2BM2A

Human beta-ii tryptase in complex with 4-(3-aminomethyl-phenyl)- piperidin-1-yl-(5-phenethyl- pyridin-3-yl)-methanone
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Based Design of 4-(3-Aminomethylphenyl) Piperidinyl-1-Amides: Novel, Potent, Selective, and Orally Bioavailable Inhibitors of Bii Tryptase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords HUMAN BETA2 TRYPTASE
total genus 46
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bm2A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bm2A01
4ESTE 4FUBA 1PPFE 1KDQA 2A4RA 1LPKB 3OTJE 1QQUA 3T5FH 1C9TA 2PLXA 2Z9KA 3GY3A 1QL8A 4OS1A 2BD7A 1ANCA 4BAKB 1IQJA 3BG4B 1XXDA 1RRKA 1ELVA 1LKBA 1WQVH 2V3OH 1QRZA 4YLUA 5FPTA 1UCYH 3KHVA 4O3UA 2FDAA 3BG8A 3STIA 1PJPA 1WTHD 3EAJA 3QWCH 1AN1E 3LH3A 1N6XA 1RJXB 3BSQA 1S83A 2NWNA 1C2FA 3UIRA 4ABGA 4FUFA 2FZZA 1V3XA 3LC5A 3RXPA 1MQ5A 3SHCH 1AFQB 4YZUA 4PROA 1BMAA 3ZVEA 5JYIA 1FUJA 3B23B 1MTSA 3T2NA 2ZCLP 3PMJA 1O5EH 3V13A 1PFXC 1INCA 2TGDA 3TITA 4A1TA 1NPMA 4A92A 1HLTH 3A84A 1ESTA 3RC6A 1BRCE 2VIDA 2ZP0H 1EQ9A 5I46H 1DVAH 2Y6TA 1ZSLA 1P2JA 2AEIH 1QJ1B 1F7ZA 1NFYA 2BMGB 1O2UA 1C1PA 2ZFPH 3K9XB 1GJAB 4OGYA 4J2YB 1NZQH 1HV7A 1A0LA 2FYRA 2Y80A 2Q6GA 4ISNA 1KXEA 2BDAA 1V2VT 4BXSA 4X8VH 4AN7A 2VVCA 1GHAF 1TMTH 2H9TH 1BB0B 2VVVA 3A86A 2TGPZ 4ZUHA 2C8WB 1QIXB 3BV9B 1O3JA 3D62A 4AZ2B 1NO9H 2W3KA 3A8DA 3LGUA 2GVFA 4CH8B 5C67A 1BBRK 1J15A 2BD4A 1YPHC 1SLXB 1XVMA 4LZ1H 3ZZDA 2UUYA 1GBTA 4YT7H 1THSH 1QQ4A 5A2MH 3LGYA 1FIZA 4E05H 1YPEH 2UWPA 1HXFH 3RLWH 3RXTA 1EPTB 1F2SE 3A7WA 3Q76A 5L30H 2ZU2A 1GJ8B 2SNWA 2XBYA 3UNRA 3O8BA 4JK6A 2Z9LA 1EZXC 4TY7A 3O8DA 4NZLA 2ZFRH 4X2WA 2ULLA 1N1LA 2F3CE 1ABJH 2HGTH 1V2MT 4HFPB 1FY3A 3P95A 1D3TB 1PPGE 1OYQA 4ZHMU 5LPEA 1E36B 2GZ7A 1ZJKA 1L2EA 4FUDA 2ZC9H 2AIPA 1W11U 1W0YH 1P02A 1GJDB 2A7CA 1C2KA 2ZKSA 1FIWA 2HNTF 3GISB 4FUHA 3LJOA 2IN2A 1BZXE 1YPGH 1NFUA 1P3EA 1Y59T 1BCUH 1Z8GA 3TJUA 1NFWA 4DT7B 2EI7A 2UWOA 2STBE 1GHXH 4Q80A 3RXGA 2F9VA 1SGRE 2FX4A 1CT4E 1N6YA 2A2XH 5L2YH 2ZQ1A 3SI3H 1NU9A 1SQOA 5FPSA 3GCTF 1UTMA 4K2YA 3RXMA 4B74A 2PUQH 1TAWA 4DW2U 1FV9A 2YNAA 2J4IA 1GI3A 1DWCH 2FI3E 1SOZA 1O3HA 1WSSH 1QNJA 1OWJA 2PFEA 2BQWB 3K6YA 4AX9H 1GG6C 5C5OA 4AOQA 3S7HB 3F68H 1IQNA 1TGNA 3UFAA 1CGJE 3HKJB 2B5TB 3FVFB 1L1GA 1CHGA 1MTVA 2ZCHP 1W3CA 3B8JA 4NIXA 4X2VA 2BD2A 3S69A 3V3MA 2NU3E 1ELFA 1BTHH 1SHHB 5JBCS 1A0HB 2ZDVH 1KDQB 1MBMA 5F03A 1Z1JA 2Q6DA 1SGFG 4WVPE 3EA7A 1V2QT 3RXIA 1O5BB 1GMDF 1SL3A 1XUGA 5LH8A 3ZZ5A 1DUAA 1AWFH 5E8EH 3SW2B 2Y82A 1SBWA 5AFYH 1SGQE 1EUFA 1J16A 1SR5C 1QA7A 1OYTH 2XBXA 1BMNH 1XXFA 3SO3A 4IMZA 1BITA 2J94A 2SGFE 2UWLA 4AGKA 1O2ZA 2A0QB 2RA0A 1S5SA 2BLQA 2SGAA 2ZDNA 2TGTA 1YP9A 1CGHA 4Q2KA 3DT0H 3KN2A 4DOQA 3SJ9A 2PHBA 5F8TA 2CF8H 1QR3E 2GDEH 5JPMH 1GDQA 2A5IA 1HB0B 1AHTH 3PMHB 3V7TA 3A87A 1F0SA 3VGCB 1SQAA 1TOMH 1F5LA 1YLCA 4Y7BA 1LO6A 1C1TA 1VGCB 4B71A 2LNCA 1E34B 1K1MA 3FZDA 4WF8A 1A5GH 1KIGH 4GHQA 5T6FA 4NWLA 3GY8A 3F1SB 2AGGX 3UOPA 1O31A 3DFLA 3RXSA 1VGCC 1Z7KA 4MNXA 2ILNA 1YM0A 4JZEH 4FU9A 1OPHB 2ZTYA 2UUKB 2HLCA 1DY8A 4F4OC 2FS9A 4HZHA 3RLYH 3DUXH 1P9SA 2BQ6B 1LVOA 3T26A 1BUIA 2BM2A 4ISOA 1GBCA 2Y5HA 1UO6A 1C5MD 4XFQA 1LHGH 3KQEA 3SU1A 1Y5AT 4ABAA 5J4SA 5DGJA 1UTOA 3SGBE 4NA8A 2ZHFH 2VIVA 2H1UA 1UVUH 3A7ZA 2GZ9A 4ZKNU 1HDTH 3TNTA 4M7GA 1LPZB 4WXVA 2PWXA 3M7QA 1P2MA 2VU8E 1HJ9A 4ISHH 1C1UH 2CHAB 2D1JA 3MWIU 1MTWA 5CHAC 1TRMA 1VJ9U 2ZDLA 3DA9B 2GP9B 2QV1A 2RDLA 3LGIA 3MNBA 5JDUB 1C5SA 1A61H 2BX3A 1AUJA 1BQYA 1KXFA 4I31A 5DP9A 1VJAU 5L6NH 2PGBB 2VGCC 1G36A 4X1QU 2BXUH 3M61U 4CR5A 1C1SA 2GZ8A 2O8TA 1A7SA 1FY4A 1EASA 1H9IE 1KXAA 1GBDA 3O8CA 1KTSB 1EX3A 1HAVA 2AS9A 4KP0A 1GMDG 1QBOA 3M35A 1AO5A 2G51A 3RC4A 5ESTE 1HAZB 4X0WU 1AWHB 2VNTA 2NU1E 4KTCA 2ZDAH 2TRMA 3MH4A 4GVUA 2XXLA 1MH0A 3SNBA 5SGAE 3KNXA 1O2PA 2BYAX 3QLPH 3LDXH 1BOQA 7KMEH 2BDIA 2Z6BD 1FI8A 1T8LA 1T8OA 5EOKA 1GBBA 2ZGCA 4IS5A 1EATA 2V6NA 4XBDA 3VGCC 4BNRA 3ITIA 2AGEX 1KLJH 1Z6JH 2WPMS 2BLWA 1O3PB 1ESAA 5IYTA 2BQ7B 1ZHRA 2WPLS 1NRNH 4JCNA 3ESTA 4I8KA 2K1QA 2GCTC 1TA6A 5EW1H 2ALPA 5LPFA 2HRVA 1O36A 1DS2E 3NPSA 1GL0E 1PPCE 4MTBA 2ZA5A 4ASHA 2FTLE 1P8VC 5EGMA 1RTKA 1H9LB 3SUGA 4D9RA 2ZZUH 1A0JA 1VR1H 2CXVA 1SGEE 1FLEE 4H42U 5FBEA 1AY6H 1K28D 4I8JA 1IOEA 2A5KA 2GV6A 1S6FA 4ZKOU 3DD2H 3RXCA 2VWLA 3PLKA 1K1LA 2RG3A 2OXSA 4FVBA 3SNCA 1SPJA 1ZOMA 1O33A 3LU9B 3QZQA 2ZFFH 5GCHG 1GMCG 3UTUH 4UEHH 3QUMP 4TY6A 1Z1IA 1TB6H 4NGAH 3PTBA 4WXIA 1GHZA 3ZZ3A 3SJOA 3LGVA 3TPIZ 1O2HA 2P3FH 3AAVA 2EI6A 2XRCA 3S0NA 1BRUP 1GHAG 2F91A 4Y76A 2G4UA 1O3KA 4KGAA 5C3NA 1JXPA 1DSUA 3HGNA 1J14A 2V3HH 2DE8A 4FUGA 1FMGA 3TH3H 1UK2A 5DK1A 1O2OA 4UFFH 4Y8ZA 3GICB 4B2BA 1DITH 4B76A 3SN8A 2BY7X 1DE7H 2C90B 2FEQH 3RXAA 1AD8H 3RXVA 3T28A 4Z6AH 2FOCA 1AFEH 1O30A 3HKIB 1A3EH 5EQQA 1H4WA 5IDKA 1P10A 3HPTB 3QGNB 3RXLA 2ZIQH 3HK6B 2FI5E 3URCA 1XUJA 1IHTH 3LJJA 1MU6B 4NIVA 3PB1E 1NRPH 2ZFSA 1UVSH 3MYWA 2FIRH 2OQ5A 1C5UA 3Q00A 3RDZA 1YPJH 4HGCA 1OOKB 3TIUA 5PTPA 1LDTT 1YKTA 2DUCA 2ZGBH 4ZKRU 3ZZ8A 2Z3DA 3GY2A 2AIQA 2QF0A 4Y0ZE 1ZTKA 1CSOE 4K8BA 1MZAA 1RTFB 4MPWA 5BRRE 3NUMA 3PO1B 1QRXA 1TE0A 3GCHB 1V2TT 1O3FA 1UK3A 1C1OA 3CS0A 3RMNH 1QJ6B 3MH5A 3MI4A 2R2MB 2GMTB 1GVLA 1G9IE 4NFFA 1GBAA 1GCTC 1P3CA 3QTOH 5HYOA 4UONA 5FHTA 1W7XH 2Y7XA 2SGQE 4H6SB 1O2JA 3ATIA 1MTUA 1N8OC 3A8BA 4B2AA 1GI6A 5FPYA 1V2NT 2Y5GA 3F9GA 2OC0A 2F9NA 1EB2A 1C5LH 1LVMA 2VIQA 2ZCKP 2PTNA 1GCTB 2ZEBA 2ZHWH 3BTGE 2HVXA 4FUCA 1KTTB 1EJAA 1TPAE 3JZ1B 3F6UH 2PKSC 3P8NA 2ZECA 4X6PA 3SNDA 1P9UA 3I77A 2XCFA 4I32A 1CBWB 4FU7A 1TGSZ 1C4V2 3SUFA 1RIWC 2BDCA 2XBVA 4YOIA 5AFZH 1NRRH 1C1NA 1FONA 3E8LA 1C5ZB 4JYTA 3ATKA 5F8XA 3PLPA 2DE9A 4UE7H 4JZFH 4K60A 1O32A 1NTPA 5EG4A 1HBTH 4R0IA 3TH4H 1EPTA 2IPHA 1TNJA 2FOAA 1O5CB 2CF9H 3W95A 2V35A 1F5RA 3M5LA 3UUZA 4B1TA 1LPGB 5DKMA 1DICA 1V2OT 3GY5A 1SGYE 1J9CH 1GI0A 1NT1A 3SUEA 1EJNA 1ZLRA 5DP4A 1SGNE 3F9EA 1Z6EA 1MMJN 6GCHF 3LH1A 3ENSB 1K1OA 2GCHG 1GBIA 1S0QA 3M5OA 2GD4B 1AVWA 1G2LA 4OS2A 2HNTE 3QGJA 2RA3A 2G55A 5FBIA 3PLBA 1GVKB 2QXGA 2W5EA 3I78A 3SU2A 1G2MA 2BD9A 3T29A 4X6NA 2FI4E 4K1SA 1W7GH 2A4OA 4FUJA 2BVRH 4I8HA 1K1NA 1O3DA 4NG9H 2BDGA 1GI1A 1JBUH 3BIUH 2OLGA 2Z3CA 4X8TH 1YBWA 2P3UB 4KTUA 1O2MA 1WOFA 1BMMH 1E0FD 1V6DA 2XW9A 3V12A 1EKBB 5GIBA 1FJSA 1AQ7A 3RP2A 1VITG 1GCDA 2JKHA 4A1VA 1KLTA 2G00A 1O5GH 2ZTXA 3QZRA 1SGFA 1HIAB 2QXIA 2BOHB 4XBCA 1ETTH 1W2KH 1GJ6A 1EAUA 4MLFB 1DDJA 1QGFA 5GCHF 4K5ZA 3AW0A 2QCYA 4U2WA 5E2PA 1DSTA 4ZXXH 1E38B 1SGPE 1PPHE 1P57B 2J95A 3M36A 4QT8C 1JIMA 7GCHF 1C5OH 4JZDH 1MCVA 5EXMA 4E06H 3H7TA 4H4FA 2B9LA 3BTME 1P2NA 1RIWB 1B0FA 1VCWA 3WY8A 4YM9A 1GHBF 2C4FH 4AB8A 2IOTA 3G01A 1GGDB 1D3QB 1FNIA 1MKXH 1TGTA 2FOEA 1GI8B 1SMFE 1EOLA 3BTEE 5G4BA 2M5TA 4UFGH 3TK9A 3A7YA 4B75A 3UR6A 1GI2A 5E0JA 1G30B 4CRDA 5C1XA 5EW2H 3K6ZA 2P59A 3W94A 2CGAA 1GPZA 2BX4A 3SHAH 3S9AA 4YTAA 4MNWA 1C2GA 1BTWA 2BY5X 4IMQA 2G52A 1JRTA 1PQ8A 1HGTH 3ODDA 2OQUA 4GPGA 3SNAA 5E2OA 4D76A 1EAXA 3TK6A 1ANBA 3P8OA 3RMOH 1VCPA 3E0PB 1W8BH 3U69H 3P8FA 1PPEE 1TGBA 4XSKU 4I7YH 3M5NA 3ZZ6A 8KME2 1P09A 3H5CB 1AB9B 2VGCB 1BDAA 1AFQC 2BZ6H 3BTFE 1TOCB 1IQLA 3IG6B 1YPKH 4AG1A 5BPEA 1GBKA 2FPZA 2R9PA 3MO6A 4CRAA 1HCGA 4I8LA 1HAYB 2Q6FA 2P8OB 7LPRA 3PV4A 3KQDA 1IHSH 2J38A 1FPHH 5ETXA 2FOGA 3ZZCA 1CVWH 1PQ7A 2AMQA 8GCHG 1O3MA 1WV7H 4XDEA 4ZXYH 3SORA 3BG4C 1L4DA 1RD3B 3D49H 4ZHLU 1IAUA 1P2OA 3E0NB 2VWOA 1L0ZA 4CHAC 4CH2B 4A1XA 4ZHAA 1Q31A 2OP9A 3MNXA 3PMAB 1O35A 3Q3XA 1S81A 2J9NA 3LT3A 3SJIA 1C5YB 1NS3A 4NCYA 4VGCC 1DUEA 1QBVH 1DFPA 3B9FH 1DX5M 1YGCH 1YYY1 5T6DA 2ZPQA 3U8OH 2STAE 1Y5UT 1V2UT 3M5MA 3EQ0H 4THNH 3GYLB 3RUOA 5A0CA 1HAXB 1T4UH 1BJVA 3Q77A 1O2LA 1ANDA 3SV6A 4O9VA 1YCPM 4NWKA 5EXNA 4INHA 2CN0H 4BAMB 2YOLA 2BOKA 1ZMLA 2AYWA 3KL6A 4OS6A 4MPUA 1TALA 1GHBG 2LPRA 4VGCB 1AE5A 1OWIA 3U8TH 1L1JA 5A0AE 2Y5FA 1O3LA 1B7XB 3ZZAA 3SGAE 1SSXA 1ESBA 1LHDH 2QXHA 2ZGHA 3BEIB 4INKA 1OWKA 1TABE 1O34A 2FLRH 1GI7B 2ESTE 3BTDE 5I25A 1ZHPA 2AERH 2FLBH 4NA7A 1HRTH 3RM0H 1ELGA 1AU8A 2A7HA 3A85A 3FZZA 1TBRH 4Y11E 3ZVCA 1GHVH 3VPKA 4Y6DA 1QURH 1TBQH 1HYLA 1FY5A 3M7UA 2A5AA 2P94A 1LVBA 1TBZH 1C5NH 1AE8H 1ZRBA 1GL1A 1D3DB 3QO6A 4YO9A 1E35B 4MG3A 3MMGA 1SI5H 1GG6B 3A8AA 2THFB 3EE0B 3UQVA 5EQSA 2VWMA 2ZTZA 2P16A 3A7TA 2Q1JA 3T62A 3ZYDA 1W13U 3M7TA 3PM3A 2ANMH 9LPRA 2VH6A 2O8MA 5DP7A 4ZH8A 5DJ7A 1BBRE 1YPMH 2TBSA 1Y3XA 2NU4E 3K2UA 4ABJA 1O2IA 1C2DA 2R0KA 3MU0A 4J1YA 4YESB 4AFSA 1DANH 3RU4D 1IQKA 2XCNA 4RN6A 1DT2A 3LONA 3SNEA 4WJG2 2Z9IA 1TA2A 1DPOA 8ESTE 3FANA 1DLKB 2P93A 1P03A 1UCYE 2JH0D 4MPXA 2G5NA 2ANKH 3RXBA 3EYDA 1GJ5H 3IITA 3BTQE 1CT2E 1HAOH 5HGGA 4X1PU 1JRSA 3BN9A 3A82A 3ZZ9A 3VEQB 1KXCA 2R3UA 1Y3WA 1O5FH 4SGAE 1TQ7B 1T8NA 1X7AC 1ACBE 3CP7A 3M3TA 4MNVA 4Y10E 5GWZA 1BBRH 3A7VA 1KLIH 1FZZA 1ARBA 1D9IA 1WTGH 3UWIA 4LXBH 2ZQ2A 3UPEA 1AIXH 1UCYK 4AGJA 4AB9A 1ZJDA 3ZYEA 3SGQE 1FQ3A 4D7GA 3RXRA 3ATMA 3TU7H 1QY6A 1GI9B 5L2ZH 2Z9GA 2SGDE 3QTVH 3RM2H 5CMXH 2A2QH 3U1JB 1LKAA 2QGRA 2BLVA 1OKXA 4X2YA 1SB1H 4O3TA 4RKOB 4JZ1A 1RXPA 1EZUC 1O3GA 5EQRA 4CBOA 1LQEA 4BTUB 1OXGA 1P2IA 3SU6A 1ELEE 1Z8JB 4XE4A 1CHOG 3L33A 3MU4A 1EOJA 1IQFA 1G32B 1ZR0A 2PV9B 3HGPA 1IQMA 1TPPA 1PPZA 1UMAH 1Q3XA 5FX6A 4CRGA 4CRBA 1LHEH 2BY8X 4TYDA 4GHTA 1QRWA 3PROA 5DG6A 3SU5A 1UTJA 9ESTA 1A5HA 1EP6A 1GI4A 2CHAC 1C5RA 3RXUA 1UTNA 1HAHH 3E6PH 1DWBH 2GT7A 3QK1A 2HALA 1ZTLA 5EU8A 1MD8A 4ABDA 1GBLA 3TNSA 4MVNA 5JB8S 1QHRB 3MU1A 4BTTB 4CR9A 1JOUB 2WV5A 4DJZB 3U8RH 3QDZB 3ZVDA 3MH7A 4ISLA 5JBBS 2PR3A 3NKKA 4AYVB 4KKDA 4Y8XA 1ABIH 2VB0A 2GGVB 1C1MA 1RTLA 3T25A 5K7RA 1C5XB 2ODYB 5C5NA 2KAIA 3S7KB 6ESTA 2O8LA 5FX5A 1MUEB 2ZFQH 1D3PB 2TGAA 1TQ0B 2SGPE 5HM9A 5AVDA 1AUTC 2WYGA 3EDXB 4B73A 3SI4H 2AMDA 2FOFA 3MO3A 4B2CA 4UDWH 1CA0B 3LGWA 1MZDA 1TGCA 2XYAA 3QN7A 1FPCH 1MQ6A 1C1RA 1TMUH 3JZ2B 4IBLH 1HNEE 2WUBA 1HJAB 1O2XA 2HWLB 2XBWA 4OS4A 3ZZ7A 2FMJA 8GCHF 4Y79A 1ZSKA 4DG4A 1QL9A 1GJBB 5GJ4B 2F9BH 4DURA 2QIQA 1S82A 4UD9H 1ZYOA 1CBWC 1YCPH 2JH5D 1T8MA 3SV8A 1KXBA 3RMLH 2ZGJA 1CU1A 2HOBA 2ANYA 1WUNH 3NZIA 3ZVBA 4DY7B 5F6MA 2XC4A 1GI5A 1NY22 3VB4A 1JMOH 4U01A 3H7OA 3A7XA 3C1KA 4ABFA 4XBBA 2PSYA 2R0LA 1GVZA 1LHCH 1TX7A 2TPIZ 3F9FA 1BHXB 1O2KA 4NIWA 1P11E 4X6OA 1BTPA 4CBNA 4OS7A 1B0EA 2ZU3A 1EZSC 3SV7A 1C1QA 2Y7ZA 3ZVFA 1U6QA 1Y5BT 1GWAA 1O5DH 1GDUA 4MQAA 2XWBI 1FN8A 1WQSA 4CRFA 3KQCA 1AVGH 1FXYA 3UWJH 1O3CA 4WMEA 2G5VA 3PWBA 1TYNA 4AFZA 3GY6A 2ZDKA 4JZIA 2C93B 2I6SA 4X1SU 1S84A 1XKBC 2Z3EA 2GTBA 3BEFB 1AB9C 1NRQH 3KQBA 3RXDA 4JYUH 3MU5A 1BTXA 1LMWB 3VFEA 4FVDA 5C2ZA 1CE5A 1MAXA 2W3IA 1TX8A 3AW1A 1HAIH 1G37A 1Y3VA 4Q7ZA 2OCVB 2GDDA 4ABBA 1O38A 1ZMNA 2EA3A 1AMHA 3ZV9A 1GDNA 3SJ8A 1TRYA 1MD7A 2GV7A 1UVOA 1S6HA 1NESE 1T4VH 3PTNA 1F5KU 2XWAA 5E0GA 3AVZA 4AG2A 1TWXB 1DXWA 3SOSA 2FESH 1SGCA 3VB5A 2J2UA 1SGTA 1D6WA 2A1DB 2SNVA 5JBAS 4WY3A 3ODFA 1P0SH 1CA0C 1IQIA 2WUCA 1GHYH 1AVXA 3HATH 3RXFA 4LK4A 5T3HA 1ZGIA 1QA0A 1Z8IB 3OSYA 4BAQB 4IW4E 1HJAC 4Y0YE 5FCRA 3ELAH 2F9OA 1TPOA 2ZNKH 3E1XB 4DIHH 3VB6A 2XC5A 3BTKE 1K1IA 2ODPA 1DY9A 3TJNA 1ETRH 1GMHF 2ZI2H 1QTFA 2WV4A 4K69A 3D23A 3BTTE 1C5QA 1H9HE 1O39A 1SG8B 3E16B 4Q7YA 3UR9A 3SV2H 4D7FA 6CHAB 3A88A 5A09A 1C1WH 1XVOA 2QA9E 3GCOA 1VCQA 2QY0B 1QBNA 1TNKA 2C8YB 1XM1A 1XUKA 1JWTA 1GJ9B 4A6LA 1TX6A 2H9HA 2VJ1A 6GCHG 4I33A 5AHGH 2VINA 1GGDC 4YOJA 3MH6A 1LCYA 1GBMA 1LTOA 2PTCE 3GYMA 5A0BA 2D8WA 5EPYA 4K1TA 2PKSB 6LPRA 1P01A 3TGIE 2CV3A 2GCTB 4BXWA 1MTNC 1UVPA 2ZF0H 1EB1H 2BDHA 2FX6A 1TLDA 2ANWA 1O2QA 3S9BA 2FP7B 3BF6H 1QJ7B 3M3VA 4I8GA 3ZVAA 4BTIB 3NXPA 1HAVB 3EA9A 3LGTA 1XUFA 1TNLA 3LIWA 4FXGH 4GAWA 1DM4B 3QX5H 3M37A 4GSOA 1CA8B 3S9CA 3SU3A 3MU8A 4Z0KA 1NN6A 3KF2A 2OBOA 2P95A 3RXKA 3ZVGA 1UTKA 1C2EA 1O0DH 3F9HA 4CRCA 2FOBA 1XX9A 4ZAEA 1K22H 1PYTD 1OWDA 4NZQA 1Y3YA 2CJIA 1D4PB 7ESTE 1TONA 1P12E 1HIAA 3A80A 1OWEA 2BDYA 3KIDU 3A89A 5HM2A 4GCHF 1K21H 1O3EA 1C2IA 2Z94A 3UQOA 1O3OA 3FP7E 3PYHA 2OD3B 1O37A 2FODA 5JBTA 3Q3YA 3UNSA 5DP8A 1GJ4H 1F0UA 2QC2A 1G3EA 2C3SA 3I29A 3P70B 3RXHA 1ID5H 3R0FA 1P04A 3RU4T 8LPRA 1A5IA 2A32A 1O2RA 5FXLA 1GJ7B 3GCHC 2QYIA 1IQEA 1TMBH 2FOHA 2B0FA 1MBQA 1EPTC 2PW8H 3FFGA 4D8NA 2PUXB 2Z7FE 3E90B 1DWEH 4MNYA 2XC0A 1Y8TA 1UK4A 4RKJB 3ATWA 4IC5A 1NM6A 4JMYA 1A46H 4UFDH 3VXEH 1O3IA 2GKVE 1LHFH 2ZPSA 5EPNA 5DP3A 1T7CA 4XOJA 1C2JA 2ZHQH 1CGIE 1OP8A 5FAHA 3GCTG 4Y71A 1SC8U 1V2JT 6CHAC 2PKAA 3CENA 3EA8A 2BD3A 1V2ST 1O2VA 2EEKA 1S85A 3FAOA 2O9QA 4A5TS 1O5AB 2C8ZB 1AI8H 3URDA 3RC5A 1ZSJA 2FS8A 1NC6A 4DGJA 1Z8RA 3U9AH 2KAIB 4K3JA 2PGQB 1TNHA 2GX4A 4LZ4B 2B8OH 3N7OA 3A8CA 2SFAA 3TH2H 2FOMB 3STJA 4ABIA 2O8WA 2WPKS 1ETSH 2XTTB 1F0TA 5HMAA 1GBJA 2I6QA 1NFXA 1A3BH 3U98H 1C5VA 4FUIA 1W10U 5K0HA 1CT0E 1UHBB 2A4GA 2HPPH 1V2PT 1O2NA 4RSPA 3PWCA 1THRH 2UUFB 2VVUA 3RXQA 3UREA 1RFNA 1VITF 3CS7A 3BEUA 1QCPA 2QAAA 4X2XA 1ZPCA 3PMBB 1GJCB 4WWYA 3ZZ4A 1UVTH 4GLYA 1WAYB 3KGPA 3ZZBA 1Y3UA 1C2LA 1QB1A 2SGEE 3SU0A 1W12U 4R8TB 4TWYA 1SGIB 1XMNB 2ZGXH 3GOVB 1BRAA 4MPVA 4X6MA 2H2ZA 4ZMAH 5C20A 2VIWA 1K9OE 1DOJA 1NRSH 3SZNA 3V0XA 2AMPA 4AYYB 1TFXA 4D9QA 3MHWU 4TPYA 3RXOA 1MKWK 4ABEA 1P2QA 1P2KA 1C9PA 4WH8A 3E3TA 1GBEA 2CMYA 3TJVA 1H8IH 1T32A 1SFQB 2F83A 3K65B 1P05A 1TNIA 1PYTC 1UTPA 3EGKH 2C8XB 3VXFH 1O3BA 2F9UA 2A31A 4X1RU 3ZV8A 5H4IB 4MDSA 2QF3A 1BT7A 4O03A 1BRBE 1UHBA 2PKAB 2FWWA 2VWNA 1THPB 1MU8B 3SQEE 2NU0E 3VB7A 2OBQA 1FY1A 1K2I1 2JETB 1F92A 1ARCA 5HXFA 2H9EH 1Q2WA 2A45B 1ZZZA 1K1PA 5TCAA 1QB9A 3MO9A 1C2HA 1OX1A 3MOCA 3OX7U 1AZZA 1G3BA 1LVYA 1HFDA 4IN2A 3RU4E 1HAPH 1SLWB 4BOHA 1UJ1A 1ZPZA 3RXEA 2QN5T 1BMLA 2AGIX 4YLQH 2H5DA 3SU4A 4F49A 4CHAB 2VIOA 2A7JA 5A8ZA 2VH0A 2FXRA 1ZMJA 1O2TA 4NIYA 5B6OA 3IWMA 2J34A 1K1JA 5T6GA 3E91A 1KXDA 5LPRA 1RGQA 4KELA 3LPRA 1ZGVA 1W14U 2D2DA 2ZU5A 3GDUA 2OC8A 1GMHG 4DIIH 2ZU1A 5DP6A 2ZG0H 1ELAA 2JETC 3OYPA 3GY4A 1G3DA 3O8RA 5ESBA 2BY6X 4ZKSU 2FTMA 1VZQH 2W7UA 3OY5U 2OC1A 3ATLA 2BDBA 2V0BA 2WPHS 2BY9X 1AGJA 4NSYA 1B5GH 4ZROA 4GUXA 3LOXA 4AORA 3P92A 5FCKA 4U30A 1OWHA 4DVAU 1PPBH 1P06A 1L1NA 3T27A 3UNQA 1HXEH 4A7IB 3GCNA 4FUEA 4FU8A 1SGDE 3L6PA 2YNBA 3LC3A 4Q7XA 2O8UA 3TGKE 1A4WH 3BTWE 1J17T 1KYNA 1FDPA 2BZAA 2VIPA 1C5PA 2BVSH 1C1VH 1YF4A 1SLVB 2GCHF 3DHKH 1O2GH 4IN1A 2HPQH 1ZTJA 1AKSB 5ABWA 1W0ZU 3L3TA 2P3TB 4Y8YA 1WYKA 2D26C 3D65E 4CREA 1A2CH 1NU7B 3TGJE 2TIOA 4JYVH 1UTQA 4UFEH 4U32A 1YPLH 4WH6A 4BAHB 2BTCE 2G8TA 2R2WU 5LGOA 2H5CA 1L4ZA 1QB6A 4BANB 1T31A 1YCPK 1SVPA 1UTLM 4WMDA 5A8XA 1EAWA 5TCCA 2Z9JA 1PQAA 1ELTA 3MFJA 1D6RA 1V2RT 4SGBE 1MKXK 1TRNA 1ORFA 4NSVA 2ZHDA 3FP6E 1EZQA 5EXLA 2OUAA 3PO1C 3C27B 5CHAB 3VB3A 4X8UH 4GCHG 5CE1A 4IC6A 2UUJB 1S0RA 2QXJA 2ZHEH 3P6ZB 3Q3KA 4NA9H 3AAUA 4INLA 1WCZA 1BTUA 3BTHE 1Z71A 1EAIA 2BD8A 5TJXA 4HI3A 1YLDA 1XKAC 2GMTC 2R3YA 4WMFA 2EI8A 2JH6D 4X8SH 2BLOA 2ZPRA 1ANEA 2ZDMA 1A1RA 1H8DH 1BIOA 1HJ8A 2BHGA 2Y81A 4KTSA 1C4U2 1BJUA 4YOGA 4YT6H 1ELCA 4HTCH 2W7SA 5C1UA 2WPJS 3BIVH 3NCLA 3P17H 1GBHA 1JIRA 4ABHA 1N8OB 1FAXA 1SLUB 2OINA 1NROH 3LKWA 3TVJB 5GXPA 3HK3B 5DPAA 3SJKA 1CO7E 1SOTA 1QFKH 1GBFA 3A83A 3TJOA 3UOUA 1OSSA 1BA8B 1KSNA 2ZWLH 4AFUA 1ZHMA 1CQQA 2XNIA 3TK5A 2OC7A 1G3CA 1TNGA 2NU2E 1SFIA 2OTVA 5JB9S 1MAYA 3SV9A 3KEEA 2G81E 2PSXA 3M3SA 4X1NU 1O2WA 1DLEA 1FAKH 4JK5A 3R3GB 5DO4H 2GT8A 3SBKA 2F9PA 5AF9H 1VITH 2ASUB 5E0HA 1AZ8A 4NFEA 2ZFTA 1V2KT 2ODQA 2H6MA 4LOYH 1PQ5A 4OS5A 4O97A 2ZO3H 2BXTH 3NWUA 3RXJA 2FM2A 4TWWA 3GY7A 2FO9A 1MCTA 1HPGA 3DFJA 1WU1A 5A8YA 3U1IB 1EXFA 3TLOA 1DXPA 1EJMA 4K1EA 1OP0A 3MTYA 4IGDA 1O2SA 7GCHG 1C5TA 2HNTC 5GPIB 4TPIZ 4Y7AA 2IJOB 2P8OC 1V2LT 2A4QA 1QL7A 2J92A 5EODA 1H1BA 1XUIA 2BVXH 1F0RA 1E37B 2AH4X 1J8AA 1ELBA 2RCEA 1BTZA 1LQDB 4E7NA 2FYQA 2WINI 1ZRKA 1EP5A 3MNCA 2B7DH 1OS8A 1GHWH 3FP8E 1FY8E 1MKWH 2ZU4A 1BTYA 5J4QA 1YPHE 1CHOF 4ISIH 4H6TA 2AFQB 3GDVA 3GDSA 1WBGB 1DWDH 1M9UA 1OP2A 4BAOB 4K8YA 1HUTH 1IQHA 2BD5A 3P8GA 3OU0A 3A81A 1O3NA 2WPIS 2EC9H 5C1YA 1MTNB 1ZPBA 3SQHE 3UY9A 1TPSA 3AASA 1ELDE 1AKSA 2W26A 1SHYA 1O3AA 1TIOA 1C5WB 3OY6U 1GMCF 1RS0A 5GDSH 1BHXF 1C2MA 5F8ZA 1YC0A 2ALVA 1IQGA 5DP5A 1C4Y2 2WYJA 1SQTA 1XUHA 2BB4A 3NK8A 3KCGH 1KY9A 1FN6A 1V2WT 4OGXA 2G4TA 4DCDA 3RMMH 4AFQA 4E7RG 3MNSA 1HAGE 3SUDA 1O2YA
chains in the Genus database with same CATH superfamily
4ESTE 4Z1MD 4FUBA 1PPFE 1KDQA 2A4RA 1LPKB 2F43B 1QQUA 3OTJE 3T5FH 1C9TA 2PLXA 2Z9KA 3GY3A 1QL8A 4OS1A 2BD7A 1ANCA 4BAKB 1IQJA 3BG4B 2V7QD 1XXDA 1RRKA 1ELVA 1LKBA 1WQVH 2V3OH 1QRZA 4YLUA 5FPTA 1UCYH 3KHVA 4O3UA 2FDAA 3BG8A 3STIA 1PJPA 1WTHD 3EAJA 3QWCH 1AN1E 3LH3A 1N6XA 1RJXB 3BSQA 1S83A 2NWNA 1C2FA 3UIRA 4ABGA 4FUFA 2FZZA 1V3XA 3LC5A 3RXPA 1MQ5A 3SHCH 1AFQB 4YZUA 4PROA 1BMAA 3ZVEA 5JYIA 1FUJA 3B23B 1MTSA 3T2NA 2ZCLP 3PMJA 1O5EH 3V13A 1PFXC 1INCA 2TGDA 3TITA 4A1TA 1NPMA 4A92A 1HLTH 3A84A 1ESTA 3RC6A 1BRCE 2VIDA 2ZP0H 1EQ9A 5I46H 1DVAH 2Y6TA 3WWBA 1ZSLA 1P2JA 2AEIH 1QJ1B 1F7ZA 1NFYA 4M9FA 2BMGB 1O2UA 1C1PA 2ZFPH 3K9XB 1GJAB 4OGYA 4J2YB 1NZQH 1HV7A 1A0LA 2FYRA 2Y80A 2Q6GA 4ISNA 1KXEA 2BDAA 1V2VT 4BXSA 4X8VH 4AN7A 2VVCA 1GHAF 1TMTH 2H9TH 1BB0B 5EJ1A 2VVVA 3A86A 2TGPZ 4ZUHA 2C8WB 1QIXB 3BV9B 1O3JA 3D62A 4AZ2B 1NO9H 2KX4A 2W3KA 3A8DA 3LGUA 2GVFA 4CH8B 5C67A 1BBRK 1J15A 5DN6D 2BD4A 1YPHC 1SLXB 1XVMA 4LZ1H 3ZZDA 2UUYA 1GBTA 1E1QD 4YT7H 1THSH 1QQ4A 5A2MH 3LGYA 1FIZA 4E05H 1YPEH 2EY4C 2PP6A 2UWPA 1HXFH 3KYGA 3RLWH 3RXTA 1EPTB 1F2SE 3A7WA 3Q76A 5L30H 2ZU2A 1GJ8B 2SNWA 2XBYA 3N7EA 3UNRA 3O8BA 4JK6A 2KCOA 2Z9LA 1EZXC 4TY7A 3O8DA 4NZLA 2ZFRH 4X2WA 2ULLA 1N1LA 2F3CE 1ABJH 2HGTH 1V2MT 4HFPB 1FY3A 3P95A 1D3TB 1PPGE 1OYQA 4ZHMU 5LPEA 1E36B 2GZ7A 1ZJKA 1L2EA 4FUDA 2ZC9H 2AIPA 1W11U 1W0YH 1P02A 1GJDB 2A7CA 1C2KA 2ZKSA 1FIWA 2HNTF 3GISB 4FUHA 3LJOA 2IN2A 1BZXE 1YPGH 1NFUA 1P3EA 1Y59T 1BCUH 1Z8GA 3TJUA 1NFWA 4DT7B 2EI7A 2UWOA 2STBE 1GHXH 4Q80A 3RXGA 2F9VA 1SGRE 2FX4A 1CT4E 1N6YA 2A2XH 5L2YH 2ZQ1A 3SI3H 1NU9A 1SQOA 5FPSA 3GCTF 1UTMA 4K2YA 3RXMA 3GS9A 4B74A 2PUQH 1TAWA 4DW2U 1FV9A 2YNAA 2J4IA 2V3MA 1GI3A 1DWCH 2FI3E 1SOZA 1O3HA 1WSSH 1QNJA 1OWJA 2PFEA 2BQWB 3K6YA 4AX9H 3CNRA 1GG6C 5C5OA 4AOQA 3F0PA 3S7HB 3F68H 1IQNA 1TGNA 3UFAA 1CGJE 3HKJB 2B5TB 3FVFB 1L1GA 1CHGA 1MTVA 2ZCHP 1W3CA 3B8JA 4NIXA 4X2VA 2BD2A 3S69A 3V3MA 2NU3E 1ELFA 1BTHH 1SHHB 5JBCS 1A0HB 2ZDVH 1KDQB 1MBMA 5F03A 1Z1JA 2Q6DA 1SGFG 4WVPE 3EA7A 1V2QT 3RXIA 1O5BB 1GMDF 1SL3A 1XUGA 5LH8A 3ZZ5A 1DUAA 1AWFH 5E8EH 3SW2B 2Y82A 1SBWA 5AFYH 1SGQE 1EUFA 1J16A 1SR5C 1QA7A 1OYTH 2XBXA 1BMNH 1XXFA 3SO3A 4IMZA 1BITA 2J94A 2SGFE 2UWLA 4AGKA 1O2ZA 2A0QB 2RA0A 1S5SA 2BLQA 2SGAA 2ZDNA 2TGTA 1YP9A 2QE7D 1CGHA 4Q2KA 3DT0H 3KN2A 4DOQA 3SJ9A 2PHBA 5F8TA 2CF8H 1QR3E 2GDEH 5JPMH 1GDQA 2A5IA 1HB0B 1AHTH 3PMHB 3V7TA 2GJGA 1F0SA 3A87A 1SQAA 1TOMH 3VGCB 5CHBA 1F5LA 1YLCA 4Y7BA 1LO6A 1C1TA 1VGCB 4B71A 2LNCA 1E34B 1K1MA 3FZDA 4WF8A 1A5GH 1KIGH 4GHQA 5T6FA 4NWLA 3GY8A 3F1SB 2AGGX 3UOPA 1O31A 3DFLA 3RXSA 1VGCC 1Z7KA 4MNXA 2JJ1D 2ILNA 1YM0A 4JZEH 4FU9A 1OPHB 2ZTYA 1NBME 2UUKB 2HLCA 1DY8A 2QF5A 4F4OC 2FS9A 4HZHA 3RLYH 3DUXH 1P9SA 2BQ6B 1LVOA 3T26A 1BUIA 2BM2A 4ISOA 3KQ5A 1GBCA 2Y5HA 1UO6A 1C5MD 4XFQA 2J98A 1LHGH 3KQEA 2LP6A 3SU1A 1Y5AT 4ABAA 5J4SA 5DGJA 1UTOA 3SGBE 4NA8A 2ZHFH 2VIVA 2H1UA 1UVUH 3A7ZA 2GZ9A 4ZKNU 1HDTH 5C0TA 3TNTA 4M7GA 1LPZB 4WXVA 2PWXA 3M7QA 1P2MA 2VU8E 1HJ9A 5KGOA 4ISHH 1C1UH 2CHAB 2D1JA 3MWIU 1MTWA 5CHAC 1TRMA 5B6LA 1VJ9U 2ZDLA 3DA9B 2GP9B 2QV1A 2RDLA 3LGIA 3MNBA 5JDUB 1C5SA 1A61H 5GNDA 2BX3A 1AUJA 1BQYA 1KXFA 4I31A 2W6JD 5DP9A 1VJAU 5L6NH 2PGBB 2VGCC 1G36A 4X1QU 2BXUH 2L6OA 3M61U 4CR5A 3F2HA 1C1SA 2GZ8A 2O8TA 1A7SA 1FY4A 1EASA 1H9IE 1KXAA 1GBDA 3O8CA 1KTSB 1EX3A 1HAVA 5CDFE 4TT3D 2AS9A 4KP0A 1GMDG 4P00A 1QBOA 3M35A 3AK5A 1AO5A 2G51A 3RC4A 5ESTE 1HAZB 4X0WU 1AWHB 2VNTA 2NU1E 4KTCA 2ZDAH 2TRMA 3PV5A 3MH4A 4GVUA 2XXLA 1MH0A 3SNBA 5SGAE 3KNXA 1O2PA 2BYAX 3QLPH 3LDXH 1BOQA 7KMEH 5C17A 2BDIA 2Z6BD 1FI8A 1T8LA 1T8OA 5EOKA 1GBBA 2ZGCA 4IS5A 1EATA 2V6NA 4XBDA 3VGCC 4BNRA 3ITIA 2AGEX 1KLJH 1Z6JH 2WPMS 2BLWA 1O3PB 1ESAA 5IYTA 2BQ7B 1ZHRA 2WPLS 1NRNH 4JCNA 3ESTA 4I8KA 2K1QA 2GCTC 1TA6A 5EW1H 2ALPA 5LPFA 2HRVA 1O36A 1DS2E 3NPSA 1GL0E 1PPCE 4MTBA 2ZA5A 4ASHA 2FTLE 1P8VC 5EGMA 2XNDD 1RTKA 3KYFA 1H9LB 3SUGA 4D9RA 2ZZUH 1A0JA 1VR1H 2CXVA 1SGEE 1FLEE 4H42U 5FBEA 1AY6H 1K28D 4I8JA 1IOEA 2A5KA 2GV6A 1S6FA 3OAAD 4ZKOU 3RXCA 3DD2H 2VWLA 3PLKA 1K1LA 2RG3A 2OXSA 4FVBA 3SNCA 1SPJA 1ZOMA 1O33A 3LU9B 3QZQA 2ZFFH 5GCHG 1GMCG 3UTUH 4UEHH 3QUMP 4TY6A 1NBMD 1Z1IA 1TB6H 4NGAH 3PTBA 4WXIA 1GHZA 3ZZ3A 3SJOA 3LGVA 3TPIZ 1O2HA 2P3FH 3AAVA 2EI6A 2M2AA 2XRCA 3S0NA 1BRUP 1GHAG 2F91A 1S6LA 3NRLA 4Y76A 2G4UA 1O3KA 4KGAA 4Q4LA 5C3NA 1JXPA 1DSUA 3HGNA 1J14A 2V3HH 2DE8A 4FUGA 1FMGA 3TH3H 1UK2A 5DK1A 1O2OA 4UFFH 4Y8ZA 3GICB 4B2BA 1DITH 4B76A 3SN8A 2BY7X 1DE7H 5C94A 2C90B 2FEQH 3RXAA 1AD8H 3RXVA 3T28A 4Z6AH 2FOCA 1AFEH 1O30A 3HKIB 1A3EH 5EQQA 1H4WA 5IDKA 1P10A 3HPTB 3QGNB 3RXLA 2ZIQH 3HK6B 2FI5E 3URCA 1XUJA 2J98B 1IHTH 3LJJA 1MU6B 4NIVA 2KCPA 3PB1E 1NRPH 1COWD 2ZFSA 1UVSH 3MYWA 2FIRH 2OQ5A 1C5UA 3Q00A 3RDZA 1YPJH 4HGCA 1OOKB 3TIUA 5PTPA 1LDTT 1YKTA 2DUCA 2ZGBH 4ZKRU 3ZZ8A 2Z3DA 3GY2A 2AIQA 2QF0A 4Y0ZE 1ZTKA 1CSOE 4K8BA 1MZAA 1RTFB 4MPWA 5BRRE 3NUMA 3PO1B 1QRXA 1TE0A 3GCHB 1V2TT 1O3FA 1UK3A 1C1OA 3CS0A 2WPDD 3RMNH 1QJ6B 3WW7A 3MH5A 3MI4A 2R2MB 2GMTB 1GVLA 1G9IE 4NFFA 1GBAA 1GCTC 1P3CA 3QTOH 5HYOA 4UONA 5FHTA 1W7XH 2Y7XA 2SGQE 4H6SB 1O2JA 3ATIA 1MTUA 1N8OC 3A8BA 4B2AA 4F55A 1GI6A 5FPYA 1V2NT 2Y5GA 3F9GA 2OC0A 2F9NA 1EB2A 1C5LH 1LVMA 2VIQA 2ZCKP 2PTNA 1GCTB 2ZEBA 2ZHWH 3BTGE 3U28C 3OTPA 2HVXA 4FUCA 1KTTB 1EJAA 2KR7A 1TPAE 3JZ1B 3FKSD 3F6UH 2PKSC 3P8NA 2ZECA 4X6PA 3SNDA 1P9UA 3I77A 2XCFA 4I32A 1CBWB 4FU7A 1TGSZ 1C4V2 3SUFA 1RIWC 2BDCA 2XBVA 4YOIA 5AFZH 1NRRH 1C1NA 1FONA 3E8LA 1C5ZB 4JYTA 3ATKA 5F8XA 3PLPA 2DE9A 4UE7H 4JZFH 4K60A 1O32A 2AHME 1NTPA 5EG4A 1HBTH 4R0IA 3TH4H 1EPTA 2IPHA 1TNJA 2FOAA 1O5CB 2CF9H 3W95A 2V35A 1F5RA 3M5LA 3UUZA 4B1TA 1LPGB 5DKMA 1DICA 1V2OT 3GY5A 1SGYE 1J9CH 1GI0A 1NT1A 3SUEA 1EJNA 1ZLRA 5DP4A 4DT4A 1SGNE 3F9EA 1Z6EA 1MMJN 6GCHF 3LH1A 3ENSB 1K1OA 2GCHG 1GBIA 1S0QA 3M5OA 2GD4B 1AVWA 1G2LA 4OS2A 2HNTE 3QGJA 2RA3A 2G55A 5FBIA 3PLBA 1GVKB 2QXGA 4ACAA 2W5EA 3I78A 3SU2A 1G2MA 2BD9A 3T29A 4X6NA 2FI4E 4K1SA 1W7GH 2A4OA 4FUJA 2BVRH 4I8HA 1K1NA 1O3DA 3N7DA 4NG9H 2BDGA 1GI1A 1JBUH 2JIZD 2OLGA 3BIUH 2Z3CA 4X8TH 1YBWA 2P3UB 4KTUA 1O2MA 1WOFA 1BMMH 1E0FD 1V6DA 2XW9A 3V12A 3F2GA 1EKBB 5GIBA 1FJSA 1AQ7A 3RP2A 1VITG 1GCDA 2JKHA 4A1VA 1KLTA 2G00A 1O5GH 2ZTXA 3OEED 3QZRA 1SGFA 1HIAB 2QXIA 2BOHB 4XBCA 1ETTH 1W2KH 1GJ6A 1EAUA 4MLFB 1DDJA 1QGFA 5GCHF 1YY3A 4K5ZA 3AW0A 2QCYA 4U2WA 5E2PA 1DSTA 4ZXXH 1E38B 1FX0B 1SGPE 1PPHE 1P57B 2J95A 3M36A 4QT8C 1JIMA 4XRNA 7GCHF 1C5OH 1K0HA 4JZDH 1MCVA 5EXMA 4E06H 3H7TA 4H4FA 2B9LA 3BTME 1P2NA 1RIWB 1B0FA 1VCWA 3WY8A 4YM9A 1GHBF 2C4FH 4AB8A 2IOTA 3G01A 1GGDB 1D3QB 1FNIA 1MKXH 1TGTA 2FOEA 1GI8B 1SMFE 1EOLA 3BTEE 5G4BA 3SYJA 2L74A 3FOAA 2M5TA 4UFGH 3TK9A 3A7YA 4B75A 3UR6A 1GI2A 5E0JA 1G30B 4CRDA 5C1XA 5EW2H 3K6ZA 2P59A 3W94A 2CGAA 1GPZA 2BX4A 3SHAH 3S9AA 4YTAA 5HKKD 4MNWA 1C2GA 1BTWA 2BY5X 4IMQA 2G52A 3UB0A 1JRTA 1PQ8A 1HGTH 3ODDA 2OQUA 4GPGA 3SNAA 5E2OA 4D76A 1EAXA 3TK6A 1ANBA 3P8OA 3RMOH 1VCPA 1QZ8A 2F4LA 2QF4A 3E0PB 1W8BH 3U69H 3P8FA 1PPEE 1TGBA 4XSKU 3PRBA 4I7YH 5F53A 3M5NA 3ZZ6A 8KME2 1P09A 3H5CB 1AB9B 2VGCB 1BDAA 1AFQC 2BZ6H 3BTFE 1TOCB 1IQLA 3IG6B 1YPKH 4AG1A 5BPEA 1GBKA 2FPZA 2R9PA 3MO6A 4CRAA 1HCGA 4I8LA 1HAYB 2Q6FA 2P8OB 7LPRA 3PV4A 3KQDA 1IHSH 2J38A 1FPHH 5ETXA 2FOGA 3ZZCA 1CVWH 1PQ7A 2AMQA 8GCHG 1O3MA 1WV7H 4XDEA 4ZXYH 3SORA 3BG4C 1L4DA 1RD3B 3D49H 4ZHLU 1IAUA 1P2OA 3ZIAD 3E0NB 2VWOA 1L0ZA 4CHAC 4CH2B 4A1XA 4ZHAA 1Q31A 2VBCA 2OP9A 3MNXA 2J5UA 3PMAB 1O35A 3Q3XA 1S81A 2J9NA 2JJ2D 3LT3A 3SJIA 1C5YB 1NS3A 4NCYA 4VGCC 3WWFA 1DUEA 1QBVH 1DFPA 3B9FH 1DX5M 1YGCH 1YYY1 5T6DA 2ZPQA 3U8OH 2STAE 1Y5UT 1V2UT 3M5MA 3EQ0H 4THNH 3GYLB 3RUOA 5A0CA 1HAXB 1T4UH 1BJVA 3Q77A 1O2LA 1H8HD 5KECA 1ANDA 3SV6A 4O9VA 1YCPM 4NWKA 5EXNA 4INHA 2CN0H 4BAMB 2YOLA 2BOKA 1ZMLA 2AYWA 3KL6A 4OS6A 4MPUA 1TALA 1GHBG 2LPRA 4VGCB 1AE5A 1OWIA 3U8TH 3DSOA 1L1JA 2KCYA 5A0AE 2Y5FA 1O3LA 1B7XB 3ZZAA 3SGAE 2WV9A 1SSXA 1ESBA 1LHDH 2QXHA 2ZGHA 3BEIB 4I86A 4INKA 1OWKA 1TABE 1O34A 2FLRH 1GI7B 2ESTE 3BTDE 4FOUC 5I25A 1ZHPA 2AERH 2FLBH 4NA7A 1HRTH 3RM0H 1ELGA 1AU8A 2A7HA 3A85A 3FZZA 1TBRH 4Y11E 3ZVCA 1GHVH 3VPKA 4Y6DA 1QURH 1TBQH 1HYLA 5EJZA 1FY5A 3M7UA 2A5AA 2P94A 1LVBA 1TBZH 1C5NH 1AE8H 1ZRBA 2LELA 1GL1A 3PV2A 1D3DB 3QO6A 4YO9A 1E35B 4MG3A 3MMGA 1SI5H 1GG6B 3A8AA 2THFB 3EE0B 3UQVA 5EQSA 2VWMA 2ZTZA 5HIYA 2P16A 3A7TA 4B6EA 2Q1JA 3T62A 3ZYDA 1W13U 3M7TA 3PM3A 2ANMH 9LPRA 2VH6A 2O8MA 5DP7A 4ZH8A 5DJ7A 4HG6A 1BBRE 1YPMH 2TBSA 1Y3XA 2NU4E 3K2UA 4ABJA 1O2IA 1C2DA 2R0KA 3MU0A 4J1YA 4YESB 4AFSA 1DANH 3RU4D 1IQKA 2XCNA 4RN6A 1DT2A 3LONA 3SNEA 4WJG2 2Z9IA 1TA2A 1DPOA 8ESTE 3FANA 1DLKB 2P93A 1P03A 1UCYE 2JH0D 4MPXA 2G5NA 2ANKH 3RXBA 3EYDA 1GJ5H 3IITA 3BTQE 1CT2E 4ACBA 5HGGA 1HAOH 4X1PU 1JRSA 3BN9A 3A82A 3ZZ9A 3VG8A 3VEQB 1KXCA 2R3UA 1Y3WA 1O5FH 4SGAE 1TQ7B 1T8NA 1X7AC 1ACBE 3CP7A 3M3TA 4MNVA 4Y10E 5GWZA 1BBRH 3A7VA 1KLIH 1FZZA 1ARBA 1D9IA 1WTGH 2YMSC 3UWIA 4LXBH 2ZQ2A 3UPEA 3DCLA 1AIXH 1UCYK 4AGJA 4AB9A 1ZJDA 3ZYEA 3SGQE 3F0OA 1FQ3A 4D7GA 3RXRA 3ATMA 3TU7H 1QY6A 1GI9B 5L2ZH 2Z9GA 2SGDE 3QTVH 3RM2H 5CMXH 2A2QH 3U1JB 1LKAA 2QGRA 2BLVA 1WXRA 1OKXA 4X2YA 1SB1H 4O3TA 4RKOB 4JZ1A 1RXPA 1BMFD 1EZUC 1O3GA 5EQRA 4CBOA 1LQEA 4BTUB 3PRDA 1OXGA 1P2IA 3SU6A 1ELEE 1Z8JB 4XE4A 1CHOG 3L33A 3MU4A 1EOJA 5C0UA 1IQFA 1G32B 1ZR0A 2PV9B 3HGPA 1IQMA 1TPPA 1PPZA 1UMAH 1Q3XA 5FX6A 4CRGA 4CRBA 1LHEH 2BY8X 4TYDA 4GHTA 1QRWA 3PROA 5DG6A 3SU5A 1UTJA 9ESTA 1W0KD 1A5HA 1EP6A 1GI4A 2CHAC 1C5RA 3RXUA 1UTNA 1HAHH 3E6PH 1DWBH 2GT7A 2EQNA 3QK1A 2HALA 1ZTLA 2KFWA 5EU8A 1MD8A 4ABDA 1GBLA 3TNSA 4MVNA 5JB8S 1QHRB 3MU1A 4BTTB 4CR9A 1JOUB 2WV5A 4DJZB 3U8RH 3QDZB 3ZVDA 3MH7A 4ISLA 5JBBS 2OK5A 2PR3A 3NKKA 4AYVB 4KKDA 4Y8XA 1ABIH 2VB0A 1VKYA 2GGVB 1C1MA 1RTLA 1SQRA 3T25A 1C5XB 5K7RA 2ODYB 5C5NA 2KAIA 3S7KB 6ESTA 2O8LA 5FX5A 1MUEB 5EIYA 1E79D 2ZFQH 1D3PB 2TGAA 1TQ0B 2KCAA 2SGPE 5HM9A 5AVDA 1AUTC 2WYGA 4Q63A 3EDXB 4B73A 3EE7A 3SI4H 2AMDA 2FOFA 3MO3A 4B2CA 4UDWH 2XOKD 1CA0B 3LGWA 1MZDA 3DSGA 1TGCA 2XYAA 3QN7A 1FPCH 1MQ6A 1C1RA 1TMUH 3JZ2B 4IBLH 1HNEE 1HJAB 2WUBA 1O2XA 2HWLB 2XBWA 4OS4A 3ZZ7A 2FMJA 8GCHF 4Y79A 1ZSKA 4DG4A 1QL9A 1GJBB 5GJ4B 2F9BH 4DURA 2QIQA 1S82A 4UD9H 5FL7D 1ZYOA 1CBWC 1YCPH 2JH5D 1T8MA 3SV8A 1KXBA 3RMLH 2ZGJA 1CU1A 2HOBA 2ANYA 1WUNH 3NZIA 3ZVBA 4DY7B 5F6MA 2XC4A 1GI5A 1NY22 3VB4A 1JMOH 4U01A 3H7OA 3A7XA 3C1KA 4ABFA 4XBBA 2PSYA 2R0LA 1GVZA 1LHCH 1TX7A 2TPIZ 3F9FA 1BHXB 1O2KA 4NIWA 3N99A 1P11E 4X6OA 1BTPA 4CBNA 4OS7A 1B0EA 2ZU3A 1H8ED 1EZSC 3SV7A 1C1QA 2Y7ZA 3ZVFA 1U6QA 1Y5BT 5EJLA 1GWAA 1O5DH 1GDUA 1OHHD 4MQAA 4RI0A 2XWBI 1FN8A 1YLNA 1WQSA 4CRFA 3KQCA 1AVGH 1FXYA 3UWJH 1O3CA 4WMEA 2G5VA 3PWBA 1TYNA 4AFZA 3GY6A 2ZDKA 4JZIA 2C93B 2I6SA 4X1SU 1S84A 1XKBC 2Z3EA 2GTBA 3BEFB 1AB9C 1NRQH 3KQBA 3RXDA 4JYUH 3MU5A 1BTXA 1LMWB 3VFEA 4FVDA 5C2ZA 1CE5A 1MAXA 1TX8A 2W3IA 3AW1A 1HAIH 1G37A 1Y3VA 4Q7ZA 2OCVB 2GDDA 4ABBA 1O38A 1ZMNA 2EA3A 1AMHA 3ZV9A 1GDNA 3SJ8A 1TRYA 1MD7A 2GV7A 1UVOA 1S6HA 1NESE 1T4VH 3PTNA 1F5KU 2XWAA 5E0GA 3AVZA 4AG2A 1TWXB 1DXWA 3SOSA 2FESH 1SGCA 3VB5A 2J2UA 1SGTA 1D6WA 2A1DB 2SNVA 5JBAS 4WY3A 3ODFA 1P0SH 1CA0C 1IQIA 2WUCA 1GHYH 3F3BA 1AVXA 3HATH 3RXFA 4LK4A 5T3HA 1ZGIA 1QA0A 3MQKC 1Z8IB 3OSYA 4BAQB 5HIZA 4IW4E 1HJAC 2WHXA 4Y0YE 5FCRA 1SKYE 3ELAH 2F9OA 1TPOA 2ZNKH 3E1XB 4DIHH 3VB6A 2XC5A 3BTKE 1K1IA 2ODPA 1DY9A 3TJNA 1ETRH 1GMHF 2ZI2H 1QTFA 2WV4A 4K69A 3D23A 2K0QA 3BTTE 1C5QA 1H9HE 1O39A 1SG8B 3E16B 4Q7YA 3UR9A 3SV2H 4D7FA 6CHAB 3A88A 5A09A 1C1WH 1XVOA 2QA9E 3GCOA 1VCQA 2QY0B 1QBNA 1TNKA 2C8YB 1XM1A 1XUKA 1JWTA 1GJ9B 4A6LA 1TX6A 2H9HA 2VJ1A 6GCHG 4I33A 5AHGH 2VINA 1GGDC 4YOJA 3MH6A 1LCYA 1GBMA 1LTOA 2PTCE 3GYMA 5A0BA 2D8WA 5EPYA 4K1TA 2PKSB 6LPRA 1P01A 3TGIE 2CV3A 2GCTB 4BXWA 1MTNC 1UVPA 2ZF0H 1EB1H 2BDHA 2FX6A 1TLDA 2ANWA 1O2QA 3S9BA 2FP7B 3BF6H 1QJ7B 3M3VA 4I8GA 3ZVAA 4BTIB 3NXPA 1HAVB 3EA9A 3LGTA 1XUFA 1TNLA 3LIWA 1W0JD 4FXGH 4GAWA 1DM4B 3QX5H 3M37A 4GSOA 1CA8B 3S9CA 3SU3A 3MU8A 2HVYB 4Z0KA 1NN6A 3KF2A 2OBOA 2P95A 3RXKA 3ZVGA 2J97A 1UTKA 1C2EA 1O0DH 3F9HA 4CRCA 2FOBA 2YMSD 1XX9A 4ZAEA 1K22H 1PYTD 2K8IA 1OWDA 4NZQA 1Y3YA 3UAIC 2CJIA 1D4PB 7ESTE 1TONA 1P12E 1HIAA 3A80A 1OWEA 2BDYA 3KIDU 3A89A 5HM2A 4GCHF 1K21H 1O3EA 1C2IA 2Z94A 3UQOA 1O3OA 3FP7E 3PYHA 2OD3B 1O37A 4F48B 2FODA 5JBTA 3Q3YA 3UNSA 5DP8A 1GJ4H 1F0UA 2QC2A 1G3EA 2C3SA 3I29A 3P70B 3RXHA 1ID5H 3R0FA 1P04A 5DSFA 3RU4T 8LPRA 1A5IA 2A32A 1O2RA 5FXLA 1GJ7B 3GCHC 2QYIA 1IQEA 1TMBH 2FOHA 2B0FA 1MBQA 1EPTC 4RT0A 2PW8H 3FFGA 4D8NA 2PUXB 2Z7FE 3E90B 1DWEH 4MNYA 2XC0A 1Y8TA 5KEDA 1KMHB 1UK4A 4RKJB 3ATWA 4IC5A 1NM6A 4JMYA 1A46H 4UFDH 3VXEH 1O3IA 2GKVE 1LHFH 2ZPSA 5EPNA 5DP3A 1T7CA 3OEHD 4XOJA 1C2JA 2ZHQH 1CGIE 1OP8A 5FAHA 3GCTG 4Y71A 1SC8U 1V2JT 5IK2D 6CHAC 2PKAA 3CENA 3EA8A 2BD3A 1V2ST 1O2VA 2EEKA 2KM0A 1S85A 3FAOA 2O9QA 4A5TS 1O5AB 2C8ZB 1AI8H 3URDA 3RC5A 1ZSJA 2FS8A 1NC6A 4DGJA 1Z8RA 3U9AH 2KAIB 4K3JA 2PGQB 1TNHA 2GX4A 4LZ4B 2B8OH 4OM9A 2CK3D 3N7OA 3A8CA 2SFAA 3F2FA 2FOMB 3STJA 3TH2H 4ABIA 2O8WA 2WPKS 1ETSH 2XTTB 1F0TA 5HMAA 1GBJA 2I6QA 1NFXA 1A3BH 3U98H 1C5VA 4FUIA 1W10U 5K0HA 1CT0E 1UHBB 2A4GA 2HPPH 1V2PT 1O2NA 4RSPA 3PWCA 1THRH 2UUFB 2VVUA 3RXQA 3UREA 1RFNA 1VITF 3CS7A 3BEUA 1QCPA 2QAAA 4X2XA 1ZPCA 3PMBB 1GJCB 4WWYA 3ZZ4A 1UVTH 4GLYA 1MABB 1WAYB 5T1VA 3KGPA 3ZZBA 1Y3UA 1C2LA 1QB1A 2SGEE 3SU0A 1W12U 4R8TB 4TWYA 1SGIB 1XMNB 2ZGXH 3GOVB 1BRAA 4MPVA 4X6MA 2H2ZA 4ZMAH 5C20A 2VIWA 1K9OE 1DOJA 1NRSH 3SZNA 3V0XA 2AMPA 4AYYB 1TFXA 4D9QA 3MHWU 3FO8D 4TPYA 3RXOA 1MKWK 4ABEA 1P2QA 1P2KA 1C9PA 4WH8A 3E3TA 1GBEA 2CMYA 3TJVA 1H8IH 1T32A 1SFQB 2F83A 3K65B 1P05A 1TNIA 1PYTC 1UTPA 3EGKH 2C8XB 4P02A 3VXFH 1O3BA 2F9UA 2A31A 2WSSD 4RT1A 4X1RU 3ZV8A 5H4IB 4MDSA 2QF3A 1BT7A 4O03A 1BRBE 1UHBA 2PKAB 2FWWA 2RDEA 2VWNA 1THPB 1MU8B 3SQEE 2NU0E 3VB7A 2OBQA 1FY1A 1K2I1 2JETB 1F92A 1ARCA 5HXFA 2H9EH 1Q2WA 2A45B 1ZZZA 1K1PA 5TCAA 1QB9A 3MO9A 1C2HA 1OX1A 3MOCA 3OX7U 1AZZA 1G3BA 1LVYA 1HFDA 4IN2A 3RU4E 1HAPH 1SLWB 4BOHA 1UJ1A 1ZPZA 3RXEA 2QN5T 1BMLA 2AGIX 2IPQX 4YLQH 2H5DA 3SU4A 4F49A 4CHAB 2VIOA 2A7JA 5A8ZA 4XD7D 2VH0A 2FXRA 1ZMJA 1O2TA 4NIYA 5B6OA 3IWMA 2J34A 1K1JA 5T6GA 3E91A 1KXDA 5LPRA 1RGQA 4KELA 3LPRA 1ZGVA 1W14U 2D2DA 2ZU5A 3GDUA 2OC8A 1GMHG 4DIIH 2ZU1A 5DP6A 2ZG0H 1ELAA 2JETC 3OYPA 3GY4A 1G3DA 3O8RA 5ESBA 2BY6X 4ZKSU 2FTMA 1VZQH 2W7UA 3OY5U 2OC1A 3ATLA 2BDBA 2V0BA 3W1EA 2WPHS 2BY9X 1YWUA 1AGJA 4NSYA 1B5GH 4ZROA 4GUXA 3LOXA 4AORA 3P92A 5FCKA 4U30A 1OWHA 4DVAU 1PPBH 1P06A 1L1NA 1UW7A 3T27A 3UNQA 1HXEH 4AC9A 4A7IB 3GCNA 4FUEA 4FU8A 1SGDE 3L6PA 2YNBA 3LC3A 4Q7XA 2O8UA 2HLDD 3TGKE 1A4WH 3BTWE 1J17T 1KYNA 1FDPA 2BZAA 2VIPA 1C5PA 2BVSH 1C1VH 1YF4A 1SLVB 2GCHF 2IJD1 3DHKH 1O2GH 4IN1A 2HPQH 1ZTJA 1AKSB 5ABWA 1W0ZU 3L3TA 2P3TB 4Y8YA 1WYKA 2D26C 3D65E 4CREA 1A2CH 1NU7B 3TGJE 2TIOA 4JYVH 1UTQA 4UFEH 4U32A 1YPLH 4WH6A 4BAHB 2BTCE 2G8TA 2R2WU 5LGOA 1E1RD 2H5CA 1L4ZA 1QB6A 4ASUD 4BANB 1T31A 1YCPK 1SVPA 1UTLM 4WMDA 5A8XA 1EAWA 5TCCA 2Z9JA 1PQAA 1ELTA 3MFJA 1D6RA 1V2RT 4SGBE 1MKXK 1TRNA 1ORFA 4NSVA 2ZHDA 3FP6E 1EZQA 5EXLA 2OUAA 3PO1C 3C27B 5CHAB 3VB3A 4X8UH 4GCHG 5CE1A 4IC6A 2UUJB 1S0RA 2QXJA 2ZHEH 3P6ZB 3Q3KA 4NA9H 3AAUA 4INLA 1WCZA 1BTUA 3BTHE 1Z71A 1EAIA 2BD8A 5TJXA 4HI3A 1YLDA 1XKAC 2GMTC 2R3YA 4WMFA 2EI8A 2JH6D 4X8SH 2BLOA 2ZPRA 1ANEA 2ZDMA 1A1RA 2W6ID 1H8DH 1BIOA 1HJ8A 2BHGA 2Y81A 4KTSA 1C4U2 1BJUA 4YOGA 4B6FA 4YT6H 1ELCA 4HTCH 2W7SA 5C1UA 2WPJS 3BIVH 3NCLA 3P17H 1GBHA 2YMSB 1JIRA 4ABHA 1N8OB 1FAXA 1SLUB 2OINA 3OE7D 1NROH 3LKWA 3TVJB 5GXPA 3HK3B 5DPAA 3SJKA 1CO7E 1SOTA 1QFKH 1GBFA 3A83A 3TJOA 3UOUA 1OSSA 1BA8B 1KSNA 2ZWLH 4AFUA 1ZHMA 1CQQA 2XNIA 3TK5A 2OC7A 1G3CA 1TNGA 2NU2E 1SFIA 2OTVA 5JB9S 1MAYA 3SV9A 3KEEA 2G81E 2PSXA 3M3SA 1WDIA 4X1NU 1O2WA 1DLEA 1FAKH 4JK5A 3R3GB 5DO4H 2GT8A 3SBKA 2F9PA 5AF9H 1VITH 2ASUB 5E0HA 1AZ8A 4NFEA 2ZFTA 1V2KT 2ODQA 2H6MA 4LOYH 1PQ5A 4OS5A 4O97A 2ZO3H 2BXTH 3NWUA 3RXJA 2FM2A 4TWWA 3GY7A 4FETA 2FO9A 1MCTA 1HPGA 2JDID 1WU1A 3DFJA 5A8YA 3U1IB 1EXFA 3TLOA 1DXPA 1EJMA 4K1EA 1OP0A 3MTYA 4IGDA 1O2SA 7GCHG 1C5TA 2HNTC 5GPIB 4TPIZ 4Y7AA 3SZEA 2IJOB 2P8OC 1V2LT 2A4QA 1QL7A 2J92A 5EODA 1H1BA 1XUIA 2BVXH 1F0RA 1E37B 3H09A 2AH4X 3DSPA 1J8AA 1ELBA 2RCEA 1BTZA 1LQDB 4E7NA 2FYQA 2WINI 1ZRKA 1EP5A 3MNCA 2B7DH 1OS8A 2WZQA 1GHWH 3FP8E 1FY8E 1MKWH 2ZU4A 1BTYA 5J4QA 1YPHE 1CHOF 4ISIH 1EFRD 4H6TA 2AFQB 2KZ4A 3GDVA 3GDSA 1WBGB 1DWDH 1M9UA 1OP2A 4BAOB 4K8YA 1HUTH 1IQHA 2BD5A 3P8GA 3OFND 3OU0A 3A81A 1O3NA 2WPIS 2EC9H 5C1YA 2RFKC 1MTNB 1ZPBA 3SQHE 3UY9A 1TPSA 3AASA 1ELDE 1AKSA 2W26A 4YXWD 1SHYA 1O3AA 1TIOA 4TSFD 1C5WB 3OY6U 1GMCF 1RS0A 5GDSH 1BHXF 1C2MA 4ZCNA 5F8ZA 1YC0A 2ALVA 1IQGA 5DP5A 1C4Y2 2WYJA 1SQTA 1XUHA 2BB4A 3NK8A 3KCGH 1KY9A 1FN6A 1V2WT 4OGXA 2G4TA 4DCDA 3RMMH 4AFQA 4E7RG 3FN8A 3MNSA 1HAGE 3SUDA 1O2YA
chains in the Genus database with same CATH topology
4ESTE 4FUBA 1PPFE 1KDQA 2A4RA 1LPKB 3OTJE 1QQUA 3T5FH 1C9TA 2PLXA 2Z9KA 3GY3A 1QL8A 4OS1A 2BD7A 1ANCA 4BAKB 1IQJA 3BG4B 1XXDA 1RRKA 1ELVA 1LKBA 1WQVH 2V3OH 1QRZA 4YLUA 5FPTA 1UCYH 3KHVA 4O3UA 2FDAA 3BG8A 3STIA 1PJPA 1WTHD 3EAJA 3QWCH 1AN1E 3LH3A 1N6XA 1RJXB 3BSQA 1S83A 2NWNA 1C2FA 3UIRA 4ABGA 4FUFA 2FZZA 1V3XA 3LC5A 3RXPA 1MQ5A 3SHCH 1AFQB 4YZUA 4PROA 1BMAA 3ZVEA 5JYIA 1FUJA 3B23B 1MTSA 3T2NA 2ZCLP 3PMJA 1O5EH 3V13A 1PFXC 1INCA 2TGDA 3TITA 4A1TA 1NPMA 4A92A 1HLTH 3A84A 1ESTA 3RC6A 1BRCE 2VIDA 2ZP0H 1EQ9A 5I46H 1DVAH 2Y6TA 1ZSLA 1P2JA 2AEIH 1QJ1B 1F7ZA 1NFYA 2BMGB 1O2UA 1C1PA 2ZFPH 3K9XB 1GJAB 4OGYA 4J2YB 1NZQH 1HV7A 1A0LA 2FYRA 2Y80A 2Q6GA 4ISNA 1KXEA 2BDAA 1V2VT 4BXSA 4X8VH 4AN7A 2VVCA 1GHAF 1TMTH 2H9TH 1BB0B 2VVVA 3A86A 2TGPZ 4ZUHA 2C8WB 1QIXB 3BV9B 1O3JA 3D62A 4AZ2B 1NO9H 2W3KA 3A8DA 3LGUA 2GVFA 4CH8B 5C67A 1BBRK 1J15A 2BD4A 1YPHC 1SLXB 1XVMA 4LZ1H 3ZZDA 2UUYA 1GBTA 4YT7H 1THSH 1QQ4A 5A2MH 3LGYA 1FIZA 4E05H 1YPEH 2UWPA 1HXFH 3RLWH 3RXTA 1EPTB 1F2SE 3A7WA 3Q76A 5L30H 2ZU2A 1GJ8B 2SNWA 2XBYA 3UNRA 3O8BA 4JK6A 2Z9LA 1EZXC 4TY7A 3O8DA 4NZLA 2ZFRH 4X2WA 2ULLA 1N1LA 2F3CE 1ABJH 2HGTH 1V2MT 4HFPB 1FY3A 3P95A 1D3TB 1PPGE 1OYQA 4ZHMU 5LPEA 1E36B 2GZ7A 1ZJKA 1L2EA 4FUDA 2ZC9H 2AIPA 1W11U 1W0YH 1P02A 1GJDB 2A7CA 1C2KA 2ZKSA 1FIWA 2HNTF 3GISB 4FUHA 3LJOA 2IN2A 1BZXE 1YPGH 1NFUA 1P3EA 1Y59T 1BCUH 1Z8GA 3TJUA 1NFWA 4DT7B 2EI7A 2UWOA 2STBE 1GHXH 4Q80A 3RXGA 2F9VA 1SGRE 2FX4A 1CT4E 1N6YA 2A2XH 5L2YH 2ZQ1A 3SI3H 1NU9A 1SQOA 5FPSA 3GCTF 1UTMA 4K2YA 3RXMA 4B74A 2PUQH 1TAWA 4DW2U 1FV9A 2YNAA 2J4IA 1GI3A 1DWCH 2FI3E 1SOZA 1O3HA 1WSSH 1QNJA 1OWJA 2PFEA 2BQWB 3K6YA 4AX9H 1GG6C 5C5OA 4AOQA 3S7HB 3F68H 1IQNA 1TGNA 3UFAA 1CGJE 3HKJB 2B5TB 3FVFB 1L1GA 1CHGA 1MTVA 2ZCHP 1W3CA 3B8JA 4NIXA 4X2VA 2BD2A 3S69A 3V3MA 2NU3E 1ELFA 1BTHH 1SHHB 5JBCS 1A0HB 2ZDVH 1KDQB 1MBMA 5F03A 1Z1JA 2Q6DA 1SGFG 4WVPE 3EA7A 1V2QT 3RXIA 1O5BB 1GMDF 1SL3A 1XUGA 5LH8A 3ZZ5A 1DUAA 1AWFH 5E8EH 3SW2B 2Y82A 1SBWA 5AFYH 1SGQE 1EUFA 1J16A 1SR5C 1QA7A 1OYTH 2XBXA 1BMNH 1XXFA 3SO3A 4IMZA 1BITA 2J94A 2SGFE 2UWLA 4AGKA 1O2ZA 2A0QB 2RA0A 1S5SA 2BLQA 2SGAA 2ZDNA 2TGTA 1YP9A 1CGHA 4Q2KA 3DT0H 3KN2A 4DOQA 3SJ9A 2PHBA 5F8TA 2CF8H 1QR3E 2GDEH 5JPMH 1GDQA 2A5IA 1HB0B 1AHTH 3PMHB 3V7TA 3A87A 1F0SA 3VGCB 1SQAA 1TOMH 1F5LA 1YLCA 4Y7BA 1LO6A 1C1TA 1VGCB 4B71A 2LNCA 1E34B 1K1MA 3FZDA 4WF8A 1A5GH 1KIGH 4GHQA 5T6FA 4NWLA 3GY8A 3F1SB 2AGGX 3UOPA 1O31A 3DFLA 3RXSA 1VGCC 1Z7KA 4MNXA 2ILNA 1YM0A 4JZEH 4FU9A 1OPHB 2ZTYA 2UUKB 2HLCA 1DY8A 4F4OC 2FS9A 4HZHA 3RLYH 3DUXH 1P9SA 2BQ6B 1LVOA 3T26A 1BUIA 2BM2A 4ISOA 1GBCA 2Y5HA 1UO6A 1C5MD 4XFQA 1LHGH 3KQEA 3SU1A 1Y5AT 4ABAA 5J4SA 5DGJA 1UTOA 3SGBE 4NA8A 2ZHFH 2VIVA 2H1UA 1UVUH 3A7ZA 2GZ9A 4ZKNU 1HDTH 3TNTA 4M7GA 1LPZB 4WXVA 2PWXA 3M7QA 1P2MA 2VU8E 1HJ9A 4ISHH 1C1UH 2CHAB 2D1JA 3MWIU 1MTWA 5CHAC 1TRMA 1VJ9U 2ZDLA 3DA9B 2GP9B 2QV1A 2RDLA 3LGIA 3MNBA 5JDUB 1C5SA 1A61H 2BX3A 1AUJA 1BQYA 1KXFA 4I31A 5DP9A 1VJAU 5L6NH 2PGBB 2VGCC 1G36A 4X1QU 2BXUH 3M61U 4CR5A 1C1SA 2GZ8A 2O8TA 1A7SA 1FY4A 1EASA 1H9IE 1KXAA 1GBDA 3O8CA 1KTSB 1EX3A 1HAVA 2AS9A 4KP0A 1GMDG 1QBOA 3M35A 1AO5A 2G51A 3RC4A 5ESTE 1HAZB 4X0WU 1AWHB 2VNTA 2NU1E 4KTCA 2ZDAH 2TRMA 3MH4A 4GVUA 2XXLA 1MH0A 3SNBA 5SGAE 3KNXA 1O2PA 2BYAX 3QLPH 3LDXH 1BOQA 7KMEH 2BDIA 2Z6BD 1FI8A 1T8LA 1T8OA 5EOKA 1GBBA 2ZGCA 4IS5A 1EATA 2V6NA 4XBDA 3VGCC 4BNRA 3ITIA 2AGEX 1KLJH 1Z6JH 2WPMS 2BLWA 1O3PB 1ESAA 5IYTA 2BQ7B 1ZHRA 2WPLS 1NRNH 4JCNA 3ESTA 4I8KA 2K1QA 2GCTC 1TA6A 5EW1H 2ALPA 5LPFA 2HRVA 1O36A 1DS2E 3NPSA 1GL0E 1PPCE 4MTBA 2ZA5A 4ASHA 2FTLE 1P8VC 5EGMA 1RTKA 1H9LB 3SUGA 4D9RA 2ZZUH 1A0JA 1VR1H 2CXVA 1SGEE 1FLEE 4H42U 5FBEA 1AY6H 1K28D 4I8JA 1IOEA 2A5KA 2GV6A 1S6FA 4ZKOU 3DD2H 3RXCA 2VWLA 3PLKA 1K1LA 2RG3A 2OXSA 4FVBA 3SNCA 1SPJA 1ZOMA 1O33A 3LU9B 3QZQA 2ZFFH 5GCHG 1GMCG 3UTUH 4UEHH 3QUMP 4TY6A 1Z1IA 1TB6H 4NGAH 3PTBA 4WXIA 1GHZA 3ZZ3A 3SJOA 3LGVA 3TPIZ 1O2HA 2P3FH 3AAVA 2EI6A 2XRCA 3S0NA 1BRUP 1GHAG 2F91A 4Y76A 2G4UA 1O3KA 4KGAA 5C3NA 1JXPA 1DSUA 3HGNA 1J14A 2V3HH 2DE8A 4FUGA 1FMGA 3TH3H 1UK2A 5DK1A 1O2OA 4UFFH 4Y8ZA 3GICB 4B2BA 1DITH 4B76A 3SN8A 2BY7X 1DE7H 2C90B 2FEQH 3RXAA 1AD8H 3RXVA 3T28A 4Z6AH 2FOCA 1AFEH 1O30A 3HKIB 1A3EH 5EQQA 1H4WA 5IDKA 1P10A 3HPTB 3QGNB 3RXLA 2ZIQH 3HK6B 2FI5E 3URCA 1XUJA 1IHTH 3LJJA 1MU6B 4NIVA 3PB1E 1NRPH 2ZFSA 1UVSH 3MYWA 2FIRH 2OQ5A 1C5UA 3Q00A 3RDZA 1YPJH 4HGCA 1OOKB 3TIUA 5PTPA 1LDTT 1YKTA 2DUCA 2ZGBH 4ZKRU 3ZZ8A 2Z3DA 3GY2A 2AIQA 2QF0A 4Y0ZE 1ZTKA 1CSOE 4K8BA 1MZAA 1RTFB 4MPWA 5BRRE 3NUMA 3PO1B 1QRXA 1TE0A 3GCHB 1V2TT 1O3FA 1UK3A 1C1OA 3CS0A 3RMNH 1QJ6B 3MH5A 3MI4A 2R2MB 2GMTB 1GVLA 1G9IE 4NFFA 1GBAA 1GCTC 1P3CA 3QTOH 5HYOA 4UONA 5FHTA 1W7XH 2Y7XA 2SGQE 4H6SB 1O2JA 3ATIA 1MTUA 1N8OC 3A8BA 4B2AA 1GI6A 5FPYA 1V2NT 2Y5GA 3F9GA 2OC0A 2F9NA 1EB2A 1C5LH 1LVMA 2VIQA 2ZCKP 2PTNA 1GCTB 2ZEBA 2ZHWH 3BTGE 2HVXA 4FUCA 1KTTB 1EJAA 1TPAE 3JZ1B 3F6UH 2PKSC 3P8NA 2ZECA 4X6PA 3SNDA 1P9UA 3I77A 2XCFA 4I32A 1CBWB 4FU7A 1TGSZ 1C4V2 3SUFA 1RIWC 2BDCA 2XBVA 4YOIA 5AFZH 1NRRH 1C1NA 1FONA 3E8LA 1C5ZB 4JYTA 3ATKA 5F8XA 3PLPA 2DE9A 4UE7H 4JZFH 4K60A 1O32A 1NTPA 5EG4A 1HBTH 4R0IA 3TH4H 1EPTA 2IPHA 1TNJA 2FOAA 1O5CB 2CF9H 3W95A 2V35A 1F5RA 3M5LA 3UUZA 4B1TA 1LPGB 5DKMA 1DICA 1V2OT 3GY5A 1SGYE 1J9CH 1GI0A 1NT1A 3SUEA 1EJNA 1ZLRA 5DP4A 1SGNE 3F9EA 1Z6EA 1MMJN 6GCHF 3LH1A 3ENSB 1K1OA 2GCHG 1GBIA 1S0QA 3M5OA 2GD4B 1AVWA 1G2LA 4OS2A 2HNTE 3QGJA 2RA3A 2G55A 5FBIA 3PLBA 1GVKB 2QXGA 2W5EA 3I78A 3SU2A 1G2MA 2BD9A 3T29A 4X6NA 2FI4E 4K1SA 1W7GH 2A4OA 4FUJA 2BVRH 4I8HA 1K1NA 1O3DA 4NG9H 2BDGA 1GI1A 1JBUH 3BIUH 2OLGA 2Z3CA 4X8TH 1YBWA 2P3UB 4KTUA 1O2MA 1WOFA 1BMMH 1E0FD 1V6DA 2XW9A 3V12A 1EKBB 5GIBA 1FJSA 1AQ7A 3RP2A 1VITG 1GCDA 2JKHA 4A1VA 1KLTA 2G00A 1O5GH 2ZTXA 3QZRA 1SGFA 1HIAB 2QXIA 2BOHB 4XBCA 1ETTH 1W2KH 1GJ6A 1EAUA 4MLFB 1DDJA 1QGFA 5GCHF 4K5ZA 3AW0A 2QCYA 4U2WA 5E2PA 1DSTA 4ZXXH 1E38B 1SGPE 1PPHE 1P57B 2J95A 3M36A 4QT8C 1JIMA 7GCHF 1C5OH 4JZDH 1MCVA 5EXMA 4E06H 3H7TA 4H4FA 2B9LA 3BTME 1P2NA 1RIWB 1B0FA 1VCWA 3WY8A 4YM9A 1GHBF 2C4FH 4AB8A 2IOTA 3G01A 1GGDB 1D3QB 1FNIA 1MKXH 1TGTA 2FOEA 1GI8B 1SMFE 1EOLA 3BTEE 5G4BA 2M5TA 4UFGH 3TK9A 3A7YA 4B75A 3UR6A 1GI2A 5E0JA 1G30B 4CRDA 5C1XA 5EW2H 3K6ZA 2P59A 3W94A 2CGAA 1GPZA 2BX4A 3SHAH 3S9AA 4YTAA 4MNWA 1C2GA 1BTWA 2BY5X 4IMQA 2G52A 1JRTA 1PQ8A 1HGTH 3ODDA 2OQUA 4GPGA 3SNAA 5E2OA 4D76A 1EAXA 3TK6A 1ANBA 3P8OA 3RMOH 1VCPA 3E0PB 1W8BH 3U69H 3P8FA 1PPEE 1TGBA 4XSKU 4I7YH 3M5NA 3ZZ6A 8KME2 1P09A 3H5CB 1AB9B 2VGCB 1BDAA 1AFQC 2BZ6H 3BTFE 1TOCB 1IQLA 3IG6B 1YPKH 4AG1A 5BPEA 1GBKA 2FPZA 2R9PA 3MO6A 4CRAA 1HCGA 4I8LA 1HAYB 2Q6FA 2P8OB 7LPRA 3PV4A 3KQDA 1IHSH 2J38A 1FPHH 5ETXA 2FOGA 3ZZCA 1CVWH 1PQ7A 2AMQA 8GCHG 1O3MA 1WV7H 4XDEA 4ZXYH 3SORA 3BG4C 1L4DA 1RD3B 3D49H 4ZHLU 1IAUA 1P2OA 3E0NB 2VWOA 1L0ZA 4CHAC 4CH2B 4A1XA 4ZHAA 1Q31A 2OP9A 3MNXA 3PMAB 1O35A 3Q3XA 1S81A 2J9NA 3LT3A 3SJIA 1C5YB 1NS3A 4NCYA 4VGCC 1DUEA 1QBVH 1DFPA 3B9FH 1DX5M 1YGCH 1YYY1 5T6DA 2ZPQA 3U8OH 2STAE 1Y5UT 1V2UT 3M5MA 3EQ0H 4THNH 3GYLB 3RUOA 5A0CA 1HAXB 1T4UH 1BJVA 3Q77A 1O2LA 1ANDA 3SV6A 4O9VA 1YCPM 4NWKA 5EXNA 4INHA 2CN0H 4BAMB 2YOLA 2BOKA 1ZMLA 2AYWA 3KL6A 4OS6A 4MPUA 1TALA 1GHBG 2LPRA 4VGCB 1AE5A 1OWIA 3U8TH 1L1JA 5A0AE 2Y5FA 1O3LA 1B7XB 3ZZAA 3SGAE 1SSXA 1ESBA 1LHDH 2QXHA 2ZGHA 3BEIB 4INKA 1OWKA 1TABE 1O34A 2FLRH 1GI7B 2ESTE 3BTDE 5I25A 1ZHPA 2AERH 2FLBH 4NA7A 1HRTH 3RM0H 1ELGA 1AU8A 2A7HA 3A85A 3FZZA 1TBRH 4Y11E 3ZVCA 1GHVH 3VPKA 4Y6DA 1QURH 1TBQH 1HYLA 1FY5A 3M7UA 2A5AA 2P94A 1LVBA 1TBZH 1C5NH 1AE8H 1ZRBA 1GL1A 1D3DB 3QO6A 4YO9A 1E35B 4MG3A 3MMGA 1SI5H 1GG6B 3A8AA 2THFB 3EE0B 3UQVA 5EQSA 2VWMA 2ZTZA 2P16A 3A7TA 2Q1JA 3T62A 3ZYDA 1W13U 3M7TA 3PM3A 2ANMH 9LPRA 2VH6A 2O8MA 5DP7A 4ZH8A 5DJ7A 1BBRE 1YPMH 2TBSA 1Y3XA 2NU4E 3K2UA 4ABJA 1O2IA 1C2DA 2R0KA 3MU0A 4J1YA 4YESB 4AFSA 1DANH 3RU4D 1IQKA 2XCNA 4RN6A 1DT2A 3LONA 3SNEA