA 3GUZA 3UM9A 4IO1A 4MR7A 4UE2A 1LZKA 1OZGA 1N3LA 2EHJA 2FTKE 3QJ5A 4GWLA 1HG0A 3HJRA 4EF4A 1EFPB 4M98A 3NVMB 4CIAA 3U4CA 2NX2A 3FOWA 2FSSA 1NY5A 5EWLB 4Z0HO 5LMUB 1Q0HA 1ONOA 4PAWA 2QK4A 1DAPA 3SCZA 4DIFA 1NW7A 5KPDA 3G5LA 3VVCA 3C2QA 4MOWA 5FUMA 1OH6A 3A37A 4E5PA 4Y1GA 1P2SA 4EHAA 3H9QA 1VBMA 2ON6A 4JUDX 4BFZA 5FEUA 3RRXA 3QI2A 3OUZA 3CG0A 2WVGA 1LTHR 3LQQA 4BYGA 4MLDA 2GBIA 4R9SA 1UKCA 3VJMA 3ZI7A 4H1UA 5D85A 3GB9A 4GMKA 4GWKA 3R5JA 2GDZA 6REQB 3PQ7A 1N2BA 1U0HC 4CMJA 4GMXA 4GX0A 4H4EA 2BUAA 4JJ8A 3I8OA 4YAFA 5D5PA 4F4JA 4D45A 5GZ3A 3REQB 4ZQHA 1N34B 4GYYA 4KGVA 3ZHSA 2ONYA 2PX0A 2PT5A 2D0OB 4MUHA 3NOOA 1PUXA 2NWQA 5DHRA 2YIJA 3PR3A 1M0TA 2LUOA 2OSBA 2P75A 1DZ3A 2QM8A 4PG5A 2AUTA 3U4MA 2ZBDA 4JA2A 3WMGA 3BWMA 4EG0A 2ODWA 2HLDD 4AMYA 3R7LA 2HRZA 3KAPA 1WPXA 3BCUA 1O6CA 1I6LA 2PL5A 3MF4A 4F2HA 5GV8A 1PWZA 2AOUB 1W85A 4CL8A 4X91A 4U7DA 3FF4A 2GPSA 1U8YA 4UE6A 1WPGA 2WVJA 2YFHA 3AUYA 4GLFA 1ABFA 2W70A 1D4AA 2J07A 4F72A 1F0NA 2ZRPA 1JQ5A 3GNLA 1M1NA 2P7HA 1U90A 3GRCA 3HN7A 4XYBA 4RPJA 4NF2A 1UM9A 1V6SA 3TE7A 3W7AA 3KPWA 1RXCA 1T9KA 1CEQA 2VSXA 3Q8XB 2WKRA 5AHRA 2RGEA 5EFOA 4LDNA 4IV5A 2R3SA 1FK8A 2X19A 1OXXK 1THMA 1RJFA 2GQ0A 3CPJB 3DLIA 4Q82A 4QWWA 3P97A 5DTEA 4ARAA 1BGWA 1Y4DE 2EL9A 3FPHA 2FZCA 1JH8A 2EFCB 5L6MB 1G2QA 3VR3A 3QBTA 2WU3A 3ZK7A 3I9FA 4PINA 2P3OA 3JRWA 4BFSA 4KI7A 2QDKA 1ST2A 3EW9A 1SRRA 4UU7A 3DONA 2Q5EA 3L0DA 5LUAA 3BL5A 3DCNA 5KX5B 2BFNA 2EG9A 3NT2A 4NYJR 1SUAA 4J7UA 1N5MA 3HVIA 5BSTA 1DC5A 1VKHA 3LXRA 1PVOA 1EWQA 4MRMB 5B7QA 4J75A 5T4BA 1GKKA 2GYWA 2BISA 5KAPA 1E2EA 2IX9A 4I36A 4M8IA 4ROTA 5FF9A 3T7AA 1LPMA 1THGA 4Q24A 3T3HA 4AFNA 3L2OB 1O03A 3EDYA 1PR3A 4RTNA 3A3PA 4B80A 3NAQA 2JHFA 2R6JA 4F9TA 2F8LA 3AP3A 4O59O 5E7IA 3VR6D 1HTBA 1X8XA 1W0KA 1XD2A 1ECCA 3QFSA 3DT8A 3P9SA 2PKYX 2H4WA 1I6WA 4GKVA 4RF2A 3R8XA 4PYKA 1Z18A 2C42A 3B5IA 4BB9A 4J76A 2DHCA 1E2FA 3ZTTA 3DXZA 4KAFA 1UAAA 1FCJA 4GR4A 4IG9A 4MR9A 2YL2A 3MOSA 3KPYA 1V3UA 4ZOLB 5EYPA 3OKPA 1RI4A 3UV7A 2JKYA 2GPTA 1IN8A 4JB0A 1U8UA 5BO5A 4DSOA 1MB3A 3JQAB 2OZLB 3WIEA 1GGEA 3PWTA 1T0JB 3CB2A 4G0YA 2J3LA 3BAFA 1USVA 2Q3BA 3HMQA 3GOQA 1E1RA 1IEQA 3D59A 1U9ZA 2Y4OA 3FLAA 3O4JA 4KRYA 3FCYA 2ZXUA 3C6MA 4NZOA 4D9GA 2HK7A 3UMFA 1UPCA 3IO5A 5BN3B 3WX0A 1HGXA 4CV1A 1S9HA 3G79A 5EEGA 2JA1A 3EISA 3KQUA 4PTZA 4BFXA 1E6UA 3G49A 4V0MA 5ADVA 2PYDA 1TEVA 3GAZA 4F92B 3PDHA 5HMLA 5BQ5A 3CX4A 1MORA 5AWFC 2JH8A 2VXBA 1M2NA 2G17A 2TECE 4LGCA 4S2EA 2IXAA 3FJ1A 4CQLA 1RJGA 2JIOA 1DAGA 1CNFA 4ZK6A 3SQDA 5HW0A 1TMOA 2QUBA 2Q3DA 4EW3A 4LBYA 4TMZA 3TJRA 1TMKA 2ECQA 3JD1A 3OD5A 4LN1A 3EHEA 1N57A 1NDHA 2ZUVA 2H06A 4J0GA 1F1BA 4TT3A 2QV7A 3WP1B 2FYTA 1B7GO 3ZY2A 5E6SB 3ZJTA 4HFMA 3F6RA 2YYYA 2RSLA 1W4LA 4OIMA 4LF7B 4OGWA 4Q4AA 4UNQA 3BMQB 1E79D 3D8RA 3N7AA 1DQNA 4IJKA 5ELMA 3T7SA 3TM5A 2NTJA 2YH2A 4RJKA 4X24A 1GLNA 1WDMA 1R0WA 5HE9A 2EBWA 4CPDA 3CIOA 1HYHA 2CV0A 3ZLUA 4EYGA 1Y1RA 4DIKA 1YQDA 3ESRA 1H8HD 3KPUA 2A3RA 3DEZA 1H2ZA 4MB2A 2VTEA 3N70A 4N48A 4YAIA 5E7QA 3R20A 1ONNA 3H2JA 3TW6A 1UEXC 4F8YA 1JAYA 2OP1A 3KO8A 1J8DA 1YQUA 2IYXA 4GPD1 1DPGA 5EWMA 3C8UA 1OYYA 4Y0AA 2B7CA 2P1ZA 2G82A 4OF4A 1XC7A 1R6XA 4M49A 4HPXB 2W98A 4PHGA 3PL1A 4O25A 2AEMA 2HDNB 5H59A 3HVJA 4D74A 5L9AA 4DDHA 4TLLB 5I5GA 2VDJA 3MJVA 2H5EA 4MQMA 4CE6A 4JNGA 5AH0A 3NHJA 1SVKA 1SU8A 5KKAA 3UMVA 2GEBA 3WBJA 1L5VA 1MQSA 4MEBA 4B32A 1TUEA 1GFSA 1HNZB 4PVDA 5L51A 1WVMA 4UUPA 3QMWA 3H4IA 5LQCA 3GJXC 1VG1A 5HP4A 3PRHA 3JYQA 2DWOA 1GSHA 1Z0ZA 3N74A 4OH1A 1FMFA 3KOYA 1PK9A 1VHLA 2V7TA 4BO1A 4DEYA 1VGQA 1OY1A 3F4KA 2VPWA 2O8NA 2BH2A 4INOA 1JB1A 4K26A 4RIEA 4W1SA 4A8PA 4C0LA 2NSLA 1CVLA 2E48A 3A6LA 4JBIA 3WTCA 1FC0A 3EBOA 4IIXA 2HHLA 3AVTA 5KYWB 1K6MA 3KYDA 1R2QA 3LCUA 1N1EA 1YFLA 3AUJB 2FX2A 5B36A 1N1MA 1U3UA 3CR3C 2PGOA 4G89A 1V7ZA 1CYDA 3AY0A 4MR8A 4RZIA 2IU6A 3TF5A 3O90A 5I8ZA 4MZXA 5CRIA 1SIUA 1NASA 2Q5QA 1T5DX 1X2EA 2CBGA 3KV1A 4IGEA 3GK3A 2W8ZA 5KTMA 1Q1NA 3P0IA 4LHEA 3O73A 1SU7A 4E33A 2Q0HA 2VSNA 3ELDA 1CS4C 1V7PC 4N5DA 1QYVA 3GLHE 2X0JA 2EKDA 1LH0A 3HS3A 4EFNA 1FRQA 2EFGA 5DYTA 4ARVA 3U16A 2VRCD 2PLNA 1XOIA 1E2MA 2YJTD 4CQJA 5SICE 3VZPA 1GO2A 3JPWA 5CH8A 3X1YA 4O08A 1PD0A 5G0WA 4BKRA 4UFNA 5CVCA 3ICWA 1A7JA 3IT2A 4RSRA 2G1JA 3LCVB 4D41A 4D8UA 2GZ3A 4WCVA 5I4BA 3F3MA 3E35A 5JZMA 2LW7A 4FGWA 3TAHA 5FBKA 1QG6A 3FOEC 1F5NA 2EFYA 5IZCC 1SCJA 1Z2DA 3H5LA 2V9PA 3D8NA 4BLOA 3FCXA 1RRKA 4XH9B 1V96A 4KTTE 1KRHA 3DPIA 1KARA 2HU5A 4BZPA 3P4UA 3TMYA 3TR0A 3LBIA 3WBKA 2CFIA 2GXQA 3AZPA 3OHPA 4NHEA 4OB7A 3QKTA 3PQDA 4LHWA 1XB2A 4QGGA 4CEIA 1G20A 2X41A 4FLFA 1JI0A 4YAJA 3WYEA 1LDMA 4HLDA 4E2FA 1JEAA 4CM4A 4CM7A 5FTKA 3D8HA 4UHCA 4YYEA 1L7DA 1Q0PA 1JW9B 2PY6A 3W5IA 1QHYA 3I76A 3JWJA 4EVQA 4WVFA 1Z9BA 1JXAA 1I3NA 1QO7A 2Q8NA 1NOKA 2APJA 3ZUGA 5L3QB 2GVDC 4AXBA 5B53A 2BBOA 4PXSA 2QN6A 3HYRA 3FYCA 5LQNA 2V96A 3TXXA 2BZ0A 1DL5A 1H2XA 4EHHA 2JFGA 1ZGCA 3HKEB 1CDZA 1Q14A 1I13A 9LDBA 4I08A 4RXTA 1DBQA 5G53C 3VAAA 1L7AA 1ODFA 3WL7A 3I39X 5J4LA 4DV7B 3I72A 4U5XA 1GDTA 4D5EA 3NETA 1GZUA 4RZHA 3VQTA 4C29A 2FB9A 4M87A 2OQRA 2Z5LA 2H5LA 2J3EA 5JFOA 3ZV3A 4YXWA 4FYVA 4RGVA 1U94A 2VLBA 2JJ2A 5CJ2A 2J59A 4EKGA 4DR1B 4RKYA 2D4HA 4P82A 4E21A 5TIIA 4HWRA 3TZEA 2VPTA 4PNHA 2HA3A 3RJ5A 2I4IA 2IP4A 5B1YA 4YCDA 4BNYA 4YC7A 3DMDA 1FJGB 4DC9A 3FY4A 1S4QA 1BE8A 3BKWA 2VJOA 3MC1A 4IDEA 5JAZA 1W5SA 3GRFA 2CJYA 1TW3A 5BURA 1KSFX 1FJHA 3D1JA 3D81A 3GCDA 2I8LA 3PK0A 5AW4A 1K7EB 3I53A 2IDZA 3OZXA 3N0WA 5CK4A 3RUEA 4R8LA 3CNHA 1G21E 1KYVA 1AZLA 3OPYI 5JO9A 3DFZA 3ACBA 3ROXA 1X87A 2GRJA 2PLAA 4H6VA 4KO2S 4YAEA 4DAEA 3O3MB 3GRRA 3D0KA 3HN6A 1O2DA 4W5RA 5FH9A 2A88A 3M9LA 2PBZA 2JL1A 1TM2A 2QRKA 4MW4A 5HZGA 3PUVA 5AFSA 3HDVA 2ZRDA 4GBMA 3WRYA 4NL4H 4OMUA 2IZ7A 1ORIA 2GZDA 4QUGA 2H63A 4E30A 1ESNA 2NAPA 4EKNB 3NHAA 5H3LA 2AA3A 4Y7CA 1LNZA 4BMDA 3VR4H 5JVDF 3AI2A 4ID9A 5J3JA 3MOGA 4G25A 1QB8A 1TC1A 3KNZA 2PYZA 3QITA 4Z49A 3LY7A 1A9PA 3ZDAA 3EXHB 1CJTC 5A4IS 2CLKB 2FWNA 2ZUBA 3KQSA 4OI2A 3T5CA 1A5SB 3I6BA 3DM9B 2CJWB 5MDHA 1NAHA 4IKOA 1GGFA 3CUYA 4YRPA 1GL6A 3C85A 2R11A 3PCXA 1T0PA 1F2DA 1T2UA 3FLEA 4WFJA 5AW7A 3EAGA 4DV0B 1YFZA 3BSYA 2QMHA 5SY9A 2PAAA 4DJ5X 3DUWA 3QKUA 1OASA 4WZBB 2GN0A 2OCAA 3BGIA 3KHKA 1BWQA 2PSDA 3WKEA 4BFTA 1OT5A 4PRZA 1ZHFA 5AKIA 4KH1A 3Q2KA 1U7WA 1WKVA 4G4GA 4G0MA 1HT2E 1WDLA 2VJQA 4EAQA 1FFCA 1UKZA 4ZOBA 4BNDB 4QKQA 1U2DA 4JK3A 1VFNA 4MSUA 1XF1A 1OZFA 4UM8B 2RJOA 5FXMA 4R3UC 1MTOA 2WWWA 4UHDA 4D7AA 2HMUA 3GEIA 2J48A 2UXBB 4DR6B 1Q7RA 2O2XA 2XOXA 3BMCA 3BWXA 3P7MA 2Q4RA 4HADA 2W8BB 1ZWKA 9ABPA 1D09A 3I45A 5CDTA 3ZCSA 3I04M 4CR7A 3ZWNA 3QU4A 3RYCA 1WCIB 3C5EA 3VSCA 3GFVA 4LFBB 4EMUA 4RFSB 5G0VA 3V4VB 2ZBPA 4A2QA 3B6EA 1NRXA 3FVVA 5EMKA 2HLHA 2XEXA 1ZBDA 1DAHA 4Q7KA 3PF9A 4HKTA 4AO6A 4UBMA 1YQEA 1ZU5A 4D9HA 5KSYA 5LQDA 4L73A 1GWNA 4MV0A 1YU9A 4RH1A 2C4UA 4ZANA 4ZCTA 1XN4A 2FSPA 1AQ6A 5KBYA 4RQUA 4CW7A 2OBNA 1RTKA 1GFZA 3R9KA 2FDRA 3F71A 1Y1LA 4QFBA 1CZKA 2YJ6A 3GRPA 3SEQA 3AU9A 1X0VA 3STTA 5IH7A 4KXQA 5JJLA 1RM4A 4AUEA 4IJUA 2QUIA 1VLVA 3Q98A 4ZGWA 3BEDA 4KHZA 2IXFA 1MJGA 2JFHA 4X64B 3A3YA 3MN1A 1P61B 3L4EA 3IGFA 3O8LA 3PCTA 1OQAA 3QWHA 5C31A 1RW4A 2GD0A 2WWVD 2C2MA 2IYFA 3QKSA 4CMIB 1AO3A 2FSIA 2QVYX 5F1PA 2NU8A 3W79A 3OSUA 1AKNA 5CLHA 3L1IA 5IZ4A 2BGIA 3MS2A 4O2BB 5ALEA 3NOQA 4NG4A 2OVFA 3MFYA 4PR0A 2VCEA 4FUTA 4G1CA 5TY0A 3LQRA 1FTGA 4ZDWA 4EPTA 4LYAA 1MIOA 2QN1A 3DEYX 3LK7A 4FKMA 1H6BA 2RHWA 3IP7A 2OGUA 3TQFA 1EWYA 5HDBB 1D6JA 3W5BA 2VHJA 2OCGA 3AV0B 3RFFA 1VE6A 2BLNA 5DHTA 1XU7A 2ZYHA 1U1GA 4FNOA 4XX0B 5IC4A 1PJ8A 4LXGA 4UHKA 4KK4A 1R0RE 2FJPA 3QYFA 4CM9D 4DRXA 1EMDA 3ETNA 1M1YA 2OQVA 4GZ5A 1IBRA 2QV0A 4QOHA 1VCMA 2NSJA 4LJLA 2BMAA 3NDBB 1PIWA 2I1VB 3E22A 3T7EA 2F55A 4KXXA 2AIRA 3EG9A 3QLUC 2DFDA 4LRQA 3TOSA 5KYGA 3ZY4A 2FEAA 3OT4A 4GZ3A 1F6DA 1PTKA 4BGPA 1I1QB 1RXUA 3CH6A 4MUMA 4WK6A 5F7ZA 1EVYA 4I1VA 1P29A 1R5JA 2AZDA 1MAHA 4H3SA 2E5LB 4PFSA 4FYMA 3M4XA 4D8YA 1IFXA 1JHYA 2I4NA 3FYUC 4X1IA 5DE3A 3ZE6A 1EVKA 1GZ3A 2PZKA 2XR1A 4HEQA 2WHPB 4QG3A 3FCAA 4UZSA 2V6MA 1ZK2A 4WINA 3U5TA 4NH4A 1OV4A 1UDXA 2BGJA 2KQUA 4JASB 1G2IA 1LBQA 4I4NA 2DWQA 2HCJB 3ZJUA 1XQWA 4LKOA 2EFDB 4M1OA 4X7RA 1VCIA 2VI5A 1ODIA 4L1KA 1KC1A 1VA5A 1DUIA 2WTAA 3FTPA 4B2IA 2P2DA 1SVUA 2RDMA 2DFNA 2HRQA 4EG1A 4KDRA 1P33A 2EX1A 2X0KA 3FNFA 1F1JA 3AESB 3BZBA 3DNPA 4AX4A 3JS5A 1WL8A 3GJZA 4J7XA 2JD0A 1YRLA 1OBOA 4G24A 5DBIA 2NZWA 3SIXA 4A0SA 2IH2A 1LS6A 2OFOA 4HZUB 3TPFA 1LBTA 2G09A 4WUTA 3OX3A 1QR2A 1YI1A 4URHA 3WI7A 2CE2X 3OLZA 1ULAA 4DRYA 4MYRA 2ADFA 2K6GA 2X3FA 1WUKS 3V32A 4GFDA 1J21A 2MTBA 3RC9A 4IHJF 3STHA 5BSFA 5JO0A 1VM6A 1T6YA 1NBWB 1IWPB 3PHIA 4NNJA 3R7WA 4LF8B 4PX9A 2GYYA 1YZ3A 4NY1A 2IYTA 1CP2A 2CMHA 2CUTA 1PT9A 2FRDA 2HMTA 2KYRA 3LQ2A 3OD1A 3QOWA 4KBFA 2P6NA 2VG8A 5A0TA 4LC1A 2JIPA 1RAFA 4IOMA 3X2SA 1ODSA 2EYUA 4RS4A 3WNCA 4MQUA 4BAGA 2RHDA 4AKTA 4BV3A 3A2LA 3SSNA 4JP1A 1QVRA 3UJ7A 4QU5A 4C89A 2YWXA 4F84A 3H9GA 5E38A 4ZIRA 2A6PA 4TVKA 5FOVA 1VKOA 4BNZA 2WWGA 3CO5A 4MQBA 5ULLA 1H65A 5M3BA 1DJMA 3CSDA 3GLGE 1DP4A 3C8HA 1RIIA 2IL1A 5AXDA 1E6KA 2O2YA 4HQ6A 1FW6A 2Y66A 1PZXA 3D5QA 3EUFA 1R4MA 3OPVA 4OA8A 4OLJA 5GJCA 4DUGA 1YKSA 1SBYA 4PSDA 3UJDA 4E0BA 2YKGA 3QUTA 1AUPA 3HO8A 2O7VA 5IASA 1FUUA 2JZNA 4K6FA 1E7YA 3EZLA 4DLKA 5JISA 4AUKA 1XDWA 1V26A 3NVKI 3J81A 4PHTA 1ZUD1 2GPWA 3PF8A 4OUDA 3ZUPA 3MSCA 3QJYA 1TQHA 3O8OB 2VUIB 3GEPA 1V8DA 2NU9B 3QVMA 3U4GA 2FSVA 3JATA 1U7HA 3Q10A 2O48X 4OTZA 1VYVA 4UAGA 4Y9DA 5KCMA 3RWBA 2RHBA 1WU8A 1Z7WA 5KTSA 3DOUA 5AVTA 3JYLA 2IE8A 4DHEA 2X22A 1TU4A 4FDUA 4REMA 2GR9A 4J0IA 4TTVA 4E4RA 4QT0A 1Y8RB 3BGWA 4GEGA 4LF4B 3IAHA 3I1IA 5CT9A 5TARA 4B0PA 4GVXA 2ZUTA 5AJWA 3MD0A 4EB8A 2NXEA 3PD1A 4R69A 5J9FA 4DBLC 4IGAA 1JEQA 3OA0A 3THYA 4BE7B 4IDBA 1NW4A 4PG8A 1E77A 4GO1A 4PN3A 2CV2A 3ABQB 3LWDA 1R4NB 2LBPA 2O14A 3VKWA 2O2SA 1M8PA 3TLKA 2GJAA 5CG1A 3USZA 4XR9A 3BVPA 4IHJA 2PRSA 2WSYB 5JCJA 4NU6A 1CERA 4TL7A 2G83A 1SHUX 1TK2A 5TMDA 2I6XA 4WKBA 2DPMA 1QH8A 2ID7A 2I0FA 2Z6QA 4GG1A 4DC1A 2BMDA 3ZCUA 3S6JA 3B6KA 5ILOA 4MB6A 2OM2A 1G5PA 2QW0X 3O84A 4URWR 5HBRA 4XGNA 5B7PA 1HEUA 5KYXB 3V6LA 4ENVA 2NAFA 3C5VA 5JSUA 3JAKA 1QKIA 2XLCA 1T91A 3C6BA 1LF0A 3SYRA 4W5OA 2V6BA 4KREA 1H9BA 3KP1A 1DV2A 1IBCA 2XCLA 1KEZA 3OM9A 5LCXA 5HKKA 3DZJA 3JQ6A 1WMEA 3V80A 2I62A 3UJPA 2DFPA 4QDJA 1GTJ1 1D0SA 3GZ4A 3DDUA 2HXSA 2YN2A 2VCHA 5TXGA 1NLZA 3ER6A 1N3YA 1E1LA 4OK3A 1NVVR 3K3PA 1JTFA 5JCOC 4MQFA 4L75A 3FTDA 5TE9A 4JI6B 2C2GA 3MCAA 3DA8A 1DKPA 3T5MA 3IQEA 4JC8A 3ROKA 4WK4B 1YC5A 2CJPA 3OZFA 4N0PA 2CK3A 2AMFA 3ROGA 1QS0B 3V33A 2AI3A 3R6TA 3O8RA 3IAUA 3AEQA 4ARIA 3IA2A 4A4DA 2FPXA 3H65A 3OU2A 3HJAA 2BFAA 4LI0A 2A84A 3W6PA 1H6CA 4IIYA 3SR0A 2JDIA 3QWFA 1KMQA 5DVZA 1J7KA 3ZK9A 4P83A 3GLIB 1EVEA 3C87A 3CX7A 1ZIPA 1FNDA 3KJGA 2QUZA 1GQ2A 3RIMA 1NVWQ 3WLKX 3GEGA 4A6XA 3DVQX 1LUAA 3W5CA 4HBGA 4B09A 3A06A 4IOLA 4WGGA 4YPOA 3FCSB 1VL5A 1BD4A 2O6HA 1YBMA 2PPLA 1WUTA 2Z3VA 1AD2A 3DAOA 1HSOA 2NUAB 7ABPA 2ZS7A 2WYVA 5IT0A 2ZULA 5JAMA 4MYCA 3L7AA 2ZZMA 2V6GA 2H0AA 4ADSG 2A35A 1YS9A 4UUAA 1H5QA 2BEVA 2WJYA 2IEYA 3DH0A 2WQ7A 4E2XA 4E5SA 2R6R1 4WESA 2WW8A 2ZE7A 3NDPA 2AFHE 4TYPA 4YWHA 2CXTA 1AOXA 1GZ5A 4R68A 2GEDA 2CNNA 2HRDA 2P4QA 4NDNE 2P9EA 4Q3AA 4AUNA 2OCIA 3KQOA 1IUPA 4WNCA 2F1OA 3AOGA 3Q7PA 3AVOA 1LDYA 1L7MA 1FSGA 4MYSA 4ZVUA 5U1PA 1KMCA 1EK6A 2OHGA 2IY7A 3SJUA 1SK8A 4D81A 4LEIA 4B35A 1HLPA 3Q3VA 4RFLA 1Z8DA 2ETVA 2O2EA 1T1IA 1GILA 2WC1A 4K6HA 5K20A 1P7CA 4IQFA 1AHPA 1OWOA 1T6ZA 2B7LA 2ERYA 2V6IA 1HDGO 2E6UX 2GZMA 2PRYA 4JL5A 4PANA 3VDRA 4JKIA 4BMZA 2XUIA 4TTJA 1P5ZB 2QTMA 3CW8X 5FUVA 1TCAA 1PD1A 1LB1B 4EW6A 3BD8A 1BMFD 3KU1A 1Z7GA 3WY9A 1WMSA 4ZZ3A 1AKWA 2QLFA 1J07A 5ALPA 4EG6A 3NCTA 1O9GA 1Z63A 2PD4A 5JJ5A 2BFDB 4IYJA 3FNRA 4TKMA 3GMDA 4MS1B 4G5OA 1TQDA 1TAGA 2GD2A 1UKVY 1YR9A 5EJFA 4DDVA 4F45A 2QT1A 4A2CA 3WWZA 3LVRE 4DMRA 5BVHA 3DBIA 2IEDA 2GK4A 2QLJA 2ZSBA 3BSSA 3KBBA 3WRYC 1KI6A 1ZC3A 4AROA 3TEMA 2QUJA 1UXHA 2EWMA 1OMOA 3WGLA 2KMLA 2P2ZA 3LNTA 4MWGA 1B23P 3PKJA 3P2MA 5E3JA 4C06A 2OAEA 3DO6A 4W99A 5AICA 5MHTA 1UBMS 2QN7A 2ZI7A 3D2CA 2R5WA 2ZK7A 1U63A 3S81A 4PXYA 4E1AA 5JSYA 3OJFA 1GRQA 2XTJA 1P62B 1D2CA 2VYVD 2BUBA 3PJFA 2O0KA 3FPAA 3QVXA 1CUVA 4MA5A 2JBAB 1J8QA 4WD3A 2JAHA 3O94A 5HE8A 3W1WA 4B6OA 1G18A 4H27A 2G1PA 1DO0A 1YGPA 1HDRA 4Q0MA 3L7CA 4HEHA 3RSGA 2EF0A 3V2UA 2PQ6A 3U7QB 3QBEA 3PKIA 3U44A 3EZ7A 4G67A 2VRWA 3IPLA 3M6VA 4Z7OB 1S7GA 3ER9A 1OLUA 4KJXA 2OEPA 1KSHA 3U61B 1BMQA 1X2BA 3VHRA 1EHIA 1KNQA 2C2ZA 2DR2A 2X15A 5JBNA 1Y1TA 4E14A 2WV9A 4BQPA 4G5GA 3VR2D 5HKOA 2FP4B 3LM8A 1E3SA 1PU2A 3A6PC 3D6MA 4IRXA 3OAAA 1X8JA 4DG8A 3NYIA 2YHIA 2H2HA 3ES9A 3GCWA 3UHFA 3ED1A 3G8YA 3LUDA 1EJBA 2VAXA 4WN9A 4YJHB 3SZMA 1ZSNA 2YZ7A 1BC5A 1J8FA 1EQ2A 2QRUA 1U2DC 1YJXA 2ZJ5A 4BV8A 4C5AA 2G7MC 2OCLA 1QBGA 4QJ5A 4OK5A 4REQB 5JDIA 2FMKA 2COKA 2R7NA 1I33A 3AP2A 3ANLA 5DTMA 2MSDB 5FL7A 3VKFA 3VO8A 1M10A 4I55B 3ETCA 5EQTA 1YGYA 2QLMA 3NIDB 3E84A 3LWZA 4XTRA 3O93A 1LU9A 5JQWA 2QRNA 3WR5A 1OIWA 4OXQA 3BFKA 5I4CA 4LYYA 4FXOA 4WVLA 5A3JA 2VNHA 5IC6A 1WDWB 1N6LA 3HHEA 2OV8A 4AI6A 4PZCA 4RESA 4XASA 3FUVA 4LXHA 5FBQB 3T06B 2WOJA 2JEZA 4RCZA 4B31A 2BDTA 1PEKE 1ZOIA 1KQPA 4A8HA 4L2IA 3JVUA 3L8GA 4KQ1A 3ZH2A 4E22A 4TMTA 3O47A 2ZU0C 3CE6A 4JN6B 1Z6QA 4KQKA 4U6NA 2E1PA 1NSYA 2J7KA 4ZCSA 3HR4A 5T8KC 2BE9A 3B36A 2IYYA 2QTCA 3GQBA 1OC2A 1YVRA 3OM0A 3QLJA 4M54A 4ESHA 1NP6A 4X1YA 3IE1A 1TTTA 1E9VA 2W4MA 3BHMA 4DM3A 3B70A 4Q9NA 5BV2P 1CE8B 4K7JA 4NS4A 3WWEA 4ETNA 2Y0PA 1JKMA 1R3UA 4YRDA 5A62A 3FCOA 1TVCA 4JP3A 4AB1A 3DYVA 1SBTA 3MMSA 1AH2A 4EABA 3KDPA 3VV3A 1XQ6A 5C52B 4M9ZA 4XPIA 1XLVA 5BR4A 3RAFC 3WB0A 3ZDEA 2ZTVA 5U4QA 1YKFA 2BR4A 2V58A 5J5VA 1NW6A 3G89A 4ZVOA 3T0FA 4TWJA 4R98A 1BEZA 1KXZA 2IYNA 4PBRA 3M1AA 7GPBA 5K3OA 4WMLA 4UUQA 2XQIA 2AOTB 5EQFA 3S2IA 4U9HS 3PNMA 2BC9A 4RAOA 2G25A 3FYUB 2XTZA 2B20A 1JF8A 4DLVA 4UC0A 4MW7A 1QU2A 2H1IA 1AX9A 3ZIAD 1MC8A 4DJFC 1ATIA 1R0ZA 1UMBB 2BKAA 1DOZA 2YWDA 3M6WA 1GFIA 3IP9A 5H80A 4JEUA 1Q1AA 3P94A 3SMQA 1RQRA 3GVCA 3QE0A 1U81A 3RSHA 1YXMA 3I2HA 4J7AA 2DKNA 2R4UA 5H81A 4LXYA 1KEUA 1V43A 2BL4A 3D7NA 4IH4A 3B1JA 4RABA 4WGFA 4X7BA 3RWMB 1L4GA 1Z6YA 2A9QA 3I23A 1NYTA 2CFCA 2ZI4A 4YRLA 4V03A 3KAJA 2VT7A 3X1MA 3I62A 3ETJA 3IOYA 1YIAA 4RJLA 1HQKA 3WGTA 1JBQA 3E9ZA 4DDUA 1DQSA 2Z9CA 4BQFA 3STVA 4FQ5A 5JRZA 1N2CA 2FY8A 4YJGA 3ZJ5A 1VCHA 2AC2A 4JH0A 4KEAA 5IBQA 3U4DA 1E58A 3R9IA 3JAWA 4S1NA 3WDMA 5KCZA 4YRKA 2X7HA 3DVLA 4GLLA 4BBJA 5JAOA 1G1AA 1XLTA 3ZGNA 2FW7A 2Y68A 2XOKD 3RC2A 3EXIB 1Z5VA 2I2FA 3E2PA 1MAWA 1Y8QA 2RI1A 5BSUA 3DV2A 5EQDA 3CLUD 3O0TA 3BWCA 4JYMA 3H8SA 1T9BA 4OOEA 4Q18A 1HOXA 3B9RA 5ENDA 5AOBA 4B17A 2G9QA 1PT7A 4ZVMA 4DYDA 2GLXA 1CRPA 4LQDA 1XTSA 2IV7A 4D6PA 4AYWA 4S12A 1KK1A 2WUGA 3FOZA 2GM5A 1TTQB 3Q9LA 1BJRE 2ZDGA 4M9SA 4JHXA 2FPMA 3DO8A 3F3KA 1V8BA 3C3JA 4X61A 3O3NB 4UU0A 4QYMA 1D1TA 5ARCA 3TIIA 4AZSA 2VLIA 2GJ8A 2DQYA 1PFKA 3MLEA 1F0KA 2WYUA 3I5XA 1L5WA 4IGFA 1X39A 3NV7A 1U7TA 3BJMA 4PQRA 2IBTA 1X8KA 2Z1MA 2D2EA 3T3DA 2Z8YM 2EDAA 3TRKA 1JG3A 4M1KA 4N0DA 3QE3A 2QXYA 1C30A 4C2BA 5D1HA 2JLAA 3EPJA 1HLDA 1W52X 2X4DA 1S3GA 1XPJA 1V7CA 2W48A 2ZIUB 3LHFA 4OQ4A 3GVHA 3SYMA 5CLFA 4AY3A 4YR9A 1EQAA 2RAPA 1XYGA 2Z9DA 5HXAA 2FFJA 2VDWA 4I19A 3LYUA 3FBGA 4IUYA 2E55A 2A0FA 2OBXA 2Z43A 4P7GA 3VJKA 4DQUA 5ALNA 1OX4B 1P0CA 5FRDA 1P0IA 3DCYA 3P9CA 4HNRA 3T34A 2P1DA 3STYA 1Q6ZA 2MU1A 3WL8A 1ZUIA 4W82A 2H51A 3G5TA 5EKSA 2G4CA 3EPLA 1PJTA 1LDBA 1NN3A 4FMDF 3ZWVA 1G1MA 2R84A 2VHQA 3I6ZA 3TQCA 3DO5A 1AXEA 4X1KA 1MW8X 1U4SA 4Q1FA 4QSMA 1PLKA 4HAUA 4DNOA 2PX2A 2YY5A 3A27A 3NCHA 4GMGA 4QDTA 5AI6A 4ZEOA 5HIAA 1U65A 3QH4A 1M2KA 1JFFA 2BP7A 2HY7A 3MUNA 1VKRA 3PGA1 2ZANA 3R3XA 5IAJA 2C96A 2HPAA 3R5TA 1PJ4A 4FIZA 2X5XA 3FPFA 1WABA 2NACA 3I5UA 4IJ6A 4YN3A 2QQ0A 4ROSA 3HB9A 3I3SR 3RF7A 1UUFA 3DOFA 3LUJA 2JGEA 4FYIA 3OOEA 2FUG1 2YVKA 3HSKA 3T15A 2HU7A 1MMFB 4DLSA 1K3TA 4GOOD 4DIMA 2FSVC 4G37A 2OORC 2RGWA 3KB6A 3U7RA 4ILKA 1GR1A 3HEBA 3HM2A 1BDMA 4K9RA 4LF6B 1KS2A 3BGSA 4MHSA 1A82A 3FRHA 4RKEA 2YRFA 3AI3A 1A27A 2WM2A 1KFBB 3LFUA 4IMPA 2Y1EA 3HNOA 5HF5A 5IC5A 3VVMA 3OIVA 1U1IA 4E31A 1HY3A 3KEMA 5JYBA 1FLDA 2XECA 1CVRA 4F06A 4ZHSA 3QE2A 5HX7A 4U2FA 1JPUA 2G77B 3PGXA 4KB5A 1Z7YA 2B1GA 3O3CA 4BGUA 4X97A 4XE5A 4E94A 1JS1X 4BB5A 3TRDA 5C8ZA 1K0UA 4RZSA 1ISRA 1BSVA 1ZCJA 3NBZC 4PLGA 1IHPA 3R0VA 1TJPB 4O3FA 4ZZ0A 3AG6A 1SKYB 4BO7A 2QTVB 4X84A 2AFRA 4LKRA 3QF4B 4CMKA 1NF8A 1W96A 1NXPA 2HHCA 1HFJA 1XMQB 4JLBA 2H4JA 5KDDA 5LN1A 3E7PA 1ST3A 2H2GA 3H1TA 4RXMA 4XFKA 4EB6B 5DH9A 5CITA 3PE6A 1JSRA 1B26A 2BN4A 1PYDA 3NH6A 4PYMA 4RIIA 3SNKA 4OJMX 2BHSA 2BTQA 1ZSYA 5FWDA 4KIJA 2BONA 2XYQA 4IIJF 4IEIA 4R84A 2OCKA 3KCQA 2XOEA 4LHXA 4Z0NA 4H0NA 2Q1XA 1SC9A 1CF2O 1E98A 2VXCA 3K0FB 2JCVA 5JAPA 4MIYA 3ZIUA 5G0SA 4IH9A 2JHCA 4B4KA 3FVTA 1E89A 1TO1E 2XUFA 3O38A 3HSSA 4KG7A 3U4AA 4GX2A 1ZZEA 2NV6A 4UEJA 3T4XA 4S1PA 1NVAA 1P18A 1TD1A 5C35A 4P0QB 4RK5A 2VTBA 3D7MA 3PUHA 3SS7X 4HT3B 2ZKLA 3A4MA 3Q9NA 3ILVA 3G59A 4LJYA 1YZLA 4HNQA 3ZWBA 4N0QA 2PHZA 3WLPA 4JV5B 1CR1A 1R50A 2VJMA 4COOA 3EGXB 1NLYA 1I2CA 3K5HA 4JQYA 3WK8A 5BUQA 5JLJA 5HM6A 1L5LA 3TTXA 3LD9A 3T5BA 4YPFA 1EUCB 4DW8A 3P9XA 1L4BA 1ZOLA 2QX4A 3F5QA 3MM4A 4BS9A 1IU9A 1XMJA 4B7ZA 2NQ2C 3U2QA 3CNLA 4FMCF 5D3ZA 3WIVA 2OOSA 3BRCA 4YAKA 4ZC8A 1GCUA 3UTDA 5MFZA 3VR3D 5FBLB 2PZJA 5LP6B 4PYNA 4K0RA 4NVRA 3RSQA 3K96A 1PJZA 3H87A 2R85A 1W5BA 3I32A 4FT2A 3HNPA 4DCTA 2V0CA 1H4SA 1IQUA 5AK3A 4GEKA 1M8KA 1RC8A 2HEGA 3ROPA 1R16A 1YZUA 3TNYA 4AKIA 2OZEA 1Q44A 2UZIR 2ZROA 2OLJA 4PWZA 3WIDA 1J49A 4OHXA 3TQSA 1R15A 4FC6A 2IX3A 3PHGA 2GXUA 1BW9B 3ERCA 3QW4B 1E3QA 1HG1A 4WZAA 2EJCA 3E5MA 3O4GA 1QV9A 2IJGX 4OBXA 4YASA 1JHUA 2JHAA 4HDNA 1KK0A 2W2NA 3PHCA 4JGBA 3CPEA 1RHKA 4JIGA 3ZOZA 5KYUB 5LXTB