2BLLA

Apo-structure of the c-terminal decarboxylase domain of arna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
330
Chain Sequence
MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVVEHRKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L- Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PROTEIN YFBG
total genus 128
structure length 330
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2bllA02
1VLLA 4PG5A 5DT9A 2CDCA 3DBRB 3DHYA 2BFPA 1XIVA 1DO8A 1LDYA 3QE3A 3U62A 4GMGA 4IXWA 1HE4A 3L77A 3PDUA 3E82A 4QTZA 1W4ZA 1BHSA 4BO8A 3GVHA 4QSMA 2FRDA 4K6CA 2ZK7A 1LRLA 2B37A 2OL4A 4PGFA 3SJUA 1NR7A 2QRLA 4DXHA 2O4UX 1Q0HA 1DJQA 5U4QA 1R37A 2WJPA 1N2SA 3TZHA 1BW9B 3HQ4O 3INGA 4GX5A 3D5QA 1K6JA 1UXIA 3GRPA 4QFDA 1ZMTA 1EDOA 4CM1A 2D5AA 2OGUA 2AQHA 4Z6KA 1E1LA 4YXFA 4P4LA 1CYDA 3IC5A 1MC5A 4RQTA 4O1MA 3RKUA 4GI2A 5DBFA 4GWKA 5JY1A 3MJSA 1AGNA 2PV7A 4XYBA 3P2YA 2O3UA 1Y8RA 3DQPA 3OEWA 4IS3A 5L3ZA 2C7GA 4YAKA 1XYGA 4KUHA 5JAIA 3TJRA 1QLJA 3DB2A 4FB5A 1GYRA 2Q2VA 3HWRA 2HMUA 5CEEA 3ANLA 1ZJZA 3W8DA 1D1SA 3D3WB 3E9MA 1JVBA 4CPDA 4IQ8A 2UUOA 4AJOA 3K9QO 5EINA 3ST7A 2B4RO 1Z74A 4CM4B 2JD2A 5KNLA 4XYMA 4R68A 5CDSA 2I5PO 2OMEA 5I7VA 4IS2A 4H15A 4D44A 4TROA 3ZWOA 5JO9A 4RF2A 4CL3A 5A9SA 2ET6A 3SEFA 2B5WA 3ZWCA 5CDTA 2GN6A 1XSEA 1W8DA 4IDFA 4JGBA 5DOZA 3A9WA 1O5IA 2Y99A 2EW2A 3AWDA 1RJWA 4XD2A 4TVOA 5L40A 2EJVA 3AFNA 4OXNA 3VZSA 4AVYA 1P9LA 2DBRA 3GK3A 2ZJ0A 2Y93A 3ADOA 3EVTA 3H5NA 3F5SA 4FGWA 3DL2A 1ZXBA 1B16A 1HDGO 1I36A 1MFZA 3G1UA 3Q3CA 3ZWWA 2PWZA 3FWNA 3MJCA 4Y6SA 1JAYA 1ZXLA 1Y8QA 1KEPA 3G17A 3FNEA 1LDGA 4CV3A 3BYZA 3AUAA 1N92A 1GDHA 4CM4A 1KVSA 2GZ1A 1T2FA 2C82A 4OOFA 1RM0A 1KY5A 4Z0PA 4JJGA 4AJHA 1QYXA 1UJMA 1GV1A 3PRJA 4J1TA 3JCZA 5AVOA 3HDQA 3PHIA 3K5PA 3NTRA 3PYMA 3SC4A 1DXYA 1LEHA 3GVPA 3E48A 4LRSB 1DOHA 2C54A 1KOLA 1Y8RB 2YJZA 3TPCA 1JAXA 4XR9A 3IAHA 4YJHA 1R16A 1HZZA 4YJFB 1YBMA 1Q7GA 5ES3A 4RVUA 1PSDA 4GBJA 2BELA 4R4JA 3OP4A 1QMGA 4GLLA 1LBEA 3FRJA 2PGLA 3BTOA 2Y1FA 1YL6A 4CQMB 1U28A 4I5EA 3OA0A 1DJNA 1Y81A 4MVJP 4UAGA 2CD9A 2WEKA 3VKVA 4Q3CA 3GG9A 3EC7A 4NFSA 4PN3A 5JFOA 3HG7A 4NBRA 5U9CA 5I7FA 1M6HA 1C1XA 3DXFA 1NPDA 4TRRA 3L6EA 2J5QA 4QX6A 1C1DA 4CMEA 1VM6A 1NWHA 4XGNA 4JX8A 1C0PA 3CZMA 4R1NA 4Z0TA 3UCEA 3GUYA 1ZW1A 1EBUA 3HN2A 1O9BA 2Q2QA 2SCUA 3UXYA 4R3WA 3ASUA 3RROA 2YQ5A 3GFBA 1ENYA 1Z45A 4XQ9A 2HAEA 2RBEA 1YWGO 1I3KA 3GA0A 1WP4A 3MWDB 5IXSA 3COSA 1DIBA 3LT1A 3JYPA 2V6BA 2ZTMA 4GKBA 3OJFA 3JQ8A 3JQ9A 1AHIA 1GCOA 3EZLA 3GC6A 4JJIA 1K3TA 1BXGA 5IXYA 3UHAA 3ZHZA 2B4QA 1DFHA 2NVUB 5LCXA 3IS3A 5DULA 3G3EA 1UAYA 3BMNA 2W4QA 3CINA 3PIDA 4W4TA 2GCGA 3A06A 4WLOA 3RKRA 5HTOA 4I5FA 3SC6A 4EUFA 4CQLA 2VWGA 2FHSA 1WWKA 3W4JA 3GEMA 4PLFA 3GF4A 3QP9A 4P8RA 3PQEA 1EK6A 2O2YA 3JV7A 3RIHA 4CLOB 3T4XA 3GH3A 1Q1NA 1GTMA 4J3FA 4EUEA 1IOLA 3MTJA 4PZCA 4AICA 2GUGA 5BSEA 4BB5A 4EEZA 1PQPA 2E49A 1C0KA 3JD1A 1Y5MA 5GZ3A 3HJAA 5EQDA 4CMIB 3DAGA 5KKCA 1H2BA 1GY8A 4CR6A 3IP3A 3QQPA 1R0KA 3GEGA 1ML3A 2IRWA 5ILGA 1WW8A 1UR5A 1YE3A 4Q3BA 4R01A 3TWOA 3WR5A 4G81A 3BTVA 4HUJA 4BNTA 4XYEA 4PRLA 3H4VA 5IDYA 4N54A 1GPJA 1R4MA 2C07A 3O9ZA 4FW8A 3UAGA 2WD8A 3ZHYA 2YFHA 2X1HA 3KVOA 3QRWA 5C7OO 1LU9A 4QQRA 4WE3A 2O3RA 3MCVA 2P9CA 5JC8A 3OM9A 1PTJA 2JHGA 1U2DA 3RBZA 2C5EA 3OMLA 7ADHA 1QYCA 3BZUA 3K96A 3Q2KA 3EDMA 1YO6A 2BI8A 2A35A 4IDEA 4PLTA 3JD4A 5I8WA 2PD6A 4RPJA 4XX0A 2AE2A 5MDHA 3AOEC 3AM4A 2QIOA 2BFAA 2Q1UA 4O0LA 1UXJA 3ZU5A 2B4TO 3L9XA 1ZZEA 2HRBA 2Y0CA 3D4NA 5GZ6A 4O5OA 1A9YA 2YV1A 3D4PA 4DLAA 2D4AA 3PVZA 3ZI0A 4EITA 2EKPA 1PS9A 1TB4A 3O03A 3MWEB 4FJ2A 2NADA 3LT4A 3I3OA 2WMDA 3DZBA 1EE2A 4D79A 1CRWG 1MUUA 3H6KA 5A5EA 4RLHA 4J4HA 3FI9A 5EN4A 3PWSA 4HNGA 4Y67A 3GPDG 1E3WA 3S2IA 2BFOA 3WGYA 5ER6A 4CMBA 2IZ1A 3AUTA 2EIHA 3JQ7A 3JQFA 4NJOA 4FFRA 2NVUA 4J9UE 2HK7A 3QWIA 1Z73A 3R0IA 1DSSG 1M2WA 1I2ZA 2P5UA 2DVMA 1E5QA 3VH1A 1B26A 1WDLA 1GQQA 4LVUA 1PL8A 2ZB8A 1PR9A 2NM0A 3HDJA 4AJIA 2B69A 2Y1CA 4UEOA 3N74A 3FD8A 3ONDA 2PZMA 3KRTA 4YQZA 4E32A 4YJGA 2O4CA 3ZN2A 1LLCA 3RUDA 1YRLA 4OKIA 4DIFA 1TT5A 4KOAA 5KIAA 3GLQA 4UULA 1HSOA 4OGWA 4UVHA 1QV7A 2QRKA 1IYZA 1XEAA 4O6VA 5TC4A 2Z1NA 2Z1MA 1HLDA 2VUUA 4UEKA 1LSSA 3EK2A 3VTFA 3TZCA 4L74A 2EEZA 1C1XB 1SBYA 4GGPA 4BO2A 2IDZA 3BMQA 2DBQA 4YPOA 5L7TA 3RC9A 3Q6IA 3WGHA 2NVWA 3TFQA 3D1LA 4D41A 2POQX 2YV3A 3JQFC 4KUGA 3AU8A 4LMRA 4CV0A 4PVCA 1A4IA 2JD0A 2AG8A 3WGQA 1ZFNA 1FDWA 1EE9A 1U8XX 4GQAA 2V65A 1E7QA 2C2XA 3W6UA 2ZTVA 2GR9A 2VRCA 4MO2A 4A2CA 3R1IA 3H9UA 3FTPA 5C3MA 8ADHA 4W99A 3PGXA 1HE5A 2NTNA 4PLCA 1JKFA 4MVJF 2AA3A 1IUKA 4R1SA 1XU9A 1Q0LA 1ARZA 2YZ7A 1A5ZA 2PK3A 3OH8A 4BO1A 2DU8A 1QKIA 6ADHA 1GADO 3K30A 2VT2A 4MP8A 1E6EA 4KZPA 5KTKA 4M49A 2X8LA 4FC6A 4L4RA 4AJKA 4MVJA 3V2UA 2FPGA 1O95A 2BHLA 4J49A 2BFMA 4CR8A 4MIEA 3DHNA 5DP1A 1AXGA 1PL6A 2Y66A 4W82A 4ZRNA 4E2YA 5JW6A 1KVRA 3A4VA 2VRCD 4CM3A 4IBOA 2A4KA 4IJVA 4WLVA 4DGSA 1QP8A 4GAEA 4LISA 3QWBA 4RVFA 5I9LA 4IUYA 3U9LA 3HSKA 5A06A 1QRRA 2WSBA 2Y1EA 4N5NA 1SAYA 4LGVA 3D0OA 1HDCA 3OJEA 5IG2A 1ZKMA 1J4AA 1T2AA 3GHYA 4FJ0A 4J4BA 2C2YA 4R9SA 3UOGA 3ZCXA 2VNAA 4XWYA 4N5LA 1OMOA 1DRUA 1V8BA 2J5KA 2X0NA 4NDNE 4ZQBA 5TGDA 1G0NA 3CMMA 4H16A 1B15A 2OZPA 4YT2A 3KM0A 3LQFA 4WCFA 2XPCA 5A03A 1GZ6A 1NP3A 3BMOA 3OECA 4AG3A 1LC3A 2R6JA 3P2OA 1MXHA 4PRKA 2GGSA 1IHXA 2WD7B 2CZCA 1ISHA 1HL3A 4KMSA 5DCWA 2O3TA 4NJMB 2VOEA 1PIWA 1GAEO 3E6AA 1X7HA 1P1JA 3RJ5A 1I33A 1GFSA 2EV9A 3UF0A 3KYDB 3EVNA 2OORA 4BNIA 1CETA 2YFQA 2DKNA 4CQMD 3ASVA 2W2KA 4LN1A 3PPIA 5EJ2A 2H9IA 2OXIA 4UUNA 2V6MA 4U0JA 1PZFA 1E1MA 5A3VA 3WQQA 4E2XA 3G49A 4GLOA 3LF2A 4ZQEA 1WDKA 1UXHA 5H83A 4GL4A 4IZIA 1NVGA 3NTQA 3OEYA 1U1IA 1NFQA 1JKIA 1E3LA 5ILOA 2P5YA 4FOSA 4UUMA 4UVGA 2PKRA 5DBIA 2A94A 3W4IA 4E33A 5DN9A 3F3SA 4WNCA 2Y1OA 1NQAO 2H5LA 1H0KA 3I9LA 2ZYDA 2DC1A 3GNQA 4ALMA 1ONNA 4WUVA 4ZD6A 4AFNA 2VYVD 1ZK2A 4CMEC 1B7GO 1ONPA 4HKTA 1ADCA 5DBGA 1NPTO 3DOOA 4JP3A 3H9GA 3ZV4A 1EFKA 3K8ZA 4LRTB 2IXAA 4BNWA 1I2BA 2EWMA 4C7KA 4B7CA 4J7XA 1RM4A 3BHIA 4OYRA 2VWQA 1HRDA 2IYPA 4J6FA 1UDAA 1IZ9A 1R66A 2VTEA 1V3VA 3WMWA 4R5HA 1A27A 3JTMA 4W6ZA 2X7HA 5K9ZA 4E2WA 5TT0A 2HUNA 1RKXA 3HUDA 4GMFA 2D0IA 3JYNA 4YBZA 1SB8A 5IAAA 2Y67A 4H3VA 5I9MA 3AOEA 2AHRA 1U7TA 5FFFA 4CLHA 4WLEA 5ITWA 3CTMA 4CUJA 1E1KA 1PS8A 3MJEA 3WOHA 1BMDA 3DOCA 3H9JA 4KWHA 4S1VA 1FF9A 4M89A 5T67A 3C85A 3BTSA 3KEOA 1FJHA 1CWUA 2PKQP 3G1TA 4II3A 3ZH2A 3RFTA 3ZWVA 2NVBA 5TJ9A 1UDBA 3EHEA 2UVDA 1QYVA 2PA3A 4TKLA 1NFRA 3VPHA 1P0FA 2Y68A 5CP8A 4I1IA 4M87A 3ZWBA 3JQBC 3GNSA 4B7XA 3E03A 4AJPA 4CMCA 2FR1A 1JDJA 1KEVA 1HZJA 2LDBA 2X58A 4WJZA 4MKXA 1LX6A 2CVOA 4Q39A 5HM8A 4F46A 3FR7A 4ESOA 4BGEA 4DREA 1AXEA 1O94A 3OFSA 4XYGA 3AI1A 3U49A 2XOXA 3WFIA 2GASA 3JYOA 1DLIA 3CXRA 4E30A 2OBNA 3GG2A 3RD5A 4TKMA 3RSHA 2AQKA 2CFCA 3H2SA 1HDRA 2XXBA 1E6UA 1WMAA 2HDHA 3RWBA 5THKA 1N9GB 3HN7A 3AW9A 4XGKA 3GDOA 5IN4A 1H9BA 2V6GA 1LLQA 4D0SA 3CE6A 5KJ1A 1PS0A 2WE8A 3BMQB 1BDBA 4BNUA 4DLBA 5AYVA 3M1AA 5A04A 3NT5A 6LDHA 4DC1A 1AHHA 2J3IA 3U4CA 3WFJA 1XHLA 4TSKA 3LU1A 3RC2A 2VHYA 4EJ0A 2UYYA 1V0JA 2BD0A 4AL4A 1BSVA 3IIEA 4ALNA 2JFHA 4MP6A 1X1EA 5KKAA 4D45A 2R00C 1I10A 1UZLA 4CR7A 3DMTA 4DYVA 5EL0A 1PGNA 1Z7BA 2VYVA 4DUPA 4R1TA 4OSOA 1TLTA 4RQUA 4YT8A 3ZWAA 1GR0A 3WLFA 1YB4A 4IGEA 3D5TA 2Q3EA 2W98A 3K92A 1IB6A 2ZB4A 3DTTA 3DZJA 4IDDA 4EI2A 2IZ0A 3DBVO 1I2CA 3G0OA 3UGKA 1ADBA 4NMHA 1HWYA 4CMIA 3ENNA 3FCOA 5HRUA 4RPGA 4GH5A 5BNIA 3M1LA 1ZEJA 2PZLA 1DHRA 4U6SA 4CMAA 4N18A 4EW6A 2GPTA 3A14A 2Q46A 2NACA 4FFOA 1YL5A 1EUZA 4KP7A 1GEGA 3DBLB 4ITUA 4OOEA 4IJUA 2P9EA 3H65A 4NNJA 4QXMA 5BNFA 2BRUA 3GOHA 1Y7TA 2QX7A 3U09A 1PQWA 2VYNA 5HA5A 3KYCB 4PLWA 4BNYA 3TQHA 2X9GA 4NBUA 1KBZA 4HWKA 3ZWMA 4QUKA 4RZHA 4N7RA 3H3FA 1LDEA 4AJNA 1TT7A 1KERA 4EJ6A 1PEDA 1T4BA 1WPQA 2BGKA 1D7OA 1B8VA 1EVIA 4XEHA 1EMDA 3PK0A 3LZ6A 1X0VA 3TZQA 5L53A 1LA2A 1Y9EA 4XQGA 3IL2A 1X7DA 3B6ZA 4J91A 2VZ9A 3WQSB 1X13A 4HADA 3E5MA 3LC1O 3PHGA 3B70A 3DAFA 3DFUA 1HE3A 4CLRB 4BMNA 2V6FA 5G2OA 1B8UA 7MDHA 4WECA 1ZVMA 5IJZA 2O23A 2RH8A 4NIMA 3OQBA 4Z3KA 2GN9A 1P1HA 4CUKA 5B12A 2J3HA 4PFJA 4RLSA 2EG9A 1BVRA 3ADPA 3LK7A 2B36A 4XQCA 1WZEA 2UDPA 1SZJG 4MPDA 1HKUA 5AQ1A 4YQYA 1N9GA 2HMVA 5IDWA 4E12A 3GAZA 3ZW8A 3KHUA 3PI7A 4B3HA 4JIGA 4WPGA 4NPCA 1ZO8A 1FDVA 1NQ5A 4Z9YA 5TRTA 1C3VA 4YR9A 3DFZA 5C5IA 3KB6A 3QW2A 2CUKA 4IPTA 1HDOA 4ID9A 4CM8A 2VWHA 3EGOA 4MVJD 4B3IA 1NWCA 4IDCA 1Q2XA 1V35A 2X0IA 4CM9A 3WGTA 1JTVA 2QQ5A 1ZK0A 2UV8A 4L9RA 3WGIA 2OUIA 1N8KA 3C24A 4BL5A 5KJ6A 4BO9A 1P77A 3KLMX 3CZRA 3SVTA 1U4OA 3OICA 1OBFO 4BO6A 4HBGA 4F45A 2EW8A 1BTOA 1WLYA 1UZNA 3SBOA 3UICA 2C59A 1E3SA 3OQ1A 1M67A 4XJSA 3I1JA 4FR5A 1SCUA 2F1KA 4R51A 1VKOA 2HQ1A 5G0WA 4BNZA 3DMTC 3PQFA 4BGVA 1FDTA 1ZEMA 1S6YA 4D7AA 3HDYA 5ENDA 4MVJH 4A26A 2IE0A 3JD2A 3OETA 3OSUA 3WWZA 5DCUA 5COQA 2HK9A 3I52A 3UUWA 1OI7A 2P4QA 4LK3A 3DHEA 2VYND 5FI5A 4PG4A 1PZHA 1DIRA 1VKNA 2PNFA 1YS4A 4RGBA 2I66A 3B1KA 3F46A 4ZQGA 1DB3A 3GZ4A 5MGBA 3PTZA 2D3TA 4BMVA 5JO0A 4M55A 3DONA 9LDTA 4A5OA 1W6UA 2YHUA 4ND2A 3CIFA 1XWFA 3GY0A 1V3UA 2JAPA 1JN0A 4DPMA 1KY4A 3VVBA 3ZU4A 2X6TA 3D3WA 2P91A 1SMKA 3H5AA 1PWXA 5G4KB 2C5AA 1T2EA 5EERA 1D8AA 3UVEA 2FOIA 5TNXA 1WNTA 2FR8A 3K6JA 4DRYA 3GUCA 2FZEA 5DOVA 4BNMA 4MVJG 3RCBA 4K28A 1G6KA 4R41A 4UVIA 2HO5A 2W8ZA 1E7YA 1BXZA 2Q99A 2QYSA 4E31A 1B8PA 4IDBA 4OIMA 1O6ZA 1P3DA 1J6UA 4J4TA 1SOWA 4XGIA 3ZU2A 3IMFA 5A5FA 4PIVA 1XKQA 4BNVA 3LLVA 3OQ6A 2GLXA 1IPEA 4QFCA 1PGQA 2OFPA 2GNAA 2VN8A 1ZNQO 4JROA 4A73A 3IKTA 4OO3A 4GX0A 4WNIA 1SB9A 4NZ9A 5AXAA 1OFGA 3LF1A 1RYEA 3ICCA 3DZKA 4D3SA 5CEFA 4XZ3A 2EXXA 4GVLA 3A1NA 3DBRA 5CEJA 3L4BC 2VOJA 4R16A 3P7MA 1UXGA 4D43A 5TSDA 5JCJD 1F06A 4QEDA 1RM3A 1ISJA 1YBAA 4JQCA 2EP5A 2E6UX 2YHIB 3TRIA 4TWRA 3L6OO 1ADFA 4AJ1A 1F8FA 1YQDA 1VE9A 3NAQA 2NNLD 1EFLA 1K6IA 3KYDA 3BMOB 1MG5A 3PHHA 4NR0A 2NU8A 3QIVA 5I7SA 2WYUA 2GZ3A 2Q1WA 2O2SA 3ANMA 4NBVA 1F12A 3JQAB 3AK4A 1GU7A 2Y05A 2O7QA 4AJ4A 2VCYA 3WGZA 4TVBA 3K31A 3IKVA 2A9FA 2NV6A 4PG7A 3O4RA 4J9VA 4BV9A 1VL0A 3EZYA 4NH4A 4WCFB 1H9AA 1XQ1A 3Q9NA 3RFVA 3TZ6A 5U1PA 4UVDA 1I3NA 1LUAA 2I99A 4BGUA 2YYYA 3CKYA 4Q9NA 4TZTA 4YEDA 2PZJA 1UH5A 3JSAA 3QSGA 1AUPA 2ZATA 1OAAA 2HLPA 4JBIA 2I3AA 5JBIA 3WWYA 1X0XA 1ZMOA 3MZ0A 1EQ2A 3GVCA 3TN7A 2YV2A 4J7CA 3C1OA 1CJCA 1F14A 4BO5A 3WIDA 4WEOA 1VC2A 1EUDA 4HX5A 4MP3A 2EGGA 1BXKA 3ORFA 4LSWA 5CDGA 5TQVA 4MKZA 1MFPA 5JPIA 4RDIA 5EESA 3WGGA 1JA9A 1JWAB 1OOEA 1W0CA 3ZNQA 1XDWA 4J2OA 3OHSX 3TZKA 3R6DA 2C0CA 5B37A 3TFOA 2GO1A 2HCTA 4FJ1A 4DC0A 4DTIA 2BGMA 3AI2A 4NHEA 4BNKA 2QW8A 4M86A 2X86A 3ONFA 3WICA 3RI3A 5CHEA 5A9TA 3KYBA 1BVUA 3B20A 4L75A 3DDNA 4KQWA 3EW7A 4PZDA 4WLFA 3ZV5A 4CM8B 5DF1A 1DFGA 4I9UA 2AEFA 4C7JA 1X7GA 3F1LA 5L9AA 1T25A 3ZV6A 1ENPA 3LYLA 1R4NA 2Q50A 4DYDA 5JAMA 1P33A 1DHTA 3GRKA 1A7KA 4BNLA 4OH1A 1MV8A 4HFNA 2HJSA 3H2ZA 1M66A 1MB4A 2JKVA 3NDJA 3TDKA 3AU9A 3V1YA 2DPHA 1IE3A 1PR3A 4DBVO 3QWAA 5G0VA 1LQUA 1CEQA 4FN4A 3U4HA 1R0LA 4GPD1 4I5GA 3LDHA 2Y0DA 2NTJA 1O0SA 4INAA 1YONA 1HYHA 2NLOA 4ZU3A 2NU6A 1NHWA 4L4XA 3QY9A 4CLRA 1A7AA 1GQ2A 1WMBA 2O48X 1ZUD1 3K2EA 3WJAA 4DMMA 5A4DA 1CQIA 3ZHXA 1IL0A 3V1TC 5IF3A 4XA8A 1TT5B 1YL7A 5JDCA 3LC7O 5CPBA 2IXBA 1A72A 5ICSA 5DNAA 4ZQFA 4NQZA 3RAJA 2J6IA 1J5PA 3OJLA 1NQTA 3U4DA 3MJTA 5EQFA 5KJCA 5TLSA 3FSRA 2EKQA 3NKLA 1VJ1A 2ZJ1A 4QO8A 3P19A 3RQSA 1YDEA 2D1YA 3S2GA 3FNHA 2J3JA 4I9HA 3ZGYA 1RPNA 3AUUA 4YB8A 1ZSYA 1YDWA 4O59O 3JQ7B 1F0YA 4NBWA 4ND4A 2AEJA 3DR3A 1KIFA 1KVUA 1MC4A 2P68A 3F1KA 1H93A 5KOIA 3HADA 1R15A 5CG2A 1P1RA 4XQEA 3OJ0A 3AOGA 5JMPA 3WTBA 3X2EA 3H8VA 2XAAA 3DZFA 3GGOA 3U3XA 5L51A 4HFJA 2D2IA 3PYLA 1YXMA 3WMXA 1EZ4A 4ND1A 2AQIA 4A0SA 1EEHA 2PH5A 3QVTA 4D3FA 4IGFA 1T24A 3ZWNA 3TF5A 5JSFA 3S2EA 4MVJM 4YAJA 4Y6RA 2GERA 2JHFA 2OP1A 4WLUA 3CEAA 1Z75A 4XDYA 1YOVA 1DC5A 3QWFA 4MVJE 5CG1A 1CQJA 1KVQA 4ND5A 4GX2A 3FWZA 2DFDA 5F5LA 2DBZA 2EJWA 3VDRA 4J90A 4NFHA 3TL3A 1V9LA 5FYDA 5T57A 5JC1A 1H6CA 1JQBA 3JQGA 1E7SA 2G1UA 1QYWA 3IJPA 1H6DA 2WYWA 1ONOA 4FQ8A 2PZKA 4Z3DA 2JAHA 4CJXA 4K9DA 1NM5A 1XR3A 1L7DA 2ZCUA 3F6YA 3KXDA 3RC1A 1FDUA 2NQTA 2CY0A 2OO5A 4EYEA 1ISGA 3KSZO 1K5HA 2FMUA 3C7AA 3X2FA 5JXWA 1CF2O 2B0JA 4Q3NA 4B79A 3NGLA 4M54A 2X0RA 4OXKA 3WS7A 1NXQA 4J7UA 4GX1A 2HK8A 3QWHA 4J0FA 1JLLA 2PGJA 4CQLB 1VSUA 1A4UA 3ON5A 5THQA 3QV1A 4ROSA 5KVQA 2BMAA 1JWBB 4S3MA 3ETDA 4CMGA 1E3IA 2FSSA 4CM6A 4DQVA 3D4OA 4KDFA 1HYEA 3NYWA 2VUSA 4BNJA 4YRAA 4WGGA 2JFGA 1GUZA 1MA0A 4WKGA 3NX4A 4ALLA 1DIHA 4BKRA 1U9JA 3GMSA 3EUWA 4P4GA 1GUYA 3GNTA 4YACA 4UVEA 2Y0EA 4TQGA 3LSYA 4XYLA 3W8EA 5IDXA 4DVJA 5JAQA 1MG0A 4WCDA 3ETEA 3OA2A 1GEEA 1YQGA 5FWNA 5F3RA 5KVVA 2VTDA 4J43A 1XELA 2CNBA 4U8GA 2YW9A 1P1IA 4R9RA 4E0BA 1N7HA 2GZ2A 3CSDA 4M1QA 2V7PA 2E82A 1XA0A 4PG6A 4W7IA 1QR6A 1YB5A 3RUCA 1HDXA 1ENOA 3E1KA 4CQMA 2DBVO 1C1DB 2G82A 4P4NA 4RPLA 3ITDA 1A9ZA 4LVCA 4DWVA 1O8CA 1KYQA 4PZEA 4RPHA 4BKOA 3WBFA 1RWBA 2CMDA 3V2GA 1L1FA 3KO8A 3PWKA 5HBRA 4IDAA 3GPIA 3Q0EA 1MLDA 3I4FA 4FD3A 3SXPA 1FXSA 1ISIA 5BSHA 4CV1A 4UREA 1U3WA 5BSFA 3DZGA 4RZIA 3UCFA 5JYEA 3NRCA 2AQ8A 1PZGA 4NU5A 4NI5A 3AFMA 1I0ZA 4BO4A 4YJFA 1LXCA 1Q0QA 5B4UA 1O89A 3UFXA 1WVGA 4WOKA 1U3VA 3JQDA 1PJBA 2HMSA 4TZKA 1HEUA 3WBBA 3E5RA 1Q7BA 4WK6A 4YJDA 3PYXA 5DP2A 5JE8A 3T7CA 5L7WA 3GZNB 3QVXA 1R12A 1U3UA 3B1FA 1ZSNA 4I9NA 2F00A 1BG6A 1U5AA 2AE1A 3DZHA 4O63O 3WNVA 2X23A 4Y8VA 3ULKA 5TX7A 1EUCA 3LVFO 2D5CA 4M8SA 4HV4A 2H63A 4OL9A 2CDBA 2DUUA 1NPYA 2I65A 1P45A 2VZ8A 3GVIA 4WCFC 1QXSA 2GN4A 5ER9A 3BA1A 4D46A 3UN1A 4I08A 3TOXA 3PWZA 1CERA 5GY7A 2GSDA 3RUIA 3I4CA 3AM3A 4RF4A 4AJJA 2OOSA 1NVMB 1IPFA 4XRGA 3I9JA 5T8KA 4RDHA 1GUFA 3PXXA 3RASA 4OSPA 3ZDFA 4J16A 3JQAA 3VZPA 3GN2A 3VPXA 2AMFA 1ULSA 1DIGA 2NSDA 2WTBA 1WAMA 5T5QA 3E8XA 4B7UA 3D3EA 1IZ0A 3O26A 3AY3A 1VL6A 4G65A 3WX0A 4A27A 4CLXA 4BO3A 2GDZA 5FI3A 3T7EA 5EMHA 5TS3A 1V3TA 4BNGA 1U8FO 2YHIA 4EGFA 3OBBA 3WGOA 1PGOA 3RU9A 4DPKA 4ALKA 2I67A 3VOSA 3VPGA 4KDEA 1QG6A 4KTVE 1KVTA 3LT2A 5LDGA 5B1YA 2E4AA 3CPSA 1DLJA 3D7LA 5COBA 1LDBA 2X5KO 3OIFA 4BKUA 3TNLA 4Z0HO 4E21A 2PD3A 5LDHA 1B2LA 1E77A 3I5MA 2FPPA 2PFGA 3PQDA 3K2BA 3FN4A 3NUGA 2X9NA 1SOVA 2PGDA 2R2GA 1H6BA 4FC7A 3KSUA 2RHRA 3EYWA 3N7UA 1DIAA 4XDZA 1OC2A 4QT0A 3U0BA 3FF4A 3NV9A 5JLAA 1DC6A 1GCUA 3IUSA 4GKVA 4IMPA 2IEDA 3ZNOA 4IDGA 4UEJA 1LI4A 1HXHA 1UP4A 1LDMA 4BUCA 1QORA 2Q1TA 5HS4A 1YJQA 1ISMA 3OIGA 1ZJYA 4OM8A 3ZU3A 1I8TA 2FY8A 3UKOA 4CMJA 2EERA 3WB9A 4DA9A 3V1UA 4OMUA 4R3NA 3BHJA 4U6QA 2DFVA 2QYTA 1M6WA 4NJMA 1YB1A 3BXXA 1AE1A 3ITKA 1PL7A 1ZK1A 5G4KA 4D3DA 5BSGA 2X4GA 5DCYA 4BO7A 2LDXA 5J23A 4YT4A 2AXQA 4K1LA 1YVEI 4XR4A 3C7DB 2DTEA 1E7RA 4U0KA 4TRJA 3CMCO 3NJ8A 4BV8A 4ZN6A 2XF8A 4YWJA 2Q4BA 5JAZA 3BMCB 4PLHA 4E5PA 1LC0A 3S2FA 2UAGA 1UP6A 3KV3O 3L4SO 2B5VA 4B3JA 4Q3DA 1H2HA 1JW9B 3FNGA 3GR6A 3KLPX 1HETA 1IHYA 2EF1A 5TIIA 3VAZA 1PJTA 2PH3A 4EEXA 1ORRA 3TSCA 1HSZA 4JK3A 3PIIA 1YQXA 3ROQA 1EBFA 3H5RA 4RVGA 2P2SA 4GSKA 3VPSA 3WIEA 3BTUA 4KQXA 2NTVA 1G0OA 1PU2A 2DTXA 2IODA 1Q7CA 5BQFA 3N58A 3Q11A 3FBGA 3JQGB 5T8KC 4JBGA 5JCJA 5H81A 1CDOA 3PZBA 1XQ6A 2P9GA 4RVDA 3VTZA 9LDBA 4MKRA 5KJEA 3WJ7A 4OHUA 1P44A 1V6AA 4Y98A 2CF5A 3ZWYA 2VRBA 4FS3A 4UUOA 4L8VA 1E3WB 3STHA 4B4OA 3I9NA 5FF9A 2VHZA 4OAQA 3PJGA 4DQXA 1YKFA 2WWRA 3KOUA 4LCEA 3HDHA 1KEUA 1K2WA 3AI3A 4ZJUA 5L95A 3K73O 1K0UA 2I9PA 3F4BA 5A02A 3WG9A 3INTA 1GV0A 3KBOA 4OJNA 5IZCA 3C7CB 1T1SA 1NR1A 3HFGA 4A10A 2FPIA 3RBVA 2PLAA 4EBFA 3L6DA 2HJRA 1ENZA 3DBHB 3Q1LA 4FFMA 4PG8A 2XXJA 1QLHA 2CF6A 4GSLA 4IM7A 4WOJA 1XGKA 1Y5RA 4NFYA 1DC4A 2HMTA 2R00A 4PCVA 1N1EA 4B4VA 3GN1A 2HU2A 2YQ4A 1YH3A 3QA9A 1JKJA 3FTNA 3WYEA 2YUTA 5AXCA 2PKQO 3I6IA 3L0DA 3O8QB 1ZIDA 3PGJA 4YRBA 3VC7A 4E5NA 1GQYA 4PLVA 1DFIA 3V8BA 2VQ3A 4TMFA 4ZRMA 5BNTA 4DPLA 4YAGA 4JN6B 1TVEA 2DQ4A 1E0DA 2GYYA 3M2TA 4R1UA 1DC3A 1DAPA 5JDCC 3UH1A 1TXGA 1J0XO 4K26A 4URFA 2VT3A 5L4LA 1KETA 4CMHA 4RVSA 5CFZA 1LRKA 1I24A 3DZIA 4YJGB 3WNQA 1R4MB 5GMOA 3W6ZA 5JCXA 4E5MA 3VH4A 4BQPA 1HLPA 3KUXA 1T1RA 4XRRA 4NK5A 3VKUA 4A03A 4BNXA 4I8XA 3WDSA 3WXBA 1VRWA 2O3QA 4YA6A 4RV9A 3W4KA 3CUKA 1GYQA 1EDZA 4N5MA 3VDQA 4CLEA 3DTYA 1DEHA 3O8QA 4UUPA 4E5YA 1NFFA 1LRJA 1E3JA 5ITVA 3V2HA 3MJ4A 2BH9A 3AM5A 3M6IA 3L4BA 5JDIA 1L7EA 2BGLA 5C7LO 3ZNPA 2Q4EA 1EVJA 3WSVA 4CLOA 1HDYA 3C1AA 2QZ9A 2YDYA 5DDIP 4FPXA 1YJ8A 3PFWO 4XCVA 1R6DA 5HWSA 3HB5X 3S55A 2FSVA 2CSUA 3VHRA 1F8GA 2O7SA 3BMNB 4YAIA 4BHTA 2VHXA 4IINA 4FCCA 4J0EA 4F3YA 2OHXA 4XIYA 5KVCA 2VZ0A 3VVCA 2O3SA 1DBVO 3GQVA 3ZNNA 3Q2IA 4CV2A 2IYOA 5IZ4A 2NQ8A 1ID1A 1I01A 3H9QA 4LCJA 4BS9A 4HFRA 1HT0A 2ZIZA 4H7PA 2VNSA 2Z95A 1PJCA 1UXKA 2NU9A 5EPOA 2DAPA 1DAOA 1M75A 3QJ5A 2GF2A 1QV6A 4FDAA 4BVAA 1FDSA 2G17A 2I3GA 4YDRA 1B3RA 1I30A 3DMYA 3GFGA 2Q49A 2QZZA 3MJVA 1BRMA 4RF5A 4ZA2A 1DDOA 2BLLA 3GGGA 4YTEA 4W9NC 3W1VA 1G1AA 4RF3A 2I76A 3R3SA 2Z5LA 2AG5A 4PVDA 2WM3A 4IXTA 1GD1O 4QO7A 2FN7A 1PJQA 4BQRA 1NX6A 3DAPA 4YVFA 3I9MA 1Y6JA 2PD4A 2FWMX 4Z9FA 4KWIA 4BB6A 1LDNA 1ISFA 1Y9AA 1I5RA 3MTGA 4HP8A 4JCOA 3F47A 1NHGA 4BMSA 3BMCA 5I7EA 5I9NA 3TL2A 3W8FA 3NGXA 1E5LA 5COAA 3E9QA 3P5SA 3QVSA 4B4UA 2AEMA 4E6PA 1MXFA 3VZQA 1X1TA 4L76A 4JLWA 2HKIA 4YJHB 1YBVA 2ZYGA 3O38A 5ADHA 3BHMA 4E13A 1T4DA 4GVXA 3U5TA 1DPGA 1VL8A 2FR0A 4P38A 1I3LA 1VJ0A 3EY4A 2I6TA 4RPKA 3ROPA 3DEYX 2WDZA 4OKNA 1Z82A 5T64A 2Y1GA 3EAGA 4MOWA 3F9IA 4IJWA 4XB2A 3IUPA 3L9WA 2GD1O 4W9NA 2JCXA 3ONEA 4TRNA 4Z9XA 1UZMA 1BDMA 2HMWA 3F4LA 3IOYA 3I9KA 1BXGB 2EGHA 2D8AA 4Q3AA 3JQ8B 3GHHA 3U4IA 3E9NA 1H6AA 4CM5A 4BIIA 2DUWA 2ZCVA 4TRMA 2B83A 2Q45A 1Y8QB 1GL3A 3PHJA 4XIJA 3WQRA 1LSOA 2J5RA 3DO5A 4R54A 1NQOA 2IEBA 3ZW9A 3QLJA 1GZ4A 1VJTA 4NG5A 3M2PA 5F1PA 4IIVA 4ND3A 2JD1A 4FIZA 2ZKLA 1TA4A 2E37A 2VHVA 3NT4A 3FPCA 3PLRA 4WEQA 4KTTE 2Q1SA 1C0IA 3LT0A 1J49A 3SLGA 5C37A 3NEPX 4HNHA 4CL8A 2A92A 2FP4A 1EVYA 2G0TA 1NBOA 4CLDA 5A9SB 4IQ0A 1MP0A 1M76A 3HB4X 4YAEA 4DBZA 3FBTA 4BNFA 1XU7A 3KSDO 3PLNA 1ZH8A 3F5QA 5TF4A 4HY3A 1H94A 1TI7A 1I32A 3OJOA 5IN5A 5JNLA 3QVWA 4WASA 3QVOA 4IIUA 4JP2A 4YT5A 1VI2A 5FEUA 4AJLA 1QYDA 5H82A 2JCVA 1N5DA 3VPFA 4DIBA 2G5CA 5A9RA 3MEQA 1UP7A 5L4NA 4ALIA 1LNQA 2ZB7A 3KZVA 3SLKA 2CVQA 3CH6A 1MX3A 5AXBA 5B4VA 2EKLA 4JBHA 5CAEA 3RFXA 1LLUA 2DTDA 2W2LD 3H3JA 4MINA 1ZK4A 3C1TA 4XB1A 1HDZA 2QHXA 1RYDA 3VH2A 5JYDA 2NUAA 5G4LA 5G0SA 2GN8A 3FNFA 5F1OA 4EDFA 4AJEA 2DPGA 4YRDA 3S1LA 2RH4A 5G0UA 3VZRA 3BAZA 4E4YA 3D64A 3ETGA 3PJFA 4FSHA 3WYCA 1CIVA 1U5CA 3E18A 3IDSA 5BT9A 5TT1A 4ZHSA 2VUTA 4BOYA 2RIRA 1B0AA 4HFMA 4HXYA 2E48A 3VH3A 2CVZA 2AW5A 2W2KB 1C0LA 4GWGA 5JS6A 2FZWA 3HHPA 1HE2A 1AN9A 4MIYA 4XKJA 3LC2O 4BKPA 1U7HA 2RAFA 5F21A 3ICPA 4A7PA 3JD0A 1PJLA 3GZNA 3NJ4A 3ZWPA 1ZBQA 3IP1A 4LMPA 2W90A 3RUEA 4FOOA 1SEVA 2J3KA 3IQDB 4DMLA 4JXKA 2BI7A 2WD7A 3GT0A 1P31A 1PGJA 2DLDA 3BIOA 1WDMA 1MGOA 1Z6ZA 1E7MA 4DL9A 3ROMA 2C20A 5G0TA 2PTGA 4IY1A 3S8MA 1P0CA 1A71A 1P1KA 1PJSA 1T2CA 1DRVA 1YGYA 3A28A 2B35A 1QSGA 5I8ZA 2TMGA 3DOJA 3GEDA 1SO8A 4OQZA 5F5NA 3JYQA 4BGIA 1IULA 5AOVA 4LW8A 4Q3EA 1E3EA 1ZK3A 3RUAA 3H7AA 3PJDA 5L7YA 1ZSVA 3HFSA 2NU7A 5GZ1A 3SX2A 5IDQA 4JNKA 2D59A 4E3ZA 5B4TA 2ZB3A 3RU7A 4ZICA 3C8MA 5CDUA 3FR8A 1WZIA 2DM6A 4BNNA 3RVDA 1BW9A 1K6XA 3ZHBA 4U7WA 1PJ3A 2ZQYA 2ZQZA 3KTDA 3C3XA 3L07A 1D3AA 4CM7A 2JJYA 3I83A 3GDFA 4FFLA 4Y6PA 4CODB 4RJTA 1U2GA 2P4HX 3JQEA 4PLZA 4PLPA 4RORA 2W2LA 1OC4A 2J8ZA 3NTOA 4F6LA 3WLEA 3ANNA 2WYVA 3RUHA 4W7HA 5A3JA 1NNUA 5L4SA 5L45A 1PJ2A 1GYPA 3WTCA 4U5QA 2VWPA 5ENVA 2ZYAA 4G2NA 4FFNA 2BKAA 4D0RA 5A05A 4FGSA 3INRA 4NBTA 1PQUA 4BO0A 2PY6A 1WXDA 3HZZA 1TEHA 1U3TA 3OF2A 5KWEA 3EMKA 1N1GA 5CDYA 3KYCA 1LSJA 2Q2WA 4NK4A 4X54A 1E1NA 3ENKA 3FHLA 1PWZA 1T2DA 1T26A 1GZ3A 4L73A 3RJ9A 1W73A 5JMWA 4B8WA 4R69A 4LSMA 2RCYA 2ILTA 4AJ2A 1KS9A 1NASA 3DBLA 4OXYA 4P22A 4RVHA 2OBYA 1HF3A 5JDIC 3UCXA 1LLDA 4PLYA 3JYLA 3ZZNA 4IJKA 3ZV3A 4J2HA 1LSUA 5HS6A 2CDAA 2IZZA 4JJFA 4RCVA 4XJTA 4ZVVA 2X9VA 1ADGA 2G76A 1UAGA 2O50A 5TJHA 4MVJI 4EZBA 3AY6A 1EQUA 3MOGA 2YDXA 1X14A 3IJRA 5DZSA 2GRAA 1PX0A 3B1JA 2C7VA 2O3JA 3JD3A 4I5DA 3JQ9C 1S7CA 5A1TA 3PJEA 4J1NA 1E92A 1Y1PA 3UW3A 4FFPA 1BWSA 1X15A 1UDCA 5JY6A 1B14A 1P74A 4ONEA 3I23A 3MOIA 4J1SA 1N7GA 1HYGA 5KVSA 1NAHA 4DQUA 1YOVB 1NVTA 3ABIA 1XLTA 5EIOA 3GDGA 3RBXA 5ICMA 3GVXA 1LTHR 1DRWA 4DIOA 5BR7A 5IZCC 4K6FA 5C7IO 3PHLA 5K6AC 2WE7A 1IY8A 2EHDA 2X5JO 3V5NA 4IQGA 5F1KA 4B8ZA 3RC7A 4G5HA 4MDHA 3HNPA 4CM9D 1XG5A 4EUHA 2X0JA 2BF7A 5IFLA 2ZTLA 2RHCA 4YYZA 3RUFA 2JL1A 3DBHA 3DWFA 3OIDA 1NAIA 5LC1A 4YCAA 8LDHA 3TOZA 1BGVA 1LJ8A 1P1FA 2EP7A 3G79A 1U4SA 3ZWXA 3AUSA 3GMDA 5KCZA 1D4FA 1E7WA 1FMCA 1ZCJA 1PGPA 4ZGWA 4BKQA 5KJFA 1PJ4A 4ZQHA 4IZHA 1JU9A 4GGOA 5K0ZA 3PP8A 4OQYA 3HE3A 3JQBA 2H6EA 2C29D 3T4EA 3AY7A 4L4SA 4E2ZA 4PLGA 3QHAA 5K6AA 5CPFA 4DLLA 4ILKA 3KEQA 2TMDA 3R3JA 3NT2A 1HTBA 1KC1A 3GGPA 4NU6A 4B4WA 1OZAA 1RM5A 5AXDA 5T6BA 2PR2A 2OP0A 1FK8A 1ULUA 2X5OA 1KC3A 3JQ6A 1VSVA 3NDIA 3DC2A 4J1QA 4ALJA 3AJRA 3SJ7A 4RO0A 4C4OA 2Y1DA 1GPDG 1E6WA 1H5QA 1SNYA 1PZEA 3Q9UA 3FPLA 3WYBA 4MIOA 4EJMA 2UUPA 4II2A 2HSDA 1XCBA 4CUZA 1D1TA 3I9OA 4F6CA 4CMKA 3GAFA 1B3BA 1R4NB 1K89A 1SPXA 1C14A 1SC6A 3PZRA 4Y9DA 1VPDA 2H1SA 2HRZA 1KEWA 1F17A 1Z7EA 4D42A 1I3MA 3NDRA 1EK5A 2VHWA 4QECA 2QG4A 1EVZA 3H9EO 3JQCA 3WSWA 2QRJA 3LLSA 2NWQA 4KUEA 1LQTA 2JCYA 3ROKA 4IMRA 1SEPA 4R5MA 4BNHA 4L0QA 1UUFA 2JFFA 3JQAD 3I6QA 2DT5A 1NYTA 1NTOA 4WLNA 4FBGA 3PDJA 3PEFA 3PFFA 2ZTUA 4MJLA 4RL6A 4E5KA 3KETA 2X22A 2YY7A 1R0SA 1JVSA
chains in the Genus database with same CATH superfamily
2WR8A 4OYLA 2CLOB 3DHYA 1YS9A 3ENQA 1GXSB 1XIVA 1FC0A 3KU1A 4KQHA 1LDYA 2IEIA 2OLJA 2P9QA 3H9CA 3LSTA 3QE3A 4ZVLA 1Y1SA 4WW0A 3U62A 2HT6A 1BO6A 4M9CA 1IM2A 1HE4A 3PDUA 1EUDB 4HAXA 4IDHA 4I55A 1W4ZA 4OB8A 3N6XA 4BO8A 2X41A 1QG0A 3DF9A 1JTEA 2FRDA 4MPPA 4JBNA 1DVRA 5DYGA 5FI0B 2O4UX 1Q0HA 1DJQA 1OSNA 3L0SA 1V39A 1H0RA 1T36A 2E4VA 4KGVA 5DO9A 3UH0A 4H1WA 2WJPA 3SSMA 1BW9B 1QWSA 3IILA 4GX5A 3RSSA 2WG2A 3PFBA 3WV5A 3CGWA 2O1SA 4OQFA 2FEKA 4AZVA 2AXEA 2VF4X 3AFIA 1N0IA 1CS4C 1ZMTA 4ZEWA 3WLKX 2BKVA 3HY4A 1SC3A 6GPBA 4H0NA 3BE5A 4EWLA 2AQHA 1M6EX 3LFTA 1ZRHA 2VP9A 1WOMA 2XXAB 1XYYA 4O5AA 3IC5A 2ECFA 3GPCA 4OGFA 3RKUA 3ZDDA 4GWKA 3W1EA 2PV7A 3P2YA 1MA3A 1PNQA 1Y8RA 3BFVA 2G07A 3BXPA 4IS3A 1W76A 2YJ6A 4N49A 1FW8A 1QLJA 3DB2A 3A1TA 2OM6A 3UYLA 1Z34A 5AUNB 1TQHA 5CBKA 4Z4IA 4IWNA 1SU7A 3MT8A 1JVNA 2HMUA 4MAMA 4DLNA 4NCAA 4LJ7A 2E4UA 1D1SA 2YWEA 3I58A 3ZGVA 3E9MA 1J90A 3P8ZA 1DS6A 2MU1A 3M83A 3SYKA 1KZYC 3PV0A 1WDWB 4HN9A 4BB0A 2H17A 5EINA 1OA1A 2B4RO 1TYBE 4RK6A 1QRSA 3U6KA 2VJAA 3Q7QA 1FMTA 2VTBA 1D6NA 4IS2A 3ZWOA 4ADSG 5A9SA 5IUJC 1LF5A 2ET6A 2DUJA 4HDOB 1Z3CA 4Q4HB 1W8DA 4IDFA 1YRBA 4JGBA 1XT6A 1SUPA 2Y99A 3BRSA 3N39C 1OE0A 3WL8A 3AWDA 4KXYA 2WF5A 1HLGA 4IXDA 4XD2A 4ZMRA 2EX4A 3PUHA 3MSCA 2ZR7A 3VZSA 2FJUA 3P32A 1Z83A 4X84A 4AVYA 5JOQA 5FFMA 1VLHA 3M9XA 3ETHA 1HE8B 2ZJ0A 1UPTA 2CXSA 2Y93A 1XKXA 5KX5B 3AEKA 2FLVA 1GT6A 2JFNA 3B38A 3EBPA 4FGWA 4OP2A 1LK5A 1Y48E 2N75A 1PV2A 3K9NA 4DXAA 4YGXB 3AERB 4JBYA 2VK1A 3FWNA 4UZEA 4KREA 1JAYA 1ZXLA 4RIEA 4XEUA 4RQBA 1KEPA 3O8LA 2BR3A 5F73A 4DJDC 3GP8A 3AR3A 4DEYA 1B8NA 3G0HA 4LY3A 3KDPA 3I9V1 3BYZA 2I4IA 1A2OA 5KOYA 1BOFA 4L02A 1XRJA 3HVUA 3NXKA 1Z0JA 2C82A 3C6ZA 3ZTYA 5C8XA 3I04M 1TU4A 1YQTA 3LCRA 1RM0A 4LHVA 5EIHA 4YRLA 5BN5A 2C5HA 3PRJA 3W8NA 3SXUA 1XDZA 1NXSA 3ZIUA 2O52A 5EP1A 2XRZA 1ID8A 5AVOA 3IRUA 3K5PA 3CCFA 3NTRA 5CW2A 1VOTA 2RGXA 3WNZA 3IEVA 4QYMA 3ZZ0A 3RHTA 4NE9A 2R2AA 4J0CA 2I91A 4LRSB 1YCHA 1DOHA 2VP6A 3P2KA 1CPYA 1KYZA 4G1VA 1LFDB 4X7PA 1JAXA 3TPCA 2BHSA 2FHPA 4EHIA 4YJHA 4QXQA 5GGYA 3UMYA 4D4HA 1HZZA 5FV4A 4TYYA 1CUYA 4Y0AA 4CG2A 4US2R 4AF6A 4RVUA 4DG8A 3I62A 1R4ZA 4RSRA 4CKCA 3O2SB 1DBRA 4UMVA 1EAMA 3CR7A 3QFFA 4RS3A 5LZ2A 3QYPA 3V8VA 1WZCA 3CH7A 4DDUA 3FRJA 3B7PA 1NDUA 3BTOA 5SYAA 4YRQA 4YRMA 1E59A 4CQMB 4YMUA 3T1HB 2BHRA 4XGQA 2XLBA 1XN4A 4IH9A 2BDUA 4I5EA 5M34A 1V41E 4AWAA 2FOXA 1IN7A 4PPFA 4QGGA 3AKEA 4UE6A 4Y2QA 4US1R 3GG9A 4PN3A 5JFOA 3X1WA 3HG7A 1QFZA 2IPLA 4NBRA 1QG4A 4NCXA 4ODIA 4S35A 4Q5IA 5LB4A 1C1XA 3PC2A 4HSGA 1DEAA 4TRRA 1XE3A 2J5QA 3SHFA 1I0IA 5K4AA 2VHUA 1VM6A 4J07A 3AB3A 2WV7A 4XGNA 3UCEA 1OAKA 3CRMA 2V8OA 4IOKA 2HSEA 2NT4A 4L8LA 5J5CA 2Q2QA 4TTAA 4AUMA 3ZDQA 2ZRNA 2PJDA 3A6GA 3AVPA 4R3WA 3RROA 1IXSB 3VPAA 1FUUA 2PUHA 3BD6A 5TF0A 3TINA 1A95A 3K0KA 1I14A 4EZEA 1ENYA 3M81A 2ODQA 4LYHA 2HAEA 4GOLD 1W9HA 2UUAB 1WP4A 2NTEA 3VFDA 2C8JA 2A0WA 4PX2A 4RZXA 5IXSA 3N53A 3U3RA 4FYPA 2YFKA 2I6GA 4JSYA 4GKBA 3QV2A 3OJFA 4BHHB 4A9AA 3IERA 4LZZA 5AK5A 1EB9A 4JJIA 5JSYA 1ZVKA 5IXYA 4OQQA 2DKFA 1VI5A 4H1TA 4EG8A 2B4QA 1OCEA 1QRAA 4R7TA 5LCXA 1GQFA 2K87A 2V96A 3G3EA 3QLVA 2GTHA 3BMNA 3ZCUA 4KFUA 4QELA 4AJ9A 3W2FA 3QF4A 1GTZA 1NY6A 2GCGA 3P97A 3A06A 4WLOA 3IPXA 3SC6A 1FP1D 1YZGA 4TKZA 2YWHA 2FHSA 3W4JA 4IMJB 3GF4A 5C1IA 1EK6A 2O2YA 3JV7A 4CLOB 4CIDA 4HT3B 2AKAB 1Q1NA 3QPWA 1GTMA 1TUIA 4RCZA 3VV3A 2C1ZA 1XNJA 4EUEA 1CUZA 2WPDD 3AYXB 1JPUA 3JVIA 3MTJA 1C8VB 4PZCA 4LK2A 3AUFA 5CVCA 3T54A 5BSEA 1DQZA 1E63A 2E49A 3K1AA 4K5QA 5K3CA 1C0KA 1Y5MA 4DUYB 1M1NB 5BMVF 2IITA 3DAGA 1FBTA 2IEGA 1H2BA 1C41A 2JARA 1GY8A 1OXBB 3FFBA 5EXPA 5HF9A 4YFYA 4YUYA 3FOAA 5ALEA 1P9OA 1YE3A 4Q3BA 5T4HA 4KRXA 5EHIA 1GRNA 4NYJQ 3DGEC 3OQPA 4G81A 2XZOA 1LPAB 2GSWA 1NL3A 1S2DA 3BTVA 4BNTA 3RC9A 2Z2YA 4E88A 3E3LA 3IE1A 2PXHA 1AKMA 3PA6A 3R2JA 3R4CA 4UHKA 5KWSA 4ASUA 3HRIA 1QZTA 4ZO7A 4AP6A 1KEZA 1GNRA 4PZLA 4UNRA 3RLIA 1EFPB 1BX0A 1MMFB 4IHKA 2YFHA 2X1HA 3BXFA 5EWMB 721PA 1PYGA 1HEIA 4QQRA 1ATIA 5E6SB 5GOZA 5D5HA 3TM5A 3MCVA 1VGRA 3CWCA 3LPLA 5A4AA 2CL6X 3OM9A 1E2IA 2JHGA 4PXAA 3L4KA 2LV8A 2BEJA 2C5EA 4BV2A 3TM4A 2X1VA 2XYPA 7ADHA 1CQWA 1QYCA 3K96A 3NBAA 7REQB 2ON6A 2A35A 5JMTA 3NAMA 1Z9BA 4BMZA 1J9GA 1Z63A 1RWQA 4G4SO 1GVNB 2VBCA 2BDEA 3M6LA 2PD6A 4XTCS 5CM2Z 4QL3A 5AVKA 1H42A 1VZ2A 2IGBA 2PSDA 3L8CA 4UHHA 5B5SA 3GLHE 2QIOA 2DR0A 4KX3A 4EYGA 2BFAA 4PFKA 1WETA 1KQPA 3FYUA 2P0EA 1V5WA 2QYOA 4MVCA 4DY6A 2WRZA 3G7NA 5LUAA 5L6LB 2O2DA 4GYYA 2VQEB 2FU5C 3GD7A 4B43A 4O5OA 4RPCA 4MDEA 3P45A 2J5XA 2VIIA 3QKRB 3OZAA 5FTNA 3SHTA 3ZI0A 3NLLA 3UTDA 2EKPA 2ZBDA 1TB4A 3I6MA 2CW5A 4X44A 2C03A 1SCJA 1P80A 1XNGA 4FZRA 3ZE0B 3DZBA 1RIFA 2NW6A 3ND7A 3K1TA 1CJVC 1I2DA 3I39X 3K70C 2C4UA 4X1KB 4RLHA 3RVQA 3QZUA 5EN4A 2B78A 2V7TA 2LIPA 4HNGA 1W35A 2R5WA 3EX7C 2BFOA 3W3AH 1XL1A 3ECCA 5BQ3A 3JQFA 1E89A 4DILA 3I2JA 2J7PA 1U65A 2E87A 2WT4A 3D8BA 5KCMA 2Y76A 3GMIA 4UM9B 1ZGGA 5KTSA 2F55A 2NXNA 2P5UA 1E5QA 4JR0A 1B26A 1NF8A 1IEVA 1UJNA 1WDLA 5IK2D 1PL8A 2ZJ7A 1VXRA 5IJXA 3QX9A 4MR9B 3EA5A 4JUCA 1L7BA 4ZKDA 4XOIA 4KU4A 2PKEA 5AJHA 3KPYA 3DPSA 3O0DA 4E32A 2FDCA 5T4BA 3ZLBA 1LLCA 2CZQA 3RUDA 3W6NA 2ERCA 2SECE 3RSOA 4HDNB 4DRXB 2XTJA 5HKBA 1Y9ZA 1G41A 1K9SA 1UKVY 2PFSA 4M0MA 1DX6A 3KJZA 4H7KA 4UULA 4JI3B 1HT2E 2IPAB 2W6ZA 4K9NA 2Y6UA 1QV7A 2R65A 4UVHA 4C0LA 1U7UA 2OM2A 2Z1NA 3GLIE 1AIPA 3EMBA 5EZQA 4DCNA 5CCEA 4C6TB 1V1MB 1LSSA 2WWGA 3EK2A 5EVJA 4L74A 3VTFA 2UVPA 2YWRA 3A0UA 2QUJA 3LY7A 4GGPA 4MQUA 3NBXX 4LY6A 4QU9A 1YCFA 1W0KA 3KHSA 3THOA 3VDNB 4PYKA 1MZVA 3PDCA 3IIMA 4HEHA 1XTIA 1VL2A 3BCHA 4K86A 4O4LA 1NATA 1P5FA 1PX2A 1UBRS 5J4HA 2ZJ4A 2NSYA 4D98A 2X9QA 2CDNA 4X90A 1ZMRA 4D41A 4FYWA 1QGUB 4GM0A 2GEUA 3R20A 3HV0A 5BPHA 2PX8A 2VJMA 4LMRA 3SPXA 1H1LB 3ZXYA 4CV0A 3T7SA 2VPZA 1NF2A 1KMHB 2AG8A 1DOZA 3WGQA 4RMJA 1EE9A 3BRWA 4IGIA 3C4JA 3DEHA 1OBCA 2C2XA 4DA6A 2OCBA 4HEJA 1KRWA 4Z99A 3DE3X 4A2CA 2ECKA 3H9UA 2YS6A 4FFBA 5C3MA 5J2TA 1HNXB 5KTNA 5GONA 1QH8A 3N07A 2XUOA 1AXRA 5IC5A 1WLSA 2VSXA 4DMKA 5GVSA 5IJWA 2I62A 4BVGA 2PK3A 1Q0LA 4X45A 3K9BA 3OH8A 3R7AA 1OB5A 5K01A 4IEIA 1NBAA 4XLLA 4NAVA 3TW8A 2JLVA 1DG3A 3DVAB 4MZDA 3TSAA 5DGDA 1Y89A 4DAEA 3OZBA 1CY2A 1O95A 2OD7A 4UQOA 4J49A 3HCNA 1CVLA 2BFMA 3V6MA 4CR8A 1PDWA 4ZRNA 4E2YA 4QT4A 4B73A 3OQMA 2VPPA 1T6BY 2NZWA 4KNVA 4QXPA 3IIJA 4QUIA 1N6OA 3O4JA 4K40A 4GAEA 4LISA 5HFNA 5BW6B 2E3JA 3QWBA 4P32A 1XZIA 2P1ZA 4AZ0A 2BE9A 5CK5A 3D0OA 2QLNA 4AKIA 2ZXFA 2JBWA 1UJ6A 5IG2A 4LWQA 2C7RA 1XAJA 1TEXA 1J4AA 2RHHA 3ZCXA 2C2YA 2YX1A 3KSMA 4XWYA 1CVIA 4N5LA 1OMOA 3E61A 3PUKA 4HI0E 3AZPA 3DM5A 4MV4A 4IZ6A 4UHDA 4H16A 2ZDGA 5B64A 3G7UA 4EMSA 2GXAA 3C3CA 5FUWA 3R76A 1N7JA 1DTEA 2QL6A 2OZPA 4UAJA 3TB4A 1NJ5A 3T9CA 4DLSA 3LQFA 4WCFA 5A03A 1EP9A 1GZ6A 1PLLA 4GKJB 3BMOA 3GEPA 3EEQA 3M5PA 3MXOA 3QFCA 4JIMA 4YRTA 5DLEA 4LBYA 3GYBA 1UPCA 1LC3A 3GCZA 4PRKA 3FDXA 1BU8A 2GGSA 3N2GB 4NJEA 5EZYA 5CCXA 2YYZA 3WXMA 5DCWA 4OMDA 4TL7A 3CISA 2O3TA 2WTEA 2CBXA 5C34B 1P1JA 2RGCA 5GVRA 4YQEA 5EPUA 1S0UA 4RD2A 3CX4A 4F9GA 4RD0A 2FSIA 3KYDB 3EVNA 5HE9A 3U2QA 2OORA 5D6NA 3W90A 3CG0A 4DW8A 1GRCA 1NMXA 2YFQA 4Y2UA 3UWPA 5JS8A 3S2YA 4ARAA 3AVXA 2W2KA 4QPZA 5K8JB 1J06A 1GN9A 1XU4A 2E2WA 4AMZA 1NP6A 3FPAA 1C29B 4U0JA 4Q21A 1UPXA 5LZ5A 1E1MA 4E2XA 1REQA 4G1EB 3OEHD 2UVQA 3G49A 5AM5A 4BECA 3VR5H 2IXDA 1EFUA 4ZQEA 5H83A 1X70A 2IOFK 5ED0A 5DWQA 1U1IA 1X1AA 5I4CA 1BGXT 3BWYA 4EATA 5I6DA 2BKUA 1T6XA 3QVLA 4NHOA 5BYJA 3BMXA 4UVGA 1MJ5A 1G8HA 2A94A 5DT2A 5I48A 2IJGX 3W4IA 4E33A 1RXWA 4OLFA 2Q9CA 2GS9A 3IMEA 4WNCA 5DCLA 2Y1OA 1ULAA 3DKRA 3I9LA 2BDTA 4NENB 4BBPA 2VPWA 2WAYA 1SHTX 4BQEA 1QRDA 5K0EA 3M6XA 4WUVA 4RVNA 4MGZR 1TUEA 1XQ9A 5HX7A 4RTSA 4Q7EA 4ETIA 3B9BA 3THYB 3P27A 5M29A 4IIYA 1JSRA 1UDXA 1NPTO 4TWAA 5BSWA 1OLSA 3T52A 3ZV4A 3K8ZA 1BAPA 2EFHB 5IT5A 5FUBA 5AUOB 1P9RA 4MAAA 4UBKA 5AKIA 3I76A 1RM4A 1RYZA 4XIIA 5K0LA 4E2FA 3KBBA 3EXHA 3GUZA 1ZVVA 4J0HA 3IDAA 5KAMA 4EQ6B 1IZ9A 1CR1A 1A1SA 1R66A 1JRLA 3W9YA 4AU1A 4R5HA 1A27A 2GZAA 1RXEA 3CLTC 2X7HA 4W6ZA 3R75A 3VOAA 1EH5A 4WAUA 3K05A 1O2DA 4LHYA 2RGNC 2IW1A 3GRYA 5TT0A 4NAUA 1W47A 1E61A 2HHCA 4IVQA 4RY9A 1TJNA 1MT3A 1YS7A 4MARA 4YBZA 5LXTB 3BD7A 1D9XA 1ML4A 3KC2A 4MRNA 1T4CA 4KHPB 1YMQA 1RAGA 1DC8A 5I9MA 3AOEA 2AHRA 1U7TA 3O75A 4GE0A 4HB0A 3UJHA 4GKAA 3V55A 4CLHA 5FO0A 1PZNA 4HPJB 5KNDD 1JFFB 2V9PA 4DR4B 1U0LA 2F1OA 1E1KA 3NCTA 1E6KA 5LKAA 1XZKA 1PS8A 3IT0A 4RFSB 3TDMA 3NCHA 4AKSA 3DOCA 3K71B 4MPRA 1LZKA 3WP1B 1FF9A 3GLFB 3PCRB 3L1KA 1K66A 4JVOA 3C85A 3K09A 5T67A 1E64A 5BMVA 4EJ2A 1RYNA 3IBYA 3FDFA 2PKQP 1T3GA 4II3A 4RHCA 5C81A 1GGNA 5ALTA 4KQFA 3OFKA 4LF9B 1JBKA 3BSYA 3L7BA 3HDTA 3OUZA 1NQUA 3H4TA 3Q9SA 1NFRA 1WY5A 3EH2A 4I1IA 4M87A 1U0BB 2VNIA 3VKHA 2JIZA 4WVLA 3M6VA 3GNSA 2FPGB 2LD4A 3TH5A 1BXRA 3E03A 4AJPA 4ZU6X 2VJLA 2A4MA 1JX6A 2AMJA 2IL1A 2ZLBA 4FINA 3A4YA 5K0GA 5I3CA 2X58A 4WJZA 3E70C 2L42A 2P30A 5HM8A 2TRSB 3PVSA 3B7WA 4F46A 4J3JA 4BGEA 3ZZTA 2MSLA 4D9JA 3PFCA 2V4ZA 4IYRA 4F3KA 3I45A 3L41A 4LHEA 4K3UA 2QG9A 2W6PA 5LP6A 1KMQA 2WTAA 5JEEA 4E30A 2OBNA 5C3UA 1A5TA 4REOA 2KSQA 1UMDA 2YHAA 5DTQA 1C3LA 2CFCA 4WFKA 2XT0A 3PQ2A 1HDRA 3QHQA 5DU2A 1WMAA 5JTTA 3RWBA 2QSUA 5THKA 3VR6D 2COKA 4HNTA 1UQRA 1MIHA 4KQEA 2O5RA 1D2MA 4FEAA 3TVDA 4FFVA 1LPBB 2MSCB 3G2IA 3T7JA 2WTNA 4RHUA 4U39A 3HB9A 2QRVA 4BNUA 2IF0A 3KL2A 4BVFA 3MFQA 2ZUFA 2ZSJA 2ZSIA 5AYVA 3M1AA 1SBQA 4DLBA 5A04A 1TM7E 4E08A 5IKEA 3DTVB 1AHHA 4NATA 5KTMA 4BASA 3TI7A 4HWOA 3GGDA 3LU1A 3RC2A 1M34B 3CGGA 2UYYA 4L7QA 2ZJ5A 3NV7A 2VBIA 3F2IA 5AKKA 4ALNA 2FETA 5LYJB 1B6RA 1M2GA 3CUEF 5KKAA 1HOXA 4D45A 1WUTA 2OMKA 2R00C 1I10A 2OOKA 3QW4B 4UCFA 4X61A 4CKBA 4CR7A 3IVMA 1W30A 1NA5A 1NZFA 5I5EA 1C0EA 1AJEA 4X1IA 5B7QA 2HEIA 5J4KA 2A9VA 4EB6A 1YULA 5AKZA 2PHZA 3N2NA 1XDUA 4H2DA 4C4SA 5KYTA 1AKNA 2Q8NA 2ZR8A 1YB4A 3SE0A 5EE0A 4QZVA 2Q3EA 3GLSA 1KWGA 1SRQA 1D5WA 2ZB4A 5DW3A 4IDDA 5DWVA 2HEGA 4ZCRA 4JC0A 5CDFE 3A7DA 2NO7A 4G5RA 1HWYA 1Z25A 4CMIA 5HHTA 2AJBA 4F86A 2JS7A 5J59A 4DEVA 3KJHA 4TN5A 4GP7A 5BNIA 1I3OA 4YCMA 1DHRA 4LKOA 2OFXA 1N5MA 3L04A 3TB6A 4BZPA 2Q3JA 1GKIA 2PX4A 4BC1A 1XTVA 2NACA 3DP9A 1AKWA 4I36A 5HOEA 4HLDA 3O93A 1DARA 6AT1A 1W46A 2FN4A 1AH2A 3JAWA 3I0ZA 2HT1A 4RPIA 3DEAA 4OOEA 4UPEA 2WWHA 4IJUA 1YTLA 3E9YA 3H65A 1V5FA 4QXMA 5TMBA 1P18A 1GLNA 2TSYB 3GOHA 1T3HA 4J0QA 4UARA 2QRMA 2CJWB 4ZCIA 4K05A 4DLTA 5F7JA 2ARKA 2QTVA 3Q3JB 1ZI9A 2FQYA 2ZEJA 4IYJA 3VR2D 4ETWA 4HWKA 4QRIA 3FMOB 4UASA 2QPAA 4E14A 4F38A 1O96A 3V4PB 5JZVA 5LBIA 4AJNA 1TT7A 4D6XA 4U2BA 4WACA 3T7KA 3WA6A 1EQAA 3H9BA 1Z35A 1YDFA 2EKZA 2R60A 4I8IA 1W88A 2QVGA 1D7OA 4HMQA 4GZ6A 2CVPA 1EMDA 3PK0A 3LZ6A 3CWZA 3I01M 1Z7WA 2KS6A 4FZ3A 5L53A 1LA2A 3ITEA 4HDRB 1U0OC 1L4BA 4W5TA 1FLDA 4HH1A 3WQSB 1X13A 3VV2A 1CUSA 2CHVA 2HRDA 3E5MA 3EUAA 3CNBA 1XHEA 5SV2A 4C87A 1G7SA 1WTCA 4XASA 1HE3A 4U3JB 4PSVA 1CY4A 5G2OA 5CJPA 1VPLA 3NO4A 5J4YA 2FX2A 1AGRA 3MT9A 4WECA 4LF6B 3GJSA 3WB1A 3UG6A 3ILYA 4MV7A 3OF3A 5IM4F 1U2EA 3TTTA 1RPTA 2B61A 3K70B 2QQFA 1OVMA 1EGQA 3D2BA 4GQBA 2J4FA 2UDPA 3LH5A 4UTPA 1V8PA 4U7DA 4CKEB 1XPOA 1WB6A 2A0UA 3FGNA 4H6VA 3CY6A 1G8KA 1SBCA 4RNCA 1AC5A 2JJ8A 4MUIA 5HW0A 3A4MA 5IDWA 3NHWA 1ZOLA 4MRSA 4V0RA 4NCHA 3ZW8A 2ASVA 1QJCA 2XTZA 5AVZA 1NQ5A 2C9OA 4Z9YA 5TRTA 4LRYA 4ZO9A 5LP6B 2R97A 3DMHA 3VR5A 5KINB 3DFZA 5C5IA 2RKBA 1V7CA 3LBNA 3NHZA 3QW2A 4IPTA 4XVHA 1KDZA 5IKPA 4QTTB 3RAFC 4B17A 4CM8A 1UBNA 3EGOA 3RTBA 4B3IA 3FJ1A 1PCXA 2X0IA 3WGTA 4OHFA 2WMOB 2UV8A 1R8JA 3TS1A 3KXKA 4WFJA 2OUIA 1N8KA 2DT8A 4FBMA 1FTSA 5LNK6 3VGJA 1L5RA 2C5BA 4P2GA 4BL5A 2I3ZA 6REQB 2OK8A 3SVTA 3HJGA 3LQKA 5EHNA 3OICA 3U7QA 2ATCA 2W11A 1ISSA 1MNQA 5F33A 4E15A 3AF1A 1FTGA 4JSTA 4HBGA 4TLMB 2EW8A 1WLYA 2O1EA 4LXXA 3R7LA 4KRFA 2VXBA 3IOBA 2QLLA 2W6JD 2ZAIA 3OE7A 1EGVB 1ESDA 3GLTA 1NI5A 1D1QA 1A0OA 1INLA 4XJSA 3I1JA 1QGYA 1LGYA 2F1KA 1FFXA 1QK5A 2AI1A 1SCUA 2GQ0A 2HQ1A 4ZALA 4B45A 2NO1A 2WUFA 3T3IA 4BGVA 1KDRA 1ZEMA 1PZXA 2IYZA 4B3GA 3L7AA 3HDYA 3I72A 4RD3A 4MVJH 4DIKA 4FX2A 4K6KA 4PPNA 4XOUA 2PCLA 1CQPA 1PQ4A 4DNPA 4HGQA 2P4QA 3K9HA 4LK3A 5BQOA 1WHTA 5FI5A 4WN9B 2H0QA 1EINA 2A7XA 3VR2A 4UTNA 3PRHA 4UZFA 3RB8A 2I66A 3F46A 4YAUA 2BZGA 3VC1A 2DKOA 1DB3A 3GZ4A 5A62A 2D3TA 5CW1A 4HNUA 4HVLA 1JG1A 2IYRA 3Q85A 3LWDA 1E0JA 2BKEA 2EARA 1EFTA 4AM8A 1JFTA 5EA2A 1ETHA 1B0PA 4Z7NB 1PUXA 4MRVA 4AMBA 5BWNA 4X64B 2P65A 4TTRA 1V3UA 3RS8A 1JN0A 2OHJA 2PT7A 5H80A 4DJEC 2XWSA 5FORA 1Q84A 3NMUF 1NMQA 2I2AA 2O06A 4ZCSA 1EAYA 2NZ8A 4KIFA 3FMGA 3RW9A 4WZ6A 5ICGA 3H16A 3PITA 4E4TA 2AJ8A 4W9MC 3GEDA 3R7FA 3HSSA 2IUEA 4YP0A 1VE6A 4LDZA 4RMHA 1LF0A 2A5DA 1EVKA 2AFVA 1CUEA 1KQNA 1MR3F 4TMWA 1Z6GA 3GUCA 1DAGA 1L8QA 2XTAA 4K28A 4UVIA 3A10A 4ZHQA 4ZZ3A 1XTTA 4WINA 2JBAB 2WHYA 3TKAA 1XFAA 2GWRA 2Q99A 4IF6A 1QIHA 2AS0A 2C3PA 4G25A 5BQXA 1J6UA 1GFIA 3CR8A 3O1JC 3ZE2B 3PDIB 4XGIA 4IILA 3WYFA 3IDFA 2FZLA 3RTAA 3ZU2A 1IXZA 1OVGA 1JEEA 3TRKA 3W7BA 1USWA 2JIQA 4L27A 3OQ6A 3JWEA 4K81B 3MCUA 4BEBA 3D9QX 3R5TA 4D92A 2Y1WA 1W2WB 1RAEA 1OT3A 3OTOB 3THYA 2FH5B 3AIIA 4OK6A 4YH1A 4C7OB 2VN8A 1E99A 3K1JA 4URXR 3IKTA 1NVEA 4PXYA 5G1OA 1NC3A 5ELXA 4NCKA 1QC5B 5KX5A 2GD6A 4HDKB 1ZN7A 4MUFA 4M3NA 5JCOC 3T1TA 1CUBA 2J4CA 4TMTA 3DZKA 1OLXB 3HGQA 1M5RA 3L84A 3BGIA 3CRW1 4A0RA 4XZ3A 2GNPA 4GVLA 5CYOA 1O08A 1A9TA 2L69A 4IRXA 2UU9B 3LQYA 5CEJA 2XB4A 1TAGA 4FIDA 1CZKA 5H9WA 5BN3A 5ABPA 2PDAA 1P29A 1VG0B 4F1WA 2GBPA 1F06A 2ZUCA 2IV7A 1TC2A 3B3AA 2F4NA 2VXOA 3EVGA 1ISJA 1HFJA 5DLYA 4TVSA 3N8HA 5AI6A 2CNNA 3KEGA 3HJBA 1YAHA 2E6UX 2GAJA 3TRIA 4LVNA 4AYWA 5AW1A 4ASUD 4IIGA 2B2NA 4BLRA 2VDOB 3NANA 4TWRA 1CEYA 1F8FA 4IRUB 1YQDA 3GP3A 3NAQA 4LSZA 4YMIA 2NNLD 1EFLA 1K6IA 3KYDA 4E11A 2J0QA 1GLVA 1U6IA 4D97A 2NU8A 1O6FA 2C98A 4ZFNA 4KHZA 3PFGA 4TKUB 1T8YA 2WYUA 1DQRA 3RAPR 2O2SA 3D8UA 3ANMA 3DF7A 4IP0A 1XBTA 4Q7LA 2FMKA 2Y05A 2O7QA 1EM8B 3PVCA 4WA7A 3U3DA 3R5HA 3QEMA 4GUAA 1JE0A 3FZQA 3K31A 3N8DA 1S4QA 3NYIA 2NV6A 2IYAA 3DJYA 3OM8A 4LYGA 1GGMA 4NH4A 1GITA 5DIZA 3TZ6A 1YZKA 4BQQA 3EG5A 1SZDA 3OY7A 4ARBA 4F9EA 3IKJA 3SGLA 1K5GA 4U2FA 3SDZA 4BGUA 3TIIA 4HHEA 2WAAA 1LB1B 2QY6A 3DH0A 4YEDA 3ZK8A 2CXNA 2LUOA 2AI2A 3QSGA 1U0NA 4MJXA 4V24A 3VR6H 2HLPA 5AO9A 2NSJA 4JBIA 2ZSFA 3SQWA 1PR1A 5TV2A 1IBMB 2FYTA 4XM1A 3TIFA 1ZVQA 2ZIVB 4EZIA 5JJKA 3MZ0A 3VI4B 2B3TA 4J7CA 3ZIAA 5IAEA 4XJXA 3OZTA 1FU7A 1F14A 1Y4SA 4BCDA 3M33A 3AL0C 2AJCA 3O31A 4MQEB 3UIEA 1FSSA 2OGWA 2ZIWB 4YGYA 1EUDA 3OFND 3ZBQA 2AG1A 4CTMA 1ZNZA 3NC0C 1ORTA 5TQVA 3LXXA 5C9ZA 2ODNA 1V8FA 2PWPA 1W34A 4RDIA 1GXSA 5SY6A 4KYUA 1JA9A 1JWAB 4KWTA 4EPRA 3V46A 3OC0A 3ZNQA 3RPEA 4QQFA 3W9SA 2SKDA 2OHOA 4IUDS 1RXSA 2Q62A 3ZYCA 4ISCA 5JFTA 1G20A 1HGXA 1HZZC 1PL0A 4FYHA 1NLUA 2C0CA 3PSHA 5B37A 4DC0A 1CY8A 3D6JA 5JXGA 1Z6YA 5JUWA 2R3SA 2JLCA 3WICA 4QUBA 3RI3A 1H2YA 3HVHA 4BEWA 4U1RA 4WXHA 3OPMA 5BYBA 3OOEA 3KYBA 4EW1A 4LBVA 5D5QA 1QIFA 1V2GA 5EZ5A 4HDMB 4I46A 1LBQA 1Q14A 3IPCA 4FFBB 4KQWA 5I5GA 4JC8A 4WLFA 5J2TB 1OJLA 1VB5A 4UNSA 2BBSA 2WUWE 3UWKA 3TAXA 5DF1A 3VJLA 1THTA 4EY5A 3AR4A 1BVYF 2AEFA 4A82A 5AVWA 4C7JA 5FD8A 1Y3FE 4OUDA 2IHZA 5L9AA 3U60B 2QENA 2IFTA 1LKZA 1R4NA 1G2QA 2DPMA 2WICA 1JE1A 1DHTA 2AYXA 3EGVA 3PG5A 4FHDA 4Y2RA 4C6TA 2VJMB 4DG5A 4BZXA 4MI9A 4YMGA 3L7DA 1MB4A 2JKVA 3DEZA 3AU9A 3KQPA 1IMJA 1TCVA 3GBSA 3MTIA 2DPHA 4C30A 3U7JA 3PF9A 4DMHA 5B7GA 4DBVO 3BFJA 4O4LB 2HSGA 2C9DA 1D03A 3EF3A 4UATA 1JEOA 2HHJA 1GWNA 2Y9PB 4E09A 1PVDA 3R6TA 4TMKA 4QOSA 3TCKA 3NUZA 7MHTA 1R3DA 3AEQB 1U8YA 3ELDA 3LDHA 2Y0DA 2NTJA 4P58A 4RXUA 2I33A 4INAA 4ETNA 1PNRA 4MR9A 1MEJA 3R5SA 2GVZC 1SQ6A 2NLOA 4IG9A 1NHWA 1V8ZA 3I32A 4CLRA 2KLBA 2O48X 3EN0A 4H6PA 2F8TA 3CZ4A 1V7PC 3NEJA 2P11A 2AFRA 4WV3A 5GQSA 5F5XA 3V8QA 3T1QA 1T2VA 4NQZA 4NU8X 3UB3A 1W7AA 1FXWF 1O7JA 1J5PA 2PSSA 3OJLA 1NQTA 4KCGA 3MJTA 4KVZA 5EQFA 2GM9A 5KJCA 1F6WA 1IDOA 1KZHA 4FHFA 2Y27A 4MHTA 2AC4A 2H4XA 3LDAA 3G8DA 3I12A 3P19A 4JY7A 1V4VA 4RA6B 1YDEA 1Y8ZA 2ZIAA 2YMMA 1E4EA 2J3JA 1UBHS 2BGNA 5AIAA 2FVXA 5FTJA 3AUUA 3HZRA 4IIDA 2XZPA 1YDWA 1Q0TA 4NBWA 3QKRA 3CH4B 1QFSA 3SE7A 1PFYA 2P68A 3F1KA 2GAAA 3CZ5A 4RGVA 2FMTA 4KEAA 3HADA 1R15A 3E84A 4LTNA 3WKEA 3T8YA 2BBOA 4QSHA 3TE6A 1M5UA 3JAWB 3AOGA 2Z4RA 5JMPA 5FNZA 4UEWA 4R1PA 1FBNA 4ZQIA 3DD5A 3L0IB 4C1BA 2QMZA 4EA8A 5HVNA 3P9NA 1O6BA 3GJRA 1P2DA 2ORWA 5KAPA 4LC0A 1G5RA 3O1HB 3TOVA 1U1GA 2Z8YA 2R8ZA 3WMEA 5JQWA 5L51A 3PYLA 4MUXA 2ZREA 3RIYA 3BGSA 4YMTA 4ZJZA 1LVGA 1ZNWA 3BB4A 4PO9A 3U1VA 2ONJA 2PH5A 2A67A 2W93A 4YV0A 4D3FA 4IGFA 5G40A 5H8WA 3GJ7A 1Y82A 2D7JA 2EX1A 4I1VA 4R1MA 4YUAA 3S29A 4WL0A 3IP7A 5JSFA 3IAEA 3IGFA 4B85A 1T9HA 3CCCA 1JZTA 3SAJA 3PRYA 2REQB 4Y6RA 2OP1A 3I6YA 1J22A 2D1RA 2IYXA 3D5EA 4EPYA 4ND8B 1ECBA 1YOVA 5KQRA 2IQ5A 2OZLB 4EG1A 1F3OA 1FNSA 5CG1A 4OD0A 3FAZA 2ATEA 1DBSA 2CL5A 2Z2ZA 2C4KA 3V7UA 4F6RB 1NSFA 1C81A 3LK6A 4M88A 2ZBQA 1IEQA 1G20E 4J90A 4NFHA 5E6UB 5EZYF 2CV2A 3L6BA 1FPMA 1XNQB 5T57A 2Q7XA 1H6CA 1DUIA 4X8HA 3NNSA 2HRRA 3WISA 1GVHA 5DX8A 3V3TA 4LXGA 5EWMA 5JFGA 3FYUC 1B73A 4MQ5A 3W2HA 4RXTA 3ZHUA 1IN1A 4N9QA 1SHKA 1ONOA 3E2IA 1Z5GA 1M34A 1VA5A 2D62A 4TXNA 3HUUA 3VM6A 5JBNA 5KSWB 5LQJA 1Z4NA 4DJJA 4CKWB 3TLXA 1MJFA 3GIWA 3PE6A 1XR3A 3L1UA 1L7DA 2XA9A 3F6YA 2EAUA 5E7MA 3SNKA 3PU6A 4YMVA 3IQEA 3MT7A 1KI9A 2ZW9A 5JATA 3UT5B 3KSZO 2QT1A 3IP8A 2FMUA 1ZH0A 4LNHA 4M0PA 4M76B 4BLPA 1IN8A 2B0JA 1NF9A 1Y1QA 1CUJA 3N28A 1Y4DE 3RYIB 3NGLA 3LZCA 1GZ5A 2V7XA 3WK4A 1YR1A 2JANA 2ZS7A 2QN9A 3F49S 3ZHTA 4IKPA 5ALFA 1OV4A 1QGZA 3DYVA 5JAOA 2CLSA 1IRIA 2AUNA 3PGKA 4A6XA 4DZZA 3GCXA 3OTHA 3FW1A 4UDNA 2JAXA 2UYGA 3ETDA 5CT9A 4UBNA 3D4OA 3E7DA 4KDFA 2XCSB 1X7YB 3E4DA 2NUTA 1HMPA 4FMPA 2TMYA 4YRAA 3G82C 2YJNA 5HDBB 1MA0A 3PXCX 2Z09A 3NX4A 4RSGA 1MAUA 2O2IA 3G02A 1BVHA 1SC1A 2CCKA 1EFHA 3B7GA 2PMEA 5LLDA 1Z18A 4H4EA 3HM9A 1GUYA 5GV8A 2PT9A 4RV5A 3NETA 1KYWA 4PWYA 3HCOA 4N0PA 4XYLA 4MHOA 4NV0A 2BR4A 2G72A 3A37A 3SZOA 5IDXA 1M2NA 1IQUA 2IZ6A 5C8VA 4FHCA 1TKCA 4JI2B 3FLBA 3RVJA 3VX4A 1NUTA 2CJFA 1OUMA 5F51A 5GOTA 1C9KA 1YQGA 4C0QC 5KVVA 3HJTA 2FPXA 3FY4A 4BGPA 2G1JA 2PLFA 1QO0A 2X7JA 1EUQA 3A2KA 2DZDA 4U8GA 3MAGA 1SUSA 1B74A 1YJBA 3CLKA 5IHXA 5C4MA 4R9RA 3COYA 3K0CC 1RWOA 4MQLA 1KAHA 4GWLA 4HGOA 4KDRA 1ZQ1A 4M1QA 4HQRA 3RFUA 2YQZA 2BGJA 2JKYA 2FZKA 4JYBA 4GYJA 5TR9A 3SKYA 2JDIA 5K99A 1XA0A 4W7IA 1Q1EA 4O4HA 1YB5A 1EFAA 3IMCA 3TW6A 3GWGA 4CQMA 3IBGA 3TLAA 3WYDA 1D5CA 4UD6A 5L95A 2O8EB 4RPLA 4DWWA 1MHPA 3ITDA 4KYTA 4MQFA 1WB4A 1RLMA 3IHLA 1E5XA 1GSHA 2O05A 1P0QA 1JSZA 2DWPA 3ETNA 3NHFA 1FSZA 4KNWA 4PZEA 4BKOA 1QFYA 1BJRE 1JSXA 3V2GA 4DUZB 1F60A 5BSMA 1U3FA 1HURA 1L1FA 4X3PA 4B6GA 2V4UA 2WTUA 5DHAA 1A04A 3Q0EA 4MR7B 5SZIA 1SUAA 2OCKA 3I4FA 4FD3A 3ROEA 4E4RA 1GSIA 1JYSA 4QU8A 3IUBA 1TVKB 1U9YA 3KAQA 5CLQA 1JXQA 2E89A 4UREA 3ZWDA 2C04A 4ZVSA 1L7XA 2A88A 4UW9A 1PZGA 5CLIA 3SXJA 3WZLA 1YRYE 2G5PA 1P7YA 4ARCA 3EEYA 2PLWA 2G4VA 1PBTA 4BMYA 4KMRA 2BTQA 3JQDA 4BN5A 2C95A 1VBFA 1PJBA 2HMSA 4TZKA 2CMFA 1HEUA 2DCUA 2WQ6A 3H19A 5FBZA 3SX4A 3O4VA 4PY2A 1C1HA 3LECA 4KIJA 5ECDA 5EEHA 4X66B 1N32B 1ZOOA 3V7FA 3OF5A 5FIUA 3E8MA 3AERA 4LYAA 3QVXA 4WOPA 2C8VA 3CZ9A 4V1CI 1R12A 1ZSNA 4NENA 4ZOQI 5E3HA 3ZBTA 4V0SA 1U5AA 2YUIA 5EG5A 3WNVA 4XXHA 4G0XA 1J0CA 1Z2DA 3VYWA 4EG3A 3AILA 1UJ2A 3ULKA 1UMBB 1ULHA 2I6SA 3IPLA 1X9HA 3KDSE 4HDQB 2OWEA 3JZAA 2WPDA 2PVPA 4UAUA 4TKVA 1J39A 4IJQA 4M8SA 1OXKB 1RAHA 3RSLA 4MI3A 2MYNA 2QW0X