2BM2A

Human beta-ii tryptase in complex with 4-(3-aminomethyl-phenyl)- piperidin-1-yl-(5-phenethyl- pyridin-3-yl)-methanone
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN BETA2 TRYPTASE
publication title Structure Based Design of 4-(3-Aminomethylphenyl) Piperidinyl-1-Amides: Novel, Potent, Selective, and Orally Bioavailable Inhibitors of Bii Tryptase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bm2A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bm2A01
3F1SB 5FBEA 3SGAE 4WVPE 3GOVB 4JK6A 1ETSH 1MZDA 4SGAE 1GI7B 1V2PT 1MTNB 1DLKB 1EJAA 1FXYA 2WV5A 3GYLB 1QB9A 4D8NA 8LPRA 1C5VA 1J17T 4E05H 3FP8E 3RC5A 1ETTH 5FPYA 3AAVA 1TMUH 1PPEE 5DP8A 1MAXA 2PTCE 1JOUB 3E1XB 3S7HB 3SI3H 1N8OC 1ANDA 2Y7ZA 3A87A 1VZQH 3GY3A 4TWYA 1AWFH 1BTZA 4BANB 4BOHA 1MTSA 5F6MA 1C5XB 4Y8YA 2EI7A 1HGTH 3O8RA 2JH0D 4NSYA 3ZZDA 1DWCH 1GDNA 2H6MA 2AIQA 4MNVA 1MD7A 1S6HA 2YNBA 3SNDA 3A7VA 1BMAA 3LGWA 3SOSA 1FY5A 3EGKH 1GJ5H 1VITG 1SQAA 2RCEA 1UVOA 1F7ZA 1GGDC 3JZ2B 3UWIA 2CMYA 2TBSA 2O8LA 2ZQ2A 1SMFE 2CHAC 4YLUA 1O2TA 2BOHB 1A2CH 5GWZA 3PTBA 1C5WB 1OPHB 2ZDKA 3F9EA 3TITA 1F0SA 1MZAA 2WPKS 2SGAA 4RKJB 1TBQH 4ABAA 1H1BA 1O2MA 1SSXA 3BTME 4U2WA 3UR6A 1E0FD 3ATWA 1OX1A 3TJUA 2ZEBA 1BRBE 3OY6U 4GVUA 3SJOA 1UJ1A 1C2DA 1HAVB 4Y6DA 3O8CA 1Q3XA 2NU0E 4D7FA 3E8LA 1ELBA 3MU0A 3ZYDA 2AGIX 2Z9JA 2UUYA 2A2XH 1DWDH 4DURA 1IHTH 2C8WB 4WJG2 5FHTA 1H4WA 3A86A 3AW0A 1GHYH 3M5LA 1T4VH 1K22H 1RIWC 5GIBA 1IQJA 4X8TH 1SQTA 1GI0A 3QTVH 2FZZA 3A8BA 1AGJA 1C5NH 2AEIH 2BOKA 1T8OA 4ZMAH 1P03A 3P8NA 1LKBA 3T29A 3E90B 1YPMH 3M3SA 2WPIS 1EUFA 3GY7A 3P8GA 1A5HA 1DSTA 1NO9H 2FPZA 3MHWU 2JETC 2OC7A 3A84A 3RXRA 2OC1A 1UTLM 2P3TB 4HI3A 3GYMA 1BBRH 1A3EH 4FUEA 2ALPA 4AYVB 4NZLA 2Y7XA 1P2OA 1NROH 2CF9H 3ZZ8A 1GVZA 3OSYA 4Q7YA 3ZV9A 1D6RA 3ZYEA 2PR3A 1UHBA 3LONA 1NTPA 1SGPE 5FCKA 1PPHE 4Y8XA 2C90B 1GJCB 4H42U 1QL9A 1QURH 5L2YH 4DIIH 2BM2A 2GCTB 3D23A 2SFAA 2CN0H 1UTNA 1O2IA 5ESTE 1O2UA 2ZFSA 5ABWA 4XBDA 2J34A 2OC0A 3HATH 4GCHG 2EI6A 2ZO3H 1D6WA 1V2JT 1Y3YA 3SJ8A 3C1KA 1P2KA 3L33A 4KTUA 4CRGA 5E0JA 1RGQA 1NRNH 1VR1H 2F3CE 3SV8A 1ACBE 5CHAB 3EA7A 1JRTA 1QY6A 1O2JA 1C2MA 1YPJH 2XWBI 1OYQA 1Q2WA 1L1NA 2KAIA 3P95A 4JZ1A 1F5KU 2PUXB 2HPQH 1W12U 2Y80A 2STBE 4KELA 1GMCF 3TJNA 3FANA 1OWIA 2XYAA 1F5RA 1TALA 1ELVA 1TGSZ 4K5ZA 4TYDA 3FZZA 2F83A 5HM2A 3GDSA 1C1QA 1C5YB 1LPZB 5DKMA 1ZJKA 3SNCA 1A3BH 1UTKA 3BTGE 5HXFA 4Y71A 4HFPB 4B74A 2PHBA 1QL7A 2V35A 1TOCB 5E0HA 3UQOA 2ZCHP 1DWBH 1VITH 1QTFA 3PTNA 1ARCA 1BZXE 1NU9A 1DVAH 1ELAA 5JPMH 3A8AA 3GDUA 3MU4A 1C1SA 3QN7A 3SV7A 3DFJA 2LPRA 3P8FA 1ZPCA 4DG4A 2ZU1A 2F9BH 1EKBB 4CRCA 3STJA 1XUKA 3TGIE 1AY6H 1WQSA 4AFZA 2F9NA 3HGNA 1AVXA 1GI5A 1WQVH 2FTLE 1GL1A 5T6GA 4LZ4B 4BAKB 1J8AA 1H8IH 2WYGA 4YOJA 3LOXA 1BIOA 1NRSH 3LC3A 3SI4H 5DK1A 1YCPH 1THPB 4I8HA 2Y5GA 3MO9A 3M61U 5EQSA 1E36B 5C67A 5K7RA 1P02A 2O8UA 1FNIA 5EXMA 1FUJA 1YYY1 3SZNA 2RG3A 1TYNA 3OTJE 2PW8H 3GISB 3R3GB 2ZGHA 1HUTH 2B0FA 1RS0A 1K1MA 1ANEA 4INHA 3F68H 2GGVB 3H7OA 3T2NA 1CGJE 1AKSB 4FUIA 4UEHH 2GT8A 4YLQH 2O8MA 1GMHG 1O2RA 1W7XH 1F2SE 4A1VA 3LJOA 1O2XA 2BQ6B 2OP9A 3B23B 5LPFA 2SGEE 3QK1A 3HKIB 1XUHA 3SJ9A 1T8LA 4ZKSU 2UWOA 1GJ7B 1QJ7B 4I31A 1GBCA 2EI8A 3G01A 1O3BA 4R0IA 1K2I1 3A83A 1N6XA 3QO6A 4U01A 5A2MH 5A09A 1O35A 1JIRA 5C1YA 3GCTF 1ZYOA 2ZFTA 1LO6A 1OSSA 3DA9B 1EAWA 1O5CB 1GBJA 1V2MT 2R9PA 4NZQA 4KKDA 4Y7BA 1IQFA 1AZ8A 4X6MA 1O2ZA 1G3DA 1S5SA 1PYTC 1ZTLA 5A8YA 3MO3A 3RC4A 1DOJA 1BJUA 1GVKB 1QFKH 4GUXA 2V3HH 1GDQA 3VB3A 4GAWA 1ID5H 1V2TT 1GJAB 2TIOA 3BTQE 4Q7ZA 5CHAC 4M7GA 3URCA 3VPKA 3SORA 4DGJA 2OINA 1E37B 4FU8A 2XCFA 1DXWA 2Q6DA 2A5KA 1SLUB 2ZQ1A 4GHQA 1W3CA 2G52A 2SNWA 1HLTH 1GJ8B 1A0HB 4F49A 1EXFA 2ZHEH 3ZVFA 2ODQA 2PKSC 2W3IA 4XOJA 2GV6A 1GBTA 2ZCKP 2QV1A 3SU5A 4ZH8A 2XC5A 2ZFQH 2SGPE 2A2QH 3A82A 2OBQA 2ZKSA 1FPHH 3B9FH 1K21H 2BLWA 1Y8TA 4MPVA 2SGDE 1N8OB 4RKOB 1AN1E 4B2AA 1GWAA 4NFFA 5F8XA 1TPPA 4ABGA 4WMFA 1AB9B 3SNBA 4MNWA 5L2ZH 1P2IA 2FODA 1KXEA 2HNTC 3NCLA 4LXBH 2R3UA 1GJ6A 3PLKA 4X6PA 1X7AC 1AFEH 2HNTE 3GICB 5LPEA 3SUEA 1CGIE 1KTTB 1P09A 1S0QA 1SHYA 2DE9A 1DT2A 2F9OA 3CS7A 1WU1A 1OP2A 1O5FH 3U8OH 3UREA 1P2MA 1GGDB 4CH8B 1FDPA 1XUJA 2ZP0H 1O2PA 5L30H 4X6NA 5GPIB 2XRCA 4XDEA 2OQUA 2YOLA 1ZRBA 3OX7U 3MO6A 3RXTA 4FUFA 1C5ZB 1O5GH 1GCDA 3E0PB 3V13A 2H9HA 3QLPH 2QIQA 2GV7A 1A1RA 4U30A 1CE5A 1GPZA 1V2LT 1QB1A 1TWXB 3L6PA 2PFEA 4XSKU 2Z9GA 5K0HA 1O2VA 1F5LA 1PQ8A 3UIRA 3N7OA 3LC5A 3VEQB 3V12A 4NG9H 3A7TA 2CXVA 1CA8B 4ZKOU 3FZDA 2P3UB 2VB0A 4MNXA 1QIXB 2HWLB 3OY5U 4CHAC 5I25A 3TNSA 4X8VH 2Z9KA 6GCHF 3T28A 2VJ1A 2A0QB 2F91A 1SGDE 3DHKH 3O8BA 1PJPA 1RIWB 4B76A 3ZV8A 1IQHA 2W3KA 2ZECA 1YKTA 1OWEA 3HKJB 3BEFB 3UNQA 4WXVA 1OP0A 1QBOA 1OWDA 3RDZA 3GY8A 1FN6A 1CBWC 2ZF0H 2ZHQH 2WPHS 5FPSA 1KLIH 2C8ZB 4Y10E 3UOPA 5G4BA 1UHBB 3MOCA 1C1TA 2ZDMA 4NIYA 2BD5A 2UWPA 1RTKA 1GHBF 3Q00A 2JETB 4O9VA 6CHAB 2VH0A 2BD8A 1TQ0B 1EPTC 1G3BA 2ZHWH 2HOBA 2F9PA 4AFSA 4MPUA 1BHXB 2XC0A 1C2LA 3AAUA 1FY1A 1V2ST 4Q2KA 1DY9A 2OD3B 4Y8ZA 3LT3A 2BQWB 1SGFG 1GHZA 5EXLA 1UVUH 1O3OA 1GG6C 2Y5FA 1EPTA 3M35A 1HXFH 4IGDA 1C2GA 1C2FA 1OS8A 1EAUA 3UUZA 1GI1A 1HAYB 3ATIA 2Z94A 3EQ0H 3TH2H 3TJOA 1V2NT 2VIDA 3RP2A 4AYYB 1G2LA 2NU1E 1KDQA 3RU4D 3M37A 5EODA 2ZG0H 4NIXA 3MH6A 1GMCG 1MUEB 4A92A 2JKHA 1ABIH 2VWNA 3LH3A 1HAGE 1LPGB 3LKWA 3Q3KA 4NA8A 3SGQE 1FAKH 1GBBA 1MBMA 3VB5A 1HAXB 4IC6A 1TA2A 3BEUA 1A0LA 4IMZA 3FVFB 4ISOA 2VIQA 5JBCS 1K9OE 2VGCC 2ZGJA 4BAMB 3OYPA 7GCHF 2WPMS 2ZGCA 3FAOA 4HGCA 2W26A 1EP6A 2WPLS 1ANBA 4THNH 1JWTA 3KN2A 1V2OT 2GZ7A 1AB9C 1HRTH 3ZZ4A 4OS2A 1NS3A 3U1IB 1TFXA 2P8OB 3QZRA 3MU5A 1TE0A 1ZSKA 1LMWB 2ZGXH 3ESTA 2BD4A 5FXLA 2J9NA 2PTNA 1OWJA 4AOQA 1UK3A 1D3DB 3SQEE 1GJDB 2HLCA 2AGGX 4ZAEA 4X1QU 1QRXA 4BTTB 5DP3A 4JZFH 1THRH 2A45B 1OP8A 4LZ1H 1J16A 1YPGH 4NA7A 1RJXB 1O5BB 1AVGH 1O0DH 1BTUA 1FY3A 1ZPZA 1MTUA 1LDTT 2GDDA 2PUQH 3E3TA 4O3TA 4FVDA 1H9HE 1DFPA 3BN9A 3MH7A 3U9AH 5A0CA 1QNJA 4CRBA 2ZPQA 8GCHF 4YT6H 2A7HA 3S9BA 3E0NB 1EB2A 1O3JA 1W11U 3QX5H 1C1NA 5AVDA 3EA9A 3PYHA 3SHCH 4JYUH 1E38B 1EZUC 1FN8A 1ZMNA 2BD9A 4Y0YE 3RXKA 1QR3E 5FX5A 3RXCA 5CE1A 2FX4A 2BVSH 3VB6A 1G9IE 2HGTH 2VINA 3UR9A 1K1NA 1P06A 1LHEH 1LVBA 1BTYA 1Z8RA 2A31A 2EEKA 3LDXH 2QGRA 4IC5A 3QTOH 1FAXA 4K60A 4D76A 4UD9H 2OBOA 3ENSB 4D7GA 3BG4B 3SV2H 2D26C 3BTFE 4I8LA 2SGFE 1CGHA 1EP5A 4GSOA 4FUBA 4JZDH 3L3TA 2ZDAH 3O8DA 2V0BA 1P2JA 2PKAA 2V3OH 2ZHFH 2AH4X 1CA0C 2A5AA 4I8JA 1G3CA 5TCAA 2WPJS 4D9QA 2FOGA 2HPPH 1DUAA 4ZHLU 1GBKA 1LHDH 3LGIA 4AFUA 5AFZH 3UY9A 1GBFA 3UTUH 1ABJH 2ZDVH 1HBTH 1YC0A 2C8XB 1Q31A 1Z6EA 1A5IA 1SHHB 2BLOA 1JRSA 1B0FA 2VIPA 4NSVA 5EPNA 1SQOA 1UVSH 3M3VA 2Y82A 1GI2A 2BDIA 6CHAC 3GCTG 1BTWA 1YPLH 3LGYA 1C1RA 4YM9A 1PQ7A 4X1NU 3KQDA 1HXEH 3SU4A 1K28D 3ZVCA 1C1MA 4MPXA 1DXPA 5C1UA 3MH4A 3SU3A 5HGGA 2J95A 5LH8A 1GBHA 1O2KA 2C8YB 4JYTA 1EOLA 1YPKH 1QHRB 1A4WH 2FS9A 1AHTH 2P93A 1GJ4H 1BB0B 2XXLA 5GJ4B 3RUOA 1D9IA 3FP7E 2P59A 4K1TA 2C3SA 4AB9A 3TIUA 1RTLA 2LNCA 1TGCA 1NZQH 2H5DA 3ZZ7A 2XBXA 3SGBE 2CGAA 1TRMA 2QF3A 1YGCH 1MCVA 2HRVA 1YLDA 6ESTA 2QA9E 2TGTA 3NWUA 1C2EA 5GCHF 4CBOA 4U32A 2Z3CA 4ESTE 4FU9A 2VWLA 4A1XA 1Z1JA 3SNAA 1HAPH 2H9EH 3I29A 2WUBA 2VWOA 1CO7E 3P6ZB 5JBTA 3W94A 2QXHA 3Q76A 2ANYA 5FX6A 4MLFB 4X0WU 4NIVA 3V0XA 4DCDA 2PKSB 2ESTE 1ZRKA 1K1LA 1SGYE 3GY5A 3I77A 1TPSA 1C4Y2 2P8OC 2H5CA 2BD7A 2YNAA 1BCUH 1FI8A 4BXWA 1ELGA 4I33A 1NFYA 3BTKE 1AD8H 3QUMP 3E91A 4LK4A 5JBBS 4CR9A 3RXQA 3CS0A 4XBCA 1EZSC 4H6TA 1SVPA 3D62A 3K2UA 1GHWH 2TPIZ 5A8XA 3Q3YA 4UFDH 3HK3B 2FOEA 3SJIA 3DT0H 2AMPA 3ZZBA 1F0UA 2AFQB 2VVCA 2M5TA 1DANH 2XTTB 5A0AE 1JIMA 3T5FH 5AFYH 1INCA 1WUNH 2Y5HA 1SC8U 4DT7B 1RXPA 1Z71A 4AB8A 1MAYA 1H9IE 3SU2A 1YLCA 1IQLA 1O37A 1AWHB 1UVPA 1SB1H 2DE8A 3R0FA 1K1IA 3PMHB 2NU4E 3PMAB 3KQBA 1D3TB 4BTUB 1WTGH 1O32A 2Z7FE 1O2WA 2BDYA 1S82A 2ZPRA 1E34B 4JMYA 4MNYA 2HVXA 3TH4H 2BB4A 1NC6A 1QL8A 1BBRE 1QA7A 2Y81A 1HV7A 3QWCH 4UFFH 3VXEH 8ESTE 4FUHA 6GCHG 1EQ9A 1TBZH 1THSH 4NCYA 2NU3E 2PGQB 1FV9A 1W0ZU 1W8BH 1JMOH 1P12E 3BG4C 2G5VA 1O2NA 1DX5M 2AYWA 1DWEH 1XVMA 2BDHA 4A6LA 1YPHC 1HB0B 2NU2E 4FVBA 3ODDA 1G2MA 1HPGA 3TK6A 1ZPBA 2BDAA 1MMJN 1IQGA 2GX4A 1DLEA 5T6FA 4WH8A 1J14A 3TLOA 4NGAH 1C1VH 4CHAB 4XBBA 2A5IA 1NN6A 3P17H 1HCGA 4X6OA 3ZZ9A 1HJ9A 2PWXA 1QGFA 3NXPA 2BDCA 1MQ6A 1FY4A 4DVAU 1SG8B 3BIUH 1LCYA 3M5NA 1GBMA 3KGPA 1EASA 1GHBG 3M36A 1Y3XA 4X2XA 1PPGE 4ZROA 3RXOA 1SGFA 2VVUA 3BG8A 1EX3A 4JZIA 3H5CB 4WMDA 5F03A 3TU7H 3MWIU 1L0ZA 1YCPM 4X8UH 1IQEA 2GZ9A 4Z6AH 1ZSJA 1E35B 1CBWB 1FMGA 1GDUA 1NRQH 2C93B 5AHGH 4J2YB 5E2PA 3RXGA 3SUGA 2UUKB 3V3MA 1UCYH 1LKAA 2VIVA 1G36A 1JXPA 2G00A 4NIWA 3BTTE 1TNGA 3ZVEA 1EB1H 1IAUA 3VB4A 4ZKNU 3RXMA 2J94A 4ZXYH 1EPTB 2HNTF 4BNRA 4UDWH 2I6SA 2EA3A 5SGAE 4K2YA 5EW2H 1V3XA 3W95A 2J2UA 1N6YA 4X1SU 1KDQB 4IW4E 1C5RA 7ESTE 1ESBA 2BD3A 3ZZ3A 1WV7H 1S85A 1FIZA 2GT7A 3GCNA 4B75A 2ZTXA 1WAYB 2G4TA 1GG6B 5ETXA 2ZPSA 1V2UT 1SFQB 4OS6A 4YOGA 4Y11E 3RXSA 2P94A 1O38A 4ISNA 5HMAA 1TAWA 1ZR0A 3SU0A 2VNTA 3PB1E 1OYTH 2K1QA 7GCHG 1GBAA 5JB8S 3TJVA 1C4U2 1HAZB 4O3UA 2G8TA 4ISHH 1O3NA 4DJZB 2FIRH 4Y79A 1EATA 2R3YA 4KGAA 1RTFB 3RXBA 2B7DH 1W7GH 2ZHDA 1O2OA 1AE8H 1XMNB 1QJ6B 3KF2A 1XUIA 3KIDU 4K3JA 1O3HA 2VGCB 1O3PB 4CH2B 4NWKA 1O2SA 1AU8A 3RXVA 4MDSA 4ZUHA 5C3NA 2BXTH 2FOAA 2FM2A 2Z3DA 2BXUH 3CP7A 1UK4A 2AERH 2TGPZ 1SGTA 2CJIA 4WWYA 3BTDE 1ELEE 1MKXK 3RXJA 5EOKA 3DD2H 2Q6FA 1LHFH 1W2KH 2P3FH 4OS7A 1UVTH 1ZOMA 1HYLA 3BTHE 3M7TA 1KSNA 3RXEA 1ZHRA 1P0SH 2RA3A 3TNTA 4FUGA 8GCHG 1KXFA 2GMTB 3MYWA 3KL6A 1Y3WA 2WUCA 1C1UH 2XBYA 1KIGH 4ISLA 3VXFH 2ZWLH 4A7IB 2WINI 3SHAH 1C5QA 4X1PU 2RA0A 3A7WA 2ODYB 1QB6A 2A7JA 1TNJA 2G81E 3MH5A 1KLJH 3SV6A 1CT0E 3K9XB 1V2VT 2PSYA 1O3CA 2Y6TA 1ZSLA 1P05A 1KTSB 1KXAA 3PV4A 4X1RU 1O3KA 2XW9A 3VGCC 5J4QA 2J38A 1XXFA 1LHCH 4X2VA 4YT7H 1MU6B 2PKAB 4O97A 4MVNA 2BZAA 4IMQA 1CT4E 3EE0B 3KHVA 1QCPA 3LJJA 1P01A 1T8NA 3KNXA 1G30B 2Z9LA 4FXGH 3K6YA 1TIOA 4BAOB 4B2CA 1VGCB 1ANCA 1V6DA 2RDLA 3RM0H 1XM1A 4A5TS 1AO5A 1S0RA 4OS4A 1C2IA 1PFXC 1BTXA 1CA0B 1YPEH 2W7UA 2WYJA 4CRFA 2FOMB 1C5MD 1ELDE 1LVYA 3M5OA 1MCTA 1MTVA 2J4IA 2ZU5A 2XC4A 1FZZA 3TH3H 4Y7AA 1NY22 1KLTA 1QA0A 1AUJA 1YBWA 5FBIA 3ZZAA 1GCTC 1LQDB 2ODPA 3NK8A 4FUDA 1ORFA 3FFGA 4MTBA 1LVMA 4ABDA 1GBDA 2PV9B 4ABIA 1ELCA 1ZMJA 2F9UA 2A4GA 2AMQA 4WXIA 3RMLH 1Z8JB 2AIPA 1ZLRA 3HK6B 4DY7B 1A0JA 4X2WA 4CRAA 2D2DA 1CU1A 2ULLA 2QXGA 2XCNA 1C5UA 4WH6A 2SNVA 1DY8A 2BX4A 3KCGH 3PMBB 1BQYA 5BPEA 3RMNH 3M3TA 2FI5E 3ZVGA 1KXBA 1C5OH 3F6UH 3MI4A 5GCHG 1SLVB 2PLXA 3RLYH 2A4RA 3PWBA 1ZZZA 1DDJA 1RD3B 2SGQE 3PM3A 3RC6A 3S69A 2OQ5A 1YM0A 2R2WU 3K6ZA 2KAIB 4IN1A 2Q6GA 5HM9A 2BVRH 2P16A 1IOEA 4IBLH 3C27B 1SGNE 1O39A 1GHAF 2A1DB 1TB6H 1BTHH 3RMMH 2ZI2H 2BMGB 4K1SA 1T7CA 2FYQA 1TPAE 1VJ9U 3V7TA 1O2HA 4ABEA 2BTCE 4K1EA 4OS1A 3U8TH 4TY6A 1W0YH 1GL0E 4Q80A 5DP4A 3TPIZ 1H8DH 3SQHE 5DP5A 4E7NA 2GZ8A 5TJXA 1RFNA 1BBRK 1GBLA 1TPOA 1Z7KA 1K1PA 2PGBB 3A7XA 3UNRA 3QGJA 1XKBC 4E06H 5C20A 1L1GA 2IPHA 3SN8A 3IG6B 1SL3A 2W5EA 2TRMA 1C9PA 1WSSH 4WF8A 1BRAA 2GVFA 1C5SA 1OWHA 5C5OA 1HAHH 2ANWA 1DS2E 3T27A 1B5GH 1O3FA 1NRPH 1Y59T 1BTPA 3PWCA 1DUEA 1EZQA 4WMEA 4AGJA 2FDAA 1NFXA 4CBNA 2GMTC 2FESH 1NFUA 1P2NA 3MNSA 3A81A 3MMGA 2FMJA 3UFAA 1SOZA 3ZZCA 2ZA5A 1G32B 1TOMH 4D9RA 2G51A 1NT1A 1UO6A 2BLVA 3ZZ6A 3M7UA 1BHXF 1SOTA 2D1JA 3SNEA 1TRYA 1ARBA 3PLPA 1TNLA 2UUFB 4BAHB 3BTEE 3NZIA 3QZQA 1MKWH 5DP6A 2GTBA 1T4UH 5EGMA 1Z8IB 3SUFA 3T25A 3ZZ5A 1ESTA 1F0TA 1Y5UT 1UMAH 2BY7X 3NKKA 2A7CA 3M5MA 2ZCLP 3PMJA 5FCRA 2VH6A 1VCPA 2BX3A 1P10A 5F8TA 1L4DA 3BV9B 5JYIA 2AGEX 4YESB 1SBWA 1ZHPA 1NESE 4R8TB 3FP6E 1CHOF 1TLDA 1VGCC 1SGRE 4KTSA 4HZHA 2TGAA 2AMDA 1DPOA 1GI3A 2BYAX 3RXDA 3SV9A 2D8WA 2O8TA 2VVVA 1Y5AT 3RXUA 1OWKA 1BRUP 3NUMA 1O3GA 1TNIA 5C2ZA 1P3CA 5IYTA 5A0BA 3RM2H 5B6OA 1UTMA 1V2RT 1H9LB 1Z1IA 3GCHC 1D3QB 3P70B 3UWJH 1TA6A 1L1JA 1QQ4A 1TGNA 4I7YH 1EAXA 1ZHMA 1OKXA 2EC9H 4INKA 2NWNA 2HALA 3WY8A 4WY3A 4KTCA 2DUCA 2G55A 4K69A 3KEEA 1HDTH 1VCQA 1U6QA 3D65E 4XE4A 3P92A 1EZXC 3F9FA 1GMDF 5T3HA 3RU4E 4VGCB 3T26A 5EU8A 4ABBA 3RMOH 2H2ZA 2CF8H 1P2QA 2I6QA 1BT7A 2GCHF 5JB9S 1GHVH 1AZZA 2O9QA 4JK5A 1LTOA 1TGTA 1YCPK 1P04A 3DFLA 2ZC9H 1TMBH 1WOFA 3JZ1B 5E2OA 1QBVH 4FUCA 1J15A 4A1TA 1GI4A 4ZKRU 1C5PA 1O33A 1C4V2 1GJBB 1XVOA 3SU6A 4YTAA 1EJNA 1G37A 1FY8E 3TGJE 1BMNH 1GVLA 5EG4A 3T62A 2XBWA 4TPYA 4MQAA 1S81A 4INLA 3BSQA 2PSXA 1S84A 1XKAC 4GPGA 1T8MA 1TNKA 1VJAU 2BDBA 4XFQA 5I46H 4DOQA 1YF4A 2FI3E 1ZGVA 1HIAA 3ITIA 5PTPA 1D3PB 1UTQA 5JDUB 3RXIA 2QN5T 5EPYA 5FAHA 3IITA 5E8EH 5LPRA 1UCYK 4LOYH 1MTNC 3EYDA 3E6PH 1CQQA 1KYNA 2G4UA 3URDA 4RN6A 1L4ZA 1NM6A 2Q1JA 3VB7A 4ABHA 1O34A 2FLRH 2R0LA 1O3MA 3LPRA 2R0KA 3TVJB 3AW1A 1PYTD 2H1UA 3RLWH 4PROA 1QQUA 5GDSH 2BZ6H 2FYRA 2XNIA 5DP7A 1SLXB 1O31A 3OU0A 3U1JB 5J4SA 1O3LA 2BY6X 3GY6A 1P11E 1ETRH 3MNBA 3UOUA 5DO4H 1AFQB 3EA8A 1WTHD 4BXSA 1UK2A 4GLYA 2ZFRH 2H9TH 3A80A 1SGEE 4GHTA 4KP0A 1SPJA 2ZIQH 1TABE 5C1XA 2JH6D 4MG3A 5L6NH 1BJVA 7KMEH 1P8VC 5DPAA 5C5NA 1Y3UA 3E16B 3U98H 1G3EA 1D4PB 1O3IA 1TONA 1N1LA 3MU8A 1BA8B 1HJAB 3I78A 1ZTKA 4CREA 2P95A 2QXJA 3LH1A 4Q7XA 1BOQA 1VITF 3VGCB 1PPBH 3A85A 2J92A 4ZXXH 2BLQA 3BIVH 1A7SA 1QRZA 4X2YA 1O5EH 3UNSA 9ESTA 1O3DA 1T32A 1YPHE 1C1OA 2QAAA 2B8OH 1JBUH 1B0EA 3SJKA 5DP9A 1K1OA 1LHGH 2BY9X 5TCCA 1BRCE 3TK5A 3ZVAA 1HAIH 1BDAA 3EDXB 2FOBA 1EAIA 1AQ7A 4IS5A 1K1JA 4JZEH 1SGCA 3B8JA 3GCOA 1EOJA 4ABFA 5EQRA 1HAVA 2ZTZA 3SO3A 1DITH 1C1WH 4BAQB 3UQVA 2ZFPH 2VU8E 1O3EA 1RRKA 2ZDLA 1FLEE 2OLGA 2CV3A 1TNHA 3MNCA 1Y5BT 1TRNA 4J1YA 1AMHA 4AN7A 2FLBH 1GI8B 1GCTB 3A7ZA 3ATKA 3PLBA 2BHGA 4Y0ZE 1MBQA 1S6FA 1O2GH 2STAE 4VGCC 1S83A 2ANKH 1TX6A 1XXDA 3U8RH 1GHXH 1P3EA 1P57B 4ISIH 3CENA 1LPKB 1DICA 3F9GA 1W10U 3SW2B 1MQ5A 2FOFA 3ATMA 2O8WA 3MU1A 1W14U 3ELAH 5FPTA 1C1PA 1LVOA 4JYVH 3LU9B 3S9AA 1CHGA 1BITA 1QBNA 3BEIB 2FS8A 1ESAA 1GHAG 4RSPA 2FOHA 1ZTJA 1WBGB 3SBKA 1Z8GA 4CR5A 1GJ9B 4F4OC 5JBAS 2BQ7B 2XWAA 1QJ1B 1UTJA 3MTYA 4ASHA 1MD8A 3Q77A 1BMLA 4AG2A 5H4IB 1TX8A 3PO1B 1XUGA 2GCTC 8KME2 5F8ZA 5EW1H 7LPRA 5GXPA 1IQMA 4JCNA 2ZU3A 4B2BA 1WCZA 2Z9IA 1SI5H 1P9UA 1C9TA 4B1TA 1Y3VA 9LPRA 3S0NA 4YOIA 4HTCH 4K8BA 1KY9A 2Z3EA 2GD4B 1TBRH 1O5AB 1NFWA 1T31A 4I8GA 1NPMA 2FTMA 1PPCE 4SGBE 4OS5A 1SGQE 3QGNB 1C2HA 1F92A 1WYKA 2W7SA 1XUFA 2QCYA 5EQQA 4H6SB 2FEQH 1CSOE 1PQAA 2FX6A 2QF0A 1SGIB 1O30A 1FQ3A 3PROA 1M9UA 1BUIA 1FIWA 1ZMLA 3IWMA 4UFEH 4GCHF 2ZU4A 4AORA 4ABJA 2A4QA 2FP7B 5DGJA 1YP9A 2Z6BD 1Z6JH 1HFDA 1VCWA 1ELTA 4UFGH 3LGUA 3F9HA 1LQEA 2V6NA 1C2JA 2FWWA 1J9CH 4AGKA 1PPZA 2VIOA 4B71A 3STIA 4Z0KA 2VIWA 4IN2A 1OXGA 2QYIA 2B9LA 2BVXH 1AFQC 1AE5A 2VWMA 2GDEH 1FONA 3BTWE 4AG1A 3GY2A 4NWLA 3A8CA 3SU1A 5A8ZA 3TGKE 4NA9H 1PQ5A 3MFJA 2ANMH 4X8SH 5HYOA 2WV4A 5BRRE 2JH5D 3S9CA 2AS9A 1AUTC 2FO9A 1TMTH 3A8DA 1SR5C 3A7YA 5DG6A 2GP9B 1AI8H 2FXRA 1AVWA 3P8OA 1A46H 1GBIA 3A89A 1CHOG 2THFB 1HJAC 5AF9H 1CT2E 1UCYE 3KQEA 4I8KA 1ZGIA 2ZDNA 3U69H 1ZJDA 5IDKA 1HJ8A 1CVWH 1GI9B 2CHAB 1SFIA 3BF6H 3LGVA 5CMXH 1NU7B 4O03A 1NRRH 3AVZA 1IQIA 3M7QA 1ELFA 4AX9H 3K65B 2OXSA 4AFQA 2IN2A 4DW2U 2FOCA 1C5LH 3VFEA 3KQCA 1MH0A 1QRWA 1W13U 2GKVE 2A32A 2UWLA 1L2EA 2QY0B 3ODFA 1KXDA 2OUAA 2ZFFH 4MPWA 2BDGA 3QDZB 4I32A 4OGYA 3HPTB 4ZHAA 4E7RG 4YZUA 1KXCA 3TK9A 1V2QT 1P9SA 1IQNA 1HNEE 1PPFE 5ESBA 2ASUB 1A5GH 1C5TA 2ALVA 4H4FA 1IQKA 1O5DH 3GY4A 1O36A 2QXIA 1V2KT 4OGXA 1GMDG 4YO9A 3RXLA 2IOTA 3LGTA 3GCHB 3NPSA 1DM4B 1TQ7B 2ZZUH 4BTIB 3ZVDA 2GCHG 5T6DA 2QC2A 1MTWA 4NFEA 3RXAA 3MNXA 4TY7A 2ZGBH 1BMMH 3ZVBA 4TPIZ 1MKWK 1F0RA 1O2QA 4QT8C 1SLWB 2ZNKH 1FJSA 3GDVA 1IHSH 3RU4T 3RXHA 2A4OA 2F9VA 2C4FH 4AZ2B 1UTOA 3EAJA 3H7TA 3HGPA 3D49H 1O3AA 5E0GA 2OTVA 4CRDA 2OC8A 1AKSA 3Q3XA 4Y76A 4ZHMU 1GMHF 4TWWA 3RXFA 2BY5X 1DE7H 2ZTYA 4FUJA 2TGDA 3PO1C 5EXNA 3S7KB 5LGOA 1AIXH 1HIAB 2IJOB 1OOKB 1MKXH 1B7XB 3LIWA 5DJ7A 1HAOH 1O2YA 3A88A 1C2KA 1TX7A 2XBVA 2UUJB 1FPCH 6LPRA 1TGBA 3RXPA 4FU7A 4B73A 4K8YA 1EJMA 3DUXH 2ZU2A 3AASA 3ATLA 3UPEA 2R2MB 4UONA 2OCVB 1V2WT 2FI4E 1A61H 3SUDA 4UE7H 1GI6A 1GBEA 2BD2A 2B5TB 2BY8X 1MU8B 1UTPA 2ILNA 1XX9A 4DIHH 2G5NA 1DSUA 1O2LA
chains in the Genus database with same CATH superfamily
3F1SB 5FBEA 3SGAE 4WVPE 3GOVB 4JK6A 1ETSH 1MZDA 4SGAE 1GI7B 1V2PT 1MTNB 1DLKB 1EJAA 1FXYA 2KZ4A 2WV5A 3GYLB 1QB9A 4D8NA 8LPRA 1C5VA 1J17T 4E05H 3FP8E 3RC5A 1ETTH 5B6LA 5FPYA 3AAVA 1TMUH 1PPEE 5DP8A 1MAXA 2PTCE 1JOUB 3E1XB 3S7HB 3SI3H 1N8OC 1ANDA 2Y7ZA 3A87A 1VZQH 3GY3A 4TWYA 1AWFH 1BTZA 4BANB 4BOHA 1MTSA 5F6MA 1C5XB 4Y8YA 2EI7A 1HGTH 3O8RA 2JH0D 4NSYA 3ZZDA 1DWCH 1GDNA 2H6MA 2AIQA 4MNVA 1MD7A 1S6HA 2YNBA 3SNDA 3SZEA 3A7VA 1BMAA 3LGWA 3SOSA 1FY5A 3EGKH 1GJ5H 1VITG 1SQAA 2RCEA 3UB0A 1UVOA 1F7ZA 1GGDC 3JZ2B 3UWIA 2CMYA 2TBSA 2O8LA 2ZQ2A 3H09A 1SMFE 2CHAC 4YLUA 1O2TA 2BOHB 1A2CH 5GWZA 3PTBA 1C5WB 1OPHB 2ZDKA 3F9EA 3TITA 1F0SA 1MZAA 2WPKS 2SGAA 4RKJB 5HKKD 1TBQH 2WPDD 4ABAA 1H1BA 1O2MA 1SSXA 3BTME 4U2WA 3UR6A 1E0FD 1YWUA 3ATWA 1OX1A 4XD7D 2VBCA 3TJUA 2ZEBA 1BRBE 3OY6U 4GVUA 3SJOA 1UJ1A 1C2DA 1HAVB 4Y6DA 3O8CA 1Q3XA 2NU0E 4D7FA 3E8LA 1ELBA 3MU0A 3ZYDA 2AGIX 2Z9JA 2UUYA 2A2XH 1DWDH 4DURA 1IHTH 2C8WB 4WJG2 5FHTA 1H4WA 3A86A 3AW0A 1GHYH 3M5LA 1T4VH 1K22H 1RIWC 5GIBA 1IQJA 4X8TH 1SQTA 1GI0A 3QTVH 2FZZA 3A8BA 1AGJA 1C5NH 2BOKA 2AEIH 1T8OA 4ZMAH 1P03A 3P8NA 1LKBA 3T29A 3E90B 1YPMH 3OAAD 3M3SA 2WPIS 1EUFA 3GY7A 3P8GA 1A5HA 1DSTA 1NO9H 2FPZA 3MHWU 2JETC 2OC7A 3A84A 3RXRA 2OC1A 1UTLM 2P3TB 4HI3A 3GYMA 1BBRH 1A3EH 4FUEA 2ALPA 4AYVB 4NZLA 2JIZD 1P2OA 2Y7XA 1NROH 2CF9H 3ZZ8A 1GVZA 3OSYA 4Q7YA 3ZV9A 1D6RA 3UAIC 3ZYEA 2PR3A 1UHBA 2W6ID 1NTPA 3LONA 1SGPE 5EJ1A 5FCKA 1PPHE 4Y8XA 2C90B 1GJCB 4H42U 1QL9A 1QURH 5L2YH 4DIIH 2BM2A 2GCTB 3D23A 2SFAA 2CN0H 1UTNA 1O2IA 5ESTE 1O2UA 2ZFSA 5ABWA 4XBDA 2J34A 2OC0A 3HATH 4GCHG 2EI6A 2ZO3H 1D6WA 1V2JT 1Y3YA 3SJ8A 3C1KA 1P2KA 1COWD 3L33A 3KYGA 5HIZA 4KTUA 4CRGA 5E0JA 1RGQA 1NRNH 1OHHD 1VR1H 2F3CE 3SV8A 1ACBE 5CHAB 3EA7A 1JRTA 1QY6A 1O2JA 1C2MA 1YPJH 2XWBI 1OYQA 1Q2WA 1L1NA 2KAIA 3P95A 4JZ1A 1F5KU 2PUXB 2HPQH 1W12U 2Y80A 1E79D 2STBE 4KELA 1GMCF 3TJNA 3FANA 1OWIA 2XYAA 1F5RA 1TALA 1ELVA 1TGSZ 4K5ZA 4TYDA 3FZZA 2F83A 5HM2A 3GDSA 1C1QA 1C5YB 1LPZB 5DKMA 1ZJKA 3SNCA 1A3BH 1UTKA 3BTGE 5HXFA 4Y71A 4HFPB 4B74A 2PHBA 2YMSD 1QL7A 2V35A 1TOCB 5E0HA 3UQOA 2ZCHP 1DWBH 1VITH 1QTFA 3PTNA 1ARCA 1BZXE 1NU9A 1DVAH 1ELAA 5JPMH 3OE7D 3A8AA 3GDUA 3MU4A 1C1SA 3QN7A 3SV7A 2XOKD 3DFJA 2LPRA 3P8FA 1ZPCA 4DG4A 2ZU1A 2F9BH 1EKBB 4CRCA 3STJA 1XUKA 3TGIE 1AY6H 1WQSA 4AFZA 2F9NA 3HGNA 1AVXA 1GI5A 1WQVH 2FTLE 1GL1A 5T6GA 4LZ4B 4BAKB 1J8AA 1H8IH 2WYGA 3KYFA 3LOXA 4YOJA 1BIOA 1NRSH 3LC3A 3SI4H 5DK1A 2KCPA 1YCPH 1THPB 2W6JD 4I8HA 2Y5GA 3MO9A 3M61U 5EQSA 1E36B 5C67A 3DSGA 5K7RA 1P02A 2O8UA 1FNIA 5EXMA 1FUJA 1YYY1 3SZNA 2RG3A 1TYNA 3OTJE 2PW8H 3GISB 3R3GB 2ZGHA 1HUTH 2B0FA 1RS0A 1K1MA 1ANEA 4INHA 3F68H 2GGVB 3H7OA 3T2NA 1CGJE 1AKSB 4FUIA 4UEHH 2GT8A 4YLQH 2O8MA 1GMHG 1O2RA 1W7XH 1F2SE 4A1VA 3LJOA 1O2XA 2BQ6B 2OP9A 3B23B 5LPFA 2SGEE 3QK1A 3HKIB 1XUHA 3SJ9A 1T8LA 4ZKSU 3OEHD 2UWOA 1GJ7B 1QJ7B 4I31A 1GBCA 2EI8A 3G01A 1O3BA 4R0IA 2PP6A 1K2I1 3A83A 1N6XA 3QO6A 4U01A 5A2MH 4RT1A 5A09A 1O35A 1JIRA 5C1YA 3GCTF 1ZYOA 2ZFTA 1LO6A 1OSSA 3DA9B 1EAWA 1O5CB 1GBJA 1V2MT 2R9PA 4F48B 4NZQA 4KKDA 1MABB 4Y7BA 1IQFA 1AZ8A 4X6MA 1O2ZA 1G3DA 1S5SA 1PYTC 1ZTLA 5A8YA 3MO3A 3RC4A 1DOJA 1BJUA 3MQKC 1GVKB 1QFKH 4GUXA 2V3HH 1GDQA 3VB3A 4GAWA 1ID5H 1V2TT 1GJAB 2TIOA 3BTQE 4Q7ZA 5CHAC 4M7GA 3URCA 3VPKA 3SORA 4DGJA 2OINA 1E37B 4FU8A 2XCFA 1DXWA 2Q6DA 2A5KA 2M2AA 1SLUB 2ZQ1A 3N99A 4GHQA 1W3CA 2G52A 2SNWA 1HLTH 1GJ8B 2CK3D 1A0HB 4F49A 1EXFA 2ZHEH 3ZVFA 2ODQA 2PKSC 2W3IA 4XOJA 2GV6A 1GBTA 2ZCKP 2QV1A 3SU5A 4ZH8A 2XC5A 2ZFQH 2SGPE 2A2QH 3A82A 2OBQA 2ZKSA 1FPHH 3B9FH 1K21H 2BLWA 1Y8TA 4MPVA 2SGDE 1N8OB 4RKOB 1AN1E 4B2AA 1GWAA 4NFFA 5F8XA 1TPPA 4ABGA 4WMFA 1AB9B 3SNBA 4MNWA 5L2ZH 1P2IA 2FODA 1KXEA 2HNTC 3NCLA 4LXBH 2R3UA 1GJ6A 3PLKA 2WV9A 4X6PA 1X7AC 1AFEH 2HNTE 3GICB 5LPEA 3SUEA 1CGIE 3FOAA 1KTTB 1P09A 1S0QA 1SHYA 2DE9A 1DT2A 2F9OA 1S6LA 3CS7A 1WU1A 1OP2A 1O5FH 2L6OA 3U8OH 3UREA 1P2MA 1GGDB 4CH8B 1FDPA 1XUJA 2ZP0H 1O2PA 5L30H 4X6NA 5GPIB 2XRCA 4XDEA 2OQUA 2YOLA 1ZRBA 2LELA 3OX7U 3MO6A 2RDEA 3RXTA 4FUFA 1C5ZB 1O5GH 1GCDA 3E0PB 3V13A 2H9HA 3QLPH 2QIQA 2GV7A 1A1RA 4U30A 1CE5A 1GPZA 1V2LT 1QB1A 1TWXB 3L6PA 2PFEA 4XSKU 2Z9GA 5K0HA 1O2VA 1F5LA 4P02A 1PQ8A 3UIRA 3N7OA 3LC5A 3VEQB 3V12A 4NG9H 3A7TA 2CXVA 1CA8B 4ZKOU 3FZDA 2P3UB 2VB0A 4MNXA 1QIXB 2HWLB 3OY5U 4CHAC 5I25A 3TNSA 4X8VH 2Z9KA 6GCHF 3T28A 2VJ1A 2A0QB 2F91A 1SGDE 3DHKH 3O8BA 2OK5A 1PJPA 1RIWB 4B76A 3ZV8A 1IQHA 2W3KA 2ZECA 1YKTA 1OWEA 3HKJB 3BEFB 1VKYA 3UNQA 4WXVA 1OP0A 1QBOA 1OWDA 3RDZA 3GY8A 1FN6A 1CBWC 2ZF0H 2ZHQH 2WPHS 5FPSA 1KLIH 2C8ZB 2QF4A 4Y10E 3UOPA 5G4BA 1UHBB 3MOCA 4I86A 1C1TA 2ZDMA 4NIYA 2BD5A 2UWPA 1RTKA 1GHBF 3Q00A 2JETB 4O9VA 6CHAB 2VH0A 2BD8A 5IK2D 1TQ0B 1EPTC 1G3BA 2ZHWH 2HOBA 2F9PA 4AFSA 3ZIAD 4MPUA 1BHXB 2XC0A 1C2LA 3AAUA 1FY1A 1V2ST 4Q2KA 1DY9A 2OD3B 4Y8ZA 3LT3A 2BQWB 1SGFG 1GHZA 5EXLA 1UVUH 1O3OA 1GG6C 2Y5FA 1EPTA 3M35A 4RT0A 1HXFH 1NBMD 1C2GA 1C2FA 1OS8A 4IGDA 1EAUA 3UUZA 1GI1A 1HAYB 3ATIA 2Z94A 3EQ0H 3TH2H 3TJOA 1V2NT 2VIDA 3RP2A 4AYYB 1G2LA 2NU1E 1KDQA 3RU4D 3M37A 5EODA 2ZG0H 4NIXA 3MH6A 1GMCG 1MUEB 4A92A 2JKHA 1ABIH 2VWNA 3LH3A 1HAGE 1LPGB 3LKWA 3DSPA 3Q3KA 4NA8A 3SGQE 1FAKH 1GBBA 1MBMA 3VB5A 1HAXB 4IC6A 1TA2A 3BEUA 1A0LA 4IMZA 3FVFB 4ISOA 2VIQA 5JBCS 1K9OE 2VGCC 2ZGJA 4BAMB 3OYPA 7GCHF 3F2HA 2WPMS 2ZGCA 3FAOA 4HGCA 2W26A 1EP6A 2WPLS 1ANBA 4THNH 1JWTA 3KN2A 4M9FA 1V2OT 1YY3A 1AB9C 2GZ7A 1HRTH 3ZZ4A 4OS2A 1NS3A 3U1IB 1TFXA 2P8OB 3QZRA 3MU5A 1TE0A 1ZSKA 1LMWB 1YLNA 2ZGXH 3ESTA 2BD4A 5FXLA 2J9NA 2PTNA 1OWJA 4AOQA 1UK3A 1D3DB 3SQEE 2RFKC 1GJDB 2HLCA 2AGGX 4ZAEA 4X1QU 1QRXA 4BTTB 5DP3A 4JZFH 1THRH 4DT4A 2A45B 1OP8A 4LZ1H 1J16A 1YPGH 4NA7A 1RJXB 1O5BB 1AVGH 2KCOA 1O0DH 1BTUA 1FY3A 1ZPZA 1MTUA 1LDTT 2GDDA 2PUQH 3E3TA 4O3TA 4FVDA 1H9HE 1DFPA 3BN9A 2GJGA 3MH7A 3U9AH 5A0CA 1QNJA 4CRBA 2ZPQA 8GCHF 4YT6H 2A7HA 3S9BA 3E0NB 1EB2A 1O3JA 1W11U 3QX5H 1C1NA 5AVDA 3EA9A 3PYHA 3SHCH 4JYUH 1E38B 1EZUC 1FN8A 1ZMNA 2BD9A 4Y0YE 3RXKA 1QR3E 5FX5A 3RXCA 5CE1A 2WSSD 2FX4A 2BVSH 3VB6A 1G9IE 2HGTH 2VINA 1K0HA 3UR9A 1K1NA 1P06A 1LHEH 1LVBA 1BTYA 1Z8RA 2A31A 2EEKA 3LDXH 2QGRA 4IC5A 3QTOH 1FAXA 4K60A 4D76A 4UD9H 2OBOA 3ENSB 4D7GA 3BG4B 3SV2H 2D26C 3BTFE 4I8LA 2SGFE 1CGHA 1EP5A 4GSOA 4FUBA 4JZDH 3L3TA 2ZDAH 3O8DA 2V0BA 1P2JA 2PKAA 2V3OH 2ZHFH 2AH4X 1CA0C 2A5AA 4I8JA 1G3CA 5TCAA 1WXRA 2WPJS 4D9QA 2FOGA 2HPPH 1DUAA 4ZHLU 1GBKA 1LHDH 3LGIA 4AFUA 5AFZH 3UY9A 1GBFA 3UTUH 1ABJH 2ZDVH 5C0UA 1HBTH 1YC0A 2C8XB 1Q31A 1Z6EA 1A5IA 1SHHB 2BLOA 1JRSA 1B0FA 2VIPA 4NSVA 5EPNA 1SQOA 1UVSH 3M3VA 2Y82A 1GI2A 2BDIA 6CHAC 3GCTG 1BTWA 3F3BA 1YPLH 3LGYA 1C1RA 4YM9A 1PQ7A 4X1NU 3KQDA 2EY4C 1HXEH 3SU4A 1K28D 3ZVCA 1C1MA 4MPXA 1DXPA 5C1UA 3MH4A 3SU3A 5HGGA 2J95A 5LH8A 1GBHA 1O2KA 2C8YB 4JYTA 1EOLA 1YPKH 1QHRB 1A4WH 2FS9A 1AHTH 2P93A 1GJ4H 1BB0B 2XXLA 4OM9A 3F2FA 3FN8A 5GJ4B 3RUOA 1D9IA 3FP7E 2P59A 4K1TA 4B6FA 2C3SA 4AB9A 3TIUA 1RTLA 2LNCA 1TGCA 1NZQH 2H5DA 3ZZ7A 1EFRD 2XBXA 3SGBE 2CGAA 1TRMA 2QF3A 1YGCH 1MCVA 2HRVA 1YLDA 6ESTA 2QA9E 2TGTA 3NWUA 1C2EA 5GCHF 4CBOA 4U32A 2Z3CA 4ESTE 4FU9A 2YMSB 2VWLA 4A1XA 1Z1JA 3PRDA 3SNAA 1HAPH 2H9EH 3I29A 2WUBA 2VWOA 1CO7E 3P6ZB 3WWBA 5JBTA 3W94A 2QXHA 3Q76A 2ANYA 5EIYA 5FX6A 4MLFB 4X0WU 4NIVA 3V0XA 4DCDA 2PKSB 2ESTE 1ZRKA 1K1LA 1SGYE 3GY5A 3I77A 1TPSA 1FX0B 1C4Y2 2P8OC 2H5CA 2BD7A 2YNAA 1BCUH 1FI8A 4BXWA 1ELGA 4I33A 1NFYA 3BTKE 1AD8H 3QUMP 3E91A 4LK4A 5JBBS 4CR9A 3RXQA 3CS0A 4XBCA 1EZSC 1E1RD 4H6TA 1SVPA 3D62A 3K2UA 1GHWH 2TPIZ 5A8XA 3Q3YA 4UFDH 3HK3B 2FOEA 3SJIA 3DT0H 2AMPA 5CHBA 3ZZBA 1F0UA 2AFQB 2J97A 2M5TA 1DANH 2VVCA 2XTTB 5A0AE 1JIMA 3T5FH 5AFYH 1INCA 1WUNH 2Y5HA 1SC8U 3VG8A 1RXPA 4DT7B 1Z71A 4AB8A 1MAYA 1H9IE 3SU2A 1YLCA 1IQLA 1O37A 1AWHB 1UVPA 1SB1H 2DE8A 2J98A 1UW7A 3R0FA 2JJ1D 1K1IA 2KX4A 3PMHB 1W0KD 2NU4E 3PMAB 3KQBA 1D3TB 4BTUB 1WTGH 1O32A 2Z7FE 1O2WA 2BDYA 2J5UA 1S82A 2ZPRA 1E34B 4JMYA 4MNYA 2HVXA 3TH4H 2BB4A 1NC6A 1QL8A 1BBRE 1QA7A 2Y81A 1HV7A 3QWCH 4UFFH 3VXEH 8ESTE 4FUHA 6GCHG 1EQ9A 1TBZH 1THSH 4NCYA 2NU3E 2PGQB 1FV9A 1W0ZU 1W8BH 1JMOH 1P12E 3BG4C 2G5VA 1O2NA 1DX5M 2AYWA 1DWEH 1XVMA 2BDHA 4A6LA 1YPHC 1HB0B 2NU2E 4FVBA 3ODDA 1G2MA 1HPGA 3TK6A 1ZPBA 2BDAA 1MMJN 1IQGA 2GX4A 1DLEA 5T6FA 4WH8A 1J14A 3TLOA 4NGAH 1C1VH 4CHAB 4XBBA 2A5IA 1NN6A 3P17H 1HCGA 4X6OA 3N7DA 3ZZ9A 1HJ9A 2PWXA 1QGFA 3NXPA 2BDCA 3PV2A 1MQ6A 1FY4A 4DVAU 1SG8B 3BIUH 1LCYA 3M5NA 1GBMA 3KGPA 1EASA 1GHBG 3M36A 1Y3XA 4X2XA 1PPGE 4ZROA 3RXOA 1SGFA 2VVUA 3BG8A 1EX3A 4JZIA 3H5CB 4WMDA 5F03A 3TU7H 3MWIU 1L0ZA 1YCPM 4X8UH 1IQEA 2GZ9A 4Z6AH 1ZSJA 1E35B 1CBWB 1FMGA 1GDUA 1NRQH 2C93B 5AHGH 4J2YB 5E2PA 3RXGA 3SUGA 2UUKB 3V3MA 4FETA 1UCYH 1LKAA 2VIVA 1G36A 1JXPA 2G00A 4NIWA 3BTTE 2QF5A 1TNGA 3ZVEA 1EB1H 1IAUA 3VB4A 4ZKNU 3RXMA 2J94A 4ZXYH 1EPTB 2HNTF 4BNRA 4UDWH 2I6SA 2EA3A 5SGAE 4K2YA 5EW2H 1V3XA 3W95A 2J2UA 1N6YA 4X1SU 1KDQB 4IW4E 4Z1MD 1C5RA 7ESTE 1ESBA 2BD3A 3ZZ3A 1WV7H 1S85A 1FIZA 2GT7A 3GCNA 4B75A 2ZTXA 1WAYB 2G4TA 1GG6B 5ETXA 2ZPSA 1V2UT 1SFQB 2K8IA 4OS6A 4XRNA 4YOGA 4Y11E 3RXSA 2P94A 1O38A 4ISNA 5HMAA 1TAWA 1ZR0A 3SU0A 5C17A 2VNTA 3PB1E 1OYTH 2YMSC 2K1QA 7GCHG 3F2GA 1GBAA 5JB8S 3TJVA 1C4U2 1HAZB 3KQ5A 4O3UA 2G8TA 4ISHH 1O3NA 5KGOA 4DJZB 2FIRH 4Y79A 1EATA 2R3YA 4KGAA 1RTFB 3RXBA 2B7DH 3SYJA 3U28C 1W7GH 2ZHDA 1O2OA 1AE8H 1XMNB 1QJ6B 3KF2A 1XUIA 3KIDU 4K3JA 1O3HA 3DSOA 2K0QA 2VGCB 1O3PB 4CH2B 4NWKA 1O2SA 1AU8A 3RXVA 4MDSA 4ZUHA 5C3NA 2JDID 2BXTH 2FOAA 2FM2A 2Z3DA 2BXUH 3CP7A 1UK4A 2WHXA 1QZ8A 2AERH 2TGPZ 1SGTA 5DSFA 2CJIA 4WWYA 4Q4LA 3BTDE 1ELEE 1MKXK 3RXJA 5EOKA 3DD2H 2Q6FA 1LHFH 1W2KH 3PV5A 2P3FH 4HG6A 4OS7A 1UVTH 1ZOMA 1BMFD 1HYLA 3BTHE 3M7TA 1KSNA 3RXEA 1ZHRA 1P0SH 2RA3A 3TNTA 4FUGA 8GCHG 1KXFA 2GMTB 3MYWA 3KL6A 1Y3WA 2WUCA 1C1UH 2XBYA 1KIGH 4ISLA 3VXFH 2ZWLH 4A7IB 2WINI 3SHAH 1C5QA 4X1PU 2RA0A 3A7WA 2ODYB 1QB6A 2A7JA 1TNJA 2G81E 3MH5A 1KLJH 3SV6A 1CT0E 3K9XB 1V2VT 2PSYA 1O3CA 2Y6TA 1ZSLA 1P05A 1KTSB 1KXAA 3PV4A 4X1RU 1O3KA 5EJZA 2F43B 2XW9A 3VGCC 5J4QA 1WDIA 2J38A 1XXFA 1LHCH 4X2VA 4YT7H 1MU6B 2PKAB 4O97A 4MVNA 2BZAA 4IMQA 1CT4E 3EE0B 3KHVA 1QCPA 3LJJA 1P01A 1T8NA 3KNXA 1G30B 2Z9LA 4FXGH 3K6YA 1TIOA 4BAOB 4B2CA 1VGCB 1ANCA 1V6DA 2RDLA 3RM0H 1XM1A 4A5TS 1AO5A 4ACAA 1S0RA 4P00A 4OS4A 1C2IA 1PFXC 1BTXA 1CA0B 1YPEH 2W7UA 2WYJA 4CRFA 1W0JD 2FOMB 1C5MD 1ELDE 1LVYA 3M5OA 1MCTA 1MTVA 2J4IA 2ZU5A 2XC4A 1FZZA 3TH3H 4Y7AA 1NY22 1KLTA 1QA0A 1AUJA 1YBWA 5FBIA 3ZZAA 1GCTC 1LQDB 2ODPA 3NK8A 4FUDA 2IJD1 1ORFA 3FFGA 4MTBA 1LVMA 4ABDA 1GBDA 2PV9B 4ABIA 1ELCA 1ZMJA 2F9UA 2A4GA 2AMQA 4WXIA 3RMLH 1Z8JB 2AIPA 1ZLRA 3HK6B 4DY7B 1A0JA 4X2WA 4CRAA 2D2DA 1CU1A 2ULLA 2QXGA 1SKYE 2XCNA 1C5UA 4WH6A 2SNVA 1DY8A 2BX4A 3KCGH 3PMBB 1BQYA 5BPEA 3RMNH 3M3TA 2FI5E 2V7QD 3ZVGA 1KXBA 1C5OH 3F6UH 3CNRA 3MI4A 5GCHG 1SLVB 2PLXA 3RLYH 2A4RA 3PWBA 1ZZZA 1DDJA 1RD3B 2SGQE 3PM3A 3RC6A 3PRBA 3S69A 2OQ5A 1YM0A 2R2WU 3K6ZA 2KAIB 4IN1A 2Q6GA 5HM9A 5KECA 2BVRH 2P16A 1IOEA 4IBLH 3C27B 2QE7D 1SGNE 1O39A 1GHAF 2A1DB 1TB6H 1BTHH 3RMMH 2ZI2H 2BMGB 4K1SA 1T7CA 2FYQA 1TPAE 1VJ9U 3V7TA 1O2HA 4ABEA 2BTCE 4K1EA 4OS1A 3U8TH 4TY6A 1W0YH 1GL0E 4Q80A 5EJLA 4FOUC 2KCYA 5DP4A 3TPIZ 1H8DH 3SQHE 5DP5A 4E7NA 2GZ8A 5TJXA 1RFNA 1BBRK 1GBLA 1TPOA 1Z7KA 1K1PA 2PGBB 3A7XA 3UNRA 3QGJA 1XKBC 2V3MA 4E06H 5C20A 1L1GA 2IPHA 3SN8A 3IG6B 1SL3A 2W5EA 2TRMA 1C9PA 1WSSH 4WF8A 1BRAA 2GVFA 1C5SA 1OWHA 5C5OA 1HAHH 2ANWA 1DS2E 3T27A 1B5GH 1O3FA 1NRPH 1Y59T 1BTPA 2J98B 3PWCA 1DUEA 1EZQA 4WMEA 4AGJA 2FDAA 1NFXA 4CBNA 2GMTC 2FESH 1H8ED 1NFUA 1P2NA 3MNSA 3A81A 3MMGA 2FMJA 3UFAA 1SOZA 3ZZCA 2ZA5A 1G32B 1TOMH 4D9RA 2G51A 1NT1A 1UO6A 2KFWA 2BLVA 3ZZ6A 3M7UA 1BHXF 1SOTA 2D1JA 3SNEA 1TRYA 1ARBA 3PLPA 1TNLA 2UUFB 4BAHB 3BTEE 3NZIA 3QZQA 4TT3D 1MKWH 5DP6A 2GTBA 1T4UH 5EGMA 1Z8IB 3SUFA 3T25A 3ZZ5A 1ESTA 1F0TA 1Y5UT 1UMAH 2BY7X 3NKKA 2A7CA 3M5MA 2KM0A 2ZCLP 3PMJA 5FCRA 2VH6A 1VCPA 2BX3A 1P10A 5C94A 5F8TA 1L4DA 3BV9B 5JYIA 2AGEX 4YESB 1SBWA 1ZHPA 1NESE 4R8TB 3FP6E 1CHOF 1TLDA 1VGCC 1SGRE 4KTSA 4HZHA 2TGAA 2AMDA 1DPOA 1GI3A 2BYAX 3RXDA 3SV9A 2D8WA 2O8TA 2VVVA 1Y5AT 3RXUA 1OWKA 1BRUP 3NUMA 4ACBA 1O3GA 1TNIA 5C2ZA 1P3CA 5IYTA 5A0BA 3RM2H 3FO8D 5B6OA 1UTMA 1V2RT 1H9LB 2HVYB 1Z1IA 3GCHC 1D3QB 3P70B 3UWJH 1TA6A 1L1JA 1QQ4A 1TGNA 4I7YH 1EAXA 1ZHMA 1OKXA 2EC9H 4INKA 2NWNA 2HALA 3WY8A 1NBME 4WY3A 4KTCA 2DUCA 2G55A 4K69A 3KEEA 1HDTH 1VCQA 1U6QA 3D65E 4XE4A 3P92A 1EZXC 3F9FA 1GMDF 5T3HA 3RU4E 4VGCB 3T26A 5EU8A 2AHME 4ABBA 4ZCNA 3RMOH 2H2ZA 2CF8H 4ASUD 1P2QA 2I6QA 1BT7A 2GCHF 5JB9S 1GHVH 1AZZA 2O9QA 4JK5A 1LTOA 1TGTA 1YCPK 1P04A 3DFLA 2ZC9H 1TMBH 1WOFA 3JZ1B 5E2OA 1QBVH 3AK5A 4FUCA 1J15A 4A1TA 1GI4A 4ZKRU 1C5PA 1O33A 2IPQX 4YXWD 1C4V2 1GJBB 1XVOA 3SU6A 4YTAA 3F0OA 1EJNA 1G37A 1FY8E 3TGJE 1BMNH 1GVLA 5EG4A 3T62A 2XBWA 4TPYA 4MQAA 1S81A 4INLA 3BSQA 2PSXA 1S84A 1XKAC 4GPGA 1T8MA 1TNKA 1VJAU 2BDBA 4XFQA 5I46H 4DOQA 3N7EA 1YF4A 2FI3E 1ZGVA 1HIAA 3ITIA 5PTPA 1D3PB 3GS9A 1UTQA 5JDUB 3RXIA 2QN5T 5EPYA 5FAHA 3IITA 5E8EH 5LPRA 1UCYK 4LOYH 1MTNC 3EYDA 2F4LA 3E6PH 1KMHB 1CQQA 1KYNA 2G4UA 3WWFA 3URDA 4RN6A 1L4ZA 1NM6A 2Q1JA 4Q63A 3VB7A 2KCAA 4ABHA 1O34A 2FLRH 2R0LA 1O3MA 3LPRA 2R0KA 3TVJB 3AW1A 1PYTD 2H1UA 3RLWH 4PROA 1QQUA 5GDSH 2BZ6H 2FYRA 2XNIA 5DP7A 5T1VA 1SLXB 1O31A 3OU0A 3U1JB 5J4SA 3F0PA 1O3LA 2BY6X 3GY6A 1P11E 1ETRH 3MNBA 3OFND 3UOUA 5DO4H 1AFQB 3EA8A 1WTHD 4BXSA 1UK2A 4GLYA 2ZFRH 2H9TH 3A80A 1SGEE 1E1QD 4GHTA 4KP0A 1SPJA 2ZIQH 1TABE 5KEDA 5C1XA 2JH6D 4MG3A 5L6NH 1BJVA 7KMEH 1P8VC 5DPAA 5C5NA 1Y3UA 3E16B 3U98H 1G3EA 1D4PB 1O3IA 1TONA 1N1LA 3MU8A 1BA8B 1HJAB 3I78A 1ZTKA 4CREA 2P95A 2QXJA 3LH1A 4Q7XA 1BOQA 1VITF 3VGCB 1PPBH 3A85A 2J92A 4ZXXH 4F55A 2BLQA 3BIVH 1A7SA 1QRZA 4X2YA 1O5EH 3UNSA 9ESTA 1O3DA 1T32A 1YPHE 1C1OA 2QAAA 2B8OH 1JBUH 1B0EA 3SJKA 5DP9A 1K1OA 1LHGH 2BY9X 5TCCA 1BRCE 3TK5A 4AC9A 3ZVAA 1HAIH 1BDAA 3EDXB 2FOBA 1EAIA 1AQ7A 4IS5A 1K1JA 4JZEH 1SGCA 3B8JA 3GCOA 1EOJA 4ABFA 5EQRA 1HAVA 2ZTZA 3SO3A 1DITH 1C1WH 4BAQB 3UQVA 2ZFPH 2VU8E 1O3EA 1RRKA 2ZDLA 1FLEE 2OLGA 2CV3A 1TNHA 3MNCA 1Y5BT 1TRNA 4J1YA 1AMHA 4AN7A 2FLBH 1GI8B 1GCTB 3A7ZA 3ATKA 3PLBA 2BHGA 4Y0ZE 1MBQA 1S6FA 1O2GH 2STAE 4VGCC 1S83A 2ANKH 1TX6A 1XXDA 3U8RH 1GHXH 1P3EA 1P57B 4ISIH 3CENA 1LPKB 1DICA 3F9GA 1W10U 3SW2B 1MQ5A 2FOFA 3ATMA 2O8WA 3MU1A 1W14U 5HIYA 3ELAH 2HLDD 1C1PA 1LVOA 4JYVH 5FPTA 3LU9B 3S9AA 2EQNA 1CHGA 1BITA 1QBNA 3BEIB 2FS8A 1ESAA 1GHAG 4RSPA 2FOHA 1ZTJA 1WBGB 3SBKA 1Z8GA 4CR5A 1GJ9B 4F4OC 5JBAS 2BQ7B 2XWAA 1QJ1B 1UTJA 3MTYA 4ASHA 1MD8A 4B6EA 3Q77A 1BMLA 4AG2A 5H4IB 1TX8A 3PO1B 1XUGA 2GCTC 8KME2 4TSFD 5F8ZA 5EW1H 7LPRA 5GXPA 1IQMA 4JCNA 2ZU3A 4B2BA 1WCZA 2Z9IA 1SI5H 1P9UA 1C9TA 4B1TA 1SQRA 1Y3VA 9LPRA 3S0NA 4YOIA 4HTCH 4K8BA 1KY9A 2Z3EA 2GD4B 2WZQA 5C0TA 1TBRH 1O5AB 1NFWA 1T31A 4I8GA 1NPMA 2FTMA 1PPCE 4SGBE 4OS5A 1SGQE 3QGNB 1C2HA 1F92A 1WYKA 2W7SA 1XUFA 2QCYA 5EQQA 4H6SB 2FEQH 1CSOE 1PQAA 2FX6A 2QF0A 1SGIB 1O30A 1FQ3A 3PROA 1M9UA 1BUIA 1FIWA 1ZMLA 3IWMA 4UFEH 4GCHF 2ZU4A 4AORA 4ABJA 2A4QA 2FP7B 5DGJA 1YP9A 2Z6BD 1Z6JH 1HFDA 1VCWA 1ELTA 4UFGH 3LGUA 3F9HA 1LQEA 2V6NA 1C2JA 2FWWA 1J9CH 4AGKA 1PPZA 2VIOA 4B71A 3STIA 4Z0KA 2LP6A 2VIWA 4IN2A 1OXGA 2QYIA 2B9LA 2BVXH 1AFQC 1AE5A 2VWMA 2GDEH 1FONA 3BTWE 4AG1A 3GY2A 4NWLA 3A8CA 3SU1A 5A8ZA 3TGKE 4NA9H 1PQ5A 3MFJA 2ANMH 4X8SH 5HYOA 2WV4A 5BRRE 2JH5D 3S9CA 2AS9A 1AUTC 2FO9A 1TMTH 3A8DA 1SR5C 3OEED 3A7YA 5DG6A 2GP9B 1AI8H 2FXRA 1AVWA 3P8OA 1A46H 1GBIA 1H8HD 3A89A 1CHOG 2THFB 1HJAC 5AF9H 1CT2E 1UCYE 3KQEA 4I8KA 3WW7A 1ZGIA 2ZDNA 3U69H 1ZJDA 5IDKA 1HJ8A 2XNDD 1CVWH 1GI9B 2CHAB 1SFIA 3BF6H 3LGVA 5CMXH 1NU7B 4O03A 1NRRH 3AVZA 1IQIA 3M7QA 1ELFA 4AX9H 3K65B 2OXSA 4AFQA 2IN2A 4DW2U 2FOCA 1C5LH 3VFEA 3KQCA 1MH0A 1QRWA 1W13U 2GKVE 2A32A 2UWLA 1L2EA 2QY0B 3ODFA 1KXDA 2OUAA 2ZFFH 4MPWA 2BDGA 3QDZB 4I32A 4OGYA 3HPTB 4ZHAA 4E7RG 4YZUA 1KXCA 3TK9A 1V2QT 1P9SA 1IQNA 1HNEE 1PPFE 3OTPA 5ESBA 2ASUB 1A5GH 1C5TA 2ALVA 4H4FA 1IQKA 2KR7A 1O5DH 3EE7A 3GY4A 1O36A 2QXIA 1V2KT 4OGXA 1GMDG 4YO9A 3RXLA 2IOTA 3LGTA 3GCHB 3NPSA 1DM4B 1TQ7B 2ZZUH 4BTIB 3ZVDA 2GCHG 5T6DA 2QC2A 1MTWA 4NFEA 3RXAA 3MNXA 4TY7A 2ZGBH 1BMMH 3ZVBA 4TPIZ 1MKWK 3DCLA 1F0RA 1O2QA 4QT8C 1SLWB 2ZNKH 1FJSA 3GDVA 1IHSH 3RU4T 3RXHA 2A4OA 4RI0A 2F9VA 2C4FH 3FKSD 4AZ2B 3NRLA 1UTOA 3EAJA 3H7TA 3HGPA 3D49H 1O3AA 5E0GA 2OTVA 4CRDA 2OC8A 1AKSA 2JJ2D 3Q3XA 4Y76A 4ZHMU 1GMHF 4TWWA 5FL7D 2BY5X 3RXFA 1DE7H 2ZTYA 4FUJA 2TGDA 3PO1C 5EXNA 3S7KB 5LGOA 5GNDA 1AIXH 1HIAB 2IJOB 2L74A 1OOKB 1MKXH 1B7XB 3LIWA 5DJ7A 1HAOH 1O2YA 3A88A 1C2KA 5DN6D 1TX7A 2XBVA 2UUJB 1FPCH 6LPRA 1TGBA 3RXPA 4FU7A 4B73A 4K8YA 1EJMA 3DUXH 2ZU2A 3AASA 3ATLA 5CDFE 3UPEA 2R2MB 4UONA 2OCVB 1V2WT 2FI4E 1A61H 3SUDA 4UE7H 1GI6A 1GBEA 2BD2A 2B5TB 2BY8X 1MU8B 1UTPA 2ILNA 1XX9A 4DIHH 2G5NA 3W1EA 5F53A 1DSUA 1O2LA
chains in the Genus database with same CATH topology
3F1SB 5FBEA 3SGAE 4WVPE 3GOVB 4JK6A 1ETSH 1MZDA 4SGAE 1GI7B 1V2PT 1MTNB 1DLKB 1EJAA 1FXYA 2WV5A 3GYLB 1QB9A 4D8NA 8LPRA 1C5VA 1J17T 4E05H 3FP8E 3RC5A 1ETTH 5FPYA 3AAVA 1TMUH 1PPEE 5DP8A 1MAXA 2PTCE 1JOUB 3E1XB 3S7HB 3SI3H 1N8OC 1ANDA 2Y7ZA 3A87A 1VZQH 3GY3A 4TWYA 1AWFH 1BTZA 4BANB 4BOHA 1MTSA 5F6MA 1C5XB 4Y8YA 2EI7A 1HGTH 3O8RA 2JH0D 4NSYA 3ZZDA 1DWCH 1GDNA 2H6MA 2AIQA 4MNVA 1MD7A 1S6HA 2YNBA 3SNDA 3A7VA 1BMAA 3LGWA 3SOSA 1FY5A 3EGKH 1GJ5H 1VITG 1SQAA 2RCEA 1UVOA 1F7ZA 1GGDC 3JZ2B 3UWIA 2CMYA 2TBSA 2O8LA 2ZQ2A 1SMFE 2CHAC 4YLUA 1O2TA 2BOHB 1A2CH 5GWZA 3PTBA 1C5WB 1OPHB 2ZDKA 3F9EA 3TITA 1F0SA 1MZAA 2WPKS 2SGAA 4RKJB 1TBQH 4ABAA 1H1BA 1O2MA 1SSXA 3BTME 4U2WA 3UR6A 1E0FD 3ATWA 1OX1A 3TJUA 2ZEBA 1BRBE 3OY6U 4GVUA 3SJOA 1UJ1A 1C2DA 1HAVB 4Y6DA 3O8CA 1Q3XA 2NU0E 4D7FA 3E8LA 1ELBA 3MU0A 3ZYDA 2AGIX 2Z9JA 2UUYA 2A2XH 1DWDH 4DURA 1IHTH 2C8WB 4WJG2 5FHTA 1H4WA 3A86A 3AW0A 1GHYH 3M5LA 1T4VH 1K22H 1RIWC 5GIBA 1IQJA 4X8TH 1SQTA 1GI0A 3QTVH 2FZZA 3A8BA 1AGJA 1C5NH 2AEIH 2BOKA 1T8OA 4ZMAH 1P03A 3P8NA 1LKBA 3T29A 3E90B 1YPMH 3M3SA 2WPIS 1EUFA 3GY7A 3P8GA 1A5HA 1DSTA 1NO9H 2FPZA 3MHWU 2JETC 2OC7A 3A84A 3RXRA 2OC1A 1UTLM 2P3TB 4HI3A 3GYMA 1BBRH 1A3EH 4FUEA 2ALPA 4AYVB 4NZLA 2Y7XA 1P2OA 1NROH 2CF9H 3ZZ8A 1GVZA 3OSYA 4Q7YA 3ZV9A 1D6RA 3ZYEA 2PR3A 1UHBA 3LONA 1NTPA 1SGPE 5FCKA 1PPHE 4Y8XA 2C90B 1GJCB 4H42U 1QL9A 1QURH 5L2YH 4DIIH 2BM2A 2GCTB 3D23A 2SFAA 2CN0H 1UTNA 1O2IA 5ESTE 1O2UA 2ZFSA 5ABWA 4XBDA 2J34A 2OC0A 3HATH 4GCHG 2EI6A 2ZO3H 1D6WA 1V2JT 1Y3YA 3SJ8A 3C1KA 1P2KA 3L33A 4KTUA 4CRGA 5E0JA 1RGQA 1NRNH 1VR1H 2F3CE 3SV8A 1ACBE 5CHAB 3EA7A 1JRTA 1QY6A 1O2JA 1C2MA 1YPJH 2XWBI 1OYQA 1Q2WA 1L1NA 2KAIA 3P95A 4JZ1A 1F5KU 2PUXB 2HPQH 1W12U 2Y80A 2STBE 4KELA 1GMCF 3TJNA 3FANA 1OWIA 2XYAA 1F5RA 1TALA 1ELVA 1TGSZ 4K5ZA 4TYDA 3FZZA 2F83A 5HM2A 3GDSA 1C1QA 1C5YB 1LPZB 5DKMA 1ZJKA 3SNCA 1A3BH 1UTKA 3BTGE 5HXFA 4Y71A 4HFPB 4B74A 2PHBA 1QL7A 2V35A 1TOCB 5E0HA 3UQOA 2ZCHP 1DWBH 1VITH 1QTFA 3PTNA 1ARCA 1BZXE 1NU9A 1DVAH 1ELAA 5JPMH 3A8AA 3GDUA 3MU4A 1C1SA 3QN7A 3SV7A 3DFJA 2LPRA 3P8FA 1ZPCA 4DG4A 2ZU1A 2F9BH 1EKBB 4CRCA 3STJA 1XUKA 3TGIE 1AY6H 1WQSA 4AFZA 2F9NA 3HGNA 1AVXA 1GI5A 1WQVH 2FTLE 1GL1A 5T6GA 4LZ4B 4BAKB 1J8AA 1H8IH 2WYGA 4YOJA 3LOXA 1BIOA 1NRSH 3LC3A 3SI4H 5DK1A 1YCPH 1THPB 4I8HA 2Y5GA 3MO9A 3M61U 5EQSA 1E36B 5C67A 5K7RA 1P02A 2O8UA 1FNIA 5EXMA 1FUJA 1YYY1 3SZNA 2RG3A 1TYNA 3OTJE 2PW8H 3GISB 3R3GB 2ZGHA 1HUTH 2B0FA 1RS0A 1K1MA 1ANEA 4INHA 3F68H 2GGVB 3H7OA 3T2NA 1CGJE 1AKSB 4FUIA 4UEHH 2GT8A 4YLQH 2O8MA 1GMHG 1O2RA 1W7XH 1F2SE 4A1VA 3LJOA 1O2XA 2BQ6B 2OP9A 3B23B 5LPFA 2SGEE 3QK1A 3HKIB 1XUHA 3SJ9A 1T8LA 4ZKSU 2UWOA 1GJ7B 1QJ7B 4I31A 1GBCA 2EI8A 3G01A 1O3BA 4R0IA 1K2I1 3A83A 1N6XA 3QO6A 4U01A 5A2MH 5A09A 1O35A 1JIRA 5C1YA 3GCTF 1ZYOA 2ZFTA 1LO6A 1OSSA 3DA9B 1EAWA 1O5CB 1GBJA 1V2MT 2R9PA 4NZQA 4KKDA 4Y7BA 1IQFA 1AZ8A 4X6MA 1O2ZA 1G3DA 1S5SA 1PYTC 1ZTLA 5A8YA 3MO3A 3RC4A 1DOJA 1BJUA 1GVKB 1QFKH 4GUXA 2V3HH 1GDQA 3VB3A 4GAWA 1ID5H 1V2TT 1GJAB 2TIOA 3BTQE 4Q7ZA 5CHAC 4M7GA 3URCA 3VPKA 3SORA 4DGJA 2OINA 1E37B 4FU8A 2XCFA 1DXWA 2Q6DA 2A5KA 1SLUB 2ZQ1A 4GHQA 1W3CA 2G52A 2SNWA 1HLTH 1GJ8B 1A0HB 4F49A 1EXFA 2ZHEH 3ZVFA 2ODQA 2PKSC 2W3IA 4XOJA 2GV6A 1GBTA 2ZCKP 2QV1A 3SU5A 4ZH8A 2XC5A 2ZFQH 2SGPE 2A2QH 3A82A 2OBQA 2ZKSA 1FPHH 3B9FH 1K21H 2BLWA 1Y8TA 4MPVA 2SGDE 1N8OB 4RKOB 1AN1E 4B2AA 1GWAA 4NFFA 5F8XA 1TPPA 4ABGA 4WMFA 1AB9B 3SNBA 4MNWA 5L2ZH 1P2IA 2FODA 1KXEA 2HNTC 3NCLA 4LXBH 2R3UA 1GJ6A 3PLKA 4X6PA 1X7AC 1AFEH 2HNTE 3GICB 5LPEA 3SUEA 1CGIE 1KTTB 1P09A 1S0QA 1SHYA 2DE9A 1DT2A 2F9OA 3CS7A 1WU1A 1OP2A 1O5FH 3U8OH 3UREA 1P2MA 1GGDB 4CH8B 1FDPA 1XUJA 2ZP0H 1O2PA 5L30H 4X6NA 5GPIB 2XRCA 4XDEA 2OQUA 2YOLA 1ZRBA 3OX7U 3MO6A 3RXTA 4FUFA 1C5ZB 1O5GH 1GCDA 3E0PB 3V13A 2H9HA 3QLPH 2QIQA 2GV7A 1A1RA 4U30A 1CE5A 1GPZA 1V2LT 1QB1A 1TWXB 3L6PA 2PFEA 4XSKU 2Z9GA 5K0HA 1O2VA 1F5LA 1PQ8A 3UIRA 3N7OA 3LC5A 3VEQB 3V12A 4NG9H 3A7TA 2CXVA 1CA8B 4ZKOU 3FZDA 2P3UB 2VB0A 4MNXA 1QIXB 2HWLB 3OY5U 4CHAC 5I25A 3TNSA 4X8VH 2Z9KA 6GCHF 3T28A 2VJ1A 2A0QB 2F91A 1SGDE 3DHKH 3O8BA 1PJPA 1RIWB 4B76A 3ZV8A 1IQHA 2W3KA 2ZECA 1YKTA 1OWEA 3HKJB 3BEFB 3UNQA 4WXVA 1OP0A 1QBOA 1OWDA 3RDZA 3GY8A 1FN6A 1CBWC 2ZF0H 2ZHQH 2WPHS 5FPSA 1KLIH 2C8ZB 4Y10E 3UOPA 5G4BA 1UHBB 3MOCA 1C1TA 2ZDMA 4NIYA 2BD5A 2UWPA 1RTKA 1GHBF 3Q00A 2JETB 4O9VA 6CHAB 2VH0A 2BD8A 1TQ0B 1EPTC 1G3BA 2ZHWH 2HOBA 2F9PA 4AFSA 4MPUA 1BHXB 2XC0A 1C2LA 3AAUA 1FY1A 1V2ST 4Q2KA 1DY9A 2OD3B 4Y8ZA 3LT3A 2BQWB 1SGFG 1GHZA 5EXLA 1UVUH 1O3OA 1GG6C 2Y5FA 1EPTA 3M35A 1HXFH 4IGDA 1C2GA 1C2FA 1OS8A 1EAUA 3UUZA 1GI1A 1HAYB 3ATIA 2Z94A 3EQ0H 3TH2H 3TJOA 1V2NT 2VIDA 3RP2A 4AYYB 1G2LA 2NU1E 1KDQA 3RU4D 3M37A 5EODA 2ZG0H 4NIXA 3MH6A 1GMCG 1MUEB 4A92A 2JKHA 1ABIH 2VWNA 3LH3A 1HAGE 1LPGB 3LKWA 3Q3KA 4NA8A 3SGQE 1FAKH 1GBBA 1MBMA 3VB5A 1HAXB 4IC6A 1TA2A 3BEUA 1A0LA 4IMZA 3FVFB 4ISOA 2VIQA 5JBCS 1K9OE 2VGCC 2ZGJA 4BAMB 3OYPA 7GCHF 2WPMS 2ZGCA 3FAOA 4HGCA 2W26A 1EP6A 2WPLS 1ANBA 4THNH 1JWTA 3KN2A 1V2OT 2GZ7A 1AB9C 1HRTH 3ZZ4A 4OS2A 1NS3A 3U1IB 1TFXA 2P8OB 3QZRA 3MU5A 1TE0A 1ZSKA 1LMWB 2ZGXH 3ESTA 2BD4A 5FXLA 2J9NA 2PTNA 1OWJA 4AOQA 1UK3A 1D3DB 3SQEE 1GJDB 2HLCA 2AGGX 4ZAEA 4X1QU 1QRXA 4BTTB 5DP3A 4JZFH 1THRH 2A45B 1OP8A 4LZ1H 1J16A 1YPGH 4NA7A 1RJXB 1O5BB 1AVGH 1O0DH 1BTUA 1FY3A 1ZPZA 1MTUA 1LDTT 2GDDA 2PUQH 3E3TA 4O3TA 4FVDA 1H9HE 1DFPA 3BN9A 3MH7A 3U9AH 5A0CA 1QNJA 4CRBA 2ZPQA 8GCHF 4YT6H 2A7HA 3S9BA 3E0NB 1EB2A 1O3JA 1W11U 3QX5H 1C1NA 5AVDA 3EA9A 3PYHA 3SHCH 4JYUH 1E38B 1EZUC 1FN8A 1ZMNA 2BD9A 4Y0YE 3RXKA 1QR3E 5FX5A 3RXCA 5CE1A 2FX4A 2BVSH 3VB6A 1G9IE 2HGTH 2VINA 3UR9A 1K1NA 1P06A 1LHEH 1LVBA 1BTYA 1Z8RA 2A31A 2EEKA 3LDXH 2QGRA 4IC5A 3QTOH 1FAXA 4K60A 4D76A 4UD9H 2OBOA 3ENSB 4D7GA 3BG4B 3SV2H 2D26C 3BTFE 4I8LA 2SGFE 1CGHA 1EP5A 4GSOA 4FUBA 4JZDH 3L3TA 2ZDAH 3O8DA 2V0BA 1P2JA 2PKAA 2V3OH 2ZHFH 2AH4X 1CA0C 2A5AA 4I8JA 1G3CA 5TCAA 2WPJS 4D9QA 2FOGA 2HPPH 1DUAA 4ZHLU 1GBKA 1LHDH 3LGIA 4AFUA 5AFZH 3UY9A 1GBFA 3UTUH 1ABJH 2ZDVH 1HBTH 1YC0A 2C8XB 1Q31A 1Z6EA 1A5IA 1SHHB 2BLOA 1JRSA 1B0FA 2VIPA 4NSVA 5EPNA 1SQOA 1UVSH 3M3VA 2Y82A 1GI2A 2BDIA 6CHAC 3GCTG 1BTWA 1YPLH 3LGYA 1C1RA 4YM9A 1PQ7A 4X1NU 3KQDA 1HXEH 3SU4A 1K28D 3ZVCA 1C1MA 4MPXA 1DXPA 5C1UA 3MH4A 3SU3A 5HGGA 2J95A 5LH8A 1GBHA 1O2KA 2C8YB 4JYTA 1EOLA 1YPKH 1QHRB 1A4WH 2FS9A 1AHTH 2P93A 1GJ4H 1BB0B 2XXLA 5GJ4B 3RUOA 1D9IA 3FP7E 2P59A 4K1TA 2C3SA 4AB9A 3TIUA 1RTLA 2LNCA 1TGCA 1NZQH 2H5DA 3ZZ7A 2XBXA 3SGBE 2CGAA 1TRMA 2QF3A 1YGCH 1MCVA 2HRVA 1YLDA 6ESTA 2QA9E 2TGTA 3NWUA 1C2EA 5GCHF 4CBOA 4U32A 2Z3CA 4ESTE 4FU9A 2VWLA 4A1XA 1Z1JA 3SNAA 1HAPH 2H9EH 3I29A 2WUBA 2VWOA 1CO7E 3P6ZB 5JBTA 3W94A 2QXHA 3Q76A 2ANYA 5FX6A 4MLFB 4X0WU 4NIVA 3V0XA 4DCDA 2PKSB 2ESTE 1ZRKA 1K1LA 1SGYE 3GY5A 3I77A 1TPSA 1C4Y2 2P8OC 2H5CA 2BD7A 2YNAA 1BCUH 1FI8A 4BXWA 1ELGA 4I33A 1NFYA 3BTKE 1AD8H 3QUMP 3E91A 4LK4A 5JBBS 4CR9A 3RXQA 3CS0A 4XBCA 1EZSC 4H6TA 1SVPA 3D62A 3K2UA 1GHWH 2TPIZ 5A8XA 3Q3YA 4UFDH 3HK3B 2FOEA 3SJIA 3DT0H 2AMPA 3ZZBA 1F0UA 2AFQB 2VVCA 2M5TA 1DANH 2XTTB 5A0AE 1JIMA 3T5FH 5AFYH 1INCA 1WUNH 2Y5HA 1SC8U 4DT7B 1RXPA 1Z71A 4AB8A 1MAYA 1H9IE 3SU2A 1YLCA 1IQLA 1O37A 1AWHB 1UVPA 1SB1H 2DE8A 3R0FA 1K1IA 3PMHB 2NU4E 3PMAB 3KQBA 1D3TB 4BTUB 1WTGH 1O32A 2Z7FE 1O2WA 2BDYA 1S82A 2ZPRA 1E34B 4JMYA 4MNYA 2HVXA 3TH4H 2BB4A 1NC6A 1QL8A 1BBRE 1QA7A 2Y81A 1HV7A 3QWCH 4UFFH 3VXEH 8ESTE 4FUHA 6GCHG 1EQ9A 1TBZH 1THSH 4NCYA 2NU3E 2PGQB 1FV9A 1W0ZU 1W8BH 1JMOH 1P12E 3BG4C 2G5VA 1O2NA 1DX5M 2AYWA 1DWEH 1XVMA 2BDHA 4A6LA 1YPHC 1HB0B 2NU2E 4FVBA 3ODDA 1G2MA 1HPGA 3TK6A 1ZPBA 2BDAA 1MMJN 1IQGA 2GX4A 1DLEA 5T6FA 4WH8A 1J14A 3TLOA 4NGAH 1C1VH 4CHAB 4XBBA 2A5IA 1NN6A 3P17H 1HCGA 4X6OA 3ZZ9A 1HJ9A 2PWXA 1QGFA 3NXPA 2BDCA 1MQ6A 1FY4A 4DVAU 1SG8B 3BIUH 1LCYA 3M5NA 1GBMA 3KGPA 1EASA 1GHBG 3M36A 1Y3XA 4X2XA 1PPGE 4ZROA 3RXOA 1SGFA 2VVUA 3BG8A 1EX3A 4JZIA 3H5CB <