2BM3A

Structure of the type ii cohesin from clostridium thermocellum sdba
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
162
structure length
162
Chain Sequence
KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Structural Determinants of Cohesin-Dockerin Specificity Revealed by the Crystal Structure of the Type II Cohesin from Clostridium Thermocellum Sdba.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Nuclear protein
molecule keywords SCAFFOLDING DOCKERIN BINDING PROTEIN A
total genus 34
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bm3A00
5K39A 4WI0A 2ZF9A 4UYQA 1ZV9A 5G5DA 5LXVA 2OZNA 1QZNA 4FL4C 3F2LA 3FNKA 4IU3A 3KCPB 5AOZA 4UYPA 2JH2A 3UL4A 4DH2A 1ANUA 4U3SA 4WKZB 1G1KA 2Y3NA 2VO8A 2VN6A 1AOHA 3KCPA 2W1NA 1OHZA 3GHPA 2XDHA 4FL4B 3BWZA 4IU2A 2CCLA 2VN5A 4UMSA 2O4EA 1TYJA 2B59A 4N2OA 3L8QA 2BM3A
chains in the Genus database with same CATH superfamily
1SBSL 3NZHL 1UT9A 5D4IA 2DQ6A 1MCLA 1E4KA 2VZSA 4Y19A 1S5IL 3F84A 2XFXB 3V6OC 4AGMA 4DKAA 4NZJA 3MRJB 4NN7B 4PS7A 3LEYL 1A9BB 3LKRB 4EDWL 4HP5A 4ZO6A 5EN2A 2H3NA 2YPLB 2CPUA 4M5SA 4D3CH 3Q8FA 3QR2A 4BEIA 2V2TA 4HUWA 4DNLA 3PAUA 4PTUA 3OKDB 3QDMB 3ZSTA 1HCVA 2X40A 3NJGA 2Z1PA 4P23C 4Z76A 1REIA 2Z92A 4X2UA 2IG2H 5C0IB 1Q90A 3WELA 4DP1X 3KBPA 4JRLA 3ALXA 3N1PC 3QXTA 4YHIA 3TO4B 1VZGA 3QRBA 3HRZA 5B7FA 3O3BA 3ZHLA 1TITA 1XFPA 2DF3A 3O6MH 4RISL 4O02A 2XN1A 1YNKH 1GGUA 2A4CA 2QPUA 1HXMB 2XIIA 1URLA 3MRJA 3D69B 4X7CC 3VRLE 4PJ9A 5FW7A 4ZW6A 1U3ZA 2N01B 5HGDA 2ENJA 8FABB 5FKPB 3EO1A 3HG1B 1AO7E 2GB2A 4BK8A 2ZCHL 3RWFA 2BNRE 1KCUL 3WY1A 5DQDL 1N19A 5JPMB 2I5YL 2W0FB 4MDRA 2VQ1B 4DPRA 5D7JC 5ES4B 3FK3A 3LZNA 4DZ8A 4OFQA 2VMFA 3T0EC 1RZIB 4NO2B 2XQ0A 4Q9CA 4MJ5A 1D7CA 3PWNA 4F8TA 2H6UA 2R59A 1FZMB 3VJ6A 4JO1H 4DESA 2DBLL 4L3AA 4AQ8A 3OXRB 1WAEA 5TDOB 4EXPX 4RZCB 1A6UH 2YMXL 4LLDB 3SBWC 3EYQD 4TUOB 4PPTA 3B5TA 3PNWB 3MX0B 5C08A 5FECA 3H8NA 1HJCA 2V2XB 1N59B 4V1DB 4Z7UF 3IYLW 3D8MA 5AOJA 5T1DL 2PCFB 4E9RA 1V55B 4LSRH 4Z7WA 5KVDH 3BQUA 1AJ7L 2CZNA 4GAJL 1NEUA 3BZ4A 3S34L 5DFVD 5B8CA 3B6SA 2R4RL 3IEAA 4M62L 1HL4A 4MA7H 4XNZB 1FC1A 1GPOH 3MV9D 3L2NA 4NC2B 1D5ZA 1GZHA 3RL2A 4EKXA 2G0LA 3WDHA 2HVKB 4CVXA 5I1IH 3B2UD 2Q9OA 3IJ9A 3NCBB 4JAMB 5IMKA 1MRCL 1EZVX 3KW8A 3T71A 5HGGS 2E9WA 4OGQC 3FQRA 4AIZA 3ARDD 5CSBA 2F54E 4HWEL 4TNEA 4EKJA 4LB8A 3ULVH 2E76C 4J27A 2O6FA 2HFTA 1AFVH 3I2CL 1UTDA 1RZKH 4N2NA 1F11B 4WO4A 1AS6A 4NNXB 1T0PB 4J3OG 1FNAA 4WVRA 4JJ5B 4PVNA 2IDCA 4BFRA 4MD5B 2FSEB 3E2HC 3R8BB 3U4KA 4EIGB 5GHWH 3C5ZD 1KB5H 2B0SH 3F7KA 5BV7H 5FUCE 1R47A 1AHWA 2DMBA 2XDHA 3WNKA 3GB7A 3DETD 3ZDXB 3DPDA 3N2JA 5ICXA 2JF1A 5ID1A 4KO9A 3O0RL 3EYFB 1BQHB 2R8SL 1WIPA 3IBEA 2YUZA 3DXAD 2YIHA 1UWGH 1BLNA 1LEGA 4RFEB 4WFFD 1EHLL 3HMXL 3BZEA 3I6SA 4XMLH 3IF1A 4AQOA 3GXFA 1CDBA 5HI5D 4ANXA 3P0VH 5C9JB 4PREB 5CZRA 1IC7L 3WO4B 2JIXA 2X9XA 4X98B 1J9RA 3B2DC 3BVNA 1KCLA 2ORBL 3NOIA 3H7LA 1I7TB 1MJUL 1Z9LA 3VA6A 5C7XL 4PJIA 1A1NA 2HVJB 1WSST 3RVUD 2BMKA 4UQ2B 4N3UA 5KS9E 4YSSA 1H8LA 3II3A 3MXWL 3OL2A 1EGJH 3CVHL 3KGSA 3FOMB 3HKZA 4EN3B 4TNWK 2HJKB 1JGEB 4M00A 4NQDA 1KXQE 2E7LA 1USZA 1QSEB 2LHAA 2MOGA 4QTIL 3ZKSD 2FYVA 3K71A 3RWCA 3L3IA 1RD6A 4XMWA 1C9SA 4HEPA 3VM5A 1EVUA 4GRWH 4LGSB 1MCQA 1UXSA 4ZPVA 6PAZA 1NAKL 5IK3A 3HN3A 1F11A 3ALPA 4HCRH 1VJSA 1I8UA 2GVYA 4OQTA 1WZMA 3U83A 4L8DB 4PS3A 3N50A 4KC3B 3BC9A 1NCWL 1WZLA 3FQUA 3NIDF 5AVTB 4P5SA 3IRPX 2K9FB 4FQ2L 1AY1H 2HFFB 3MBWA 5JUEH 5E4EC 3MI6A 1RQ5A 1P7BA 1FE8L 3RTQD 3EGXB 2HP4A 4O5LL 2Q0ZX 3PGDB 4PJEB 3HG2A 3TJHD 1YUHA 3AY4A 4AZ8A 1DL7L 2K6WA 3TLRA 5C2BH 3GBDA 2B5IB 3Q43A 5GHWL 1D6EA 4HU2A 4ONFL 2X4NB 3FC8A 4OVUA 1NEPA 4EXKA 1QSVA 1YEWA 3U9PL 5EEZA 2P47B 3DO3A 3ETSA 5E8EB 5CJ5A 2X1QA 2CLZB 2KYIA 3O3AB 4QRBA 4S1RL 5IBUB 3SGJA 1VGKB 2WCSA 3U1SH 4LDLB 5AVYB 1OTTC 3VFOA 2VR9A 3QRFM 2G3MA 4H2CA 4P2OC 4X6FB 4DP7X 4ZFOL 5FCUL 3MREA 4Y16D 1BPVA 4N20A 5K1NA 5K9JL 3RWIA 1ETB1 3RL1A 5EZIL 3HZMB 4L5FE 4TNVF 1SJVA 1HDMB 5DJ8B 3GD1C 4HDIB 4YHKL 3K91A 1NSNL 2F7OA 1TFPA 3MGOB 3BT2H 1ACYH 4PS4L 4S1SH 1ADQA 1QQDA 5GS2H 1CTOA 4DT2A 4C4KT 2Q7AA 2ADIB 3QULA 1IC5L 4S1QL 1MDTA 5D1XC 1CURA 2BY1A 2NY5H 1O6TA 4LPTA 5GGVY 2DB8A 4P23A 2IPUG 4TN9A 1ASQA 2GT9A 2DPKA 2OMWA 3BVUA 4YHOH 5C0JB 1U91B 1X6LA 1WJ3A 4N2LA 1D5MA 2WIMA 3DK2A 4LVNB 1BVLB 2G4GA 1NPUA 4WJG3 1RPUA 3PQYA 4JKPH 4NYLB 1Z7JA 4FQCH 2LE9A 4DF9A 1KYFA 3ULVD 4JRXA 4XWGL 3EGDA 3W9DA 2YGOA 4QHPA 5AW0B 5I1DA 1QX1A 3DUHA 4G11A 1BZDA 2ISDA 3CMOH 2R4SH 1IARB 1DZ0A 5AVVB 1BIIB 3O8XB 1BD2B 1I8MB 3HC2A 3EDFA 2Q76B 3LZQA 5HDOA 2NY1C 1T2QL 4NC1E 2V8MA 4Z7OE 1Z0NA 1A14H 3WS3B 5JW5A 4P4RB 3NK3A 4KVPA 5EO1B 4FFVD 5C0BA 3GHEH 3V7AG 1TTGA 1JGUL 2VISA 2BSDA 3H0TA 5C0JA 4PJFA 4HGKC 4XX1G 3B37A 4Q58C 1AD0B 5E6ID 4DIXA 2DLFH 3ZE1B 2NY2B 1L6ZA 1LDPL 4ICXA 5DVPA 4TSBH 3HC0B 5F0JB 4CAGA 5KVEE 2C3GA 3I50H 3ATEA 5C0AE 1BX2A 4BH8B 1FFRA 1MW3A 5FV1L 1ET5A 3F7YA 4PRPA 1HDMA 2BP8B 4OM1H 3KLQA 5IP4A 4B9PA 4PJBF 1UZ8A 2R0ZH 4X7SH 2GSIA 4X9FA 5C0NC 1IZJA 2G3NA 3ULVF 4P5KB 3OPZL 3C09B 1HH6A 1J0HA 1MCWM 2VCOA 2AJVH 2IAAC 4AIXA 4C55A 3GBNH 3HRZC 3ELQA 4MA8L 5J6GA 1Z3GL 3BAYA 3U30B 1E8XA 3GK8L 4JN1L 5EU6E 5E8EA 3ZKXC 4BFKA 5I8OH 4RGND 1NMCC 2X4SB 5FA3B 4XBMA 4X6DE 3WAKA 3AUWB 1KCWA 3ZTCC 5D93B 4NDMA 5L4FA 2YAPA 3D9AL 5FF6B 3ZLQC 2DDQH 3BD5A 4JQIL 4D9RD 3L5IA 2R1XA 2WAHA 4N26A 1KCRH 4QXTB 5D7SH 5KWYC 4L48A 1ZXKA 2C9SA 1KJ3L 4D9LH 1MCNA 1JCVA 1K72A 1KEML 3TA4D 3V6OA 3K6DA 2WXKA 3NUKA 3L5WB 4KRNA 1CXEA 1H0DA 2IV8A 3BWAB 1UKSA 1XT5A 1TJMA 3TNMA 1DVQA 1I9JH 1U3HD 4PJ7E 1BWWA 4N2FA 4YC2C 4YDZA 4MNQD 2NTFA 1XCWA 3IAGC 1M3JA 1FZKB 1T03L 3QORD 1K8IA 3DO4A 1JXJA 4JDEB 2IANB 3UROR 4PRBB 1DQDL 2Y7NA 3A67H 1TU2B 1A2YA 2UXFA 3VXTB 3O2DA 2HJKA 1J1OH 4LAQL 4KO7A 1YJDL 4PB0H 4PM1A 5DMKA 2CLVA 1T4WA 3WLWC 2GUOA 1PYWB 1EJ6A 2QSQA 3C6EA 1JVOA 1MWOA 2V6HA 1RIUL 3IWVA 3OHXA 1NMCB 4GKSA 4GINA 5I73C 2HG5A 2H2SC 2BHYA 3OAZK 4IRZH 5DK2A 4KZ0A 5DMYA 4HC1H 3U30C 2K78A 4OZHA 4CN6A 1RZJL 5JLZA 3H55A 2VMJA 1GC1C 3VFVB 1HX0A 2G2RA 5A2LH 5F9WB 4NWUH 1IGCH 1R5IB 2GY5A 2IALA 4HPOH 3PDDA 4JPWL 3ZO9A 3B9VA 4N2IA 3GXDA 2E0PA 1I3RA 3PU7A 1NCBL 3T65B 5I1KH 4KH9A 4PRHE 5IB1A 5SWQB 2RB8A 1KV3A 4CADA 5GJTL 2OW7A 3DVIA 1UM6L 1ZAGA 3T6WA 4E9SA 4AZ8B 1CLOL 1OE1A 1XHHA 3ZR5A 5FUZH 4GRLB 5L88L 5I0YA 3U1SL 1WICA 4XCFL 3U1PA 2HH0H 4ELKB 4AYFB 3QIWB 3QQ4B 4OLYH 1LEIB 5KEZA 4JX0A 2X6CA 1HC1A 4UTBH 4DAGL 1A7PL 5E9NA 1UH3A 1J8HE 2GABA 4OF7A 4G6JH 2BXZA 3OLIA 5AB0A 3BP6A 3QR0A 1Y18B 3FUEA 4BKSC 1NAMH 1CFQA 2XETA 2GTWB 1I9JL 4PVBA 2BSRA 1FAKT 3BKCL 4JZJA 4J3OD 1MOEA 4WO0A 4JR9H 1FQ9C 4W9HC 4F1ZA 5CLZA 5JOFB 4HYTB 3IGUA 1JWUB 1XB3A 2ZG3A 1MG2C 2F68X 2H0FA 2XZCL 5C08E 3L5JA 2VYRE 3NJXA 3DIVA 3QUHA 3BISA 4GQ9H 1GC1H 3GSNH 5EZOL 5KZCB 3ESOA 5IQ9B 4P49A 1MVYA 4JO3H 3S3BB 4CBZA 1LTXA 4WHYH 5IKCA 2M26A 4N87A 3P69A 5JHAA 4L1TA 4LRNH 3FU8A 4F8LA 1YECL 5BMFL 5I71B 1OZUA 1BVOA 5ICYB 1F02I 4AV0A 1AZVA 1Z3GH 2VM9A 4TVPD 3HNVL 1G7MB 3RU8L 4YHYC 2ODHA 3CVHH 3LJ3A 1C12A 4JY6A 3HI6L 4G9FE 1ZT7B 3VWKC 4GW5B 1P4UA 3IN2A 1J10A 1KLGA 4P07A 2PABA 4Z0XA 5TK4A 1JXFA 2J1XA 2VDNB 5IF0A 4AQ1A 4NQXA 1I53A 5D4HA 2FGWH 4BJLA 1AR1D 1W72A 1EJ8A 3N0AA 1K2DA 4LLQA 1GXEA 4HX1B 2JJTA 2P42B 1OK0A 2G4EA 2GJ6B 5CBEA 4NZ8A 2W9EH 3T2NL 1QO3A 3DV4A 1EAPA 7CGTA 5JPMA 1KBPA 2A9MH 1KBGL 3GM0A 3KPPB 4X6CA 3L3OA 1MCPH 1WC7A 3WJLA 5A3ID 3REVA 3IDXH 4E41B 3PV7A 4RX4A 3FDWA 1S7UB 5FYKU 1WV7T 1NM9A 5LDSA 3LZPA 1HNYA 2C4XA 3Q13A 4FNLH 1XR8A 4XNDA 4LSVH 4UDUA 3KLHC 3VD2A 1DEEB 2HT3C 4DKEH 3MCKA 4IOIA 4N24A 2J43A 2J8UA 4OZHE 1TQCB 2WOYA 2X6MA 3DI3B 4FKHA 5JPNA 2XVGA 4BQCA 2MQGA 4G8GB 4ODTH 1JHKH 4BFNA 1G9MH 3QVAA 4UZGA 4XPHL 3J2PA 2AAVA 2NX5D 4Q6IB 4RAHA 5IB5A 1U92A 4GKNB 4MX7A 5TQ2L 1AFVL 3I2CH 3W11C 5T3ZE 2MNJB 1X4XA 4IGBC 5F3FA 4MZ3A 1AP2A 2ZSWB 4WK2B 3FO2A 2HSIA 4FXKA 1NDMB 3OZ9H 4UDTA 4W9LC 4M1GL 3VI4B 3IJYB 3L45A 1LEKB 5HD8C 2EXWD 1RIVH 1XR8B 2H32B 4OIIL 4MJ6A 2AZUA 5GRYA 1ORQB 2EDKA 3NIGF 4R7NB 1FH5H 2NZIA 2PR4H 5I1CL 3QYNA 3V79C 2NLJA 1FO0B 4XMXA 2R0WL 1DVFA 3MFFB 2ICWA 4KKBC 1NCIA 4JY4B 1JHLH 3MYJA 3S34H 2WZPD 3GBEA 5K9QG 1KBBA 4JM2C 4LSPL 5GGVL 1TZHB 1AKJB 2PR9A 1INEH 4G8EB 1TYJA 2E47A 2WYZA 1PMYA 4TKWA 4HOWA 4OFPA 1KNOB 4L8CB 4UQIM 2FR4A 3VFWB 3FFCD 3L3HA 5G4MA 1VFUA 2LTQC 3VYOA 2Q76A 4BFJA 2ENYA 2TSBA 4KQ3H 5DQ9A 4L1HA 3QH3A 2A6DB 2IAMB 3MRPB 3VNYA 1MFAH 2DMKA 3F85A 2WHVA 4B0MM 2M2DA 1K3IA 5FYKD 5GISL 1W0WA 4DGVH 3KPSB 2DQEH 4BSJA 1E3FA 4GAGH 3H85A 2EEXA 3D4GA 4QR7A 1RSYA 2NW3B 4XN2A 1XGUB 1H3PL 3FQUB 5EBWB 3VFMA 5DUPL 5F1IA 2FO4A 2HWZL 4PW9A 4K5MA 3GMRB 5BXFA 1EEUA 4UU9A 3PWJA 3UTSD 2OJEA 4N2CA 3BPOC 2YGVA 4HVBA 4WI0B 1ZDQA 3VRIB 1YNKL 2Q1EA 4DHLA 1N10A 3QZPA 5F96L 3GRBA 4AEIH 1SJXA 4R7VA 4Z18A 4LLMB 5EOTA 3SPCA 1UFUA 1EHNA 1YY9D 5CFAA 4ODWA 1JP5A 2NY6C 4GBXC 1R5WB 3L3IB 1UB5B 2ENQA 1TNNA 2WO4A 1FG2B 4Y19B 2X88A 3L7FA 2WANA 4XWOC 4PW3A 4OLZL 5EWIH 4PIRF 4FYTA 4D7PA 3S5LA 4HAKA 4PN6A 3QNYA 4BZ2L 4OV5B 1LWHA 3DJTA 4L1SA 2JKWA 1ILUA 3BXNB 4KH2A 3FTYA 3TN0D 2XV0A 4B0MB 3GSRA 4JVUA 3RA7L 4LVHC 3T3PB 1M57B 4HU8A 4LHQB 1M7DA 1QBLH 4OLWL 4Y4FB 4N1HB 5A1AA 4MDIA 2ZG1A 4PP2B 3CDGB 3S35X 4DN3H 5E2JA 2JKNA 3LXAA 5AD0B 1GHFL 1XL4A 4BM7A 5HYQA 1OM3L 2C7UA 1WZ1H 3D25A 4ODVL 5I17A 2Z64C 3RZCB 3CK0L 4CU6A 1DJXA 3ABKB 1D5BA 5CMAA 3E2HB 3A6BL 2UX7A 4K2UL 1H9VA 1RSFA 1VA9A 1F6AB 1AXSB 4OD1H 1KGCD 3NBNA 3NFSL 4V2CB 1E30A 1ZV2A 2LLLA 3OMZA 2GFBA 4K71B 3FB6B 4L8SB 4KXAA 4OCRH 1B6DA 1E3XA 5B1JC 1QSFA 3GLZA 4NT6B 2WXLA 4PJGA 4ZOEA 3D3VB 3Q6FA 5AYQA 1RPKA 1J8SA 5TE6L 1JGLL 3VI4E 2MKWA 5JPMC 2CDFA 3GXNA 4JFOB 1LDPH 2OTWB 2JQMA 3WJMA 4H25A 5E8PA 5T1MA 1SLVA 4FYSA 1HL8A 1IGJA 4XMPH 5F8QC 5B3JF 3A6CL 3GC3A 4FG2A 1ODUA 2NDGA 4POZC 5JXAH 3WXWH 4AQ1C 1CDYA 4JFEE 2EDTA 3EJRA 5GPRA 4AVHA 1J5OH 4ZDHB 3P9MA 1KXHA 3QWOA 1XCQA 1P4BH 5D9SB 1IGTA 3T4AB 5DUMH 3PWLB 2R4SL 4RLDA 3KPSA 2VAAB 2VDQB 3B6SB 2Y23A 1JDAA 4FTVA 1SOKA 5I16B 4LL9A 5KJRH 3RBSA 1WBYB 3MNWA 5BQ7A 1NOFA 3T0EB 4FKKA 5IHUL 4PJHA 3ZMEA 4MMZC 4QDGA 2EUVA 3AREC 5B4MD 1FRGH 1GH7A 4M3JA 3TM6A 2WO2B 2DIAA 1RZGA 5DEFB 3IF1B 1P2CB 4IU2B 2N59A 5HDBB 3F7VA 2QQKL 1J8RA 3BSGA 3JQOB 4TULH 5DRXB 5T1DH 4JM2D 4I5BA 2CKBA 4S1QH 3HBGA 4WU5A 1HH6B 3RPIA 4ZYKA 1QEWA 1FO0H 5KVEH 3R0NA 2C9XA 3K80A 1TTAA 1PS3A 1ZS8B 2EE0A 4BQ6A 4K07A 3HNTL 5C7ZA 1CI5A 4H44C 3RGVC 3ZKMD 2FHBA 3UL4A 1Q1JL 4MLSA 2Y5QA 2ZWNA 1EIBA 4FFZL 5IFAH 4PJDB 4PLKC 4H88H 1S9WB 2EE3A 2EE2A 2NNAB 1HSAB 3AQZA 4HKXA 2VH5L 2F18A 5A16A 5JQ6L 4H25B 1JD7A 9PCYA 2VDKB 4WWNA 1ZJAA 5CN1A 2BSBA 3P1VA 1L9QA 4QHUB 4RSYA 4P5TB 2JVUA 4IRJD 4RNRA 1N12A 1UWEL 4V11A 4LCCA 5DHDA 1AQKL 4DVRH 2DWDA 4PHXA 3SPGA 1GS8A 3EHBC 4YHMH 5BS0A 5KW9H 3KZ8A 3L5HA 5JORA 3VFOB 3ILEA 3OF6A 3C08L 1T7WA 3D3VE 1OD7A 3J07A 3X13A 4LK4A 2R27A 1M71A 3ZL2A 4YGAB 3BZFA 5C07B 4EN2A 5JXAL 1SJMA 1YA5A 3A6CH 4IK7A 1G7PA 3VFTB 3D2UB 3MTXA 4WEMB 2HTLC 5JW3L 3JWDH 5DJAA 5AQ0A 1FNEA 3BVVA 3ZXAC 1E42A 2E9IA 2JKIS 1CN4A 3KNBB 1UCTA 1KYDA 4ZQKA 3KMDA 3KPPA 3HR5B 5GGRY 1R3KA 2F5AH 5ALBL 4L3CB 1OVZA 4WLCA 5FAAA 2CXKA 4F2MA 1NANH 1YY8B 3S88H 1MZZA 5L2JA 1UWEH 2X1WL 3KYOA 1NFAA 3UAFA 4P9HL 2JJSC 4PBVC 1OHZA 2W9EL 2NY3C 3T2NH 2KUTA 5BRZE 2B59B 2EEBA 2I60L 1RLWA 4QTIH 2Y9RT 4PWGA 2HKAA 1HI6B 3MRHB 3WNOA 2XWBA 3RGVB 4M5YL 3MXWH 3U48A 4E0RB 2EAEA 2I9TA 1UFGA 5K9OA 4MCZA 3NCCB 3QHZL 1JNLL 3QCVL 1MEXL 4KI1A 4GJTB 2WB1A 5KVEL 3ASWA 3RLSA 2ESVB 1JV5B 3ISRA 4XRCA 4I3RL 1E2VA 2FUTA 5C1MB 3N40F 2PLTA 5MENE 2KH2B 4HHAB 3DOSB 1C5CH 5EZOH 2NQCA 4BDVB 4Q89A 1HZLA 2CO7B 2ZCKL 4HWZB 3LRHA 2F7PA 3MJ8A 4CW1B 2EKJA 1UWGL 2BVQB 1EEZB 5FDWB 5HJDA 1IFGA 1G7PB 3CDGA 3EGDB 3W9DB 4JE0A 3NCJL 3BDYL 3LV3A 1U4EA 1F1DA 5E8OB 3GMQA 3Q8CA 1OGTA 3L3DA 3TWCL 1G0XA 3IFOA 1UURA 3PWUA 3FTXA 1PIFA 4K9EH 6CGTA 3BJLA 4U1JB 1EFXA 3DGGA 5GQBA 1MCOH 3UJJL 4CMHC 2CLRB 2FZ3B 1ULVA 3DJRA 3HC4L 3KPTA 3RB7A 3WXWL 1SMAA 5TDNA 4GAYB 4P5TA 4RNRB 3T0WA 3HE7C 2VQTA 4PJFF 4BWUA 3DBXB 2J8UE 1SBBA 5DRWB 3T1WA 4B50A 1PY0A 4XN7A 3VCLA 3FRPB 4QHKJ 2VL4A 4JFZL 3KWVA 5FF6A 1NMBL 2WLZA 2VH5H 4RAVA 5AW1B 1EFQA 3WO3B 2NR6A 3CXFA 1I8IA 3WJMB 2TRHA 2PO6A 2HJLB 3ILPB 1LJMA 4NUPA 1WCBB 5E6SB 5KSBE 3TEZA 1YC7A 2OX5B 3PWVB 1V8HA 4WFEE 1DQLH 3F58L 2IFGA 1JYVA 3GBML 4Y2OB 5CJQL 3OKLA 3PRZA 1WT5C 1Z5LA 1PD6A 2GTZA 3KCWA 4PRAB 4IOFD 4QRPB 4R5VA 2NUPA 1UM5L 5DS8B 1JMZA 4A6YH 2KLRA 6TAAA 1BFOB 1Z9SB 4QHLA 4RA3A 4WFGE 3VFSB 2GY7B 2QV4A 1JPTL 3KLAA 3N55A 1QFOA 4GS7C 4PJIB 4OIIH 3UMTA 4HETA 2DKMA 3AXHA 4H1LA 5F8RC 3EH1A 1K8IB 4JDEA 2F5BH 3VFUB 1DJGA 2VRAA 2F0CA 1EERB 3L6FB 2ZKMX 5EN2B 3GLDA 2BDNH 1JHTB 5CZKA 2PYFB 3IBOA 5DMJB 1H6TA 4DOHB 1MFDH 2B59A 2GHZA 3BAKA 4GG8A 3KLDA 3SDCD 3V0WH 4DFIA 5LBSL 4JDTL 2B16A 1KZYA 1MCIA 1ZD6A 3DRTB 3G5VB 3GQFA 3GSRB 4DGIL 3PWNB 2F6AA 5TDPA 4KROB 3G3LA 2VDRB 4JFQA 5IJKC 1VACB 4DGUA 1TQVA 5EEYA 2PNDA 3MBEB 3ZIYA 2VWEC 1M1XB 3EDJA 1BIHA 2YAQA 4XAKE 5DD3H 1JF6A 4NRZB 1DQKA 4U7MA 3SPHA 1IGFL 1R17A 1V27A 2XKSA 4XT1C 5EFIB 2LABA 4AEFA 1JPFA 3M7FB 4EAEA 4B9FA 5CD3A 5FO8A 1P6AB 4K5OA 3L6FA 4ZMWA 5SWQA 1KCRL 3OX8A 5HYJB 5JW4M 2QQQA 1GY1A 2ZE0A 2A9CA 5F88B 2EH8L 2FBRA 1KYUA 4J6RH 3CXHK 5CSZA 5EUOE 2DLTA 1H6FA 1RURH 1ZLUH 3MNMA 1XTLA 1Y6KR 2Y06L 5CSGA 4AMKH 2EVIA 1KIQA 3KPLB 2H2SD 1H3PH 1NJ9A 1IQDA 1QYGH 4G8IB 4IIZA 3WJJC 1EVTC 1TPXC 4IBQA 3UZQB 3ZQXA 5FA4B 5E51A 3EJCA 4AYDC 3UPRA 3Q3GB 3UFIA 2DQEL 4UB0L 5DMIH 4FLSA 2X9YA 1F58L 3OPZH 4LT7A 2WXFA 4HZAA 4LMQI 1ZY9A 5BNXD 4FFYH 2D31B 2W9DL 4F92B 5C08B 5FECB 2B1HL 4D0CB 4MB5A 1ZK5A 3NZHH 3IFNL 5D2LF 3WNLA 2XLLA 2PCFA 4LQ1A 2BNUB 1MF2H 1H3WM 3D30A 5TH2B 4FHJA 3CZFA 4A63A 4ATWA 5BCAA 4BGDA 4PRHD 5E6IC 4KZDH 1YMHA 1SQMA 3HN5A 5C86A 3D39A 4WUKL 4AV5A 1RZFL 4M5TA 3SEPA 4XHJC 1LK3H 1P1VA 2V5YA 3HN8A 3Q2CA 5JOEA 2NLJB 4GQ9L 4P2QA 3WY4A 1UOVA 4JM0A 1ZHKB 5KVFE 1TTBA 4JPKL 3RNKB 1GL4B 4EVNA 3CLEH 5BO1H 1DVUA 2XWTA 1RZGB 3O9WA 4PJEE 5DEFA 1ML0A 1ITBB 3OV6A 4PJ7F 1D5IH 2QLVB 2NZ9C 2N7BA 1C12B 4K55A 4ALAC 2P49B 4K7PL 1SHSA 1JZHA 2N3JA 3H4HA 1CK0H 1NAML 2GK0A 1CICC 3I6GA 4ZW5A 4ISVB 2BY2A 5H8DA 1WUNT 3VFGH 4Y7MA 4ZXBC 1RK1B 4J2QA 1CG9A 2AFNA 2BVOB 2ITCB 3RDTD 2AGJH 2AABL 1CF8L 4N8VB 2AJZA 4PRDB 2FQEA 3BX7C 4WKXA 3RVVC 4TLKA 3CCHA 2O5XH 2CGZA 2A73B 3TBVB 1KGXA 2YEZA 3RZWA 1BXVA 1SVCP 3EBHA 1N2RA 3RHWF 3TONA 3I75B 1LMKA 3QUZD 2C9VA 3VI4F 4Z3JA 5E5MB 3SYOA 2LQRA 3UYRL 5DLLA 4B5ZA 4PGJA 4MB3A 2P7TB 5T3XL 1MFAL 4YHKH 1X7QA 1W8OA 1JPSL 1U8NB 1MJJA 1S9XA 2IANE 4NRZA 3WDJA 3NEOA 3CVCA 3VXOB 2E6PA 4Y16C 3E1F1 2YXVA 1KJMB 5LAXB 5BV7B 3UJIL 1P7KA 1SLWA 1Z9PA 4AYEC 4PJGB 4ODHH 3WIAA 3ZE0B 1UYWL 4PJ7B 3WFHB 4IRJA 2ALWA 2Y72A 4WV1C 3KPNA 3T6QC 3P11L 2FL5B 2HB0A 4XN8A 1RXLA 1NBZA 3SDDA 4B9ZA 2X4NA 3HBPA 5LN8A 5DYOA 4S1RH 5DUBB 1ED3A 2CBQA 4Y19D 1EJFA 4ZFOA 3KEDA 2CG9X 4NCDA 5HVHB 4QWWD 1T03H 3ARRA 1S9YA 2Z65C 2D4FA 2VSKB 3BLBA 4PI0A 3MVSA 1P84K 2MCPL 3V5HB 3FQTA 4W4OC 1CK0L 4PIBA 2FHCA 3BQUC 4TVPE 4W6WB 1JK9A 4YVNA 1T0MB 4LPVA 1NGXA 5D7EA 1UEYA 3QJFA 5BVPL 2WQSA 5F7KC 3T6ZA 4LSQL 4CC4C 1F42A 1JF1A 4ZMQA 3ULUF 3LH8A 5DWPA 1YEGL 1BG1A 4YL4A 4GW4B 4X4YA 4JFEA 1FBIH 2QKSA 2DTMH 4QOKA 2BFVH 2XN0A 1AAJA 2FJGB 5K9KA 2K8MA 3K5RA 4QRUB 3AT8A 4HUWB 3H2PA 1OAYH 5FFLA 2D7TL 4IBWA 5BOZG 3IU3A 1QUNA 4X5XB 3F62A 3OMNB 4LO9A 3GIVB 4L3EE 2WXRA 4F57H 4X8JB 4GRWB 3REVB 3NCMA 4DK5A 3HJ0A 2CRZA 4G6JL 4EI5C 5GXBB 2X4RB 4PV9B 1TZGH 5A6LA 5BO0D 1JZ5A 4LPYA 4MAUL 3T09A 1XZ0B 2P5EE 2OYLA 3GSNB 4EBQH 5CCKH 3G08B 5D8JL 4Q4IA 2P5EA 2XI9A 4HALA 3EIFA 4JDVA 3SKOA 5ITFA 1V54B 3JTTB 5TDPB 4HK3N 3ZDZF 4HUVA 2K4WA 2ICWI 5FYLD 4G71B 1XWVA 3SODB 1MJUH 1BD2A 1GIGH 1I8MA 3S4SB 1C5BL 3FTGB 3CVHB 3AS3A 5T3ZD 3FSZA 2NUPB 5D7IB 5AL0A 5DJ6B 4PGBA 3KLAB 1PG7W 3SE6A 1CXLA 1BYOA 4XP1L 1G7LB 1X5YA 1BAGA 3AG2B 2ICES 2BWIA 3G5XB 3QNYB 2WVVA 3CWGA 1U8IB 1GMEA 4KI5C 2OMWB 3FTZA 2WZ0A 3O0RH 4NPYA 5HDRA 4HPYH 5J3HC 4E5XB 4JHWL 4Z95H 5A2AA 1SF5A 4OGXH 1CF8H 3HIZA 3QDJD 2Q6WA 4AUJA 1T5XB 1ZRUA 3L3GA 1X5ZA 1CFTA 4PWEA 3GSXA 1G43A 2J55A 4G1MB 4EN3D 2XYCA 3FB8B 3I6KB 5SWZD 3U25A 3MLXL 3NZSA 3QUML 4R3SA 1A4CA 5MEPB 4JPQA 1BZ9B 2HRPH 3DI2B 4E41D 4GQRA 3B9EA 3NIGE 4AIOA 5EO1A 1QSFB 5ILTL 2JXMA 2P28B 4JRXD 5KVMC 2J73A 5CEYB 4Z3HA 1S8DB 2NOYA 3MV9E 1FIGL 4K73A 1UWXK 4PTUB 3CFCL 5AG8A 1YEKH 3EJJX 1S7VB 4ZOBA 3L9RA 3DX3A 3IMSA 4UNIA 1R5VA 2ED9A 3EO0A 1NLBH 3RWDA 2Y25A 4ODSH 5I19L 3IFPA 1NBYB 4Q4EA 3UYOD 2H8PA 4OAWA 3BFOA 4GKZA 3S37X 4NGHH 3GMMA 3DX8A 1KJ2A 1ZHNB 3OG4B 1KJVA 3PGCB 4ZW3A 4IMLA 5ESAB 5LUMA 1E9PA 4P3CL 2WQ8A 4G5ZL 2IFFL 3EOAB 2X2IA 3IFNH 1A6UL 1BVKA 1WGVA 2YMXH 1KWKA 5D1QC 4JQXA 1R6VA 1XGYL 4YIQA 1HSBA 3K2UL 1TCRA 1TLMA 5AW4B 1X4ZA 5AVWB 5E03A 1U8QA 1DN2A 2UXTA 4YHPB 2OMNA 2OA9A 3L7FB 4HJIA 4XXCC 5C0ND 4OY9A 1I4FA 3FQWB 1CIUA 4U1HA 2J4WL 4X4XB 4FQLH 3I50L 1MCOL 5IVXE 3M1BB 3RILA 1CGSH 2KL6A 4RX4D 4Q7DA 2HYMA 4F20A 2E7CA 3MRNB 3RWJA 5LAPA 4YDLB 2X70B 2BIQA 3TBVA 4PJXE 1TUPA 1CGVA 4OJAA 2OJ1A 2OMZB 5HYEA 3UYPA 4ZUSB 4HULB 2NYYD 3F7RA 3HRZB 2KPWA 4XR8C 5C6TH 2CJUH 4QT5A 1U95B 3MUUA 2W59A 5HDBF 1TMCB 2P1YA 5DJXA 4XVTH 5AWNH 4EUPH 2O93L 3MUGB 2IH3B 3KLSA 3P9WB 3MO1B 4M6ML 2Z91B 1QR1B 3QW9A 4YDNA 1C5CL 2X3CA 3MCKB 3VYPA 1F4XL 4G6ML 5DHYB 2AXJA 1CE1L 3UG4A 3V5DA 2NY1D 3WO4C 1M56B 1SDDB 5E8DH 1XF3B 4DUXA 2KC0A 2DRUA 1BJ8A 1ORSA 1UC6A 3F5WB 4D9LL 4DGIH 2NT1A 3KWUA 1EJOL 4XPTL 5EH1A 2ZF8A 2ZOUA 5DYOB 2COVD 2W92A 3MTRA 1A66A 4LHUD 4YE4H 3VSUA 2FHFA 4CU7A 2B08A 2F5BL 2XBDA 2WPGA 1VERA 3ESVF 4YDIH 3RNKA 2VN4A 1U0QA 2F53D 2AXHA 2NY5L 4OGYL 4JQVA 4XPFL 4A6YL 4HHWA 3ZDXE 3OXSA 3IU4L 3W5NA 2WXPA 4JHVA 3Q5OA 5CXPA 3Q5YA 3B56A 3MHZA 3NA9H 3KBHE 5DQJB 4ADGA 3DSNA 2VABA 4J6IA 4N9GA 3P0VL 5GIRB 1Z66A 3QQ9D 3PCYA 1UEMA 4HWUA 4Q6YA 4DP2X 1BVZA 5C6PB 5AUMA 1RH8A 4PLOB 3MBEC 3RL1B 4IBYA 4L1LA 2WSKA 4HJ1A 5IROD 3TT1H 2L7QA 4FN0A 3QIBD 2J20A 1HKLL 2F53B 4GLRI 6FABL 1KB9K 2QSVA 5FCUH 3MDJA 5IJVB 3CCHB 2BHFA 4P57A 4KK5D 5FOBB 1R3IL 1PG7H 3IXTB 3WN5B 1INDL 2HN7B 3PWVA 3ENEA 1J1PL 1PX8A 4M6OH 4FERA 3G04B 3QUXD 4G8GE 4ZXBA 5G4NA 3L17A 1R0AL 3RIFK 3VXSA 5J13B 1SJEA 4GS7B 4JPVL 4K94C 2XKNA 4Y4KA 5EF3A 2BNRA 1WBZA 4ZTPH 2WQRA 5CP7A 1VADB 4WGVB 4JPIA 2Z1KA 5CEZH 3BKYL 4I9XA 1PJ9A 3NABH 5ACZA 5ANMA 3K0WA 4OZFH 3QCUH 4HJUA 3KYNB 1JNNL 3WE6A 1OCRB 1VDGA 2EH7H 4FQHA 5F3HA 1MIEH 1YAZA 2VT0A 3FFCB 2OFQA 4CGTA 4ELKA 4ZMZA 3N41B 1LEIA 3SYCA 4MTMA 4ZI8A 3R4RA 5HVWA 1SEQH 2EDNA 2XV6B 5D70L 4TSCL 1TNMA 3ROLB 4ZUSA 1WGOA 3O6FB 4FG6C 4PTTA 3K6IA 1IFRA 2JI2A 2VM4A 4O00A 4A37A 2ATPA 3MRQB 2ZX6A 3TH4T 4QTHB 5CR8A 1SF3A 4MS8C 1TZOA 3W0WD 3CN3A 2BY3A 4CMHB 4U1KB 1XIWB 4AKQA 2Y4SA 3NP4A 4W9ZA 5D72L 1FFOB 1HOCB 1XTMA 3AU1A 4OZGA 5AYUH 1VCBC 3HG1D 1KENL 5EUKA 1AZCA 2WVTA 1S3KH 3LXUX 1IEBA 1PAZA 1N4XL 4M6NH 2XWCA 3NIDB 3CXDH 4ZMYA 2QQLL 4WWOA 2B9AA 5DD0L 3ARFC 2VXSL 3HNSH 3DV6B 4X5WB 2LU7A 2A6KB 4MWFB 1OZTG 2J8HA 3LB6D 2C1PB 2WLIA 1DUZA 2I60H 2ENSA 1KIQB 5KJRL 4YXLH 5E1QA 4RWYL 3ESNA 3MV7E 4PG9B 1PJWA 4AGQA 1I1YB 1AXSA 3NN8B 4PRPB 3I9GL 5AZ2H 1Z2KA 1K6QH 1FNLA 1P4BL 1U8LA 2OR8A 3FFOA 5ICUA 3D1MC 3HR6A 3A4FA 4GIAA 4OI8A 2MIZA 2OCFD 2O5ZH 4YK4C 1RZJC 2J12B 3N44F 3UJJH 2VLRB 1AE6L 1D3CA 3STZB 4YUEH 4HJ0D 2AEWA 2NMSA 2LVCA 4CSPA 3QRGL 3WBDA 2XZZA 1AKJA 2ODIA 2UWEB 4JL2A 4YDVB 3ZW3A 4L8BA 2IMNA 2XWJA 4FQHB 3WY3A 2JKTM 4JFDE 5LHDA 4ZPTB 3DETC 2GJ6A 5ID1B 5I15L 1H0DB 2FRGP 2BC4A 3Q1SH 5EOCH 4N3TA 4UQDA 4R90L 3JV4B 1LLAA 2RFXB 2CIIA 4C56A 5ADOL 1EAQA 3VFRB 4PJCA 2R69H 2IEPA 3D69A 3APCA 1JFQL 4MGXA 4U05A 4Q2ZB 1JV2B 5EORH 4MJ6B 4OZHF 2WQAA 4RGNB 5HTSA 1U8OA 1LE5B 1TFHA 3TVMB 3CFBB 1JIBA 1MRCH 4XCEA 2YUVA 4X4MA 1SJEB 5DVMA 3UTZA 1WWWX 1OE2A 2FO4B 5IVZB 2GBVA 3ARDC 2YXWA 1NWPA 3BDBA 4NRYB 3CFJA 5FS5A 5AZEH 4P2RD 3PWJB 3V0DA 3B2UC 4GEIA 3ZT5A 4DH2A 1IGTB 1JNLH 3LB6C 3FQNA 4TVUA 5AW8B 4AE0A 1NDTA 5AKTA 4B6ZA 1AIFB 4GKSB 2VXQL 1TJGH 3QJOA 4DN4L 4YSCA 3VXRE 4DQOL 2YAOA 5E9DA 3MZTA 5H4YA 3IMRA 3MLYL 4WUUD 5HHPA 2H1LM 1E4XI 1FO0L 4J3OH 1I3UA 4XP5L 2CO2A 3GMPB 3W37A 3CVIH 4U1NB 3M46A 3GSUA 4DP9X 2F2HA 1KCSH 3VI3A 4PRIB 1EZVY 2GTWA 1MUJA 3H6JA 5BRPA 4NBZB 1IAKA 1OT4A 2EXSA 5KN5B 4LF3A 6PCYA 2EXYD 3F00A 3H7BA 4HS8H 4X6FA 3GZKA 3AZUA 4KNUA 4M56A 4Y5XB 3MODL 5DD1L 2UWEA 1QRND 2ENPA 4WK0B 4HJ0C 1N9PA 1GOGA 2L04A 3IDYB 4D0BA 5BW7A 3DX8B 4KK8D 4UNUA 1DE4A 3L4TA 3NCYP 2EO9A 2QGEA 3ARSA 3VDCA 4X6CF 5K59E 2BPBA 4APQD 5DVOA 4NNXA 5I8KL 2UXGA 1FNSH 4NKIL 3BUPA 4ANWA 4M6OL 3II1A 1ZANL 5ICYA 5L8KB 4Y8DC 1INDH 2XXMB 4J5VA 3DYPA 3ZHDA 1R3IH 2OMTA 4WDIB 5E6ZA 3IMVA 1QI5A 1MAML 4OLVH 2FIKA 4GXUM 5FO7A 3GSNA 3BXNA 2FWSA 1IC1A 3QAZB 3VXQB 5TE6H 4ZZKA 2VXSH 4KI5E 3APNA 3LY6A 1SYVA 1VZHA 2QQLH 1HINH 2Z93A 2ERJB 3UP1A 4MD4B 4ZTOH 3G6AA 4S0SD 1KDIA 2YPKB 4MS8D 5CCJA 1S5IH 1PLBA 2R0WH 4XAKD 4HDIA 2EABA 1A3LH 2VC2L 4OGAC 3U0WH 1I1AC 4MXVE 1OGAB 1Q9WB 2WBJB 4EZLA 4MBOA 3DLQR 3SDAC 5D70H 4IIQA 2H4EA 2P3YA 4Z78B 1AH1A 4LKCA 3UOAB 3EOYG 3FRPG 4OT1H 2Y5TA 2D7OA 1NINA 3MJGX 4XE0A 2Z35A 5GGTL 4KMQA 2HKFL 4U6YB 2Y69B 1KMGA 2D8KA 1G9ML 1P2CA 1QNZH 3D06A 3FO0L 1A6PA 2OL3L 2NY6B 4RGOH 3HMWH 1EO8L 2IH8A 4G3YL 3UERA 2Y3NA 4XXCA 3CVBA 4L8SC 1N6QL 1HQ4B 2PTTA 4JUSA 2ZYIA 4ORGB 5IW1A 5HHOB 1MVUA 3THML 1WE5A 4X7DC 1UD5A 5F1OB 4X4ME 4DOHE 1Q0XH 1YDPA 3QUXB 1LDSA 4JQXC 3CFUA 3UACA 1RKRA 1M3IA 2BFGA 5JIDA 1JXGA 4E9QA 3Q8AA 4D7BA 5IT2H 5E2UH 2CGRH 3IDJA 4QNPE 2D0FA 3HPLB 4U1LB 2G3ZA 1SDYA 1YEEL 2V2TB 4PRNB 4YHLH 2HZHA 4ANUA 5DMGC 4ZS7H 4KFZC 1IIIA 2HTKC 2ATKA 4ZODA 4MCNA 1X5XA 1KTLA 2XG5A 3QC6X 1RUKH 4N2KA 2NCMA 4D3CL 5BZDA 5LXGH 4MD4A 1ZSHA 3I75A 1A7NH 1B4JH 3LHPL 1Y18A 1KULA 1MFBL 3ROLA 3SOBL 4YMPA 1KCVH 4RFNC 5D71H 3RP1A 4PY7B 3V6BR 4XNUH 1WFMA 3BP7B 2VGLM 2YOAA 3TZVB 5LDUA 3QUXA 4ZXBD 3FTSA 1E7UA 2IH1A 4GRLD 2CLRA 4ZOCA 2YD2A 1Q94B 5IEKB 2VZ3A 1UH4A 4FQQB 4NQCA 3WU1A 5ABAA 3AB0B 2WJ5A 3I85A 1NGPH 4HSAC 1EHAA 3C6LA 4YDLC 4NPJA 3TBYB 3UTTB 4CADB 3V95A 4L3ED 1OLZA 2FO1A 1P9MC 4BRJA 3AMLA 4O58H 2FLRT 3IJEB 1EEYB 1AGFB 4JO3L 3T1FB 4WI6A 3WEOA 4JGJA 4A2MA 3ISYA 4OM0L 4XXDB 2AQRA 1GYWA 3ME0A 4DEPB 1PDKA 1QSFD 1FFTB 3N1GC 3ZQWA 4I0KA 4P0DA 1PZ5B 2BO0A 2KI6A 4YHZH 4DSYA 2YMOA 2GIXA 3UAAA 1BM3L 3MCYA 4M6MH 5JO5B 3RRQA 1IT9L 3TO4D 5DGRA 2K4AA 1KFAH 1ND0B 3BH9A 1BXXA 2LTQB 4JN2A 1DHKA 3LH2L 3RIAK 3OAYH 4FZEH 5A2BA 4NQCD 2I9TB 3V9EA 3ZE1F 1AIZA 4OZGB 5INDA 4DW2L 1BZEA 3OKEB 3IAQA 5FYLL 3VXMA 5JHDD 3D48R 5MENB 3GO1L 2FJGA 2VDQL 5K9KB 4WI0A 2HX8A 3M1BA 1EX0A 4FQIL 4PJDA 2IANA 1GR7A 4Y89A 3MLSH 5E1HB 3UTQB 4WEUD 3TF4A 3GSWB 5FGBC 2JJWA 2D9QB 1MQKH 4BFEA 1OALA 3H9YA 4XP9H 3SY6A 2WAQA 4AJYV 1I9RL 2FBOJ 4MVBD 2ZX8A 3FSVA 2JKSA 1QBML 1NBVH 1U8IA 3G5YB 4KUCD 2VDOH 3H0TB 4JFWA 2GBUA 3FUKA 1VENA 1HHJB 1DANT 5B3SB 4DP0X 2C9AA 3ARQA 3BFQG 5IW1B 5EBLA 3DHMA 4P4RA 3U2JA 1PQZA 4M02A 4BCZA 1DUYB 5BRZB 4POYA 1PCSA 3LKOB 5MP6L 3CE1A 5TE7L 1QD0A 3GHBH 4MAYD 4PJIE 4UT9A 3GI9L 5AOZA 2FLMA 3NIFB 3LEXB 5AENA 5EDSA 3D4YA 2ADGB 1E3ZA 4TOYL 5KUMA 3PP4L 1M7DB 4TRPH 3RPBA 4Z9KB 2B9BA 2G3XA 4IQHA 4KFMA 5ISZD 3VAEA 2XA8L 3SDXA 2Y3AA 5FHAL 1TEYA 4TL4A 2ICCA 2BP8A 1JZFA 2QVIA 3D34A 5CJBA 4BK5C 2ZZUT 5E0FA 1XEDA 5ERWA 1MW1A 3U6XS 5KYYB 4B60A 3ULUE 3BH4A 1WBXB 2KZWA 3IFLL 2RH0A 2Z31A 3HFFA 5TQ2H 3ES6B 2DTML 4H0HB 3EO9L 1K85A 1XXDC 1J1XL 2DAVA 4DPAX 3L2MA 5DJ8A 5J3HD 4HIXL 2ZIDA 3P2TA 1UA6H 4XVUD 1B88A 4TTDC 3PLYA 1T04B 1NDGB 3QCTH 1AZBA 3H56A 2AMUA 1W0VB 2X10A 4FNSA 2A2QT 1L5GB 5C0IA 2WLHA 1CGWA 1ZV5A 1TYEB 1I7UA 5ETUA 4NERA 2HG5B 5L8JB 2DL9A 2PPEA 5KBDA 3G5WA 3PP3K 3W2DL 1S7TA 2VR6A 1G84A 2R9HD 2CO6A 3ZJAA 4PCYA 2FX9L 5C70A 3ZL4L 3WEXA 5GZNA 1PQZB 4WWPA 2Y6TE 3QDHA 4C83A 4V1DE 1CCZA 2CHWA 1O6SA 4LCIL 2BVTA 4NO5B 2GCYA 2JCCA 1YMMB 2VLJE 4BUQA 4Z77B 3H9SE 4G8EA 2WJ7A 5D5MF 5I16A 2W95A 3CFNA 4OCYL 1OF0A 3D0LA 1L5GA 1CBJA 2Y24A 3QI9C 2UY7B 4O4YH 5DSCB 4H20H 3F7PC 4HEME 1QFPA 5SX4H 4LVNC 3RWGA 2ZD0A 4A04A 2VR3A 5I8CA 3EYSL 1MFCL 4HK0A 5I74B 3TASA 4HJJL 1ZPUA 3EYOB 5IBTH 1XD0A 4DGYH 2UVFA 3C75A 1UXSB 4ABQA 3RY6A 1C08A 4YSAA 2L0DA 4PP1D 4AGLA 5C2UB 1RJYB 4OCWH 5I1JH 1RVFH 5KYUB 2VDQH 3IGAB 2YC1B 1GC1L 3GXPA 4LOUD 3FJTA 2WCPA 1UA6L 4TF4A 3CN0A 3TCXA 3NK4A 1T2XA 4XPAL 1F13A 5AW9B 4JNXA 3EO9H 5D7LE 4WSGA 1A7RH 1F3DJ 2ID5A 4PSPA 1CTNA 4P5KA 2XZAH 4AGOA 4F7PB 5BVPH 1UATA 3B2XA 2PTTB 4QRTB 3C60B 3UPAA 3L1GA 3Q7JA 2ZP9A 3N5AA 1OCWH 1NMAL 2OMUB 3VFRA 4AK1A 2JCWA 3WFCH 5LG1A 4L4VE 5JOFA 4JFFE 1S7TB 3C6LB 4Q56A 2DIJA 5DJDB 3TT3L 1CBVL 1FVEA 1TCMA 4FS0A 1Q9OA 3LKQA 3S9DB 1MLBB 4AZUA 2NYKA 4GFXA 5HDQH 2MNWA 1UD8A 3FH7A 3H3KA 3WIHL 5L7XH 2IPUK 1FNHA 2IWEA 3I6LE 4EMZA 4J7RA 2IPKA 1CD1A 1CDJA 4JO2L 4P5TD 3OLEA 4UV4L 3QIWD 2HCZX 2WZ5A 5MI0C 3VDBA 2VERN 2O72A 2R56H 2YSSA 3C8DA 3HAEA 1RPQA 5I8EB 1U33A 4ZUTA 4OZGF 3MUHL 1I9IH 3C60C 5KOMC 4KK9D 4NWUL 4G7VH 4R96A 1KEGH 2PTVA 3PGFL 4JY5H 3D85A 3MGOA 1FL6B 3PQYD 1KDJA 1VADA 5HGDB 1ZVSB 5HHMD 4ODWB 1GGBL 2QTVA 2BOCB 1N68A 2ZONA 3AWGA 4HC1L 2BIOA 4ZX3A 4QRPD 4G6KL 2AJYL 4PBWD 1NFDF 1XXFC 1SEBA 2GJZB 3WFZA 2QT6A 4PJXF 1QAWA 2APSA 2VLKA 5T3ZL 3DWTA 1U58A 3FCTA 2X7LB 4L29B 4C59B 3AB0C 4PY8J 5ACLA 3HUJE 1IE5A 3RUGB 5HDBE 5E5RB 1SLUA 4KPHH 3VTMA 1IKNC 4TVPH 2DWEB 3LKSB 4DVBA 1CICD 5DJ6A 1CLYL 2QEJA 1CGUA 2PXYC 4FQ1H 4GT0A 3LH2H 3QFJD 1LXMA 3HI1B 1FYTA 1PD1A 4P46B 3QI9B 3W0WE 1XGTB 4Z7VA 2FD6H 3D85D 4Z7WB 5BW7C 3ARVA 4WK4B 2XWZA 3P73B 5DHVB 2VNCA 4G1EA 1CDHA 8CGTA 4N5ED 3DOHA 1A4KA 4QD2E 5TPWH 2LOEA 5J1SC 3MBWB 1X44A 1XR9A 4ZMAT 4KXZI 1UOLA 3FSWA 2NZ1A 4LSDA 1U2CA 4YJZL 3SDCB 4U7SA 5I66B 3CIQA 1TPXB 1OGSA 3LYRA 4IOSA 4KKAC 4LASH 3IFLH 3MYJB 4NLAA 1IBZA 4OT1L 3GSWA 4G83A 4WGKA 3JBG7 5DJZB 3QUYD 4KKCC 4N2BA 1ZEAL 1SMOA 1KJ2B 1SXAA 1ZHNA 2EDFA 2NXZB 3PGCA 2K0RA 4YXHL 4M7KH 4NRXA 4JRWA 5T33L 4RVBA 2CK0L 1IM9D 1UM5H 4ETYA 1SJHA 4LCYA 3CZKA 1M71B 4I3SH 2G2RB 2WGNB 3PL6A 1OXYA 4JK0D 5E56A 2I07B 4ZS6D 3MV9B 2ZOOA 4ALAH 3QDGD 2V7NA 4IOFC 2NY1B 32C2B 1BQRA 4UOW1 3H9HB 4HQQL 5D2NA 4DGWC 5D9SA 2WGXA 4XMLL 2RHEA 2V3EA 3B2PA 2YBGA 4LL4A 3CDCA 1T2JA 4UILL 4A66A 1BVNP 3N06B 1DO5A 1YEEH 4RH4A 5C8JB 4R7DB 4HG4J 2IAND 3OR7B 3ZDWA 1G4RA 3LIZL 1QBBA 4E9LA 5A40E 5E2UL 1TSHA 2IPTH 5B39G 1G94A 3QHFH 4KWUA 3PE9A 5HYSB 3ECWA 3SYPA 1WA1X 2ZOKA 4NUQA 3EOTH 1W0YT 2XJKA 3MCLL 1ZIBA 2WW8A 1RMFL 2BSED 3T3PE 2EYRB 3C2AH 5CD5C 1I1FB 1KGUA 1TZIB 1Y1UA 3ETBF 1U8KA 2MTPA 4NOBA 5AVSB 3CXHJ 4OFVA 3N1MC 3NQIA 2ATAA 25C8L 4FP8H 4XBPA 4Y88A 1PW3A 3TWCH 1NAMB 4QCIB 3IDGA 1KTKE 5DRNB 5B1KA 1N0XH 3HMWL 3BUDA 4LLQB 3TCLA 4CVWA 1KJMA 1CGXA 1I8LA 1OCCB 3LKNA 4G7YH 2X6AA 1PCXA 5CBEB 2R7EB 1AY1L 1OSEA 3QAZC 2HKFH 2GBAA 4PVLA 1F8TL 3DARA 3RWFB 3AADB 1CS6A 1XO8A 2QQNL 1GKEA 3MJ9L 2ATKB 3OC8A 3A47A 5H94A 4ZMLA 3GLAA 4GG6B 2NY4D 1Z5HA 4O2EA 5KS9A 4CVUA 2P80D 5I0ZA 2Z8SA 4OFDA 4HBQA 5TFSL 1W72L 4DUVA 1K8DB 1JFHA 2EVGA 2TRYA 4BHUI 4AH2B 3ARGC 5B1AB 4L3FA 1LNUB 3ABGA 3D4CA 3ARFA 4W9FC 1KG0A 1UJ3A 4NN5C 3CC5A 2DQJH 4WZ9A 3MUGA 1XZ0A 4JHAH 3UBXA 5IVZA 1MEXH 4GQZA 4ZK8A 4BZ1A 2OCCB 1A7OH 2E7HA 3AXLB 3GBMH 1XAKA 5HI3C 4X5QA 1IQDB 4MQXC 2VN7A 3F58H 1A6VL 2CM6A 5E99L 43C9A 4K23L 2WSDA 2J6WA 1VLXA 1LP9E 4QO1B 4MJHA 5CM1A 3GZOA 1GTFA 3EJPA 2IDTA 3FHQA 4WSKA 2PWGA 3MJ7A 1AOZA 3ARDA 2ERJC 1A4JA 3QEQB 2OTWA 1OT2A 1QSEA 4BH7B 4P2OA 3SY0B 3VXRA 2WLJA 3Q2LA 3RWGB 4R0LB 1HHGB 1F0LA 1R3LA 3D39E 3MA7A 3HHRB 3QIBA 5EOCJ 3MV7D 4K5PA 4K94L 4BUHA 3MLRL 3T0BA 3UAJA 1IX2A 2WVVB 3D39D 3V8OA 2XTLA 1BZQK 1C7TA 2BRRL 5GRWA 5DJ0B 3RFRA 1KELL 2WLKA 1FO0A 4LF3B 1U3HB 4LL1A 1F6AA 4F8QA 4WNQA 2VW4A 5IF0B 5DLML 1EPFA 5DZLA 2GSGA 2WBWB 3NJLA 3FHAA 4Y4KC 4YX2L 3RGHA 5CLYA 3VFTA 5HHNB 4NDMB 2F15A 3R06A 5T1KD 1KWGA 3RFZA 5LNGA 1FVDA 2B1AH 1EUUA 1F5WA 1HEZA 5F9JA 3FKUS 3IDNB 4JG0H 3UZEA 5GGQL 4ZZFA 4XRCB 2G30A 3SBQA 3G5YA 4IIQB 3SO3B 4ZMVA 3EG9B 2QZQA 4R83A 1JUFA 4OCLC 4PRHB 5TGBA 2DICA 4ZNEE 4XI5C 5F1NA 1T1XA 3DYOA 5D4JA 4WSJA 4RAVB 1XF5A 4J2XA 1H5BC 3AREA 3V4UH 5SWZA 3PAZA 3VXUB 1UQSA 2GJJA 4MMZA 5HHQB 1TJGL 2XBZA 3BD4A 1T1WA 2HX9A 4EO5A 1FZKA 3MRHA 1L9PA 4QO1A 3CFDB 1TVDA 3VM7A 2NZ9D 3GPSA 4NO3A 5KVDL 2NY3D 3LS5H 1BA9A 1S6NA 3RGVD 1EFXD 1JK8A 3ECBA 5FW8A 3ZKMC 3GDCA 2IDFA 2IDSA 3MROA 3POCA 1MCRA 5J7CC 1NCOA 2YAHA 2CHDA 2DIEA 5AW2B 2VLJB 4I89A 4KGLA 4YK4B 2A9BA 4QXVA 3QWQB 2L7UA 2Z31D 4HIEB 1KC5H 4KXDA 2VR5A 5GGQH 2P48B 2WNGA 3KLHD 5FXCH 3E8UL 1IE4A 1KTRL 4YSQA 1P5UB 3RDTB 4KDWA 1Q9OB 2WXIA 4YSUA 2ALAA 1MWAA 1MRFL 3NPSC 1MIMH 3BAJA 4MDIB 2Y07H 3SDDB 4YX2H 1I3RB 1BD2D 4JHZA 1JNJA 2V5MA 3FQ4A 1X5AA 3QXDA 2UUDH 3D18A 3DOIA 1NH6A 3KPRB 1ZANH 3KWWB 3P2DA 4ESKA 3MBXH 3W5MA 1LE9A 3DMMD 3ECQA 4YUEL 2WLIB 2AJUL 4XAWL 3O2VH 5JORB 3BPNC 5GRVK 1F00I 1R0AH 5D5ME 5J6GB 3MRRB 5AVXB 1PKOA 3HG5A 1G6RA 2WN3A 1X5LA 1E4HA 2OYPA 4OF6A 3KL3A 3LIZH 1DLFL 4NSKB 3HRPA 4WO4B 1ZWIA 2MTAA 3ESMA 3GSOA 1IBGL 2IDQA 4PG2A 3QISA 3OJMB 3KLLA 1WBXA 3WIIH 2OZ4A 3VCLB 2YD7A 3EDKA 3AREB 4R7DA 3G6JA 4NIYE 3WXVH 5EEVA 4MQXD 3BEWA 1I8AA 4M8QB 5C09D 4MD0B 2E7LC 3T8MA 2WTOA 3FQRB 3B9KC 4JCWA 4AIZB 1OPGL 2DD8L 3QEGH 2CHNA 1TLKA 3FYEB 5D72H 5LO7A 2OTPA 2OXGA 5IHHA 3QK0A 2A0LC 4R2GD 4JRYA 5JTWA 4E42A 1GZQA 5EU5A 3CFTA 4RMRA 1JDDA 3D05A 4PJ8C 2XIDA 3B7YA 1R3KB 1QSZA 4AQEA 3PP3H 4NN5B 3P9LA 3QXVA 1CQKA 1T83A 4GSDH 4V1DD 2HT4D 4YDIL 3K72B 4DN4H 2JIXB 1A9BA 3LKRA 4X98A 2Y7LA 3PHQB 3NRPA 4YE4L 3V5DB 4H1LB 3QQDA 3R8QA 4HXAH 4CJ1A 3MUZ1 4HWZA 3T0EA 4J8QA 4WU7A 1C1EL 3WMQA 2NX5A 1U8PA 1WEJL 1YN7B 4NO2A 5ITFB 4DKDC 4Y1AA 2GI7A 4PJ8D 2JELH 3HAEH 4NYLA 1JVKA 5EPMA 5ESQB 1ADQH 1JNHB 4R2GB 3MLUH 3SE3C 3C6SA 3D5OF 4P4KD 3TBSA 3KPOA 1UB6A 1AHWC 1TOXA 2WXGA 5F97E 2B77A 4Y7OC 4KU1A 3STBA 3A21A 4QYAA 5AWNL 4F24A 4J4PC 4KRPC 2WTRA 5HPMB 1JERA 3MCLH 3DIDA 4U1NA 3B5HA 1RK0B 2GITB 3E6HB 3W39A 1J05A 4BK4A 2Q6WB 5IEHA 4X7FC 4XX1E 3ZX1A 1CXHA 1J18A 2V7HA 2B20A 1O5DT 2ITDB 4PRDA 2HWZH 4Q6IA 5IB5B 5CGYC 1AD0A 1ADQL 2F54D 2Z0BA 3QA3A 3X3FH 2KLTA 1F4HA 3E6FA 4U1JA 3VXSE 5JPNB 4K3GA 3OB8A 1MREL 3QARA 1DBJL 3F6JA 1YNLL 3GMQB 3RQ3A 4UMSA 2E27H 3IDMA 3WEAA 1H6UA 1B4RA 2YQ3A 5DRXA 2XX1A 4FJZA 4MKMA 4JY5L 1FL3A 1U2YA 4G6AC 3VQMA 3U4AA 4FRWA 4XO9A 4XMUA 3Q6GH 2QPDB 3ILQD 4BV1A 2XKNB 2VDML 4R8WL 4Z7WF 3SDXF 4KKCD 3E8VA 1OM3H 3MV8B 3RZCD 2A9NL 3E3QC 3EO0B 3RWDB 3QDJE 3P4NA 3VG0L 2BIHA 4JREB 4QJ5B 4Z8FH 4NQEE 3BD3A 3GWJA 3H3PH 3MJWA 3NPZB 2EE9A 1S2EA 1ZT4B 5FCSH 1P53A 3HE6A 4WW2F 4YXKL 2Y2WA 2N1TE 1DVFB 5D6CB 2ZKWA 3IJHA 2PCPB 2CUAA 3KDMB 5D5MA 2K1MA 5E8DL 5EU3B 3QULB 4YHNA 2Q8BH 5IGXH 5IQ7H 1NFDB 2X4UB 4UINH 1G7JA 4AYID 3WNIA 2VDKH 3CMGA 3BSZH 4WEBH 3N0PB 3VYNA 2OMXB 4N2DA 3PJNA 4KK6D 2VO8A 3RJDA 3U7WL 3VXME 1XF5B 4ES8A 3VW3L 4HLEA 1BFOA 1Z9SA 4QHLB 3VFSA 3J27A 5CWSB 2R23A 1R1CA 3NTCH 5E5UB 5EU6A 2KPNA 3FQNB 4LGPB 4EUPB 4JM2B 5I5RA 1CLYH 4JW3A 1RJLB 4NZUH 4L2YA 3IMUA 3TURA 2WXMA 3H9SD 3OMIB 1KN4L 1NA8A 2YBRB 1UH2A 4K5LA 1OP5K 3FT4B 1UWXH 2Y2YA 3UC0H 2HRLA 2BVPB 4JFPA 1NJ9B 1WRFA 4XMVA 5KVGH 2EILB 1G6RL 3QZMA 3RFZB 2DQTL 4YDMA 4GLRH 1QSEE 1K4DA 3T0DA 1HCYA 1KXVA 2J4WH 3S37H 1MRFH 1VKXA 4Z7AA 5MEQB 1JPFB 3S3JA 3QIUC 5IW3A 3EYOA 3EYSH 2VKXA 2IPTL 4N6RB 1PNCA 1AMXA 4Y2DC 3QDGA 1GTNA 3B7TA 1EZUA 3MV11 3DX6A 1I82A 4LLDA 4NP4L 4MNGE 3ULUD 1KN2H 1MFEH 3T4YA 1Q94A 2XXFA 2Z91A 4WV1A 1QR1A 3X13B 2B3IA 1QABA 2J6EL 2W91A 4XOCA 5DZOA 1FL5B 2GJ6D 4NQCB 5GSRA 1URIA 3OZLA 2DQFA 4HCIA 3K8KA 4HFWB 5I1GL 2OV0A 4ZO9A 4ZUWA 4JKKA 1QG3A 2NNXA 2V8LA 3CFMA 1BDYA 4HQQH 4YDVA 1QUPA 2G60L 2XKUA 4GSQA 5I1HL 3AACA 3FRUB 1AR1C 3NSDA 5MEPA 5HDQL 1MHHB 1XMEB 2H7WA 1S9WA 2NNAA 4M61A 5D6DC 1CBVH 4HJEA 2EDMA 4JZJC 2V3FA 3SKUD 4CGUB 1X5FA 1DO6A 4N25A 4LQFL 3CPLA 2H45A 4BIKA 3WIHA 3DOSA 3IRZA 4XXWC 2Z7WA 1RL1A 3FFDB 5DS2A 5FM4A 4MJIA 1OM9A 1EBPA 1T1YB 2AI0H 2AXGA 1NGXB 1BJ1J 2X28A 4JM2A 3FU6A 3MV9A 4UQ2A 1UADC 1PGRB 2O5YH 4PEEA 3SGDH 1A5FH 4IMLB 4ODTL 1T6VN 1T83C 2X4PA 4HF5H 4KJWD 2VUKA 5IHLB 2H2PD 3BUQA 3X2QB 4LCWA 2BS71 4EQ2A 1RJZB 2WOBA 3U4BH 1NANI 3JSSA 1ASOA 4U3SB 3LN4B 4I77L 4W4OA 3NACL 3KDMA 4J3OC 1E9QB 2RBLA 3FYIB 3BZEB 2CJUL 3AS2A 1CU4L 2HXAA 2BRRH 2QL1A 4F7CA 1QVOB 1ACZA 4HIEA 5FGRA 5IJDC 1IVTA 2IXQA 2ZSVA 4GRWF 3C5SB 3TNMB 4P48A 1YNTA 4ENED 1CR9H 3WKPA 1AKJD 1TKWA 3QJZA 1SPDA 4Y1AB 3AQYA 3EYUL 1BFVH 3TF7C 4Z6AT 1D7FA 3PIQA 2E7BA 4FXGC 5ANMB 3N42F 3REWA 1JYXA 1KYOK 4ODHL 4HG4K 1UHVA 3KYNA 5KVFH 5FGCB 3MRDB 3ZUCA 3K6NA 4ES9A 2EEAA 4G6FB 4P46A 1XQ4A 3FHEA 2X1PA 4NP4H 1EEQA 1HOEA 1CI3M 3TEWA 1BWMA 4JM4H 4MMXC 4PJHB 4B9YA 4M43L 3JWOC 2EC9T 3JT2A 4PG9A 5F9AC 1K4DB 5EU5B 3VFVA 4KITB 1E8YA 5CR1A 4B97A 3EJSA 4N0YH 1S7XA 4GUCA 4P5RA 2BJMH 2AJXL 2GJZA 3K1KC 3PREA 1DCLA 3OZKA 1KG0B 4MJIE 2J72A 3IJ8A 4RMBA 4GB9A 4UDUB 3LZFH 1KN4H 2GYSA 4LEEA 3UJTL 3V0VB 2PWFA 5B8CB 4OJDH 2ZQKA 1FBIL 1FYTE 5H37G 5FX3A 4BUGA 3KXFD 4RDBA 5F89B 3HZMA 2VJ0A 1L6PA 1OLLA 4KJQD 4XZ4A 5F9WC 5FYJH 3H4FA 3QEHB 4GW1A 2YQ2A 1MJ8L 5EOQH 2W0PA 1UZ6E 2LFGA 1CFQB 2PYED 3ERXA 3KYAA 4L4TA 3QUMH 5IGXL 5I75C 5IQ7L 1G1CA 1W80A 5SV4A 1MY5A 2UWEE 1F4WH 2F8XC 3MJ9A 1NGZB 4NT6A 2R0KH 4PV9A 2DOCA 5L6YH 3SKMA 2UVEA 1JWMB 2C7FA 3UJTH 5DJAB 3QQDB 4M7LL 1DLHB 4Y2LA 1V3JA 1PAMA 1QW9A 4O58L 3JWNC 4UTAA 4MMXA 1JAEA 2BNQA 3BP4B 3MLTB 5DS1A 4NHCH 4UZUA 2UXVA 4N8CL 5BJTB 1KYAA 4WFGD 5TE7H 1KBKA 1M7IB 1Q72L 2KZ1B 4ZXBB 1EANA 4GQQA 1ZE3H 3QEQE 2XTJD 2R0LH 1BLNB 3WTUA 2NXZD 3ROOB 1A3QA 4GAAA 4YAQB 4Y5YA 5ANHA 4WFED 1G1YA 2IH1B 3EJQA 1G9EA 3WGVB 2PPFA 4UZSA 2AXWA 4PR5B 3NJKA 4EUPA 2XY1A 1Q1PA 2DWYA 32C2A 4YFLF 4A39A 3D0VB 1W0WB 5C09B 4MCZB 1KZQA 3CHSA 3WSQH 5CSZB 1XGPB 2NY7H 1YJDH 4LIQE 4PBDA 4A7VA 9CGTA 4MNQE 3TBWA 3QORC 3GNMH 1NCDL 2F54A 4HIPA 5E6IB 4L5FH 4POUB 4HLJA 4XMKH 4UM8A 3K5SA 3CFEA 4NPKA 4NZFA 1PSKH 3FFCE 3NRFA 3E9UA 1VACA 4WU5B 3RPIB 3BQVA 3T0EE 1A14L 1M1XA 4OTXL 3FMGH 4J1UA 5ANME 1E5UI 5AOKA 4XODA 2W88A 1J0YA 2D3VA 1IB5A 5F71A 3D50A 4G43A 5I9QB 5EU4A 2BFVL 4X0KB 1I75A 4Z7UE 2VXTH 3IKCA 5HHOD 1J1XH 4JRYE 5ENWB 3BUBA 4D9QD 1P5UA 2BP0B 3GPEA 3GS0A 5LBSH 3TFKD 1N18A 1MFDL 3CHXA 1N67A 1AGFA 3POHA 4Y9CA 3ZT7A 4N2HA 4GY4A 4F7PA 2A1WL 2E7DA 4UQCA 3IDIB 2YUWA 2ESVD 2JQAA 4HC1A 4R84A 5B39B 4JZNB 1HYRC 2OI9C 3HBZA 5DK2B 4YHIB 1JCKA 1JPTH 2WBXA 2PETA 2XA8H 3GS7A 1RU9L 3OGCA 5JQIB 1GW0A 3CSYB 2VQUA 4Y1TA 1B2WH 3W38A 1QBAA 1ZLWH 1D6VH 4NKOA 3O11A 1UZ8B 4F9PA 1BZ9A 5LXVA 1JGVL 3EF7A 3CSTA 4MB4A 3P11H 4MHHG 1VB9A 2X9WA 2Q20A 3L81A 1FVCA 2MCG1 1I7ZB 4TUUA 4X0NA 3VA2C 2ZKXA 5JOPD 2EP6A 3KHOA 4X80L 4LPXA 2VXVH 2ZP8A 5DR5H 4KK9C 1QYGL 4L2LA 3PPSA 3WUWG 4AQAA 5KYWB 1EDHA 4ZUTB 4WY7H 3V0AC 2HLFC 3TYFB 3UG5A 4NO0B 5HGBA 4MX7B 4HK3J 2ZYRA 5A3IC 3O2DL 3D07A 1MWAL 4U49A 1DVYA 1UOKA 3SGEI 3EG9A 3NSCA 1E4JA 4KVNL 8PAZA 2W07B 5DJCA 1HQ4A 4G42A 4P2RE 3FQTB 4HUCA 2CLZA 3V4PL 4Z3GA 1U8MA 2DQTH 1MCBA 4PJIF 1F97A 3CHQA 3G6DL 1DL7H 1OCWL 1G5GA 3X12A 1AGEA 1PY9A 4HH9B 2CO4A 4PJGF 3WFDH 3P54A 4Y19E 2QVMA 5AOLA 1AACA 5EO0B 3FU7B 5L4JA 5F6IB 3BAIA 4Z7WE 1GSMA 3LKSA 5EO9A 3SDXE 2WTPA 5DEGA 4FAAB 3D33A 1NCCL 3AXIA 3E6FB 5DJXB 1AD9A 4TVSa 1QFWL 1HHHB 1J9QA 2IWKA 2AXFB 1KCSL 2IDUA 3FQ1A 5SWZE 1ZOXA 5HYSG 4HUXA 5HYJA 2I26N 2QMJA 4M03A 4GMSL 1TQBB 1ZHBB 1U6AH 1MFCH 2P7TA 3U0TA 5HPMA 2P5WD 3JYBA 4QTHA 1JPEA 3NAAH 3V0VA 4ZQTA 2N0MA 4RBPH 3RGVA 3HC0A 3MLZL 2XNAA 1WA0X 2OR9L 3KYMA 1U92B 1AIFA 3ARXA 3MRFB 4I48B 3IB4A 1JI2A 1MF2L 5L2KD 1T80A 1CT8B 3NSXA 3M07A 4G8IA 4Z3TA 2JLLA 1X5KA 2VKWA 3KNBA 5CJXA 4XX5A 1BZ8A 2EINB 4CKVX 2JSFA 1IC7H 4LFHG 4QF1B 4X6DA 5LWYL 1HS6A 1SQ2N 1OTUD 2A77H 4YPGA 1PLGL 4H8WL 1E50A 4WO4C 4G82A 4JFED 4JG1L 3N04A 3LN5B 2R69A 5DRZB 5T3XD 1YAIA 4QAWA 5KJ7E 5I8KH 1UACH 4ACTA 5BZZA 1SMDA 4I77H 3FN0H 4APQB 4JFFB 4LE8A 5DRNA 3TCLB 1IBFA 4JDVB 3P4LA 3WIFB 5TTRA 3G7TA 3IXAA 2XC8A 1ZA6A 2A6IB 3L3JA 2AJSL 2EE6A 5E9DD 3RAJH 1OL0A 1P4IL 1S7QA 3DHPA 1XGQB 1OPOA 4FQ2H 3O41A 4ADIA 1DQJB 4GPVA 4LLWA 4BXSV 2YQBA 4U0RB 5C0AA 1NICA 3AM8A 4O51B 4DKTA 4R3SB 4YO0B 4B27A 1IMHC 2FQDA 1CO1A 3AY2A 3C5ZC 4GSXA 3F05A 2E7MA 5EZLA 4RQQB 3IJYA 1E5ZA 3FTUA 3GM8A 2CCWA 3VFUA 3FUDA 8FABA 3SBWA 3DBXA 1NFDA 3OVUB 4I0PD 1AXTL 2CAKA 1SOQA 5C09A 2VLRD 3FOLB 3TV3L 5TJWK 5MHSD 5JA9A 1TXKA 1MCWW 2WQUA 2XVBA 4MXVF 5EU7C 2DH3A 4NPYB 3AXLA 1HJBC 1TF4A 4G8GD 4FEIA 4EF3A 1YQVL 5B1JA 5GRUL 1NEZB 2Y7QB 3C5ZA 1NL0H 2OR9H 3L3JB 3FBKA 4NEHB 4E41E 2BMKB 2G75B 1BAWA 2ITCA 4QJ3B 4R5XA 3OHXB 5I1HH 3P0GB 5E8OA 4IJ3B 4OH2A 2OCJA 5AZEL 3EOAA 2LLNA 2QSTA 4NUJA 1CFNA 2E3VA 3DX7B 4XC1H 5CF3A 2XN9B 1G6VK 5CD3B 2IAMA 4GG6A 4QF1A 1WDAA 5EBLB 1NTDA 1GGCH 1EUTA 4JCMA 1SDDA 4MASA 4Z7OF 4RZCA 3VSVA 4M8RA 2NTFB 2F5AL 1XF2B 3V9FA 3MLWL 2J25A 1OGAD 2WBJD 4LKCB 3SKMB 1BVLA 4QI3A 1RUPH 3GRWA 2XV3A 1OGAE 3C5ZB 4TM9A 2EIEA 1X5MA 5GSRB 4AYFA 3H7BB 5CJXC 4I1PA 1WQVT 4QNPF 3MSPA 4LMQE 4A7QA 4JFQB 1OSYA 4ZO7A 4PWFA 3VTAA 3I3EA 1BM7A 2UY6A 5CILH 1D2PA 4G72B 4PJ8B 5DF0A 5BVJB 5C0RH 3W9EB 4LCWB 1HT6A 4GFTB 4WEEA 3UGXA 5DDHA 3VRLF 3WFEH 4G1MA 1XH0A 3TH3T 2D03H 2YHGA 3NZ8B 3QI9A 2E74C 2H6PB 2J8UF 3JUYA 1SUJA 5TF1H 4P46D 5ELIA 1E7VA 1CVSC 3SQBA 3FQXB 4FD0A 3B34A 1AS7A 3O6FC 4XCCH 5D2LB 2X41A 2ZT9C 2LFEA 1H15A 4WY7L 1BSIA 2EIJB 4GMTL 4JHBA 5KG9B 1VEPA 1SEBB 3EJZD 1XGUA 4DTGL 5IJVA 3KPLA 5IQ9A 4NN6C 4FFWD 1KGYE 3H9ZA 4QRRA 4G9DB 3R18A 4FNUA 4YFLI 3N42B 1I7RA 4LCWE 2PO6B 4A2EA 5F7FA 5EIQA 5L0QC 3KVPA 2H8PB 4OAWB 1G7JB 1OO2A 2OMBA 3KGTA 3RZCA 3M88A 4IMKA 5F7YC 4NKMA 4TNWF 3P3RA 4DP8X 5GZND 4D0DB 5DJ2B 2YLHA 4JRXE 3ABMB 1RUAH 1NOLA 3V2AR 3ZY7A 3LOWA 4U1MA 4R6UA 5F3BA 3JTTA 2DQCH 1TZ8A 3OAYK 2ZUYA 2VUOA 3HS9A 5JW4Q 1N26A 3T0AA 2AEQL 2ZWLT 1XR9B 4HX1A 4Z77A 3WUWB 3F6LA 1YNLH 5ICXB 3UX9B 2H3XC 3NEEA 3TESA 4W9JC 4F5CA 1KIUA 5JIMA 4MA3B 2YARA 4MMZB 4OLXL 4PGZA 2VLME 4P4KA 4WNSA 5AKSA 4BK5A 4IU3A 1V7MH 1YC8A 4WCYL 1W8NA 1SN0A 3ZPDA 4FXKC 1F4XH 5I1DB 1JWSB 2QGDA 3NABL 5CP3A 4KOBA 4F9LC 1J5DA 3VMOA 3B8YA 1GGIH 4WHYG 4H1LH 4M7JH 2XV2A 2YMTA 3KJ4B 3F65A 4N2MA 5T5FH 1T6BX 4M5ZH 5CP3H 4HJSA 4A1RA 5C6TL 1AG6A 3TNNA 1MVUB 1GRWA 3FQXA 3G5XA 5EULV 1IGML 1FWXA 1DJYA 3GNML 3QIBC 4Y4HA 5HHVL 5CKGA 1U8HB 1E2WA 2VDRL 3ORJA 1E6OH 1GS7A 2OL3H 2FYYA 3NPSB 1V7ML 2XN9D 3WSQL 4NBYB 3V0HA 4UT7L 4XC3H 4D9RE 1AE6H 1CFVL 2W1NA 3QQ9C 3P02A 4GAGL 1IZKA 3NFPA 3C08H 4U1GB 1S9YB 4GAFB 3V7MA 3S35H 2A6JB 5F0LB 1HHKB 2YOCA 3MLRH 2PCPA 2ZXAA 1GGBH 3ZMNA 3WJLC 1T4KA 1YUKB 4PTTB 4W9DC 3S5LG 1UT1A 3TO2A 1YYML 1ZVYA 1KPUB 3BWAA 3IK2A 5D7KD 4K2UH 1U3HA 3EGSB 1NM4A 1IC4H 1TJXA 4S10A 2JJTC 3OKOA 4WI9A 3TTSA 1SHMA 4B3EA 2K70A 5DD0H 1HYSC 2PF6A 1VEMA 3EFFA 4BE5A 1N4XH 1EEZA 1ORQA 1QNIA 3ARYA 3EO1B 1B0RA 5E2TH 2RACA 5F93C 2YA1A 3LEXA 3D08A 4HAFA 4BKLA 1WTLA 3QPKA 4H8QA 5FUCC 1USQA 4PJEF 4Q8BA 3MMEB 2X6VA 2W81C 5JXED 4FA6A 4UIMB 1MCJA 5E7BA 4LARH 3GKWH 1WFUA 3AG1B 2Z8WC 4L0YA 3QG6A 3AITA 2BHZA 2V2WA 4RESB 2WLNA 3EJZC 15C8L 2HN7A 1BAFH 3BKJH 2XN2A 4KKNA 1FZJB 4PLNC 5EOQL 1XZWA 2VN6A 3LDBB 1U3NA 2ADIA 2ADJB 4TPRL 1TYRA 2FJFB 5DWUL 5HYJE 3ML8A 1RV6X 4JFYB 1ACCA 1FFOA 4XPHH 2H3KA 4P46C 3RVTC 1XBDA 3JT0A 1U8JA 3NJNA 3BAXA 3LKPB 3VE0A 4OGXL 2GSGB 4U33A 4XNAA 1DVTA 4I13B 4APQC 1FYTD 3BPOB 5I1LB 5FWRA 2ZTBA 3L4WA 2IGTA 5DTFB 5INDB 3MV7A 4WW2B 5LJYH 3FRUA 1B3IA 4KK8C 2BC4B 3DJZA 2R29L 5KSVA 2ZAHA 5CZVH 4XNQB 5ESQA 1NC4D 4LGRB 5L2JB 1T66C 2Y7OA 3SDXB 1LWRA 1QVOA 3V4VH 1B0IA 5L9DH 4PYHA 3L4YA 2FLBT 2IH9A 2QR0B 1B6UA 4R26L 4ABUA 4DK3A 3SDYL 4OCYH 1JXKA 1OAKH 5M95B 1X7QB 4FXTA 2A83A 2LLGA 3TL5A 3AG3B 3FUFA 4XH2B 4XNYL 1JZIA 4MAZA 1TQCC 1F90H 4XB3A 2WB7A 3L95A 3ZTDC 3EYUH 4A7UA 3LNHA 5LCVL 2OM5A 1IEAA 1TTRA 3F01A 2B2XH 2W9LA 1CR9L 1ZLEA 1UVQB 1CL7H 4X8CA 5BRZD 3T77B 3NFSH 3UAEA 5CEXB 3IMWA 1JPGA 2P80A 3HS0A 1MCCA 3A6BH 1FIGH 1Z1WA 2EZ0C 2KHAA 4J3WA 1B2WL 3V4UL 4MWFA 5KS9F 2WC7A 2F19L 4LP4A 3DJ9A 4Y9BA 4X4ZA 5KSBB 2E4TA 3PL6B 4OQ1A 3EJYC 2PUQT 3UO1H 4M7KL 5E6RB 2OMTB 4DWHA 2ZX5A 4M7ZC 1HNFA 1F41A 4LCCB 1KTDB 4NRXB 2VWEE 1C08B 2V17H 3EUDA 2DKUA 5E2VH 1SJHB 1Q8MA 4LCYB 4YR6A 4KAQL 3TVMA 3SE8H 2JI1A 3ECUA 3O9WD 4H0IA 3MLTA 4X4KA 2CDFB 4JFOA 5DXWA 3ULUH 4M1CC 2CO3A 5T1MB 1OGPA 2FJHB 2YSSB 3O81A 4L4TD 1B0RB 3M8OH 5FUOH 1EH9A 3TOPA 1GZPA 1Z0MA 4RIRB 1VFMA 1I1AA 5CEZD 1A1OB 4KI5D 3DGGB 2J71A 4ZPTA 1TCRB 3FQYA 5AVQB 3BFWA 3MA9L 3A6OA 4E2OA 2CR6A 3H42H 2H6OA 2HT2D 4XVSH 1QKZL 2EVHA 2DIBA 2P24B 3LPOA 2YRZA 4FQ1L 5D1ZA 3V0GA 4EIBA 4H7VA 2BY0A 3NCXA 3QDGB 3Q8BA 4NBXB 1E2ZA 5DJDA 1BOYA 3EFDH 4X8GA 4PREA 4H8WH 1BZ7A 2O30A 4Z7UB 4ZSOE 3U0PB 5CFHA 1K5NA 3QZWG 3FCBA 4L37B 1IL1B 1DBKH 1U8MB 4EZMA 1SY6H 1HCFX 1C5BH 4Z23A 5CNHA 1OTUC 3RUGA 4AKOA 3T4AA 3U6RB 3BVXA 5F7WC 4J3VA 1DJHA 2Q8AH 5IJCC 4ZJ9A 1F1AA 2YBRA 2ESVE 3DDFA 3SDYH 4OD2B 2YJLA 3S96A 1EXUB 3HAEG 5JYMA 1QFWM 3OKLB 4PRAA 4O2CB 1KY6A 1E5AA 3TBCA 2VN3A 1JPSH 1XL6A 1DSYA 3BSZA 2B7DT 1PLCA 2AJ3A 1A7OL 2C3XA 2OJZH 3QE5A 3F04A 4QRAA 1QFHA 2ILLA 2HPTA 3VGAB 2J5WA 1XIWA 5F7MC 3WHXB 3RWCB 4ABVA 2KS0A 4J4PD 3Q1EA 2P8LB 2L3BA 1M6UA 4W6YB 4ELMA 1LEKA 1AO7B 2DYSB 4JFTA 3MNZB 2ATPB 1MQKL 3MRQA 1NKRA 4U6VH 2A99A 3INUL 2WZ6A 5BRQA 4EIUA 2ZF9A 3KPQA 2Y1VA 2J57A 5CBAB 4OLEA 2O5NA 2VMEA 4ZBJA 4Z7QF 5IOPA 2VDLH 4YGVA 5F7UA 3GMRA 4JAMA 1P4LA 4X6EA 3K3QA 1MFVA 2OJEB 4XP4H 5EPMB 3ZE2E 4F37F 1N3NA 1JZ7A 1C8PA 5DD5H 3QT2A 4G8GA 5DYFA 1M2OA 3LTVA 4OJCA 5F70A 4KTGA 3UTPE 2EIZB 5HGAB 3PF2A 2ZOWA 2KDYA