2BLLA

Apo-structure of the c-terminal decarboxylase domain of arna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
330
Chain Sequence
MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVVEHRKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN YFBG
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L- Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 128
structure length 330
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2bllA02
3DZIA 1YQXA 2D2IA 1O9BA 2VYNA 1JWBB 5I8WA 4O59O 4IDFA 1H6CA 2WYWA 1ZCJA 1E6UA 2QYSA 3D64A 4JBIA 4MVJP 1E3EA 3GEDA 4JK3A 3KLPX 1P9LA 1P45A 1TA4A 3FPLA 1ADBA 1QYCA 1KEWA 1NYTA 2O3JA 4XZ3A 1Z45A 1LDMA 2Y1FA 3UUWA 5HRUA 5IN4A 4CQMA 3MCVA 4NR0A 4O6VA 1BWSA 3MOIA 4NH4A 1QV6A 1E3WB 2GUGA 5A9SA 1I5RA 2QQ5A 2O23A 3HFGA 4WUVA 2HK7A 4HFMA 2J8ZA 3PQFA 3R3JA 3JQ8A 4ZN6A 5L9AA 3JQAA 1DPGA 4D0SA 4YAJA 5KVQA 2O3QA 1LDNA 1L7DA 2IYPA 3GVCA 1OC4A 2V6FA 3AW9A 4FN4A 1C1XA 1I2BA 2VWPA 3W6UA 3Q6IA 5TJHA 1DC6A 2DQ4A 3IUPA 3VPSA 1KVQA 2IE0A 1OZAA 3GGGA 5JDCC 4OMUA 1DIGA 1LLQA 1ZK4A 4ZQHA 3O38A 5IZCA 1YJ8A 5FI3A 4EJMA 1F14A 1NPYA 4OAQA 4Z9XA 4D41A 2DU8A 1PJSA 2YW9A 5JBIA 4RGBA 4H15A 5DBGA 3RUIA 2O3SA 8ADHA 3QVSA 2BFAA 4J4TA 3SLGA 4ILKA 3H7AA 4YJFA 4QT0A 4NBTA 4BO8A 4Q9NA 4LCJA 3H9GA 3ASUA 4L75A 4Q3DA 2YV3A 1N1EA 3QV1A 3V1TC 2GN8A 4GWKA 4R69A 4KWIA 1QXSA 1E7SA 1GZ6A 4W7IA 1HE3A 3A28A 1QLHA 5DZSA 3STHA 4XQGA 1ZBQA 5IAAA 4FR5A 2X4GA 5B4UA 3A14A 2X86A 5GY7A 4RF3A 3MJSA 3AM4A 4R9RA 4DIOA 2AMFA 1DHRA 1T2FA 4FJ0A 1LSSA 5B4TA 3HJAA 1M76A 2VYVD 4R1SA 3GR6A 4FS3A 4DMLA 3Q9UA 3ZNNA 3LC2O 1H2HA 1JAXA 2IRWA 1EK5A 4CQLA 3N7UA 1B14A 2TMGA 1D3AA 5JPIA 1V8BA 3IKTA 3ZNQA 2GR9A 4YVFA 1HYHA 4RF2A 2NVUB 1EQUA 1HYEA 1PWXA 4YJHB 4WJZA 1JKIA 1YXMA 2AEMA 3VPHA 5T8KC 3DR3A 3Q11A 3TRIA 2FR1A 4GX1A 4TRNA 3WG9A 5B4VA 3BMOA 3LF1A 4FBGA 2B35A 4CMHA 3UGKA 4YDRA 3GEGA 3K73O 1KEUA 2QZZA 4MP3A 3QWBA 3NUGA 4CM4B 1I8TA 3ZWYA 1QLJA 2AHRA 4J2HA 4E0BA 3RASA 1LDYA 1V3VA 4RVSA 3SXPA 4KDEA 1NQTA 2AQKA 1PEDA 4CM5A 1RWBA 2V6GA 4RVDA 2E6UX 2EXXA 1BXGA 1I3MA 4OH1A 3H2SA 4RZIA 1NPDA 5G0VA 1PQPA 1X0XA 3EGOA 3WS7A 1X7GA 3L07A 3NAQA 4C7JA 4E31A 3IC5A 1NBOA 3EC7A 1HZJA 2X6TA 1WPQA 4IINA 4RLSA 5JYEA 5KCZA 3KM0A 2FWMX 4LMRA 1UZLA 4IDDA 5A05A 2C07A 1SOWA 4II2A 4E2ZA 4GKVA 2R6JA 3WOHA 1PS8A 2H6EA 3RKRA 3F5QA 2BMAA 4RVUA 2SCUA 1I36A 3VVBA 3OJLA 3QW2A 3ZU2A 3UCXA 1P1HA 2GNAA 1VC2A 2PFGA 4IDAA 1DJNA 3D4OA 4FD3A 5DP2A 2VNAA 4EI2A 1EDZA 1F8FA 3MJ4A 3ONEA 4UUMA 4M86A 1DRWA 3DAGA 3I9OA 4LMPA 4BNXA 4D3DA 1FXSA 4WCDA 2EGHA 2P9GA 1EBFA 1QYDA 2P5YA 2E37A 3I4CA 3JV7A 2PA3A 4R51A 3RFXA 3RC7A 3UH1A 1MG5A 1ZXBA 2X0RA 4XQCA 5TSDA 4AJ4A 2X0IA 3I52A 4KMSA 3SJUA 2Y1DA 3PWZA 3AM3A 1DFHA 3VPFA 1ZKMA 4OQZA 2H5LA 3GLQA 1HE5A 3FI9A 1YDEA 3IKVA 1EVYA 1Y7TA 3W8FA 1H0KA 4AJJA 4YPOA 3UOGA 3W8EA 1IUKA 3D5QA 1YE3A 4BO4A 2YQ4A 2D5AA 3INGA 3TF5A 1KVTA 3FNFA 4BIIA 4B4OA 4IJUA 4D46A 4EW6A 3VPGA 4E13A 1JAYA 1HXHA 2WM3A 5BT9A 4IQ8A 5CDUA 4XKJA 3QA9A 5TNXA 2X5JO 1T1RA 3GNSA 2RBEA 2VQ3A 3F5SA 1TXGA 1EMDA 3C7DB 2Q2VA 1NNUA 3ONFA 4XRGA 3HQ4O 3TL3A 2CZCA 4YJHA 4DYVA 4D79A 3HADA 4Z3DA 3WIDA 2NU6A 1Z7BA 2YFHA 1Y5MA 4P8RA 3PTZA 2BHLA 2DAPA 2XF8A 3ZU5A 4CODB 1NQAO 4DA9A 4E5KA 5ADHA 4WASA 2HDHA 4CL3A 2QIOA 3N58A 3AUUA 3TQHA 2VYVA 1LSOA 3NGXA 1CIVA 3B70A 4A0SA 1HE4A 2CF6A 2HKIA 5DT9A 3NYWA 2YHIB 1W8DA 5TQVA 3IP3A 1NQ5A 3U3XA 4FW8A 1B16A 1LDBA 1Y9AA 4GMFA 1YRLA 2DPHA 3DZJA 3GHHA 4BNVA 4E5YA 4Y98A 1HL3A 4CM8A 4HBGA 4PRKA 4ZQBA 3B1KA 3MTJA 1E7YA 4E2WA 1V9LA 4WCFC 4XD2A 1VM6A 4NK5A 5JC1A 4W9NA 2XAAA 1H6AA 1M6HA 4WECA 4M89A 1RPNA 4E2XA 4YXFA 3JD3A 3JYQA 3HB4X 3NTOA 3DHNA 3T7EA 3TZKA 3OIFA 4BO1A 2P5UA 2VHYA 3RBVA 4DGSA 2ZATA 1P74A 3JD2A 4JNKA 5TT0A 3EAGA 3HB5X 2R00C 3GDOA 1M75A 4DTIA 1E1KA 2Y1GA 4AJPA 4BNKA 4M87A 3KOUA 4NQZA 5H83A 4YAIA 3W8DA 5G0TA 2JCYA 3AI2A 5HS6A 2C7GA 2HJRA 3AJRA 1NHWA 4HFRA 1TI7A 4FQ8A 3BAZA 5CDTA 4PLWA 1VL0A 3G79A 4KTVE 5AYVA 4O0LA 3OJOA 4BGUA 1D8AA 1G6KA 3WBBA 1OOEA 4B79A 2DBQA 2W98A 2JFGA 4DC0A 3I6IA 3GVXA 4J4BA 5TC4A 2JHGA 1SPXA 4ZQEA 4AICA 3BMNB 1SCUA 2W90A 1HYGA 1JA9A 1N9GB 1UUFA 4K9DA 1U4SA 3NT4A 3C7AA 4OM8A 1V6AA 4J6FA 3DMTA 5KJ1A 4BKPA 4UUOA 3B20A 2IZZA 4GSLA 3DHEA 2H1SA 2AQHA 4WLEA 2Z1NA 2FN7A 4A03A 4MOWA 3KO8A 2X9VA 3OJ0A 1KY5A 1J0XO 1BDBA 2QHXA 4TQGA 5IJZA 3JYPA 4J0FA 4OIMA 3PZBA 3TZ6A 3V2UA 1LSJA 3KRTA 3C3XA 3WSVA 1TVEA 2VHVA 4F6CA 3TN7A 1EBUA 2GF2A 4TROA 3JQBA 1LI4A 2OUIA 3BHMA 3VH1A 4QSMA 3CUKA 1VL8A 1VI2A 1O8CA 1I3KA 4IPTA 4K26A 3AUAA 3U0BA 2C54A 3P2OA 3ENKA 1D1SA 2CDBA 3BMQA 1L1FA 1Y5RA 1OMOA 1ULUA 4KOAA 1VJTA 4RQTA 3IDSA 1LQUA 3E5RA 1RKXA 5KJEA 3RUDA 3UCFA 1PGNA 1ISGA 1HDYA 2OXIA 5KOIA 3I9LA 2PV7A 1AN9A 1WLYA 5G0WA 1E1MA 1DB3A 2BFMA 1TT7A 2H63A 2P9EA 1R0LA 1XGKA 2I3GA 1FJHA 4NFSA 2PR2A 4ZD6A 3LT1A 3L77A 5LDHA 3CEAA 4N5LA 5CEEA 1SMKA 1P3DA 2B5VA 1DOHA 2DVMA 3KV3O 1CDOA 2JHFA 1Q0HA 4DUPA 2O3TA 3ASVA 3QIVA 1VSUA 3GY0A 4DQUA 1DIBA 2I65A 1BG6A 3K5PA 2PD4A 3DBHB 2YV1A 4A26A 1ML3A 2BELA 4FFNA 3VKUA 5AXCA 3GDFA 5KJCA 1LRKA 3H9UA 3WGGA 3AOEA 4PLTA 4CMIA 1R15A 1WXDA 3RROA 5C7LO 3GG9A 1LUAA 2DBVO 3HNPA 2A94A 2VWGA 2QW8A 1TLTA 1PJ3A 3JQ9A 3VTZA 2BFPA 5L4SA 5THQA 4BNHA 1ZK3A 3UHAA 4IGEA 2OBYA 2PGDA 3WLEA 2FPIA 1PGPA 4E5MA 3E5MA 1XSEA 1R4NA 2OP0A 3CH6A 3LDHA 4DLAA 4NIMA 5HS4A 1DDOA 2P4HX 1UXJA 1I32A 3EMKA 4WNCA 1ZO8A 2VUTA 1R0KA 4BNWA 4CR7A 1A9YA 3BMNA 2IYOA 1N9GA 5T6BA 5TT1A 5A04A 3LYLA 3V2GA 1VKNA 2ZYAA 4MVJF 1M2WA 2IZ0A 4DPKA 1HEUA 3RUFA 2IEBA 5JDIA 3ZHXA 1IPEA 3PJDA 2G5CA 5EPOA 4CM9D 4XA8A 1BMDA 2O7SA 1UXHA 2DTEA 1ZSYA 3BTUA 5BQFA 3CINA 4CLHA 2Y93A 4BNFA 1AE1A 3PDUA 3PYMA 4LK3A 5FF9A 2Q2WA 2C29D 3GN2A 4UEKA 5AXDA 5ICMA 4KTTE 1GCUA 4B4VA 2C5EA 1LLUA 4OXYA 3GT0A 3DAPA 1LNQA 3VAZA 2ILTA 5L51A 2WYUA 1I24A 3LU1A 2A35A 4PVDA 5JW6A 4CQMB 3DMYA 3L0DA 4G81A 3TNLA 1PZFA 2VUUA 4XIJA 3PIDA 2EIHA 5A9SB 1XHLA 5C5IA 1I01A 3NKLA 4NDNE 3DOJA 3IUSA 4JN6B 2B4QA 5BSHA 2HSDA 3EDMA 9LDBA 4TRRA 1VSVA 2FPPA 2FR0A 1C0LA 3RBXA 5JCJD 1ENOA 4OJNA 4WE3A 3RIHA 1ZH8A 5TIIA 1Q1NA 1T26A 4GL4A 3B6ZA 1H9AA 1C1XB 3H5AA 4EITA 3PXXA 2YDXA 4R1NA 4X54A 1KVUA 5ITWA 1H93A 3GVPA 2Y66A 4WKGA 1Q7BA 2DTXA 3LC7O 3MJCA 2WSBA 3FN4A 2O50A 3MJVA 1Z73A 3Q9NA 3WFJA 4B8WA 4YR9A 3WGZA 3ITKA 3F9IA 5IF3A 3G1TA 3W6ZA 2H9IA 4ESOA 4BGVA 1M6WA 2NTNA 3KLMX 1R4MA 2QX7A 4I1IA 1Q0LA 2ZYGA 3G0OA 1IY8A 3QJ5A 5G0SA 1IB6A 2ZTLA 2IZ1A 4YJFB 5IDQA 2QRJA 2AQ8A 5FWNA 1GL3A 1ENZA 1FDUA 4FFOA 3DONA 4E4YA 3HG7A 3GOHA 4EEXA 3WMXA 3K8ZA 5G4KB 3VH2A 1Y81A 3BA1A 5F3RA 2Z5LA 3OA2A 4GGPA 2POQX 2NQTA 3W4JA 1ADFA 5DNAA 4NFYA 2ZTMA 1EVZA 1X7DA 3ICPA 4ZGWA 1B0AA 5A5FA 3KSUA 4YTEA 1RM5A 1CF2O 2G0TA 4XJTA 4FDAA 1P31A 2O4UX 3KUXA 3LT0A 4QUKA 4RQUA 3G17A 3GQVA 4BO7A 2CUKA 4O1MA 1LX6A 1CRWG 2P4QA 2HMWA 1PIWA 4YBZA 4AJKA 3ON5A 4CQLB 5CEJA 5EMHA 1ZFNA 4PZCA 1WMAA 4EDFA 1B3RA 4RPLA 1UDCA 2WD7A 2JL1A 2YUTA 4OOFA 4WGGA 3ADOA 1OAAA 1HLDA 1YL6A 5K6AA 4YRAA 3D7LA 4I5GA 3PJEA 3KYDA 4XR4A 2NVWA 3VZPA 4BOYA 3WSWA 4FPXA 4PZDA 3H65A 4YWJA 3NX4A 4FIZA 2BRUA 1O95A 3B1JA 3BMOB 2NNLD 2O2YA 3ZHBA 2QG4A 4TVBA 4FSHA 2A92A 2ZB4A 1Y8RA 2Y67A 5HM8A 3FRJA 4GX0A 4OQYA 4BGIA 1NTOA 2X22A 4H16A 4UEJA 4TZTA 1C3VA 2I3AA 3GFGA 4LSWA 5ENDA 1BXGB 3BXXA 3L6EA 1IULA 4I5DA 5LCXA 4M49A 2D4AA 3WICA 1Q0QA 1NHGA 2QRKA 5JNLA 4CM9A 1XIVA 1UAGA 4R5MA 4HFNA 5KVVA 4MIOA 4RF4A 4BO2A 1VL6A 5TF4A 4BKUA 5L4NA 1GYRA 2PLAA 4UVDA 3PWKA 4MP8A 4DBZA 5HTOA 3ZV5A 3LT4A 3AK4A 4E6PA 1IZ0A 1KIFA 5AXAA 3WNVA 4L0QA 1PU2A 4IDCA 1UXKA 4FFMA 1J4AA 2B4RO 4QO8A 2IDZA 1JW9B 4JX8A 1O0SA 3ICCA 3GHYA 4IZHA 1T2AA 3H5RA 3WFIA 1PR3A 1A4UA 1WZEA 3ROPA 2Y05A 4ALMA 3M6IA 5I9LA 1T4DA 2JD0A 4WLFA 4BNIA 1QR6A 1QYXA 1YJQA 3MOGA 2EKQA 4OSOA 1KC3A 3QHAA 1YVEI 3JCZA 1XEAA 4NJOA 3P19A 3WX0A 1LSUA 3AOEC 1K5HA 3O4RA 2C82A 1ZEMA 5G4KA 1VRWA 4INAA 1I33A 3QVWA 4OL9A 2XOXA 2WWRA 5JO0A 2UDPA 5TRTA 2PH3A 1DBVO 2J5KA 4HADA 2P68A 3DOOA 3JQ9C 4PVCA 5KJFA 4BMSA 4D44A 3DO5A 1GY8A 1E5QA 3TPCA 3WJAA 4L4SA 5JYDA 3ZWMA 3E9MA 2GRAA 1TB4A 3C8MA 2VOEA 3ZH2A 4PLFA 3SEFA 1ISJA 1I2ZA 3JQGA 4EUHA 4IMRA 3QWFA 2Q99A 1I30A 3P2YA 4LN1A 5JFOA 3ZWAA 2QZ9A 4P38A 6LDHA 1GQ2A 3GVHA 1PGOA 1PZHA 2Y1EA 5DCWA 3GA0A 2I9PA 5JXWA 4L74A 4XEHA 1KERA 2X9GA 1E7QA 2J3IA 2WYVA 2YV2A 3PGXA 3GZ4A 5I7EA 4PG6A 3ZV6A 2HMUA 3PVZA 1ZNQO 3W4KA 5DF1A 4LCEA 3TJRA 5JY1A 2CVOA 1HF3A 1UR5A 3U49A 3S2IA 4RF5A 3IQDB 4RPHA 4J7UA 1KVRA 1DFIA 2C0CA 3SLKA 4S1VA 1XYGA 4E2YA 2XXBA 4B4WA 4BO3A 3GDGA 4ZVVA 2W2KA 3I9MA 4MINA 3QWHA 2EJVA 2Y68A 1P1IA 2NU7A 2VHZA 5COAA 5COBA 5G4LA 3TZQA 3FPCA 4CM8B 2HAEA 2E48A 3OP4A 3ZV3A 3WLFA 4IS3A 4ND3A 3NTQA 4OXKA 5BSEA 3PEFA 2FSVA 2GN4A 2VOJA 3VZQA 1QV7A 4KUHA 5JMPA 1H5QA 4ROSA 4NJMB 5EIOA 3RC1A 1VJ1A 4RCVA 4R4JA 3PWSA 1YS4A 1Y9EA 3DFZA 3TFQA 4R1TA 1FDSA 4GI2A 3MEQA 3W4IA 3KYCB 2IXAA 1EQ2A 4UREA 3ZWXA 1LLDA 5B37A 1JN0A 2EG9A 2PNFA 4NBRA 4BNZA 1BRMA 2J5RA 3HFSA 5DCUA 1W4ZA 3RQSA 4P22A 4BV8A 3R0IA 1ZSVA 2J3HA 1EE2A 1HLPA 2RCYA 3D4NA 1K6IA 4NG5A 5L40A 1QG6A 4CPDA 3NDJA 1Z74A 1PJQA 4GLOA 4JQCA 4ALKA 3IL2A 1JWAB 4C7KA 2G82A 4JBGA 3DEYX 3ZWVA 2GZ1A 4IJWA 5EN4A 1RYDA 4KZPA 5T64A 2DBRA 3VZSA 4M8SA 4MVJM 5DOVA 4AL4A 1ONPA 4A73A 1SAYA 1JDJA 1A27A 1YKFA 3PPIA 3VZRA 1T24A 3HZZA 5AQ1A 4PG7A 4YRDA 1UXIA 2DLDA 4J90A 1QYVA 1N7HA 1U5CA 2IODA 5LDGA 3PHLA 1ZMOA 1WW8A 1U4OA 2HUNA 4HNHA 2BKAA 4I08A 3RC9A 1PR9A 4DIBA 1DLIA 1A72A 2VT2A 5AOVA 3QP9A 3OQ6A 4Z0PA 4U0JA 5DBFA 4CM3A 4CUKA 4L4RA 5CPBA 2HLPA 3B1FA 4NFHA 4U5QA 2OO5A 1LC0A 5THKA 4FFPA 2GERA 3TSCA 3ZWOA 3BTOA 3GZNB 3ORFA 3VH3A 2NM0A 4W6ZA 3ZU3A 1XCBA 1W73A 2PK3A 4XJSA 2AE1A 4MVJI 1O89A 1KS9A 4Y8VA 3KSZO 2CDAA 4GH5A 4CJXA 1BXZA 1P1FA 2B69A 2I76A 3I9NA 1O6ZA 3GUYA 3D3WA 1NFQA 2J3JA 4JP2A 3TDKA 3INRA 3OH8A 4CR8A 4Z3KA 4BNLA 5HWSA 3RJ9A 4DPMA 1ZJYA 5L7WA 5CDSA 3QWAA 3GRPA 4II3A 3TOXA 4AJIA 3M1AA 4HFJA 4IDBA 4IGFA 4ZQFA 5IDWA 2VZ0A 3CKYA 3L4SO 4ND1A 1GZ4A 1NFFA 1NQOA 3BMQB 5GZ6A 1U3UA 4DQXA 1E5LA 2HO5A 4CM1A 5CAEA 4CMEA 2PY6A 4FOSA 1D4FA 1X7HA 4IMPA 3ZNOA 2PKRA 2B4TO 3H3FA 2D8AA 1B7GO 4YACA 4XR9A 1Y6JA 2FOIA 1O94A 5JC8A 2AE2A 4D3SA 3U09A 2VUSA 1DC3A 3HWRA 1ISIA 2OOSA 4Z0HO 4J9UE 4XQ9A 1Y8QA 4DC1A 3GUCA 4D45A 4PZEA 3DTTA 1G1AA 1NX6A 5KWEA 1GTMA 3UCEA 4NJMA 4AVYA 4DVJA 5JCXA 1N7GA 3AUTA 4MVJE 3OBBA 2ZJ1A 3PDJA 3UAGA 3MJTA 3SC4A 3OJEA 3FSRA 3K9QO 3KYCA 3JTMA 5EJ2A 4L9RA 5EERA 3CZMA 4G2NA 4CMIB 3A9WA 3RUCA 3T7CA 1BGVA 3FNEA 3H4VA 2PTGA 1LA2A 5F1KA 3FF4A 5IZCC 3U4IA 4Z0TA 3VDQA 3MJEA 2BF7A 1QYWA 1BW9A 4R68A 4RPGA 4BO6A 2VWQA 2NV6A 1JKJA 2NTVA 2Z95A 4WLOA 2OHXA 3CSDA 1PGQA 3HE3A 2QRLA 3GN1A 2B36A 3CE6A 2JAPA 4QXMA 1R4NB 1GUFA 1GZ3A 1DIRA 2DC1A 3OMLA 4GAEA 1XG5A 4NBUA 2DKNA 1XU9A 2CVQA 2DUWA 4Q3NA 3C85A 3K96A 1BSVA 5JAQA 2HU2A 1YDWA 2OFPA 5JAZA 3EY4A 4GX2A 4HKTA 3H9QA 2DFDA 4GMGA 4FC6A 2CF5A 4BO5A 1Z7EA 4ZHSA 3GAZA 1ULSA 1C0PA 2CVZA 4J7XA 1WAMA 2W2LD 3WGTA 4B8ZA 5IG2A 2V6BA 4DRYA 3E6AA 4YT5A 1E1LA 2O48X 1MGOA 3DL2A 4UVIA 3Q0EA 2VHXA 3IP1A 3C1TA 4H3VA 3QVTA 2Y1OA 4IQ0A 2ZQYA 4A5OA 3AOGA 3PHJA 4MJLA 2EHDA 1D7OA 1EZ4A 3FWZA 4RPKA 4RO0A 4BKOA 3S55A 2ZKLA 4B7UA 4E30A 4BQPA 4BB6A 3GZNA 3OQ1A 4R01A 5U1PA 3IMFA 2HJSA 4PLZA 2HMVA 3D3EA 3EVNA 4UVHA 3NGLA 1GYPA 2Q4EA 2JFHA 4HXYA 3RKUA 1IL0A 3D5TA 4YJDA 3C7CB 5C37A 1VPDA 1ZSNA 1JU9A 3FNHA 2G17A 4NNJA 1PSDA 4I9UA 5A1TA 3GAFA 3P5SA 4WK6A 3SBOA 3EUWA 1UP6A 3LT2A 1J6UA 3UF0A 4CLDA 4I5FA 2BI8A 1JTVA 2BGLA 2W8ZA 4ITUA 2UUOA 1S6YA 4Y6SA 2CD9A 1GCOA 5F1PA 1Q7CA 1NP3A 1U7TA 2ZTUA 4JIGA 1W6UA 5A03A 1P0FA 4IJVA 3HDJA 3PYLA 1LTHR 4MKZA 1P1KA 4F3YA 1XKQA 1H9BA 3H2ZA 3H9JA 4F6LA 1IPFA 1L7EA 4BNTA 3OICA 2BGMA 2VN8A 2HK9A 4CLRA 2IXBA 1MP0A 4EEZA 2BD0A 3JYOA 3K6JA 5KKCA 4BQRA 1R4MB 3RD5A 4LVCA 3QSGA 4DREA 4U7WA 3K2BA 2VRCD 1B8UA 1QMGA 2GD1O 3OA0A 4O63O 4RV9A 3JQCA 4AFNA 5CG1A 1M66A 2PZJA 1KC1A 4HWKA 5U9CA 1B15A 3JSAA 3PJGA 4GGOA 2RIRA 5HBRA 5A9TA 4YJGB 1BVUA 1H2BA 3ZHZA 5EL0A 4UUNA 1ONNA 5JDCA 3DBVO 4WEQA 4YAEA 1LLCA 4IDGA 1YB5A 3R6DA 3DOCA 4QTZA 1W0CA 4RVGA 1E7RA 3KBOA 3RUAA 2GLXA 3QVOA 4HUJA 3VOSA 4QECA 4NK4A 5IXYA 2WJPA 2EEZA 3RVDA 2W4QA 3AFMA 2ZTVA 1MXFA 2EGGA 4FJ2A 1R12A 3ONDA 3A1NA 1RM4A 1KYQA 1MX3A 1GEEA 1VJ0A 4B3IA 3OSUA 4XYGA 5TJ9A 2NTJA 3H3JA 1YL5A 4XX0A 3ROQA 1LDEA 1XDWA 2FZEA 1AHIA 3WTBA 3WTCA 4EJ6A 1U7HA 2WD7B 2X9NA 1ZXLA 2X5KO 3V1YA 3MTGA 3ZWNA 4CUJA 3FR7A 2AEFA 5U4QA 4IM7A 3GGOA 4J1QA 1DRVA 5TLSA 1Z6ZA 3KYDB 1LXCA 2VZ8A 4JBHA 5H82A 4E33A 1CWUA 2AEJA 3EW7A 4OHUA 2VYND 4C4OA 1GV1A 3I9JA 3COSA 4MDHA 5L4LA 1MFZA 3S2GA 3TWOA 4DPLA 1EFKA 3L9WA 3AI3A 2J5QA 4U6QA 4D7AA 2GPTA 3GRKA 3RAJA 3WXBA 1Y8RB 1PZGA 1V35A 2VTEA 1PTJA 3BHIA 4Q3CA 4RVHA 1ADGA 2HMTA 1RM0A 3QVXA 4AJEA 4NMHA 1FDVA 1E6EA 5T8KA 2EW8A 4CMAA 3PHGA 3IJRA 3RUEA 1YL7A 1MUUA 2EW2A 3JQAD 3KEOA 2ZB3A 5GZ3A 5IZ4A 1H6BA 4MVJD 1NAHA 5DBIA 1WMBA 2ZQZA 1ID1A 1U5AA 1DAOA 5JAMA 1DC5A 1ZW1A 3S8MA 5JMWA 2NWQA 3AFNA 3V2HA 1JVBA 2C20A 1PZEA 2P2SA 4JGBA 4JXKA 2ET6A 3ULKA 1A71A 1E77A 2Y1CA 4LRTB 3TL2A 2C7VA 3PGJA 4MVJG 4PG8A 4XDYA 3RUHA 3RCBA 4XQEA 4JJGA 4IBOA 4CLEA 2I67A 3PK0A 1GUZA 3WMWA 2GZ3A 4WCFB 3ZWPA 1LJ8A 4KP7A 1IOLA 4B4UA 1SB8A 4W9NC 3GMDA 4KQXA 4BO9A 1U2DA 4J3FA 4QFCA 4CL8A 4R41A 1AGNA 1OBFO 4ZU3A 2NU9A 3WWYA 9LDTA 3FTPA 1S7CA 1HZZA 2PZKA 3H6KA 3DBRA 2BLLA 3PLRA 5COQA 6ADHA 1CJCA 1R16A 4R9SA 1R66A 3R1IA 3RSHA 4E5PA 4BHTA 5KVCA 1XR3A 1SNYA 3FBGA 3PHHA 4YJGA 5A02A 3IS3A 1GPDG 1TEHA 1A7AA 4JLWA 4BKRA 3F4BA 3EVTA 1K6JA 1GQYA 4P4LA 1EUDA 1FK8A 2DTDA 2FPGA 1X0VA 3F47A 3O26A 5ILOA 1IE3A 1FDTA 1UP7A 4Q3AA 2WDZA 1BHSA 5KNLA 3DZBA 5JLAA 2BFOA 4D42A 4QO7A 1F8GA 5DCYA 3F6YA 5CHEA 1NAIA 4D43A 4I9HA 4HNGA 3JQGB 3CMMA 3S1LA 1HDOA 3D4PA 3V8BA 1UDBA 4CMKA 2OBNA 4E5NA 4AJNA 1B8VA 2FP4A 2YDYA 4FGWA 3RBZA 1PQUA 4J9VA 2XXJA 3KYBA 4R3WA 4Y9DA 3BMCB 3UW3A 1C0KA 1TT5A 3DZKA 1NVGA 3DMTC 1VLLA 4W7HA 4YYZA 4E32A 1HWYA 2NADA 2J6IA 3ZWCA 1T2DA 3LLSA 3CXRA 3JQ7A 1F06A 5H81A 5L7TA 4HP8A 1ARZA 1C0IA 1PJBA 4UUPA 1DIHA 4J4HA 1F12A 3KETA 1MXHA 1PL6A 3DZFA 3JQDA 4OKNA 3U4HA 4BNNA 3E8XA 4Z9YA 2VCYA 4YRBA 4ZA2A 1SOVA 4L8VA 3DAFA 3EYWA 3WGYA 3AM5A 4Y6RA 3K2EA 4K1LA 2EP5A 3H9EO 4YA6A 3PJFA 4KDFA 2RAFA 5KKAA 2W2KB 2EJWA 1N1GA 5J23A 3JQBC 3HUDA 3NTRA 4OXNA 4U6SA 2OMEA 3T4EA 4DLLA 4XGNA 1MC4A 2R2GA 3RWBA 4BVAA 3K30A 1PX0A 3QWIA 5ER6A 4RLHA 2OP1A 4KUEA 2X0NA 2V6MA 1ENYA 5FEUA 4UVGA 3D0OA 5ITVA 4GVXA 4RORA 1YOVB 3EZYA 4J1TA 1ZZEA 4N7RA 3ETGA 1KVSA 1CETA 3L6OO 4EJ0A 1YQGA 1NWCA 3DQPA 1P1JA 3QQPA 3ANMA 2JAHA 3EHEA 2GN9A 3PIIA 3ADPA 5AXBA 3WGQA 2HCTA 2VT3A 4DWVA 4CV2A 5EQFA 4OO3A 4TKLA 5F1OA 3E03A 4UULA 3G1UA 4BB5A 4LRSB 5EINA 4AJOA 4A2CA 3U5TA 4TKMA 2X7HA 1DXYA 3HN2A 1C14A 3WJ7A 4K6CA 4L76A 4DBVO 4BV9A 4WCFA 2B83A 3DFUA 3SVTA 1A5ZA 1PWZA 1T25A 1C1DB 4HV4A 4YAGA 3FHLA 1NM5A 3ZNPA 1XLTA 4MVJA 3PI7A 3ETEA 4AJHA 3TFOA 4XGKA 2EKPA 3JQFA 2DUUA 4CM7A 3RU9A 1CERA 2ZIZA 2PGJA 4FGSA 3WNQA 4PIVA 2EP7A 5JCJA 1UDAA 4YT2A 5F5LA 4TZKA 2R00A 1AHHA 3C24A 4U0KA 3VHRA 5C7IO 2O3UA 3A4VA 2CDCA 3OEYA 4GWGA 5G2OA 1DIAA 3ZHYA 4TRJA 4AJ1A 4J43A 4I5EA 5EQDA 5A3VA 1NVMB 1E0DA 3PP8A 4CMCA 1E3LA 4EYEA 1K6XA 5ES3A 1PS9A 3UVEA 2AA3A 1KEVA 2YHUA 4OSPA 1MV8A 1YH3A 5L3ZA 3O03A 4N5MA 4Q39A 2DT5A 5I8ZA 4ZQGA 4PCVA 3ETDA 3OEWA 4O5OA 4RL6A 2BH9A 1EK6A 2NSDA 5K9ZA 2JCXA 3X2FA 1GADO 1WZIA 5L7YA 3OJFA 1U3WA 4FOOA 1NR7A 1V0JA 2CMDA 4XB1A 3NJ4A 5CDYA 4NBVA 3FD8A 2GCGA 4WPGA 3ZN2A 4R16A 3P7MA 4J16A 4XYMA 3S2FA 4Y6PA 3RFVA 3ZGYA 4NBWA 4L73A 1D1TA 2VRBA 3NT2A 3BMCA 3D3WB 1HRDA 1YBAA 3GC6A 4ZRNA 4BO0A 3FTNA 3H8VA 1U28A 3O9ZA 4BS9A 4CV0A 5A06A 4IXWA 5JDIC 5TGDA 4FB5A 4M1QA 4MPDA 1OC2A 4TWRA 2C5AA 4H7PA 4IJKA 1G0NA 2Q1WA 2WE7A 2PD3A 4IIUA 1Y1PA 4PG4A 2XPCA 3RC2A 3AI1A 4ZRMA 3JYLA 1PJ2A 3ANNA 1ADCA 3DB2A 2NVBA 1B26A 1ZK2A 3Q3CA 3KHUA 1LBEA 4DMMA 1A4IA 4WOKA 5BNTA 3VDRA 3E18A 1N8KA 3OIGA 1SZJG 4OYRA 1NWHA 2AXQA 1PJLA 4J1NA 4D3FA 1M67A 4ND5A 4R3NA 1AXGA 3G49A 3JD0A 4K6FA 1E7MA 1XQ6A 4FCCA 4I8XA 4J0EA 4WLVA 5ILGA 3JD4A 1E1NA 1LC3A 1MLDA 1Y8QB 2F00A 4PLHA 4CV1A 5LC1A 3E9QA 4NHEA 1YOVA 5B12A 4NI5A 4J1SA 4AJ2A 1U2GA 3D1LA 3KVOA 3LZ6A 4DL9A 3WGHA 3I23A 4EZBA 5MGBA 3OHSX 2DBZA 3BZUA 2JFFA 3WBFA 3LSYA 2RHRA 1DLJA 2X8LA 2D0IA 2JCVA 2ZCUA 3L6DA 2FMUA 3R3SA 4BNMA 4YT8A 3GNQA 2AQIA 4W99A 1LEHA 1P33A 5JO9A 5A3JA 4GQAA 3V5NA 3HDQA 3I83A 1GQQA 1EE9A 1J5PA 1P44A 1UZMA 3ZW8A 5A5EA 3UN1A 3DWFA 2Q45A 3GF4A 3O8QB 1E3WA 4QFDA 5CG2A 1ISHA 3ZZNA 2UAGA 2X5OA 1BW9B 5I9MA 2RHCA 5T5QA 4RZHA 5EESA 2NQ8A 1C1DA 2EWMA 2WMDA 5KJ6A 4TMFA 1MFPA 1SEPA 3PFWO 3VKVA 2ZB8A 1Q2XA 1E7WA 2RH4A 3NDRA 3PLNA 1HETA 1LU9A 2A9FA 2OORA 3HDYA 2JKVA 5IXSA 4MIEA 3GPIA 4E3ZA 3BHJA 4BNYA 1T1SA 1GV0A 1HDCA 3QLJA 1EFLA 3WGIA 1GUYA 1WVGA 1QSGA 3K92A 3I9KA 3UKOA 4JJFA 5L53A 2AG8A 3ZDFA 4G65A 1K0UA 1YBVA 1YB4A 2CFCA 3I6QA 3GEMA 3PYXA 1PJCA 4URFA 1WDLA 5F21A 5I9NA 1KEPA 3DTYA 4JCOA 4N18A 5F5NA 4CLXA 2Q50A 4MVJH 1DAPA 5IDYA 3ST7A 2GZ2A 3ZWBA 3ROKA 4XRRA 2LDBA 3FBTA 4ND2A 4TRMA 2AW5A 4Q3EA 4CLOB 5K6AC 3M1LA 3EZLA 3HDHA 3IJPA 3WDSA 4G5HA 3ITDA 4ID9A 3PFFA 4GX5A 1SEVA 2O2SA 1H94A 5ER9A 4CMJA 2GASA 4W82A 3FR8A 2YJZA 4LW8A 3TZHA 2C59A 5JE8A 3M2TA 1XU7A 1ZJZA 1F17A 1KOLA 3TZCA 4MO2A 4NU6A 4RDIA 1XELA 1HTBA 4BL5A 3WQRA 1IZ9A 3OM9A 2I66A 4FFLA 3AY3A 4XGIA 2NVUA 2VTDA 3NEPX 7ADHA 1GR0A 1SB9A 1YONA 1F0YA 4PG5A 3ROMA 4WEOA 1DO8A 1CQIA 4IY1A 3PRJA 4PRLA 2VWHA 2EKLA 3VPXA 3WYBA 3T4XA 1V3TA 1JKFA 3U4DA 1WP4A 3LLVA 4CLRB 1NFRA 4ND4A 3BTSA 3JQ6A 3VC7A 4GVLA 2JD1A 1HKUA 1YO6A 2OL4A 1T4BA 2X58A 3L9XA 3GMSA 4B3JA 4CM4A 1IHYA 3WQQA 1GPJA 1HDGO 3ZU4A 3G3EA 5DULA 3IAHA 1K3TA 4JP3A 4F46A 1SO8A 5JAIA 4W4TA 4ZJUA 5HA5A 3HSKA 2WTBA 2Z1MA 5JS6A 1G0OA 3FWNA 3GPDG 1UAYA 1U8FO 1I10A 4YT4A 3RU7A 1P77A 4BMNA 4DYDA 4PN3A 4IDEA 2EV9A 4MKXA 1K2WA 5IN5A 3FNGA 3O8QA 3QE3A 5BR7A 5GZ1A 5ENVA 1NVTA 4J49A 1K89A 4K28A 5BNFA 1GU7A 1XQ1A 3KTDA 2ZB7A 1Z75A 3JQFC 4CM6A 5MDHA 2EF1A 2X1HA 5IDXA 1HE2A 1PQWA 1WWKA 1UXGA 4XIYA 1I3NA 1RYEA 3A06A 3KSDO 4N5NA 2QYTA 1N2SA 2NU8A 4YAKA 2B37A 3OETA 3BIOA 3KZVA 1EVIA 3GNTA 5AVOA 2D5CA 1T2EA 3JYNA 1FMCA 1X1EA 4IS2A 2Q2QA 4P4NA 1NPTO 2Y0EA 3WQSB 1BXKA 2HRZA 2ZCVA 1RM3A 1CYDA 4KUGA 4PLPA 1B3BA 2Q1UA 2WE8A 5KIAA 5TX7A 1IYZA 4GPD1 4TVOA 4EUFA 2I99A 3Q2KA 3N74A 5CEFA 4JJIA 3GVIA 2RH8A 2GO1A 2FZWA 3UICA 4AJLA 3K31A 4S3MA 2CSUA 3I4FA 1QRRA 3L4BA 2NACA 3SX2A 2FRDA 3LK7A 4Z6KA 1NASA 2V7PA 1E3JA 4J2OA 1R0SA 5A9RA 1JQBA 4LSMA 1VE9A 1T2CA 4RPJA 1A7KA 4N54A 2HK8A 1FDWA 4DQVA 3I3OA 1EVJA 1X13A 3MZ0A 4A10A 4EBFA 4IXTA 1BDMA 4QX6A 3AWDA 3VTFA 4RVFA 3QRWA 5CFZA 3ZCXA 1E92A 1ISFA 4XWYA 1EDOA 3X2EA 1DFGA 3E82A 2JD2A 2PKQO 1AUPA 4CLOA 4PLVA 1HDRA 4IZIA 4AG3A 3AUSA 1NXQA 1N92A 3PQDA 1U9JA 2GDZA 2O3RA 4I9NA 3ANLA 3TOZA 1GDHA 4ALJA 3GG2A 2GN6A 3INTA 4CMBA 3GFBA 3F1LA 4A7PA 3CTMA 4Z9FA 3OECA 1GYQA 3I5MA 4U8GA 1XWFA 2OGUA 1MA0A 1O5IA 4TSKA 4HY3A 2P9CA 4NPCA 2ZYDA 4BGEA 2B0JA 1I0ZA 1I3LA 1ZK1A 2P91A 5DN9A 1DHTA 4CR6A 2I6TA 2Q46A 5TS3A 4M55A 1QKIA 1J49A 3ABIA 5T57A 4RDHA 1X15A 3U62A 3E48A 4JROA 3W1VA 2UYYA 4GLLA 1R37A 4XB2A 2YFQA 1DC4A 1ZVMA 1KY4A 8LDHA 3DBLB 3KEQA 1MC5A 1LRJA 3E9NA 4UAGA 2PH5A 1Q7GA 2Y99A 1HSOA 4P4GA 4B7XA 3HN7A 2PZMA 1UZNA 3KB6A 4NU5A 1CEQA 4E21A 5C3MA 2YHIA 1LDGA 2Q49A 3AU9A 3DBRB 1GFSA 1PJTA 5L95A 2CNBA 2NUAA 5DDIP 2Q4BA 5CP8A 2HRBA 1WNTA 3ZW9A 2G1UA 4DIFA 3RFTA 2HQ1A 3DDNA 2PGLA 5BSGA 1JVSA 4QEDA 3AY7A 4BNGA 1DRUA 2DM6A 2Q1TA 3PQEA 4MP6A 3F3SA 1WDKA 1EUZA 1ONOA 3ZWWA 1RJWA 4A27A 3RJ5A 5C7OO 2GYYA 4UEOA 4CUZA 2A4KA 2NLOA 2B5WA 3DC2A 1EUCA 2Q3EA 3GGPA 2VNSA 1CQJA 3JD1A 1IHXA 1GEGA 1U8XX 4B3HA 4E12A 2BI7A 5JY6A 5T67A 1ENPA 1TT5B 4LVUA 2YQ5A 4ONEA 3BTVA 3IOYA 2WEKA 3LC1O 3Q2IA 4WNIA 3JQ7B 1QORA 2CY0A 3C1AA 4NZ9A 1BTOA 1VKOA 4B7CA 3IIEA 2G76A 3CIFA 4ALNA 4ALLA 3FCOA 3EK2A 2PKQP 3VH4A 3F4LA 1I2CA 4FJ1A 1YQDA 4KWHA 3S2EA 3F46A 4QQRA 2E82A 3SJ7A 5I7FA 3U9LA 3ZV4A 4R1UA 2FHSA 2HMSA 3RI3A 3SC6A 3DZHA 4F45A 1ORRA 1P0CA 3LVFO 2ZJ0A 4XCVA 1YBMA 2LDXA 4CQMD 3NV9A 1PJ4A 4R54A 4XYEA 5FFFA 7MDHA 1UP4A 2Y0CA 5JSFA 4RJTA 2E49A 3WYCA 2W2LA 4YQYA 2D1YA 4YEDA 2WD8A 3NJ8A 2I5PO 4YB8A 1KETA 1U3TA 1ZK0A 4CV3A 5KVSA 4M54A 3AY6A 4EUEA 3ENNA 3CPSA 4FC7A 1B2LA 1LQTA 1R6DA 2D3TA 1HDXA 4BMVA 2PWZA 3GK3A 2VZ9A 5L45A 1YGYA 5I7VA 2FY8A 5DOZA 3Q1LA 2TMDA 4PFJA 1PGJA 3OIDA 4CMEC 2YYYA 1OFGA 2DFVA 5CDGA 2C2XA 3U4CA 3LQFA 4XDZA 3C1OA 3OF2A 1MG0A 2V65A 2OZPA 4DXHA 1UJMA 3ZI0A 1B8PA 3H5NA 4OGWA 2IEDA 1U3VA 3VVCA 3DZGA 3QY9A 5KTKA 1HSZA 4LISA 4BNJA 2PZLA 2GGSA 4GKBA 4BUCA 1X14A 4GBJA 1E6WA 1EEHA 3JQ8B 1HT0A 4J7CA 3JQAB 2O7QA 1ZUD1 4IIVA 3WYEA 3WIEA 2AG5A 3DBLA 1GAEO 3PZRA 4ZICA 1JLLA 4FFRA 2Q1SA 4BNUA 1N5DA 2C2YA 3OFSA 1UH5A 1AXEA 4L4XA 4BKQA 1DEHA 3E1KA 4MIYA 2J3KA 2VHWA 3JQEA 4PLCA 4IQGA 3DXFA 4UVEA 4WOJA 4PGFA 4YCAA 5BNIA 2BGKA 1H6DA 3OQBA 1V3UA 3LF2A 3M2PA 5A4DA 4CMGA 1PL7A 1SC6A 1A9ZA 1YB1A 4R5HA 1FF9A 3WGOA 4D0RA 1WDMA 3CMCO 2E4AA 5I7SA 1DSSG 3V1UA 2Y0DA 3I1JA 1DJQA 1MB4A 1E3SA 2X23A 4DLBA 4Y67A 4EGFA 2UUPA 5DP1A 1XA0A 3GH3A 5GMOA 3HHPA 2YY7A 5FYDA 2VRCA 3DBHA 1U1IA 2X0JA 1GD1O 1ZEJA 4XYLA 5IFLA 1QP8A 4PLYA 1P1RA 2EERA 2FR8A 3BYZA 3WWZA 2YZ7A 3MWEB 3CZRA 1NR1A 3NRCA 3NDIA 3PHIA 1ISMA 1KBZA 3MWDB 1OI7A 4IUYA 3WB9A 2ZK7A 3NT5A 4KQWA 3L4BC 1ZIDA 1PS0A 3UXYA 5K0ZA 1Z82A 5G0UA 3KXDA 4XYBA 4GSKA 2PD6A 4MKRA 1LRLA 1E3IA 2UVDA 1YWGO 5CPFA 4WLUA 2D59A 2UV8A 4ALIA 3AU8A 3F1KA 4PLGA 5BSFA 5ICSA 2GSDA 4LGVA 4YQZA 4HX5A 1PL8A 1ZMTA 2DPGA 3UFXA 5FI5A 3DHYA 2FSSA 5B1YA 4J91A 4WLNA 2F1KA 1SBYA 2JJYA 1BVRA 1HDZA 2O4CA 4OKIA 4OOEA 4Q3BA 3WR5A 1X1TA
chains in the Genus database with same CATH superfamily
3N6XA 3DZIA 3U4QA 2D2IA 1G8GA 5F9FA 2CVFA 3FIJA 1O9BA 4BE4A 2NP7A 3L43A 5IARA 3P52A 1E6UA 2QYSA 4IJMA 4BJ5A 4BV3A 5KQLA 2P2GA 2YN2A 2X5XA 3GEDA 1M8KA 3M4YA 2ZJBA 1Q11A 1N7JA 1H85A 2HEIA 4DABA 3MS4A 2CV2A 3K2QA 1KEWA 2R85A 3C6QA 1EWVA 1GRCA 1HFJA 2EVWX 3O0TA 4OUDA 4XTCS 3Q1KA 4XZ3A 5D86A 4JUCA 1JEEA 1Z45A 1EIZA 4YASA 1TZCA 1NY6A 2FTKE 1ONSA 5F77A 1HE1C 3TMYA 4DF3A 2D1QA 2H51A 4K0KB 4NR0A 2FN8A 3LOQA 3QPDA 1UBCA 2COKA 1E79D 4NH4A 4G0XA 1IXRC 3EVDA 3QU5A 4D25A 1I5RA 5CA1A 4L4YA 4WUVA 2JHPA 1A9XA 2J8ZA 2FSFA 3PQFA 2RKWA 4WAUA 1PFYA 1DPGA 4HWTA 4D0SA 3BWDD 1H4SA 4YAJA 4K6GA 4GOKA 3SF8A 1TYDE 2IYPA 1S3IA 2C94A 1P2UA 1PN3A 2P3SA 2AV6A 2V6FA 2XCIA 4PV7A 1CU1A 3TMAA 2QUAA 2O1SA 3BWCA 1TQDA 1WB4A 3QU7A 3WGMA 4ZZ3A 3NANA 5HVNA 2XWSA 2G9UA 3ZUPA 2PX0A 2NXCA 3Q6IA 5TJHA 4B6FA 4C88A 4FKZA 1KRWA 4EBBA 4L72A 2F9MA 2OZEA 4U9HS 3VPSA 5EHIA 1OZAA 3GGGA 4OMUA 3WLHA 1BD3A 4EK9A 1DIGA 1T5OA 1ZK4A 2OLJA 2OO7A 4E5DA 1F14A 4P7BA 4HQKA 4OAQA 2AC2A 1PFUA 1J8YF 1A4XA 3O0DA 4HLNA 5AVTA 5JBIA 1AMUA 2ZSAA 1EK0A 2O3SA 1DAHA 1KDPA 4U7TB 3TI7A 2RH5A 4FOPA 3M5PA 2JGEA 3NRBA 3WBJA 3WYFA 3JASB 1KZGB 3BGOS 4FFDA 3Q3VA 3H7AA 1ZD2P 3PUHA 2E85A 4W8OA 2JC3A 3P32A 4QT0A 2I87A 4D74A 4LCJA 3H9GA 4L75A 2OZLA 4X90A 4OBBA 5HIMA 1GZ5A 3ZWDA 2PLWA 3MJDA 2GN8A 1PG0A 2OGTA 4BMYA 3BBPA 1DADA 3UTCA 4MVYA 4QTXA 2OTCA 1ZNWA 3SIXA 1J22A 3TKAA 1L5HB 3MHPA 2C0PA 4E7OA 3HJRA 4KXNA 2F6RA 3HPQA 1BWRA 4PGGA 5F5XA 5PNTA 3D6VA 2R60A 2CL7X 4PTYA 5IAKA 4TZ0A 2AMFA 4Q1CA 3QI7A 1CY0A 1OI3A 3RJZA 1LSSA 3L8CA 2CJWB 1OFIA 3HJAA 3K1AA 4LY0A 1PI3A 4YC7A 1RT9A 1M76A 2VYVD 3EEYA 3KE9A 4R1SA 3EB9A 221PA 1N0VC 5JHHB 3MN1A 4DMLA 2B8JA 3QG5A 2C04A 1EK5A 1K3UB 5KREA 3UAVA 4AQDA 5JPIA 2VXYA 2VTBB 5EP1A 2MYUA 4MPJA 3IKTA 1G19A 3HJNA 1SIWA 2GR9A 5BWOA 1HYHA 5H80A 4PYIA 3HMKA 4JDPA 4IHAA 1GG2A 4WOCA 1YXMA 3FPHA 4EB6B 1I7DA 3ZD6A 1CQIB 5AI6A 1AGRA 3DR3A 1CUXA 2ZE7A 3IEKA 1NVXQ 1MO3A 1C4WA 4TRNA 3OD1A 4ZCQA 4ZYVA 1KZHA 3LF1A 3SM3A 3DLTA 2B35A 2IY7A 3DB1A 3TLYA 2Q3JA 5J40A 4D99A 4DTIA 4GXTA 521PA 1Z4PX 3EEBA 3ZE2B 1PJZA 2EAUA 5IW8A 1OZHA 4DAEA 1U8EA 3PC4A 2AMVA 2ENWA 4B5LA 4FINA 4BBPA 1I8TA 1IWOA 1T3GA 5EJ8A 5FTWA 3RAEC 1RBZA 1NIPA 4WT7A 1AKNA 2AHRA 2XIJA 2QVCA 3BB4A 1KYYA 1V3VA 3SXPA 1XTRA 4KDEA 4FHDA 2NZXA 2VYQA 4PR3A 4R0MA 1WOYA 2REBA 2AQKA 3LRTA 4MYDA 1QG4A 2NO6A 2EZ4A 4IOLA 3IUQA 1JEQB 1YFKA 5KHAA 2MT9A 2AD5A 3AJEA 3MGBA 4H77A 5BMVF 2F8MA 3TNDA 4PINA 4QZVA 4FBMA 3V7FA 6ABPA 3H2GA 3MF4A 4HF7A 4YO8A 1KMCA 5DCLA 1Z63A 2BFBA 2AC7A 1T36A 1U2EA 3FF1A 3Q7RA 4KX5A 2I7DA 1F1JA 4OYHA 1X7GA 2ZZMA 3FYHA 3REQB 1N33B 4A3SA 4F5DA 3PRKE 1SBHA 4RKEA 4Y2UA 4C7JA 4E31A 4M60A 1JSCA 3NP9A 5AM1A 1NBOA 4IINA 1HZJA 4V0QA 4F84A 5TV2A 2X3UA 3L6BA 1JJFA 3H42B 2PS0A 3KM0A 2O1XA 4BX0A 1NYRA 1X6VA 4X9XA 3TW6A 1OH8A 5BWCA 4ZCLA 4JKIA 3QFFA 2F3QA 4Q5IA 1SC4A 3OMXA 5J47A 3PT5A 3T9AA 1W52X 2BR5A 2IEGA 1PS8A 1H05A 1QH1B 1XA3A 1YVRA 3HEMA 5EIFA 2SCUA 3VVBA 4RESA 1P1HA 2YH2A 1T35A 2GNAA 4OK5A 4D9KA 4IDAA 4TYPA 2DR3A 2F1OA 3ORQA 3TIXB 3ZTWA 4CW7A 3DNFA 4FD3A 3I5AA 3RJTA 1Z7WA 3G2LA 4LQDA 3GUHA 2QQFA 2IS4A 2GD6A 3B3GA 4XWAA 3ICVA 2G25A 1N6RA 4U9IS 3A0UA 1P7PA 2PWAA 5F64A 2H85A 5EKDA 4H3SA 1YUMA 4DMGA 2EGHA 1V71A 2P9GA 3GB9A 3PRYA 5GPBA 2COEA 3I4CA 1THGA 3N39C 4O3FA 3FTCA 4PPYA 4R51A 3GLRA 3HP1A 3DNMA 3RFXA 3MMZA 4YJ3A 5TSDA 1Z4OA 5C5CA 3OZBA 5ALVA 1XL1A 1KZ4A 3OPNA 5LLDA 4XI9A 2AK3A 4IG9A 4MYTA 4M98A 1A04A 1U04A 1NC3A 3VPFA 1A8HA 1RQGA 1ZKMA 1H65A 3LOPA 1NOJA 4JFAA 1XL0A 2AVNA 3LBIA 1HE5A 1J5EB 4G9BA 2IHVA 4ENVA 3GFQA 4MLZA 3HVIA 3W8FA 1W1UA 5A4KA 3ZHCA 3IE0A 4YPOA 3UOGA 1RWKA 3ZKWB 2YZKA 3G1WA 4LNAA 3ZU6A 1ZINA 1G3QA 2D5AA 3KIPA 4BIIA 1NBAA 1C8KA 1QAMA 2CVHA 4Q01A 1KJQA 4Z4EA 2OHHA 1QAQA 2AIRA 4EW6A 4LJ9A 5IJ0A 3HI6A 3VPGA 5ISMA 2O5CA 2Y27A 4E13A 2JCBA 1HXHA 2E4ZA 1RBMA 3IP5A 2BUAA 2XWBF 4IQ8A 1CEYA 4O4HB 5TNXA 4R2WA 4EKDA 1N2CA 1UPXA 1T1RA 3GNSA 3UAZA 4COOA 2V55B 3A27A 3CRZA 3F5SA 4EENA 5BXYA 1A1VA 3RSLA 5J4YA 3ONFA 3IH5A 4XRGA 3OOSA 3CX6A 3WY9A 2CZCA 5HKBA 5IMSA 3UWKA 3HADA 1QRDA 2V5AA 3IB3A 2HNKA 3PFGA 3TIFA 3CHYA 3AVWA 1JIIA 1Z7BA 4IF6A 1US8B 1Y5MA 2GA8A 3PTZA 1TVMA 1QVRA 4Z0NA 4CODB 4I4IA 3TJMA 1KOGA 1I80A 2Y92A 1TW3A 1QPGA 1J1IA 2HDHA 4CL3A 5FAKA 3L8DA 2N3ZA 1K98A 3FRHA 3TQHA 1B0PA 2WUFA 1KQOA 2XMGA 2JARA 2JG3A 2WZCA 5HRCA 3KUDA 1KJWA 5J2TA 1TYEB 3MLEA 2A0WA 1W8DA 2YHIB 5TQVA 3TAUA 3HP4A 1G5FA 4YN3A 3V8RA 2HSEA 1DUVG 3M49A 2GXQA 2CXNA 3MWGA 1K7EB 1M8GA 1B16A 1OJLA 5IULC 3UMMA 1E98A 1XEXB 1IG0A 1ZY2A 3D7SA 5C1PA 2ORVA 4E5YA 1VI5A 3I62A 4Y98A 4IIXA 4PX5A 3RSZA 1FUEA 5DTJA 4TUYF 3RTAA 3S99A 2P4SA 5EIWA 3MTJA 1CQPA 5GOZA 1E7YA 3QOFA 3G0GA 1V9LA 3ACDA 3D2AA 3BWVA 5F52A 1RYYA 1VM6A 5A7GA 5BWLA 2XAAA 4HLCA 2HBRA 4D26A 2VYFA 3EIOA 5BRNA 1RI5A 1MABA 1O08A 4YXFA 2PYIA 3UFBA 2UUCB 3NTOA 1V7PC 1B1CA 2F43A 2R7LA 1SD2A 3OIFA 2OCBA 3QJYA 4A2PA 1G4UR 3EMBA 2ZIWB 5ESDA 4LKOA 5ALZA 4G4SO 1P74A 2R4UA 2ZYUX 1F2UA 1EUCB 1YZTA 3HB5X 1EIWA 1YRWA 2V5UA 3PUKA 3TLGB 4L7QA 2Y1GA 3W5JA 4ALNA 1P19A 4RVNA 4AJPA 4BNKA 4B3XA 4NQZA 2OHOA 4KXWA 2GH1A 4I1VA 2ZUVA 3KQMA 1WCIA 1QUEA 3PSHA 3QENA 2CLFB 4AWXA 3FX2A 3H1TA 1P81A 4TMYA 5DTQA 5KX5A 3RT9A 1IATA 2OBBA 3MUNA 4ZZIA 1XI2A 2WAOA 2N1MA 3AJRA 4JFRA 4HFRA 1TI7A 4Z9BA 1VHTA 4RD0A 2PQ6A 3ETHA 3BAZA 3QE4A 3G8AA 3G79A 3PPWA 1DUIA 3CVWA 3KOYA 5AYVA 4BGUA 3OJOA 3GLHE 5KO2A 3AF4A 4C6HA 3U7HB 2WTEA 1G6KA 5T4EA 4OJTA 4DLPA 4RXMA 1Q1AA 2LBPA 2JFGA 4DC0A 4J0QA 1IBLB 1LWNA 4IHKA 2Q3CA 2ODEA 4UE3S 5A5DA 2OVBA 2XR1A 4U8HA 2BWJA 2P9QA 3LCUA 3WJ1A 4ZQEA 3FCAA 4AICA 5GJBA 3LI2A 4J16C 3UG6A 3BMNB 3SZGA 1YZGA 1N9GB 1UUFA 1E2UA 3E22B 4OM8A 4JL6A 5FOTA 3DP9A 3NBZC 4X6XA 1BCSB 2WJ4A 4UHHA 5GADl 4NHOA 1QFXA 3DMTA 2QZ4A 4E14A 1KDZA 3K6SB 1T9GS 1VKZA 2OZVA 1M1NB 4GSLA 1XNHA 4UOZA 1UBNA 5I7WA 1Z0SA 2AQHA 3TBKA 1ZPDA 2BGUA 1M74A 2Z1NA 5E0OA 1VIAA 5FO0A 5M04A 3KPWA 1YNSA 4WCVA 4A03A 5HGXA 3USES 2X9VA 1WXEA 2BSAA 1UOEA 1BDBA 2QHXA 3G13A 4TQGA 1SBZA 5LB2A 4EQ6B 2C4MA 1A5SB 3ECCA 4MDEA 1MJFA 4H31A 4L4UA 3TQIA 3ZBTA 2SKCA 1SM4A 3WKCA 2OSVA 3ZY6A 3WJ2A 1SHUX 1TVEA 3W2EA 1DC8A 1G63A 4TROA 1UJCA 1IY2A 5GONF 2ORED 1UJ4A 2X76A 3BHMA 5E6UB 5LQSA 3GJ7A 4PR0A 2WT4A 4RFVA 4ZEVA 3R77A 1VI2A 1NSYA 2VDWA 3C3WA 2JFUA 1ADYA 4UNQA 4K26A 5IK2A 4G0NA 2G7ZA 1W47A 5KTRA 3AF1A 2IOFK 4U2EA 3ENKA 2O6LA 2Z3ZA 5LL6P 3RC8A 5DB4A 1OMOA 4KOEC 2ZBGA 1ULUA 1AVTA 2GEDA 3Q12A 1UKYA 5DSXA 3K20A 3E5RA 3RUDA 2GZDA 3PD1A 1PGNA 4NZNA 2IIPA 4C04A 5KOIA 2OCYC 4LFAB 5G0WA 1SVSA 1ZM7A 1PZXA 5DVZA 1JDZA 1XYVA 3B82A 2H63A 2XVZA 3QE0A 1HNXB 2ZEJA 2PR2A 1ZD1A 3P9YA 4ZD6A 1F8YA 4KKVA 2I3BA 3CX7A 3CEAA 1L5WA 5KOYA 3O2NA 3U7JA 1MRZA 1P3DA 3T52A 3B36A 3D8RA 1RRCA 2W4IA 4TKZA 2DVMA 4LRUA 1G6OA 3B6MA 5SY9A 3KV3O 1O7JA 2H65A 1CDOA 1T3TA 3SJCA 3BIJA 2XNDD 3FGZA 5IKXA 3ENWA 1MJGA 1RHQA 1VSUA 2AZ4A 1L4BA 1N5KA 2AWNA 1D5WA 2G09A 3N9IA 4KPUA 4RPIA 4GXQA 4J0DA 3UJ9A 2YV1A 3DS8A 5HKAA 5CTAA 5JVDF 4GYKA 3I9V6 1E60A 2QYOA 2B7LA 4TL7A 4CMIA 2I4TA 4RKYA 3ZDCA 5CDFE 1A96A 1WXDA 2B5OA 4R8MA 4ITVA 3RROA 4ZEMA 4UXHA 2CLHB 2HB6A 1LUAA 5GV7A 5KAMA 4RZ2A 1BD4A 2A57A 2VWGA 2A5YB 2BMEA 5ED0A 3ZDYB 1TIBA 2QW8A 1UMKA 1TLTA 1YJ5A 3UJCA 5DM1A 4DJJA 2A14A 5D84A 3MCAA 3M6VA 2CNLA 4DQLA 1SRRA 3ODPA 1P62B 5KSYA 1KFBB 4HX9A 3H13A 4IGEA 5JIBA 2V4ZA 3Q5DA 1WOMA 3KKMA 4E5MA 3T54A 4EF5A 3BK1A 4EO7A 1XSEA 3IP7A 1MQ8B 4A6EA 1XTPA 3S68A 5C34B 4EHKA 1HE8B 4B9AA 4C1NA 2IKSA 4O2BB 3BEOA 3EQZA 4JSRA 4HGYA 5CTJA 4FW9A 3L6CA 1DBIA 1REQA 2V45A 4CR7A 1A9YA 1JF8A 4DEVA 5T6BA 3G6KA 1XMPA 4TVKA 2J3EA 3R3ZA 4R9NA 3RSSA 1VKNA 4MWDA 2INGX 4BU0A 5BV2P 4EPYA 1Y6GA 4MVJF 3WDKA 1T91A 3GRUA 5KS2A 1B93A 1RWPA 4LZOA 5FB3A 4EHNA 4I8IA 1TE2A 3ZHXA 3FJ1A 3BXEA 5EPOA 1M0TA 1S2MA 3A2MA 3AESA 4H1VA 3MPUA 4CM9D 3RIMA 1BMDA 4WWHA 2GBIA 4IJQA 2X13A 1NLFA 1CHDA 2DTEA 5B7GA 1ZSYA 3HC7A 3U4QB 1T2NA 3CINA 5B58T 4EAQA 1R2QA 3DFFA 1QIJA 3I2JA 4HS9A 3QQ5A 4LYFA 4PTLA 2FOLA 4QUHA 1CJTC 1EZ1A 5ALGA 4BNFA 4M53A 3PDUA 1IG3A 5A7FA 2Q2WA 1WUHS 4GOOD 1KYVA 2MJLA 4UQLA 5AXDA 4MUHA 3RS2A 4B4VA 2C5EA 3AIOA 5ENZA 3VFDA 4UPEA 3GT0A 3M81A 2FHPA 1LNQA 3DAPA 2YJ3A 4HEJA 3VAZA 1DKQA 4KNYA 4OUDB 3QYPA 3QBDA 4YFVA 1MD9A 2PSFA 3QELA 5JW6A 3L0DA 4G81A 1OBHA 4MI9A 4CETA 2DH6A 1XVUA 2O0MA 2VUUA 3L3BA 3M6LA 2OWEA 3LDAA 2H18A 3NKLA 5I9IA 2QR3A 5CA1B 3CNNA 3IUSA 4JN6B 2B4QA 3JQQA 1Z4MA 5BSHA 3VQTA 2P4UA 4QG3A 1VSVA 2FPPA 1CUVA 1XCJA 5CT4A 3UMCA 4AM8A 3E4DA 3K9GA 1TM3E 2X5NA 2GAAA 2W8BB 1ZH8A 1OX5A 1UJ2A 3ESAA 3RKSA 3SF8B 3LLMA 3EZ7A 5TIIA 2KM1A 1OLSA 4XVUA 2NGRA 4TM7A 1G5IA 3PNPA 1INLA 2QN3A 3VYUB 4DBLE 1YR7A 5ITWA 1RU3A 1ESDA 4FFSA 4HPXB 1T9AA 2Q3BA 3FN4A 1SBNE 1QP7A 3MJVA 1Z73A 1JI0A 1Z0UA 2FPOA 4GC9A 3IAM6 1O96A 4EPRA 3WIVA 4JP8A 4MWSA 3EA0A 3HGTA 1A2QA 1K7XB 3DE1X 4MEAA 2NTNA 2QRVA 1VSBA 2OD2A 2PJDA 4U2BA 1E9DA 1Q0LA 3G0OA 2DCMA 2R6GA 3C1UA 4OK3A 5G0SA 3H4MA 1AQIA 2D5BA 2B21A 5FWNA 3P71T 4XFKA 4W5HA 1J07A 4E15A 3PEUA 2OZLB 3DONA 4I3GA 5LXTB 5IJAA 4E4YA 4NXMB 4W5JA 1Z2CA 5HKOA 1F2DA 4LGMA 1OR8A 1JZTA 1ULBA 1AB5A 3BA1A 5BYBA 3M9LA 2JLUA 1EUQA 1YRBA 1L4HA 1TD1A 1Z15A 2POQX 2QSZA 4HQ0A 5NULA 4RX1A 4NFYA 4BRZA 4E5VA 1YRAA 2EGUA 2BBTA 1AQ6A 3KWFA 3NTXA 4OCZA 3T3MB 1NW4A 1SUIA 4M46A 4NX2A 1RM5A 3KKNA 1P31A 1QHIA 1S2DA 2FWPA 1DEKA 3AV0B 1BE8A 2FRDC 4KU4A 4QUKA 2FQ1A 1ZJ6A 4RQUA 3PQ6A 3KPYA 5LQNA 2EDAA 2GJ8A 1OH6A 2FUKA 5K0TA 1DKNA 4YDQA 4CG0A 2AN9A 3ER6A 4KXMA 5D3KA 5CEJA 4PZCA 1WMAA 2PXAA 5KNCA 4EDFA 1Y7HA 2QUIA 2JL1A 2LCFA 5DXFA 2VF4X 4AUMA 3ICEA 2CYBA 2YZMA 2WZDA 3A3YA 2Q27A 1IWBB 1HLDA 1N2BA 5IT9A 2FUEA 1K7SN 4Q7MB 3AEZA 3VZPA 2ONZA 1KEZA 4XR4A 5FUWA 5LA6F 2W71A 5K8TA 4JYAB 1MOQA 3GLSA 4Q19A 3B7WA 2XH8A 1RACA 2V8BA 4FIZA 3UOWA 3T1TA 3F8WA 3U60B 4P84A 2NNLD 3WBKA 1QQ6A 2JRCA 3RF7A 3GP8A 1U80A 3PQCA 4I50A 4JLJA 1FFBA 1M0SA 3WL4A 1YZUA 4DL9A 2QG4A 3OFNA 3G23A 2A92A 4M2LA 2GFQA 3GDWA 5GM1A 3ZZTA 5KTSA 2W37A 2FDCA 4Z7JA 1XRJA 4GI7A 3WKEA 4HO1X 3BMXA 5K3CA 3H4TA 4BEVA 3THOA 4H27A 1QGDA 1XDBA 4UEJA 1C3VA 1Q7TA 3MT9A 3A4NA 1UBGA 4LSWA 4M7RA 1NXSA 5ENDA 2H7XA 1TVCA 2AR9A 5FWYB 2BFBB 1PX2A 1T36B 5LCXA 4BZQA 1NQVA 1NHGA 3NHKA 1OCEA 2CXHA 2P2DA 4AL4A 2QRKA 2NAFA 3RC3A 3ZJUA 1N2XA 1JEDA 1E2JA 1ES9A 2XCLA 3QVGB 2WJZB 4PYLA 2IY8A 3DE2X 2D3WA 3EQ9A 1XVAA 3QKRA 3TK1A 2XGMA 3U3MA 3ZGOA 1VL6A 2B94A 2JLRA 2VBCA 4FX2A 3LK6A 1GYRA 3R7FA 5ALFA 3LVQE 1ODCA 2CKDA 2RC5A 4WK0B 1QP4A 4YV7A 4EATA 2GF9A 2WUDA 4IV5A 2BDTA 1E5XA 2DY0A 1GUDA 3AK4A 2E5LB 2A88A 1JXMA 3TQQA 3KU1A 2JK0A 4UAVA 1NVFA 1U5BA 5EPEA 5REQA 4BWGA 4L0QA 1FNBA 5HFNA 2BCJQ 3L1KA 4IRMA 4FFMA 2A4MA 1J4AA 2CB0A 2PPLA 2SCUB 1J0DA 4KNVA 5H70A 3L4KA 2XNSA 3SICE 4D81A 2V0GA 2IS6A 1GAXA 3WK7A 3P0FA 2OFWA 5EC8A 1O0SA 1E4OA 3ICCA 3GHYA 3JWHA 4ZXPA 1X3LA 1KFCB 1T2AA 4FONA 1SY7A 2XRYA 4M7OA 5AT1A 4AUKA 3HWSA 5JQWA 2QSUA 1N4AA 2TYSB 3ROPA 1WZEA 1JR4A 3IBCA 2DQZA 3MWFA 5I51A 5TS2A 4ALMA 5I9LA 1L3IA 1T4DA 4WLFA 5TPWA 2IHUA 1CE8A 1F20A 2HO4A 5HK8A 2BMJA 2I4IA 2X0KA 3VZDA 4RHCA 2DH5A 3MOGA 2B4AA 3F7TA 1Y98A 4UTPA 5BQ3A 5LZ8A 1Z2EA 4RTSA 1V37A 9ATCA 5I3CA 1SKUA 1I4OA 1NYLA 5DSZA 5JNSA 1SIOA 2G28A 4MJ3A 4F5YA 5E2AA 1XEAA 1LSUA 2C95A 2HI0A 4YJ3B 3U9SA 2FFJA 1NE2A 1K5HA 1Z12A 2XDWA 1USWA 2H00A 2C82A 1VB5A 3B53X 3SNKA 4OSEA 4ISCA 4B6GA 2D8MA 2XOXA 2ATVA 2EZ8A 3CNEA 3M4XA 1X7WA 4Z8YA 2OG2A 3T5PA 1QHSA 2P68A 4TLMB 1KFJB 5ESXA 1E5QA 3O1JC 3FPJA 1ZNZA 4GZ6A 4K03A 2R8XA 4HRXA 3ZBQA 3MGAA 2ZRNA 2BTOA 4PYRA 4O25A 1TB4A 3U81A 2ZXUA 4C6TB 2VOEA 2B1IA 2C2BA 2DWCA 3HU2A 2QP4A 2YVAA 2Z2JA 1I2ZA 3JQGA 3T7SA 4IWNA 3OWXA 1WY7A 1I30A 3F5FA 3TEJA 3OLXA 1TMGE 3P2YA 5JSZA 3DV0B 5JFOA 1L7QA 2UVPB 2DQYA 4P38A 6LDHA 2H5JA 1V5EA 3DOEA 1JUDA 4I99A 4LAFA 4MIKA 5FHRA 3AJDA 5AVRA 5JXWA 2WDPA 5KMGB 4KWCA 4MARA 1KERA 3DVAA 1UCFA 4FYVA 5JI2E 4Y2SA 2WYVA 3EDQA 3D7MA 3WRYC 2YV2A 3F49S 3PGXA 4L95C 4FOTA 3PEWA 4U1RA 3AERA 3GD7A 1N2OA 1Y3HA 2A9OA 2OQRA 3INYA 4L07A 3K3PA 5CLLA 4EFKA 3W4KA 5DF1A 2A9QA 3AEUA 1PLKA 2Z2ZA 4MWZA 2KYRA 2H1RA 3BS4A 5LN1A 1HF3A 1UR5A 4BMOB 4MMXB 4OHXA 4FUTA 4M1SA 4RF5A 5CAEB 2R68A 3MMPA 4NOJA 1Y80A 2JH9A 2IPNA 4B6RA 3SLKA 1RPTA 4KQMA 4MDYA 2A3NA 3IR6A 4TYQA 1OHHD 1CB0A 5IAJA 3UAWA 1T2UA 5I5EA 3GH1A 1XEWX 4PQFA 5K05A 1CG6A 1KZ6A 1T9KA 1ZNYA 3ZG6A 2FQYA 2D0PB 3HR7A 5AI5A 4ZEOA 3NHBA 4JWTA 4I1SA 5G4LA 2P3QA 3OP4A 5D00A 3O7MA 4M36A 3WLFA 4IS3A 5HPYB 4G0QA 3OFKA 2GN4A 3PEFA 2ZRHA 3KHSA 3QF7A 4KFTA 1J23A 5EUMA 5AW9A 3ZQUA 1F2TA 4L8FA 1JSLA 2XUOA 4P3OA 1P75A 2ZT5A 4U7GA 3NI2A 1MABB 4NJMB 4EARA 4J2TA 1HNNA 1T6ZA 3BVPA 1TC2A 1ZL2A 4F1WA 3KZOA 2F43B 2XDYA 3LYHA 3RC1A 1H4QA 3EBLA 4LF7B 1SR8A 3DFZA 1ZOPA 3TFQA 4RTRA 4HTFA 4AKEA 1EZZA 1FDSA 3MEQA 3U4MA 2F62A 2GPSA 1CULC 1FP1D 1F2UB 4FMCB 3JPYA 4LOAA 3FGNA 1LLDA 4LHSA 5B37A 4X3OA 3IODA 5K3AA 3NOVA 1FDOA 1WCIB 5JTUA 4OQMA 2CJXA 2C2HA 2GKGA 1IY1A 2C92A 1EFRA 1EE2A 1MR3F 4NARA 4KRFA 3KZXA 1DT5A 1U81A 2JEZA 1V5FA 4D4HA 5BUZA 4GLOA 3VR5D 4ALKA 2D0DA 2HC9A 4O8CA 4D5EA 4M0FA 1KYWA 3IHLA 4FSXA 3UV6A 2ZWMA 1JWAB 2P3OA 4U9UA 1Z22A 4AZSA 2G3YA 4JJ7A 4B7AA 4C7KA 2ZPAA 2ODNA 3DEYX 4JMPA 4ZOAA 5EN4A 5TDHA 5FPYA 1U9IA 1YFJA 3Q10A 3FMOB 2FK8A 2DBRA 2PSSA 1RAGA 3CLUC 3EXFA 1Z5OA 5CYFA 1UEXC 2ZI5A 5LQKA 3MWYW 3HZZA 5CYGA 4IWYA 4YDHB 4DV6B 4QGHA 5DX1A 5AQ1A 2NUBA 1IAQA 1XCGB 2VJOA 1GSAA 4PG7A 4DJFC 4CQNA 2WFLB 5BYKA 5EYPA 2AX4A 2DLDA 4DDVA 4JP5A 2A3RA 2ZAYA 4QJ3A 1XTQA 3GLGB 1QYVA 2C9OA 1N7HA 1U5CA 1T9ZA 2IODA 4QYMA 3SM9A 1U4OA 2HUNA 1D2AA 1NLMA 4NL4H 4AKGA 1J8FA 2OENG 3PGVA 1Z39A 3ZQKA 4XIIA 1M73E 1YKSA 2R1TB 2VT2A 1A72A 4R9UC 2R7MA 4UQOA 4XDHA 4F8EA 5F2KA 5KYNA 4Z0PA 4Q02A 4U0JA 4CM3A 1FMTA 3AETB 5AVWA 4UE6A 2P2NA 5EWJA 3UUFA 3HV2A 4NFHA 1U0EA 3LCVB 2QDXA 4FFPA 4L7VA 3TSCA 1QGED 2W6IA 3GZNB 3ORFA 1O0CA 2NM0A 1R6TA 2PK3A 2ZI6A 1RWOA 2YMPA 4I1YA 2ZR0A 1CXZA 1PP4A 5BSRA 1FU7A 2XT9A 3X1XA 2XB4A 4MYCA 2CDAA 2P65A 4WY2A 3U7QA 2HSZA 1XV5A 1P1FA 2FMIA 2QOEA 4LTDA 3I9NA 1XKTA 1O6ZA 4KL8S 2UZ0A 3ZBPA 1WQ1R 4E1VA 3EPPA 2VDWB 1TEVA 1A5TA 4CR8A 4A15A 3RJ9A 4DPMA 5HQ3A 5K2OA 2NVOA 3I61A 5CDSA 4ZKDA 2WHPB 2Y3IA 4II3A 4KSBA 3AP3A 3H5WA 4IDBA 4IXNA 4FI3F 4IGFA 3QGMA 1S2LA 2ZS9A 4M1OA 4D0NA 2QRMA 3AJ8A 1K4KA 3COPA 5AVSA 4LXXA 1QFMA 1ZGCA 1M3SA 2RHOA 3PICA 3G0IA 1U3UA 5I5GA 1E5LA 2CV0A 4G5GA 1W0KD 5J63A 4O4LF 4DCUA 2PY6A 1BMQA 1NI3A 4IMPA 5C18A 1P5FA 1QX4A 2A84A 3ET4A 1SK9A 2HW8A 2PKRA 2YASA 3YASA 3WLMA 3ZYCA 5EAIA 1B7GO 5DGHA 2FOIA 1K63A 1O94A 4XUEA 4B8YA 3EVCA 1QHYA 1Z0ZA 1XMJA 4PC6A 5GTDA 3LX8A 3P0IA 4JASB 2VUSA 4F7DA 1Z8DA 3VAYA 2OOSA 4Z0HO 3NDPA 2IL1A 5F98A 1CZKA 1WDWB 2BEVA 1VZ2A 1Z4JA 2I1WA 4EHBA 4QC2A 3J81A 3DTTA 2C4TA 1G1AA 3TB6A 5HCIA 1NX6A 3W3AA 5A5VA 3TRJA 4DVJA 2YYAA 2IWRA 2OFOA 3L7IA 4D8VA 1N7GA 1XLWA 3AUTA 5AI9A 1ZUHA 1PR2A 3E9EA 4D80A 3HBLA 2W43A 3SC4A 4BLVA 2XI4A 1WXFA 3OJEA 4C7XA 3FSRA 5FO1A 2AX3A 3K9QO 3KV1A 3CU5A 4L9RA 5EERA 5EJ2A 5DMXA 2C2OA 3CZMA 4G2NA 4JJ6A 1WB5A 1I7LA 4CMIB 1NVBA 2WIAA 3SSNA 4ZFNA 4N39A 1EHYA 1RCUA 3BZBA 3T7CA 5CXSA 1BGVA 2PTGA 5ALHA 5KWIA 2IOQA 3RYIA 4LYYA 4IMJB 2WU0A 1M2NA 2WBLC 1T9GR 3E15A 4E46A 4I1OA 4RPGA 3WWPA 2O2IA 2NV6A 3ILSA 3LKDA 1JKJA 1LV8A 1W94A 2FEPA 3F97A 4WLOA 2GB4A 3DEKA 4MVXA 3G5MA 2OHXA 1NQUA 3B5EA 3EJ6A 4H0NA 1EG2A 2JAPA 1FS6A 5E1MA 4DCSA 1YQEA 1Y42X 5EE5B 3O90A 1QCYA 5IT5A 1OV4A 1JEAA 3R7SA 3LQ1A 3FIUA 4Q3NA 3QXJA 5DLEA 1ZMRA 1JXAA 2IVZA 2HU2A 3MNFA 4GPAA 5JAZA 3BEDA 3CCBA 3PDIA 5JJ5A 2IELA 4FC6A 4U02A 4BO5A 1Z7EA 4C3UA 4DR7B 3QLVA 3MINA 4N47A 1FQJA 5TY0A 3WWEA 2M6SA 1WAMA 2GVNA 3C3PA 4RK6A 3WGTA 4B8ZA 4CIXA 4YCSA 421PA 1MQAA 4M0CA 2G4CA 4YT5A 1OUMA 2JI7A 3SOPA 3DL2A 2R1ZA 4TXMA 1ZCZA 2G07A 3AESB 3C1TA 4DANA 4X1YA 3QVTA 3A11A 3CWZA 1S8OA 5BMVA 4KJXA 4RE6A 3R09A 1PLLA 4MJLA 3KB2A 4MQLA 4ESHA 1IXKA 3LT5A 1D7OA 3FWZA 3KSRA 1M8PA 3C6KA 2BI4A 2HUPA 1M54A 1F48A 2GFIA 3KL2A 2PSHA 4JCCA 4KMOA 3FCEA 4FT2A 4I5IA 1EJ0A 4M9UA 2FW6A 4W5RA 1C7IA 3AO0B 3LRPA 4JKOA 1E59A 2HJSA 4PLZA 3T5BA 5ALOA 4WL0A 1XTSA 3EVNA 3AR7A 4NAUA 1GYPA 4BCCA 3AVOA 4E94A 1C9JA 3KT8A 3RVLA 5K0FA 2V9ZA 4CU5A 2CGEA 2P69A 4YJDA 1GKIA 1Z08A 3FMFA 2YFYA 2XB9A 3P2IA 3G2HA 1VPDA 1ZSNA 2MMCA 2GVDC 4NNJA 1PSDA 3AR3A 1HORA 3SSMA 1JHMA 5FAXA 2FEMA 2PL5A 1ODJA 2EP8A 1SVOA 3AI7A 3E27A 3EUWA 1T4CA 2HN9A 3FXAA 1T10A 2BI8A 4AWBA 3OO1A 2GN2A 2NXJA 3R9XA 1BN7A 4ALLA 4B71A 3DTVB 4J0HA 3F2VA 1GRQA 3MBIA 1PQ4A 4XJXA 5TGTA 4ACAA 2C7BA 4M1MA 2NTYC 2C5LA 4XSHA 1DZ3A 1W6UA 4HI0E 5A03A 1DCFA 3DEHA 3DM9B 4HXGA 4ED9A 1P1KA 1H9BA 3H2ZA 3H87A 4F6LA 2OAGA 1F3LA 1L7EA 1TIKA 3RAFC 1E69A 1JHAA 1L8OA 3LOUA 1O96B 2VN8A 3OICA 4HSEA 2HK9A 4QRHA 3HBFA 3UWOA 1MP0A 2J0QA 5D3QA 2BD0A 4JLNA 1B41A 1UM8A 2QRVB 4LE1A 4B76A 5KHLB 1RHMA 5FCDA 2YC2C 4H3HB 5FBLB 3RD5A 1UIRA 3W5BA 3SKXA 3PXCX 1YR3A 3IDQA 5MN4A 3SNHA 1EXDA 3IAAA 3RBAA 3K2BA 2H1LA 3DGEC 2I6QA 3LV8A 4LJSA 1QMGA 2QAIA 3ABOB 4MULA 4RV9A 3JQCA 3HCEA 3NKVA 4AFNA 4DSNA 1TMOA 5CLGA 1KC1A 4HWKA 4D9EA 1B15A 3FOEC 2JVKA 2RIRA 5A9TA 3QF4B 1RW4A 3AUJB 3DOUA 2E1PA 2ZRQA 1H2BA 4M7PA 5J59A 1MZPA 3RK0A 4JUAA 4BMXA 3F8TA 3CPEA 1NN0A 3F8SA 4UOEA 1EAMA 3O75A 3R6DA 3G5UA 3LL7A 3WE7A 2M6KA 1VIVA 1M33A 1W0CA 1T3SA 4DRZA 1E7RA 1SUWA 1IXYA 2FPGB 3RUAA 3T0FA 4HT3B 1QE3A 4FCVA 4ENPA 2GHRA 4NK4A 4P53A 1GITA 1T3HA 1GGVA 4QECA 4TTJA 3TE7A 4BMDA 1CP3A 3G2OA 4GMKA 4EHAA 2Z98A 3AFMA 4ND6A 5AW8A 5KSWB 1GGMA 2FRXA 1U02A 4NFLA 1ZD8A 1LK5A 2Q1YA 3G2PA 1FSFA 3MS2A 3PDWA 4EG3A 3JS5A 5E4JA 1RM4A 1HOTA 4QELA 1P73A 3FFTA 3LUPA 4B3IA 3OSUA 3I34X 4PAOA 4FHCA 1FMJA 2NTJA 3H3JA 1YL5A 3OOYA 5EXXA 4P1ZA 1LDEA 2CUTA 3WTCA 1AHIA 2JFNA 5IJ9A 3BGIA 2V7GA 4FKMA 2HJHA 2X9NA 4EJ6A 4KITB 1Q15A 1GG5A 2Z5GA 3L0PA 2GHQA 3FR7A 2AEFA 4FGUA 4NCXA 3SBEA 5EJ4A 3G5TA 1HT2E 3UYKA 4ETIA 1Y0BA 5JXJA 3IT0A 4GM1A 2QRNA 4EW3A 5G53C 1Z6ZA 1LXCA 1R9MA 3MG9A 1YFLA 5DLPA 4RE5A 2AEJA 1E32A 1CZNA 4I50B 3AUKA 1Q77A 5K3FA 4YGYA 4CCYA 3THXB 3R3HA 2FGJA 3RSGA 1SCAA 4TUYA 2RMKA 1MHTA 3EYAA 6GPBA 2A0FA 5JSYA 3IPXA 4FXPA 5HILA 2LWIA 4QGGA 1MVNA 3D43A 1GQFA 1R3DA 3CN7A 3B3FA 4HXEB 4E07A 3NBYC 3WXBA 1FW6A 4RELA 1DUSA 3GFFA 4BVFA 2HMTA 4NMHA 2ZIVB 2BP7A 2IOHA 1FDVA 3CVUA 1E6EA 1JRLA 4FGKA 2ODWA 2ZIAA 3H7IA 4D8WA 1E1QA 4R2MA 1GJRA 5AM4A 2D7JA 2ZJ2A 1MPXA 4H1WA 1Q91A 5JJCA 1GLVA 2J31A 2R79A 2XE6A 2EW2A 3T9EA 2QT0A 1Z0AA 2BDUA 1AUOA 3L7BA 4B3DA 2ODPA 1H6BA 1R4ZA 1Q44A 1WMBA 4X41A 1UT5A 2ZQZA 3QKRB 3H6HA 4HQRA 5DNDA 1U5AA 1T15A 5EKXA 4B5KA 2HF2A 4QJBA 2WIKA 1KBOA 4GP9A 4ZCTA 3TECE 3AFNA 4PGAA 3O1LA 3VR5H 4BEWA 3CNOA 1JVBA 3OZFA 2P2SA 1RLIA 3GJRA 1L7RA 4KWEA 4DJAA 3X1KA 1U1FA 4LRTB 4QD3A 1U5BB 1SXQA 4P4UA 3FTFA 1PSZA 2X4DA 2Z6UA 1YBHA 2RGNA 2V3CC 3RRZA 4E09A 1VJGA 5CX1B 1ND6A 3V7UA 4JJAA 5HIKA 3PK0A 3TTXA 2JIPA 1CEEA 3C5EA 2HWWA 1CUJA 3FUCA 1LJ8A 1LY1A 2RG1A 3T9CA 3ZWPA 4F4UA 5KUTA 2HBZA 1TZKA 2C5BA 4BP1A 2FMXA 1Q1GA 1LBTA 1U2DA 3E3AA 2WW8A 5TPWB 3DW3X 3TCNA 3ESDA 1CE8B 1NF3A 2CBGA 3KKOA 3ZUGA 5JJBA 5EA2A 4BAGA 4R9VA 1S1MA 2NU9A 2XBUA 3NEJA 2RK6A 5KSZA 4C1BA 1HZZA 3EXHA 3IX7A 3D4BA 5ELXA 1TVKA 1NX9A 1FUUA 4KR0A 1WMEA 1KNXA 4G07A 4BHTA 3T8YA 3PHHA 2J3QA 4YJGA 5A02A 2O59A 4G2TA 2D4HA 3H5LA 1TEHA 3NU1A 3PNMA 5BQ5A 1TCUA 4JOSA 3ZY5A 1U7UA 3BXZA 1MX5A 3FUWA 3PD7A 5C52B 2VDUE 5FP0A 3CS3A 3SSAA 1PT6A 2GWRA 3EGWA 3TOVA 4CZ2A 4IV0A 2F9FA 2CD7A 3F47A 5GONA 2ZJ7A 4RSMA 5ILOA 1IE3A 1FDTA 1Q3HA 2VQDA 1RTTA 4L5JA 3ZGXA 5KNLA 1KI7A 4R8RA 1N2EA 4D42A 4FT4A 4K9KA 2HNAA 1A2BA 5DCYA 2Z6AA 4DLAA 4D43A 2BGTA