2BM3A

Structure of the type ii cohesin from clostridium thermocellum sdba
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
162
structure length
162
Chain Sequence
KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCAFFOLDING DOCKERIN BINDING PROTEIN A
publication title Insights Into the Structural Determinants of Cohesin-Dockerin Specificity Revealed by the Crystal Structure of the Type II Cohesin from Clostridium Thermocellum Sdba.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Nuclear protein
total genus 34
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bm3A00
4WKZB 2JH2A 1OHZA 1ZV9A 2OZNA 3F2LA 3UL4A 1ANUA 2VN5A 4U3SA 1QZNA 4IU3A 3GHPA 1G1KA 3FNKA 2XDHA 2Y3NA 3BWZA 3KCPB 4FL4B 4WI0A 5AOZA 2ZF9A 4IU2A 1AOHA 3L8QA 5K39A 1TYJA 2B59A 4N2OA 2VN6A 2O4EA 2VO8A 4DH2A 2BM3A 5G5DA 5LXVA 3KCPA 4FL4C 4UYQA 4UYPA 2CCLA 4UMSA 2W1NA
chains in the Genus database with same CATH superfamily
4EZJA 3CC5B 5FM5M 4X80H 3AZUA 1YEJL 2A2QT 3SHSA 4M9PA 1KT2A 4ORZC 2RCSH 1JWMA 3UAAA 2ZOWA 4RZCB 1IGIL 2DQGH 2VR7A 4NJ9L 3L16A 2A74B 5F93C 4K9EL 1N0XH 2F18A 1TT6A 3O3BA 2ITCA 5I8KL 3H0TA 1GIGH 4JN1H 2AXHA 4QIRA 1GZQB 1EJ8A 4Y1AA 1T1WA 4QXVA 1HHKB 3U2SB 1EANA 4Q56A 3BGMB 2LABA 2NW2B 4D3CL 4D2NA 3B9VA 3QQ4A 1MRCH 3QDGD 2Y07H 2YPKB 5I2IB 2CRYA 4JDVB 3ILQD 2QMJA 4QRTA 1T83A 2DQFB 1AP2B 3DMMA 2BSRB 4QJ5B 5EO1B 4PJCF 1HINH 1L6XA 4GAGH 3D18A 3OZKA 2HJKB 1RURH 5C0AA 2IAAC 3ZDZE 3SBPA 4W93A 5KBDA 5SWSB 1SQ2N 1R5WA 5GRYA 3S98A 6TAAA 1OCWL 1KXTA 2A4ZA 1DJZA 4WU7A 4CC0A 5J6SA 3S34L 2WANA 1MREL 1S7WA 1KELL 3D25A 2NSXA 4NRXA 3QUHA 1E9PA 5D2NC 5D7SH 3S37L 5FX3A 4APQB 1F8TH 4JHZA 4R7VA 2Y23A 4GKNA 4O02B 4BFEA 1F3JB 3DIVA 1SXZA 1YMMA 4L29A 3IJHA 5JQHC 2FEEL 3RY4A 4GXVH 1LE5A 2WLJA 4OLWH 4H1LG 1ROCA 2LW3A 2WM0A 1IBGH 4EUPA 2X6CA 3Q2LA 4NX0A 4V11A 5DC9B 1I85A 5E2UH 1EHLH 5GZOA 5BS0B 2VDNL 4JS7A 4UQCA 3RIAK 4PIRF 5D7EA 3LXBA 4WI5A 1XSJA 4FJ6A 4FTVB 4AYFB 2BDNH 5ITFA 3BZFA 2BWIA 5EUOF 5MEQB 3WTUA 1TJXA 5E5MA 5IOPB 4UUJB 3HNSL 35C8H 3P0VL 3VQ2C 4Y16B 5L2KB 4BWWA 1CGUA 4O00A 1OANA 3Q2WA 5DJYA 2Z92B 1MCHA 3IGAA 5B4MD 5MHSE 4IDJH 1ZDQA 3LH2L 2VXTH 3L4CA 2P8PA 3AB0C 3ARDB 4I0PB 4E5XG 3T4AA 1VFUA 1RY7B 4R8WH 2WXKA 4NZTL 1FFOB 2EIZA 5IJKC 3O8XA 2EVJA 3OZLA 1OOWA 2Y25A 5D2LA 3IJEA 4UV4L 1MF2H 3RJOA 1KEGL 4IRSD 4GMSL 5E7FA 1E4HA 3SPVA 1JNNH 3ILQC 4K5MA 4P2QB 1JBJA 4F37F 2UVFA 4H8UA 4GW4A 4WKZA 4F7EB 1PEWA 3KPOB 5D1XB 2AF2A 4F91B 1TZAA 3SE4C 4U1SA 3DV6A 5H94B 5HP5A 3WL9A 3H6JA 4L8BA 4LSUL 4KDWA 1RHHA 1AFVL 1NEZA 3CQPA 3EW3B 2R0KL 1BQLL 3MV9A 1RMFL 2WB7A 4HIXH 3BAEH 2ZAGA 5HGGS 4AQ8C 4DTGH 4KX9A 2E9IA 5JIIA 3NIGB 4BK5C 2FJHB 4NZRL 1M7XA 1E6JH 2ZXQA 1MAKA 5GZND 1AQDA 3UGUA 3GHBL 4L1BA 4QGTA 5CLTA 1GH7A 2CO4A 2XJLA 3FFDA 4FHBD 4UTBL 1FPTL 1B3IA 1QSEB 2GK2A 3M88A 3JWNG 2YOCA 1MW3A 3GMNA 1UGKA 4Y9BA 2WQVA 4M1DH 1ZPLA 3H2QA 2WP3O 3QZWB 4M8RA 2WHVA 1B4LA 3PGCA 3VWKD 3VFVB 4DQOH 3N06B 2BVPB 2VC2B 4EOWL 3EOBB 5D7LD 3VD0A 1XIWB 3ARGB 4XP5H 1N5AA 3V4PH 1E4WL 4KRMB 4YUEL 4ELKB 5IMKB 4EMZA 3EO1A 4M4RB 5AUMA 3T2NH 1WA1X 2FWOB 3BSZH 3LNIA 5EA0H 4HJTA 4IHOA 2RACA 3DOSA 1Z9MA 3LNDA 4G9FB 3VFUB 5AVYB 3WEBA 5DS1A 2X2IA 3NIFB 2XYBA 4JFEB 3RQ3A 4DP4X 1XB6A 5F71A 2Q7YA 5AW0B 3BUIA 1H8LA 1UA6L 4NS0A 4U0RB 1OW0A 1NFIA 5DDHB 5ECJE 1HE7A 3HUJE 1N8OE 4IRSC 3GJEA 1R75A 4Q9RL 2G0LA 1NGPL 4J12A 5T3XD 4GUPB 2XWRA 2H9GB 1U8NA 2A9ML 2P80A 3IDIB 3CHQA 2WJ7A 3SCMB 1T7YA 4OF7A 1E8WA 1UJ3A 2NZ1A 4LVOC 2WVTA 4Q8BA 4UAHA 2XTJD 3BQUB 3WTYA 3GXUB 4HGKC 5B22A 1TUPA 3X17A 3RRQA 3RWDA 5CBAA 2UV3A 1CXLA 4HISA 1Z9PA 4NQVA 1W8OA 3GO1L 2KLRA 4N9GA 4ZW8A 1Z2KA 2VR3A 1FVDB 4F7TB 4M1GH 3KYNB 3BVNA 4PJAE 5MEPB 1TTAA 4M7JL 3ILPB 1X5GA 1U92A 5GZNC 1TPXC 3O81A 4WKXA 3STLA 3VG0H 1Z6JT 3KPPA 2IBBA 3TIDB 1CDIA 5CZKA 1KXHA 3HEIB 2J5LB 1OCOB 1CJYA 2AAAA 2IBZY 3OWRA 1NDGB 2FJGB 5GJTH 2P5EB 1HWHB 5JLZB 3FTGA 4YSDA 4OV5B 1SBSH 5AW4B 2PO6A 3VRLF 5I8EA 4W70A 3OZ9H 1KPUA 3BVVA 3CZKA 4GP4B 3VWKC 5I18H 3DA0A 2C3VB 4HDIA 3B37A 2CM5A 5FKAA 1ANUA 1OAQL 4JFYA 5E6ZA 3OJVC 4EN3D 4XVSH 1QSFD 5DR5H 3VCLB 2CUMA 3FU5A 3C60A 2GB2A 5L4JA 4FG4A 1V7ML 3AT0A 1WBYA 4QTIH 1G43A 1TZGL 1J11A 4HIHB 5B39B 4N0YH 5HYQA 3P4OA 3V4PA 2ZP9A 3KCPA 3BMWA 4PD4K 1QTSA 1OB1A 2J43A 4ZSOE 3UTTD 1Z3GH 1EEYA 2X38A 1R3IL 2XG4B 1VFOA 2EXWD 3BSZA 2CIKA 1ZV5A 4WSKA 5I5IA 5GSVB 4MJ2A 5JW4N 2WZ6A 3X3FH 4PY7B 1KG0B 4ZFFA 5DI8B 3X14B 3Q06A 3QUMH 2WNWA 1BJ1H 4X6FB 3X11B 1I7ZA 2HG5B 3QJRB 5LBSL 4G80A 2MIZA 2XTJC 1FVEB 2Y36H 1I8LC 1F42A 1GGUA 2Z93B 3KPRD 3JYBA 4J8RB 4Z76A 5FA3B 1HSBA 1HHIA 2ZAHA 2VDML 3C6EA 3K2IA 4UDUB 3IS0X 4YSQA 2KBGA 4ALAL 4PJXE 3D52A 4B0MM 2VR8A 4LF3B 4S1RL 1J18A 1VCBC 1Z7JA 5DVOA 1QASA 4UQAA 4B9IA 2NDFA 5I17B 2VDRB 5KS9B 3L4XA 4G6ML 1ASPA 3BZ4A 3QEQB 4PRAA 1G7HA 3LSOB 3IDXL 2DYRB 4R2GB 1ILSA 2NT0A 5F7EH 3FU3A 3RVUD 3KPSA 5JW4Q 4J3XA 4WW2B 5K9JL 4N2GA 3RBSA 1JZ4A 4PJ8B 3FONA 1P5VA 5D1ZI 1QEWA 1S9XA 3NSXA 3W81A 4EN3C 4L18A 3O6KH 1E2VA 3RVWD 1GGBL 5BQDA 2VZOA 1JPTL 2C1OA 5EIIG 2VQ1A 2A9CA 3MRJB 4IKJA 5IFHL 2VLJD 3HE7B 2JTDA 1B0RB 1KSRA 4YSPA 3HRZC 1S8DA 2XPYA 1JZIA 4ZAKD 4BCXA 5MI0B 1S5IL 4GLRI 3FF8A 1ZANH 3AQXA 2BHZA 4O51B 5IQ9A 3OD3A 2HA1A 1U30A 4OI8A 1SVCP 4G8EB 5I1HH 12E8L 2BP0A 2EXWC 3GBNH 4DK3A 1YSOA 1WBXA 2LAAA 3C5ZA 3JT2A 4I18B 5DD3L 5EOCJ 4KKZA 3MSPA 4I9WE 3MMEA 4MD4B 3GNML 3B9KD 3D39B 4WNQB 3QJZA 4J3UA 2CH8A 5F96H 2F53B 3EH5B 1N9PA 3KXFD 3L9YA 3WFZA 4UT9H 2BM3A 2HFFB 2JKIS 2KKQA 4G8FA 1RV6X 1BJ8A 3NJNA 2B1HL 4DP1X 2IGFL 5IB4B 3QUMA 3H9SE 3S4SG 3TF7C 4Z78A 5CEZL 3NTCH 4HQQH 3ARBB 1NLBH 3FT0A 4KJYB 1U6AH 1RFDH 3AU1B 1U8PA 4IS6B 5DD5L 4IBVA 3ULAB 5IQ7L 3PJNA 4WSJA 3UJIH 4Z23A 3TS8A 1K6QH 2P3YA 4AOFA 4OJYA 5MERA 1C5BH 2WGXA 2CK0L 2NQ3A 3D3VA 3L3IB 3L4UA 2OX5B 3T3ME 2NY0B 2Q86B 1R5VB 5LDUA 3GFUA 3QCVL 4RMRA 2BVEA 5FHAH 1KB5H 4WTZA 1GCYA 5EU5A 5AZUA 3E8UL 5CSBA 1IM9A 2LHAA 5AOJA 1LO2H 4F2EA 1PZDA 3U7YL 4YHYB 2N56A 4B9FA 1AHKA 3H4HA 4BSVB 3P4MB 2IANE 2QGDA 3CXHJ 4M1CD 3DURB 2IV8A 3G5ZA 4TVSa 3SYAA 3RVWC 3U79A 3EH3B 1JNLL 3FH7A 2Q2EB 3OLGA 1ZA3A 4Z7OE 4LVEA 3NZ8A 3U82B 4MB4A 4N0UE 2YSTA 2VWEC 3FKUS 2AXWA 2ISDA 1YYMH 4ZAKC 4MJIE 4XO3A 1NCAL 1NOLA 2WBJD 4N4YB 4LVHB 1XF4A 5IZ7A 3CD4A 3DO7B 1QTYT 4QAWA 3NSFA 1ET8A 1ZK9A 5HGHA 3N5AA 3F12B 2XX1A 4AJYV 4NCDA 5IJBC 2X4RA 4EDWH 1OQOA 4AYSA 1KJ3L 4PJ5B 1A1OA 3L95B 1ID5I 3B9KC 3LNFA 3MLSH 1MUJA 4AM0B 5D71L 1AZNA 3HS0C 2V5MA 3OM3B 1VKXA 4X7SL 2EDYA 1F6AA 2CZNA 3BRFA 5F1OB 2BZ7A 2ZWZA 1Q0YL 5G5DA 2LLLA 3H4FA 5TE6H 1J5DA 5EIIB 3VI3E 1PCXA 4FJYA 2AK4D 5I1GL 1HWWA 1DL7L 3HR6A 1SN5A 2YEZA 2IDFA 1NWPA 1UD3A 4FFWD 2E7DA 4M48L 7PAZA 1CGTA 1WZMA 2CGYA 4UT9A 1SHMA 4XPHH 5DEJA 1OGTB 2PR4H 2ENSA 3BUPA 2ADJA 5ACLA 1A6AA 4N2DA 1TKWB 3MLVL 4ZD3H 5IGXH 1TU2B 4FLQA 4P23B 3PF2A 4NZ8A 4UM8B 1H9VA 1BVOA 3U9WA 5FIEA 4FQ2L 4DO6A 1ZIAA 4X7DC 4JKPL 1OAZL 3CBKB 1MWAB 5HJ3B 4CL7A 2BFGA 4GKZA 3RWIB 3CK0H 2EECA 1AIZA 5FECA 4LEOA 1E28A 5I0VA 4Y2NA 2E27L 2HPOA 1M7UA 3VI4A 5E2VL 2EDRA 2AEWA 3CFBA 4M1CC 4M6NH 4JFDB 3GBDA 3IMRA 4LCVA 3BAJA 4J28A 3AFLA 1BZ7A 1KB5A 4Z7UB 4Z7VA 3WGVB 1UB5B 1FFTB 1YYCA 3KPLA 5I19H 5E6IA 1NCDL 3VYOA 3IF1A 5IIEB 1TQWA 4AI7A 4OTXH 1U2YA 3O3EA 1PZSA 2Y06H 3RFZC 1I53A 3LHAA 4BK4A 2WBJC 5F72S 3RTLA 1PD1A 5T5FA 5I0DA 3EG9B 4Z7IA 4WJG3 3T2PA 5CD3A 1BQSA 1OGSA 1GS6X 5BZZA 4YDKL 4O02H 4E9XA 3HHRB 1J1XL 2WZPA 4FABL 4WLCA 1IGFH 1MAML 1SY6L 5HDBF 5CN1A 1GW0A 3SODB 4WUUE 1L0YA 4X0KB 1NGZA 1T7WA 3GZKA 3A6BL 1C5DA 2FHBA 2YN3A 4WEUD 4GSQA 4I85A 3FB7A 1CFSB 3QHZH 4ZTPH 1HAUA 4Y2LA 5CZVL 4HYTB 4ZUUB 3WKPA 2Y7MA 5TE7H 1BEXA 4ZJ9A 2P4AB 2OSWA 1XZ0A 1FA4A 4W68A 3LQAH 5IM7A 1RJLA 5IMMA 1TTBA 4P5TD 5EFIB 1X7TA 4U1NB 3HMXH 4FFWC 2KZBA 1KJVB 4FQ1L 4NM8L 4PG9B 4U3SA 4D8PB 2X9ZA 2ICCA 4TQEH 1IC0A 3T8XA 2R8SH 4N6RA 3E3QE 4K0OA 2VJXA 1R6VA 1JZ2A 4O9HL 3OG6B 1M05B 4X5RA 5J3HD 1A8ZA 4RZCA 3CZLA 2GAZA 5EF0A 4XBMA 4F9LC 3P30H 1UWXH 2A74A 1KBVA 3QS2A 4MWFB 5DD0L 5EDSA 1KIQA 2R9HD 3MRFB 4MHHG 1BEYH 4YE4H 3RZCD 4TRPH 3V52H 1HHKA 3C8KB 3L2LA 4HFUL 3U2SA 2VW4A 3BUTA 2NW2A 1FNSH 4LPUA 1UYWH 3D7PA 3HE6D 3SY6A 2DYPD 2K3TA 5I2IA 3ULUH 4F5CA 4HUKB 3E7JA 5EZJB 5HYSA 5E5UB 2FDBP 3VD5A 1AP2A 2BSRA 2CPUA 4XMPH 5I8OL 2C9RA 5EO1A 1V7NL 43CAB 2MOGA 4H8PA 5EUOE 3PG2A 4DVBA 2QZ5A 1BFOA 2HJKA 4LHUG 2PWEA 1Y1UA 1IAII 5SWSA 5ABZA 3KM2A 4G8GE 1LGVA 1J8RA 3ZE2B 3IE9A 1LVEA 3QUZB 5KAQF 4YH6A 4M6OH 3MJ7B 4HEPG 5E2TH 2K7QA 3I84A 4JCWA 4NCC1 3DX6A 5FGRA 1G4RA 1MI5E 4LPXA 1DZ0A 4JKNA 4X8XA 1FYTD 3SDXB 3S36L 2GSIB 4O02A 2QVKA 1GGIH 2F08A 1F3JA 4CGTA 1S9YB 1P53A 3DHMA 1L0QA 1UENA 1FN4B 5DWUL 2DWTA 1SN0A 4K55A 5ESQA 3U9UA 1Q9WB 1GGTA 1AKPA 4UMSA 2PCPB 3B2DC 4P5TC 5BS0A 3OR6B 1RULH 5HHMB 4DK6A 4U6VL 3ECBB 1TVHB 5EEVA 1NUGA 5B8CC 4HIIB 2FLRT 4U31A 1EHXA 3CN3A 1SUJA 5E2JA 3OMIB 4KXDA 5A7BA 2ICES 3CN0A 5MEQA 2P42B 1S3KL 5IOPA 4UUJA 4RA3A 1U3HB 1P4UA 4Y16A 1DVXA 3W9DB 5L2KA 4KY1L 2CJUL 5J3HC 3HMXA 3CZFB 2Z92A 4RGMB 4X7EC 2X9WA 3FRPA 1HZHL 1TETH 5GPRA 4WI2A 3FT2A 2R9HC 1IGJB 1PSKH 1RVFL 4JFFE 5AYQA 4HPHA 4PGZA 4K5OA 4P3WA 3ARDA 4I0PA 4NB7A 4GAFB 4OD1H 3W0WA 2E5EA 4PQXA 2JKSA 1PAMA 4KZ0A 3CVCA 4LU5H 1XWVA 2OULB 1FFOA 5I1AB 4JPVH 5GGVH 5DLML 3HE6C 2NUTB 2AITA 2DEXX 5DJXA 4AUJA 4DQAA 1HKLH 4NYLB 4PREB 3ZPDA 1WH0A 1ZOXA 2EC9T 4FG6D 1TMQA 4AENA 4P2QA 5EPMA 2D7TH 3E9TA 1X5AA 3LZOA 2LU7A 3R0MA 5F9OL 1D7DA 5KW9H 3I6GB 4NPKA 4F7EA 5EZOL 1J5CA 3CZGA 2GJ6B 3VH8G 3VSQA 5D1XA 1PU0A 3V0HA 1UACL 1BYNA 1UATA 4KDTA 3Q3GB 1MJ8H 4L3CB 3S35X 5CWSA 4XX1G 5H94A 5C0JB 1NA8A 4QLRA 5F0MB 1ZY9A 3MROB 5LLIC 1UWFA 3P54A 1IAIL 3TA4D 2MSPA 1TJGH 4NNPH 4NQDE 2FJHA 5DC0A 4WTWA 3ZT7A 1ZIBA 1WEJH 5FS5A 4PLKD 4JHVA 3ZYIA 1NH6A 4BBWA 4DP2X 1KY6A 1PZCA 1N64L 2YBGA 1MZYA 1QSEA 3ZZ1A 4CKVX 3MYJB 5HHNA 2YOAA 1OAJA 2HRLA 5SX5H 3QZWA 3E6FB 3F85A 2YAFA 3MBED 4M7ZC 3VFVA 4JM2B 3EOBA 3VH8B 1WIOA 1XIWA 3ARGA 2ZX7A 3QUYD 5EC1A 5BRPA 1FLTX 1D6EB 1KIUB 5EEWA 2IDQA 1H5BB 3LRSB 4ELKA 5J6GB 5IMKA 4FXKB 4M4RA 4CILA 1CB4A 2FWOA 3VXSB 3ZHLA 3C5JA 1NC4D 2VL5B 4O58L 1C1EH 4G9FA 5SX4H 4OCMC 3VFUA 4C83A 4GP5B 4IOIA 4PJGF 5DK0B 2VXVH 4NQTA 5TGBA 1AKJA 3L6FB 1CDYA 4GAAA 1SJHA 2CO2A 4NQXB 4JW3A 4MRBA 4CDHA 4Y4FB 3U46B 2VN7A 2ITEA 4FG6C 4GUPA 2H9GA 3IDIA 4FQIL 2K6YA 4L48A 2DQIH 2OMVB 3L3GB 3CBRA 4DKFL 1C8PA 5FYJD 2A3TA 5T3XL 3GIZL 4XODA 2XWZA 4ZQKB 4Z3TA 5KVFH 2N1KA 2I07B 3P4NA 3QQNA 1I3GL 4PJCB 5DD1L 3SQBB 1ROWA 4RIRB 2BW4A 3FT4A 2WMPA 3IE4A 3NIDF 4KNUA 5CR8A 2E6PA 3MBXH 2LLNA 1DBAL 2VDRH 1FVDA 2EDTA 2VYRE 2QQLH 4F7TA 4I87A 4MXVF 3KYNA 1JZJA 2EABA 4Z8FH 5MEPA 1SYSB 3FTSA 2AVFA 1O7DC 3NOIA 4PLKC 5DHYB 3TIDA 4X5QA 1A6UL 1WISA 4P9HH 4NBZB 4PI0A 3NA9H 1I7TB 2DQUH 2X7LB 4XNUL 1DEDA 2I69A 2J8OA 3CDGB 3N3EA 1MCJA 3FF7A 5CSGA 1NDGA 1PIFA 1SOKA 2FJGA 4OCYL 3OB0H 3GXIA 2VLRE 4NPJA 4HAKA 2BY0A 2LV4A 3NESA 5GISL 3PWUB 3QNZB 3SDCB 3P0GB 5E5LA 2NNAB 4L3FA 1XD0A 3MBEC 4NIYE 1HH9A 2JQAA 5HYIA 2C3VA 3OWEA 3QJSB 4Z0XB 2FRGP 3BLBA 2IAMD 5AOZA 4DERA 1WO2A 4N2CA 2BRRL 4UZGA 5EIVA 1L7TH 3QUYC 4HUUB 4WWID 3KR3H 5C97A 4X42A 2C1PB 1HCVA 2MKLC 4S1QL 1LO3H 4Z7WF 2J4WH 4L9LB 3S6CA 4C56E 2I9LB 4LCWB 2DQTH 4LXFA 1F02I 4PV8A 1QFWL 5ADPH 2DPKA 3EJTA 4UZSA 3BX7C 2W59A 5B39A 4HIHA 4WUKL 4E9RA 2W1NA 3KGUA 1TEGA 3GT6A 4KRPD 5ELIA 2ZF8A 3JWDC 4UQEA 4YFDB 3EJPA 1P4BL 4YDLC 3S5LB 4DPAX 2GC7C 3T0EB 3VXUB 1OZUA 2YHGA 4RGNB 1NKOA 1HHGB 3BKJH 3GBLA 5IB2B 4PY7A 4YLCA 1KG0A 4X9YA 2H6UA 3MCG1 2JFCA 3L5XL 4QKXB 2IWFA 4UNUA 3X14A 5EU3B 4JRXE 1B6UA 4LLVB 3WFDL 2Z7YA 2AV1B 4I77H 2IVFC 1D6VH 4DP8X 2Z93A 2Q8BH 2YPVH 4J8RA 5T1DH 4R7NB 4OB5H 4A6YH 4XC1L 2LOEA 4A7SA 4L0YA 4BWUA 1J9QA 4OJCA 4OQ1A 4UDUA 1XF2A 3A22A 4Y5XA 1THAA 3TWCL 5BVPL 5A2IH 5JXEA 2IO5A 4XCNB 5IESH 4JFZH 2GPZA 1FZMB 2G60H 2TSAA 1P4IL 3MXWH 3A67H 3VWJB 5I1CH 2ZX8A 1RUQH 5EZPA 2R1WA 5FGBC 3GZQA 2DRUA 4PJHE 5JW5B 3PJLA 5DO8A 3ZDYF 5I66B 5F9JB 3QEQA 3DYOA 2VN5A 2R51A 3LSOA 5KWYC 4NRZA 2QKIB 3G04A 1SMAA 2F61A 5I9QC 4FZ8H 2E7LA 4BWTA 4FTDA 1R3LB 2FX8L 4LPWA 3CLEH 1M57B 2V17H 2YSSB 2WYZA 3MRCB 4NWUL 4WW2A 2W81C 1VGKB 2IAMC 2VZTA 4NQEB 5ETUB 3MRPB 4PJ8A 3M7OA 1RAMA 1AGDA 4ZMAT 4N2IA 3UYPA 1YC7A 4KUZL 1FRGL 2LLGA 4NFCA 1KYUA 3MRJA 2WXRA 1AQ8A 2VKXA 4MDRA 1B0RA 5DJ2B 2WBKA 1RUKH 1KNOB 2ZOOA 25C8L 5FFGA 4WY7H 2OMZB 1LWRA 5CHNA 4KRPC 1GVIA 5J1AB 3LN5A 1NFDF 4XCCH 1MW2A 4NBYB 4N0CD 2BERA 4G8EA 2DQJL 4IKLA 2XBDA 1MNUH 2H1LM 4AY0A 3SOTA 2QFPA 4KXCA 1JRHI 3SKJH 4IQHA 5EOCH 4I18A 4KZDH 5ALBL 4RBPH 2E3VA 5JXAH 1ZJAA 2XNAB 9PCYA 5IQOA 3D39A 2C9XA 3B34A 1DFXA 4ODXA 1BA9A 2Q76B 2F53A 2NY2B 1KC5H 4P3CL 2H8PB 1ETJA 2NDGA 1OGAB 2HFFA 3TPKA 4AH2A 2JKWA 4U1HB 3I3BA 4R9HA 2BHYA 2YIHA 5IB4A 2BWDA 3W57A 5EEZA 1KTDB 1KFGA 1KY7A 2O6EA 4BFOA 3APDA 2EXYD 4PB0L 2ZKHH 5GSRB 1CICB 3ARBA 2ORBH 1RIHH 1ZA6B 3DROB 3KGRA 4KJYA 2YAEA 4IS6A 1UVQA 2QADD 4QUOA 3V95A 2NXYB 3QUXD 4ZUWB 4R26H 4EQ3A 2NX5B 2VZ1A 5D2NE 4ZZFA 2QTVA 4JQVC 3AM8A 4CA4A 2OX5A 4YN3A 1CL7I 4UTAH 1R5VA 2WNKA 3B9EA 2AMGA 2E9GA 5IROD 1K72A 4FFYH 2WAQA 1HU8A 1ACYH 4TN9A 4X4XB 4XXCC 1UZ6E 3U9PL 3FS9A 3HUJA 2BOBB 2F7QA 4HLZG 4BSVA 5CEYB 3P4MA 4PRPD 1NC2D 4AVIA 3TONA 1EPFA 2MPVA 1Q4NX 1ERNA 3I3DA 3VD4A 4TM9A 4HUWB 2O4EA 2YD0A 4OCXL 1H3VA 3H3BC 4Q6IB 3WNNA 1T2QL 3EJZD 2RQ8A 2FHFA 5EBGA 3HFMH 4LLUB 1JHTB 1DLFH 1MCWM 3LDBB 1E9QB 4PH8A 4QEGA 1QFUH 1FZKB 1Q0XL 3DO7A 3KG5A 4QKTA 4CVWA 1D9KB 4MB5A 4N0CC 4PU2A 5CCKL 1WA2X 1Z9OA 1HEZB 3F12A 4XB8A 2OM5A 1WF5A 4PJAA 3QDJD 4AVHA 3D69B 4FRWA 4MCZA 2YMXH 1G6RL 4PJ5A 3L95A 4AM0A 4MJJA 3KVPA 4HWBL 4WU5B 4LHJB 5F6IB 1E5CA 4ABWA 4Q0XL 1XD1A 3POHA 4X6DB 3HMWL 1F5WA 2H6PB 3LCYA 5BNXD 3BPOB 5CBEA 1O7VA 4KRLB 4RRPM 5D70L 5C08E 5DQDL 5E8EB 3SZ6A 3FU8A 4XI5D 4CBZA 1G1KA 8FABB 2FHCA 4LEXL 2EXYC 3UJTL 2LFEA 1X7QA 7CGTA 4B50A 4M8UA 4D0DA 5E24E 1OGTA 3L3OC 4L4TD 2F7RA 2QADC 3N41F 4XMLH 3QUXC 1RXLA 5C9KA 1TKWA 1KENL 2OAAA 1Q1JL 3VXPB 3LZFL 1LO4L 2VXQL 3SDAB 4P23A 5HDBE 2NMSA 5HDRA 5TK4A 2VM9A 5IROC 4LSQL 4ZSOA 5GHWL 1A4CA 1MWAA 1AS7A 3LOWA 1CYGA 2X3CA 3PE9A 1I4FB 4LOVA 5HYJB 1N3NB 4BA8A 4NC1C 1CL7L 3V9EA 1PBYA 5EU6B 2QBWA 4KFZC 1INEL 4UTAA 1IAOB 1VZIA 1I9IL 3SGDI 1N59A 4MA1C 3NAAL 4QRBA 1E5BA 1T1YB 2VO8A 4Z7UA 4FFYA 5D1ZB 4ETYA 5ADOL 1UB5A 1E4KA 5IIEA 3EJZC 3EBGA 5FV1L 3ATFA 4UYPA 4L0ZA 3HAEG 1V8HA 2A9NH 4XP6L 4PAZA 4AJ0A 4HUCA 2AJSL 2WV3A 1JZHA 4Y8DC 1KXQE 2TRYA 4KROB 4F27A 3U0PA 2R0WL 3KPMB 2NT1A 2JELH 3COOA 4DGIL 1FFPB 1Y07A 3FMGL 1Z9NA 4N5ED 1DVZA 3AQYA 1E4XH 1DJIA 3ZUNC 1PG7X 3DNKA 3KS0J 4X0KA 2OS7A 1TTGA 2VXSL 4GQZA 1ZLVK 1C5CH 5TFSL 1EZVX 5FV2A 5E94B 1YEJH 3ULSA 1CFSA 3S9DB 2GTQA 3NJKA 4ZUUA 3PCYA 1MHEB 4W9CC 1IGIH 1OP9A 2VMEA 3S5ZA 1IGML 4NJ9H 3L4VA 3CHSA 4K9EH 3S2AA 1LL1A 4XI5C 5F3FA 5E9DD 5EFIA 3KLKA 4U1NA 3RKDD 5I8KH 4ONGL 5AW6B 1KJVA 2GJPA 4I2XE 4PG9A 3WBDA 1HCZA 3BZEB 2BSSB 4D8PA 1HZLA 5MP6L 3WJJC 2EEBA 4NXSA 5L8LB 1DJGA 2MCG1 4R5VA 5DHVB 4YIQB 2AI0L 4D3CH 4YHZL 3DO3A 4WI7A 2OI9C 2JB6B 3LEVL 1J9CT 3DVFA 1FAIL 4OLXL 4TQIA 1XCTB 3GD1C 2CR0A 5HVHC 1JNJA 3KPTA 3UJJL 2GITA 2DM4A 4K7FA 1G7QB 1BPLB 1NDMA 2C9SA 4URTB 3HC2A 3WXWL 1I1FA 3CZNA 4Y5YC 4U6HB 1G87A 3UMTA 3K3QA 4PB9L 3HW7A 3HG1D 4M5ZL 2XIDA 3F7RA 1OCWH 3ARED 4LASL 3S34H 4PJ7F 3LS4L 1MREH 5EZJA 5AVTB 1KELH 1BD2E 1AZVA 5KSUB 1T0OA 3OF6A 5GGSB 3S37H 4FADA 1YZZA 3PQYE 2AS5M 1HVXA 2BMKB 4X4ME 5JZ7D 1LILA 2N7AA 3VGAC 2HAZA 3JTTB 2GT9B 5AKSA 1XZWA 3H9SA 3LPOA 3C09C 4JLRA 5H2BA 2VITB 1FC1A 3Q2VA 3QUZA 4N5EC 1T6WA 2VDNH 3MJ7A 2VAJA 2PP7A 1KYOK 4RQQB 1OVZA 3RTQA 1ZHKB 2C7FA 1Q9LB 3PV7A 1UJTA 4C58B 4KPHL 1PZ2A 1G4MA 2ITFA 2JSFA 5KVMC 2YFOA 4MD0B 1A21A 3HNSH 3EJJX 1S9YA 2VUOA 3P0VH 5T3XE 4MYPA 5LNEA 3K6SA 1FN4A 1YY9D 2GIMA 5DEGB 1QHPA 2OMTA 5JYMA 1CFNB 4EBQL 3NRQA 4IIZA 4OQTL 5C2UB 1FNLA 3UGXA 3OR6A 2H47C 3LH2H 3A47A 1TVHA 3ECBA 1OAUL 4HIIA 3IPBA 4BQ8A 4I0KA 5TTRA 2IOIA 2OPCA 2A38A 4NZTH 5HGDB 1IBDA 3M1BB 3Q9QA 1DQDL 5LXVA 3TN0D 4EVNB 1U3HA 1YNTA 4UV4H 1KEGH 3W9DA 5KVDL 4N2AA 3DUUB 3NH7L 4GMSH 5CXPA 1USZA 3CZFA 2QLYA 3GK8L 1V3KA 1UC6A 1WTGT 3L1FA 3JWNE 1IGJA 1MCBA 2NOYA 4L8SA 4PRIE 1A3LL 2PCFA 2XN9E 1OP3H 2ZYIA 4EXPX 4HH9A 3CDYA 3R4RA 1AE6L 2J56A 2VJ8A 4MNGB 1QSZA 4PJEF 3AREC 2W91A 1KJ2B 4PJBE 3FQRB 2OQJB 1C12B 1AFVH 4PREA 4WFGE 3CV5A 3QDGB 2R0KH 1BQLH 2FYYB 1RMFH 2D31B 5CN3A 4OD2B 1JS4A 3LKQB 4ZMWA 3F64A 5JZ7C 4NZRH 1XR9B 1J0HA 1QKZL 3CN1A 5C0ND 1KBKA 5K33A 5IKCB 2BVQB 5SV3A 3GHBH 3FC8A 4R90L 4BSWB 2J72A 3Q3GA 1Y1DA 5H35B 4L3CA 5AG8A 1KGCE 1U8IB 1FPTH 4UTBH 5C0JA 2VDKL 3QZPA 3X1EA 3MROA 3EYOB 2D7MA 2L0DA 4PR5B 3NACL 4PHZA 4NN5C 2WJ5A 3GSWA 3IB4A 1GSMA 3U7AA 1AG0A 3PWNB 4EO5A 4EOWH 4Y1SA 4M7LT 2AHIA 4PFEA 1E4WH 2CNZA 1HYRC 1MCLA 3WYRA 1IAMA 4KI1A 1BP3B 2O61A 4YUEH 4YEFA 1YY9C 2G2NA 3IKKA 2WQWA 1MRDH 3AT8A 4JN2A 3ELAT 5JW4M 1IM3D 3OHXC 3DOHA 1JXGA 3MYJA 1IC4L 2MTPA 2R1YB 2A4CA 4LBAA 2XDHA 2PP8A 2WXLA 3CTTA 3EKCA 1XGZA 4BE6A 3E6FA 2V5YA 3FTWA 1OAYL 4TLSA 1UA6H 3RVVD 4KI5F 3VH8A 4RNRB 3TN0C 3VXRB 4S0SD 1D6EA 1FSKC 3LRSA 5J6GA 4Q9RH 1ZLVH 3JV6B 4FXKA 1NGPH 6PCYA 3FTUA 4XBGB 2L7QA 1JGDB 5F9DC 2X9XA 4OFYA 2A9MH 5H37G 3VXSA 1PYWB 3FO9B 5CSZB 4GXFA 2JCCE 2VL5A 5FYKD 2BNRE 4MMYB 5JTWA 4JREB 5DK0A 2GI0A 2CR3A 1SJEB 2HLEB 4EKJA 1MFMA 1TO5A 1YAZA 5C09D 3IJYB 4NQXA 2EE9A 4ELMF 2YLKA 4QHUA 4Y4FA 3U46A 1ZVHA 2NNXA 3GO1H 3JWDL 1AO7E 2FIRT 3NPZB 3FL7A 4L4VD 1HXMB 3S2CA 4M7JH 4DCQB 3L3GA 5C0NC 3VXMB 1T4KB 4TL5A 1ZHLA 1XHHA 2ESVE 2VLJE 2VWEE 1N7ML 1IKOP 4FYTA 2I07A 3SQBA 4RIRA 1WGOA 2AGJL 2OCFD 5FYJL 1MIML 3U1QA 1RPQA 3LKOB 3ZE1F 3MRGB 3MRDB 3CSFA 1EMTL 1B3JA 5CINL 4KO9A 4LLAA 1SYSA 3WNMA 3ABLB 1OAQH 3T6WA 1JN6A 4UTBA 1B0IA 3O4LD 3KLDA 5AWNL 5AVVB 1MJJB 1I7TA 1M56B 2IGTA 5JW4R 1FGVL 4JO8A 3CDGA 3DUSB 3JTSB 4F1ZA 1V7MH 1X5KA 1YEHL 5LKNA 1TZGH 3SDCA 1A6VL 3PWUA 3QNZA 3D09A 3DJTA 1AR1D 2IDUA 4KWUA 3RVVC 3TH4T 1R3IH 3S36X 3NJIA 1M42A 4HUUA 5D7LB 4A7VA 1YUKB 1XF5B 2C1PA 3RFRA 4WIQA 3L2NA 2M2DA 1E27B 5EUOA 3KBHE 3NPSC 3P9LB 4WSGA 3KWXA 5TDNB 1SOQA 4JKMA 4PJFF 5LBSH 4AK2A 2Y5TA 1JPGB 4KQ4L 2IPTL 2I5YL 3W9EB 1COBA 2JIXD 4PVNA 4F15B 2ZF9A 5HHOB 3S5LA 4EDXB 3T0EA 2AP2A 4LBEB 1EDYA 2VDMH 1HHGA 3KWWB 4P2RD 3FHAA 4X6EA 4XBEL 5EU4A 3TWYA 3UIZA 5IB2A 1TTCA 4ALAH 4EIZC 3V7MA 5EU3A 3D2UB 3MREB 4FI7A 4S1RH 4U2ZA 3U0WH 1EXUB 4RDQG 3RWEB 2XTJB 5ABDE 5DVKA 5F88A 2BRQA 4QRPD 5HHXL 4CADB 2EE6A 1A25A 4G6MH 3KWVA 3KZ8A 4FQCL 3IDXH 1CGVA 2B9BA 2FO4B 2CJ3A 1P69B 2GI7A 4ISVB 4OY9A 1CD1B 4XCNA 4JHAL 4Z0BL 5HVGB 1A3QA 1WG3A 2R7EB 1IC7L 3VWJA 4H88L 1OTSD 2O5XL 1GGBH 3DRTA 3US0A 1H9DA 4FKKA 1JPTH 2PCXA 4BRJA 2AEPL 3QK0A 4A66A 2WTPA 1BVZA 1NCWL 1TNMA 5IFHH 2D3VA 5JW5A 5I66A 3EBAA 5F9JA 4HW6A 3QJXA 5HDOA 2D8KA 4UNIA 2RTTA 1S5IH 5DZNA 4XN4A 2QKIA 1ZLSL 4UB0L 1R3LA 2AK4E 1AR1C 4R7DB 3ZOAA 2YSSA 1J0JA 3MRCA 5DJ8B 3WUWG 3WO3B 1VGKA 12E8H 4NQEA 5CZXD 5ETUA 5C0BB 4JY4B 4LLDB 1SYVB 4V2CB 3FYEB 5DJCB 3DHJA 3GS4A 5DK2B 1QSFB 2HCZX 3KPQA 5HDQH 5DD3H 5JDSA 4NPYB 2CXGA 3ZO9A 4AT6A 3GNMH 1FL6B 5DJ2A 4CC1A 4YOKA 2UWEF 1BZEA 5FLVA 2J3SA 2OMZA 3HRZB 1E42A 2GC4C 3UP6A 1GY2A 1RJCA 4KTDL 2XETA 2YD7A 1SEQL 1VENA 3BOVA 3UTTB 2B1HH 2MNJB 3TA3B 2Z4TA 2IGFH 2AEOA 4X4YA 4NQDA 4PJGB 4N1EA 5LBSA 2R0LL 5BUGA 1AOZA 5CEZH 4B9GA 4YDJA 2XNAA 2ZSVB 4FHJA 2J44A 4HKZA 4ETQB 5FOBB 4A55A 5DD5H 3IJSA 5IQ7H 2H32B 3B8YA 2Q76A 2V8MA 5FGCE 5JOPD 2H8PA 2O93L 2CK0H 3KPRB 1OGAA 3B7UX 5C07E 5CP3H 4OLEA 4U1HA 3CPLA 3QCVH 3FTVA 3BPNC 2X1QA 4N5UA 2BNUB 1KTDA 3E8UH 4BRVA 3RWCB 2E9WA 1I1AD 3K8LA 3CWGA 4AQZA 2Y7QB 1CICA 2PW1B 4XN5A 3U6XA 3U7YH 1U8QB 1ZA6A 2BVOB 2NYZA 4LDLB 1EFXB 4ADGA 1JHLL 4QRRE 2HJLB 3NIDB 5T3ZD 4K23L 1OTSC 3OKKB 1I3VA 4ZUWA 2NX5A 4K3JL 4CU7A 1JNLH 2Y2YA 1FL3A 2YRBA 3MGAA 3N44F 4N2EA 2DS4A 4I13B 2KZ1B 3KDPB 4PJDE 1H6TA 5GJSL 4JVPA 4CGUB 4TUKL 1L5GA 1NCAH 2X1XR 3BPLC 5F7DB 4X4XA 1MJUL 3ZDWA 1N5YL 2BOBA 1M4KA 3CHXA 4JO5A 4YBLB 5CEYA 1PDKB 3SE9L 5CZXC 2X3BA 3O3DA 4IU3B 3V5KB 1HXKA 4DUXA 5HBBA 4G8IA 4GG6F 2ICEB 3HCVB 4GLRH 3HFFA 4NHUB 1L0PA 1NMCC 1DSFL 4WO4D 4WI8A 4Q6IA 2YA0A 4WVRA 1KJ3H 4BHUI 3ZBMA 2B7DT 3EXJA 2DIJA 3S3BB 1GOFA 4JO1L 4LLUA 5AW2B 1JHTA 1PGRB 2OMUB 4HC1L 5D71H 1E9QA 1QD0A 3UBFA 3WKML 4UM9B 2ZPKL 3FTZA 3H9HB 4MCYB 4Z7WB 1PS3A 4X7SH 3UPRB 5AW9B 1VCAA 1FZKA 1Q0YH 2DWEA 4TUJA 4FE9A 4OM1L 3CFCL 1HEZA 5I1GH 1DL7H 5B7MA 5D1QB 1QA9A 1EERB 1G9HA 3W11D 3GLDA 1KLUB 3FQ2A 4F2MB 3D69A 4PRBB 3BXNA 4M48H 5I73C 2DYSB 1OY3B 2XV0A 3T1FB 3GI9L 5HHQB 1J5IA 3B9KB 4WU5A 2G2PA 3D48R 4E2OA 3MTXA 3APMA 3BAWA 3MLVH 3BD4A 3MUJA 1SJMA 4KK6C 4OLVL 5FW8A 5DMIL 1H8SA 2WQXA 2H6PA 3KXFB 3U0TB 4A38A 4J3OF 3MV8D 1J8HB 4J2QA 4XNXL 2XIBA 3TZVD 1UASA 5E8EA 4FQ2H 3UTSD 2OXGB 4JKPH 1OAZH 4FMKA 4ZXBD 8FABA 1GY1A 5I76A 4FQXC 1I1AC 2DTML 2YA2A 3CIAA 5FEBA 5KBNC 5T5NG 5KSBF 1VGEL 4JHUA 4AEFA 1ZKAA 5PAZA 4AJWA 2E27H 1GJIA 4C56A 3SKMB 5E2VH 5CP3A 4R0LB 3I02A 2BFVL 4QHLB 4AM0Q 4F9PA 2GIXA 1Q1PA 5FM4A 3W5NA 2ZXGA 3VXPA 1GZHA 5G4OA 1FYTE 2N7SA 1NCDH 3QNFA 4Q2ZB 1HNFA 3CQFA 3SJVD 3OAZK 1CLYL 2DQHL 4ATTA 2ZKXA 2VISB 2XZAL 3ALWA 1UB6B 1PZUB 3QIWD 5HYJA 1I4FA 2VN6A 2V3FA 2NR6A 5E1IA 3J07A 4YDKH 4M93C 3FT9A 1J1XH 4FL4C 1JK9A 4P46D 3ZDYB 2D3LA 4JVUA 4FABH 2WQAA 5EU6A 3NDZE 4QXTA 3T3PF 2GY7B 4M6ML 1GSKA 1MAMH 1SY6H 1MLCB 4HXBL 4HSCX 3HZYA 5KVDE 5C0GB 1T1YA 2ADIA 1W0WA 3NCCB 3POCA 5D1ZA 2APVA 2ROYA 1RK1B 4YSRA 3LH8A 4WO4C 2OZNA 3UDWA 3A6BH 2VM4A 4NIKB 3TPUB 5DEFB 4OH2A 2Q0ZX 5CZVH 1T21B 3ZLQC 2WXPA 3KPMA 1FFPA 1QX1A 2F0CA 3W11C 3Q1SL 3FCBA 4FQ1H 3KS0H 1NFDB 2FJFB 4NM8H 1SJXA 1I1YB 5D96B 2GBVA 3G9AB 3DPBB 4HKJB 4LGRB 2OCCB 5DJZA 3O6FB 4S1SL 4Y0GA 3TV3L 1I1RA 4NN6B 2XWBB 3NJMA 1NFAA 4O9HH 4WHTB 1MHEA 4TNGA 3MGOB 5GRZA 1ZXKA 1F6FB 5DD0H 2WSDA 3TZVC 5ANHA 1O6TA 4ZXBC 2EO9A 2ARWA 5A2CA 3U1PA 3BZEA 1ZHBB 1GR7A 2BSSA 2ARJB 4U6YB 2X5PA 4B3VA 4HFUH 1IX2A 5DHVA 4G7SB 4YIQA 1UOVA 4JZOB 1F3DH 3FQWA 2MOQA 3HZKB 2HTLD 2JB6A 4EI5D 5HI3D 1BDYA 5BW7A 1I75A 5IEHB 3VFGL 3WTSA 2O5YL 4P4KC 2CQVA 3TH3T 3N1FC 4PCSA 2B5IB 5I6OA 1V7NH 5I8OH 4MJ6B 3VFTB 3ARUA 3I6LD 3KLLA 3VXNB 3QIWC 4U6HA 4XN2A 4AEEA 2YEVB 1NICA 3EJYD 2RIKA 3MA9L 2XX0A 1KTCA 1XT5A 4Y5VB 4Z1PA 5KTEH 4DESA 2YPLB 1AR2A 3KJ4C 5KSUA 4Z77B 5GGSA 4DK5A 5A6IA 3GQFA 5D93B 2XV3A 2F54D 2VT0A 3S36H 4DPRA 2BMKA 1UFUA 2IC2A 4FOMA 2XPZA 3W2DL 1RJYB 4B53A 2PETA 2J8UB 5DWUH 5EN2B 5D6CB 2UZXB 3EFDL 3JTTA 1EEUA 2GT9A 3M45A 1R19A 2C3GA 3SKNA 4K2UL 2VITA 4JR9H 2CJTA 4K5LA 1A4KB 4HKXB 4BINA 4U6VH 4K73A 4RQQA 4BZYA 3LIUA 1Q9LA 4GMTL 3O6LL 4FP8L 1J0IA 1S3KH 3LZQA 4MD0A 4BA0A 3IFOB 5IK3B 2Z8SA 4GW1B 3OHMB 4R5XA 3IFNL 2CJUH 4KY1H 4AE1A 1AACA 1JF6A 4Z7QE 3B83A 3VFRA 5DEGA 2YXWA 1CFNA 2D3NA 3RNQB 1HZHH 2DM3A 4XX1E 5FYJE 1RVFH 4BFFA 1TVDA 4AMWA 1T3FB 5DTFB 4YSAA 2FL5A 1UD5A 4XRCB 1ETZB 4RRPG 2C7UB 5DJDA 5HGDA 1ZVSB 3M1BA 5DLMH 3INOA 5E8DH 4EVNA 2HTLC 3DUUA 3FUJA 3FUMA 1BVLB 4EI5C 1PW3A 5HI3C 4ZNCD 3QWRD 1UWEL 1S2EA 3AG1B 4E9SA 1DQJA 1UT9A 5E51A 5F9OH 4E9VA 1N10A 3KL3A 1K5WA 5EZOH 2ZUSA 2K8QA 1UACH 3ZKXC 3RZCB 2UYLB 1QAWA 4F8TA 3EJYC 4NP4L 4RH4A 1RUPL 2DBLL 2P5WE 2J1WA 1OM3L 5BV7C 5IJKA 4H25B 4MNGA 2AQ3A 4LRIA 2IFFL 5HJDA 5DQJA 3FQRA 2OQJA 1C12A 3O3AB 5JO5B 3V0DA 3BUBA 1HILB 1UGNA 2GTZB 3QDGA 2WUCL 1NAML 1HFUA 1IAIH 1TYEB 2AQQA 2B59B 2CNYA 2RJMA 2PYEB 3QORD 1LNUA 1WWWX 4OD2A 4F33B 2EYSB 1XR9A 3G5VB 5IKCA 4H26B 1IB5A 2BVQA 3MV7B 4BSWA 2J5WA 5DD6B 5L0QB 2OYLA 4F7MB 4YDZA 1YEFL 4IRJD 1U3JA 4QXUL 1N64H 3GXMA 3JTBA 1U8IA 5E8OB 2WXIA 4Q6KA 3EYOA 4PCYA 3WIAA 4N9OB 4PR5A 2FGWH 1TJMA 4XB7A 1QHQA 3ZW3A 3BJLA 1PCSA 1X5ZA 2B08A 2CDFB 2X70B 3GMLB 4AQ8A 1DVYA 3V2AR 3B1UA 5J4MA 1FP5A 5FW6A 3D05A 5CGYD 3LKNB 4OSUL 1M9SA 1A1MB 3K80A 4J4PD 2GEEA 1M6UA 1QVOA 2ENYA 1UD8A 4X9FA 2GABA 2DJUA 4O58H 3B7SA 3ETSA 3ETBF 2XRAL 3U36B 3ZTNL 4XP4L 3BVWA 4HZAA 3N42F 3IGLA 1YQVL 2B1AL 5C0EB 4RNRA 1QSVA 3SBWC 1QR1B 4ZO7A 3QYCA 1MQ8A 2APSA 3JV6A 1G9EA 4Q7DA 1JGDA 4ACPA 1U3NA 4FQIH 2EILB 3D9AL 3PAZA 1Z9LA 3INUL 4HVBA 4WNSA 4DKFH 3VD3A 5JUEL 1WFNA 3FUIA 5T3XH 4NXKA 3GIZH 5LB1A 4OAWB 4JFOB 1WWAX 2XQYG 5F0LB 3RPKA 1I3GH 2AQTA 5DD1H 5FYKL 5IBLD 2GJZB 3IJYA 1C8QA 4IKKA 2I7SA 4HCIA 1DBAH 1HXMA 3QORC 3ATDA 4JPSA 5BOPA 7FABL 1XF3B 4DCQA 3APFA 4PJ7B 3VXMA 2C9UA 3A0OA 5J12C 1BZDA 1M53A 5IQMA 2RR3A 2XI9A 2P8LA 4LPYA 1A6UH 2DWYA 4FNLL 4IRJC 4OKVB 2HRHA 3Q6GH 2ADGB 4XNUH 4FA8A 5AVRB 4F93B 1L9RA 1EFQA 4PRHD 4OCYH 1A65A 4WFHE 4AKQA 1N6QL 4GQ9L 2QZQA 4S0TD 5GISH 3RJQB 3LKOA 2UUDH 1PNDA 4DKEL 3MRGA 3PGDB 4QAMB 1KB9K 4K71C 1CYWA 1HE8A 1INQB 1FZOB 5DZVA 2BRRH 3IPEA 4UIKL 1LP9E 3ZYZA 3AY2A 4MLSA 1YY8B 5CGYC 2JMRA 3VRJA 5AD0B 1X9UA 3L2MA 5GZNA 4S1QH 4J4PC 4LQ1A 4QXGL 4M03A 3D85D 2YEQA 3DX9A 1MJJA 1EJFA 1UKSA 4CC4A 5F8RC 3DUSA 1GGYA 1QFWH 1GJWA 2Z7WA 3JTSA 3IGUA 3CVDA 4WUKH 5LBVA 4ZMPA 1JWUB 3GIVA 4I7ZC 4H40A 5LN8A 1NMAL 1P4BH 1OD7A 2VLLB 3W5MA 1E8YA 2VIRB 4NRYB 3VA2C 2NYKA 4GQPH 5D5MF 5D7LA 5FPIA 4JFXB 3U4AA 1XF5A 2X10A 4UQIM 5FO9A 2FD6L 4X4MA 4OZHF 1E27A 2WNXA 2WSPA 3ZO0A 5E70A 3L5XH 3P9LA 4HWEL 3NJJA 2VZVA 3CN2A 3CX5J 3FRUB 3WFDH 1IJNA 4KTEL 1IFHL 3W9EA 3IXAA 4XNBA 2J73A 2WXFA 1CD8A 2CA4A 2VW7A 3VX0A 4YSEA 5HHOA 3GKZA 1RZ8B 5JHDB 4G7RB 2LTQC 4MMZC 1QPPA 4HHAB 4EDXA 5CFAA 4XC1H 5IBLC 1CDCA 4LBEA 4C55A 3KWWA 1AMYA 1X5JA 3DX2A 3WFBL 5TDPB 1XCXA 1AHWB 3MOQA 4NC1E 4D9LL 1KBBA 4PRPE 3TWCH 4GNKB 5BVPH 5GS0D 2XICA 1DJHA 3BAKA 3D2UA 4PJEB 1JCVA 3MREA 3NG5A 1EUTA 3HNVL 4OIIL 3DK2A 1P4IH 2NY5C 1G0DA 1S9WB 2PWHA 1I8LA 1V54B 2HX9A 3MRRB 4KKBD 3WN5B 3ZTDC 2EO1A 4XNMB 5TE4L 4MDJB 5K9QG 4IGBB 2QT6A 5F7WC 4N26A 2PMZA 5D7IE 2O6CA 2QPUA 3M6DA 2FO4A 2FX8H 4ISVA 1LK3L 4NWUH 1NWOA 3QEUB 3QDJE 4QGYA 1C08B 2R7EA 4ODBD 4XOBA 4KUZH 1FRGH 1NANI 2HMID 2C4FT 2XPGB 3MOBL 3I50L 3QPKA 2FNBA 4LT7A 1CTNA 2DQEL 4HKBB 25C8H 5KYYB 3ZRCC 4N3TA 5AZEL 4R7LA 1AAJA 4R7DA 5DJ8A 2G3MA 4GI9A 3F6JA 2DQJH 1XAUA 3IFLL 4JY4A 4LLDA 2IV9A 1SYVA 2IAMB 3BH8A 4JRYB 4NLAA 5DJCA 5DK2A 3RB5A 3WKQA 4EN3A 5AYUL 5B1JC 4J2XA 1QSFA 1CO1A 5ALBH 4N2NA 2PTVA 3H3PL 1T0NB 4NPYA 3VE0B 1BSIA 1FL6A 3HLAB 1RIVL 1DN2A 4DZBA 1JZ7A 2E7HA 3KHQA 3HRZA 3RAJL 3D08A 2UY6B 2VRKA 3E1F1 4H13C 4PVLA 1MCWW 4HJ1A 4KRPB 3DKHA 4P3CH 3V5DA 4DFHA 3NZHL 1ZJBA 1FZJA 1SM3L 1N8ZA 4OZIE 3GSUB 3UTTA 3TA3A 5J13C 1YC8A 4PJGA 4MASA 4RMBA 5F3HB 1KYOJ 4HIQA 4JG9A 3JSSA 4M4PA 3HPLA 4PB0H 3WMSA 4WAFA 4ZMTA 5GS0C 4GEJA 3DX0A 2ZSVA 5SWZE 2QV4A 4ELMB 3VFNB 4MMXC 1OPGL 4P5SA 2H32A 4NI6A 2EC9U 4IIQB 2JJUA 5J1TC 2RALA 4KKBC 1TSRA 3KPRA 2VDQB 2FR4B 5ANMB 2FSEB 4DGYL 2KDYA 1SFHA 4D8OA 1E7VA 3BQVA 1O9ZA 3RWCA 1CDHA 3U9PH 4QR7A 2Z7UA 2Y7QA 3KLQA 1BXAA 3AUWB 1U93B 1U8QA 2BVOA 1EFXA 4E9LA 3EF4A 2HJLA 2KLSA 2BJML 2HYMA 3ZE1B 1KGYE 5JHLL 1FG2A 3AVEA 2HMIC 4OCXH 4JAMB 1ZV2A 4BIKA 1T2QH 1IGTB 3UTQB 2X6AA 3MRLB 5M94B 5T3ZL 1QHOA 4KK5D 3F7YA 3UERA 5IOKA 1MCQA 2XVLA 5F7DA 4Y4HD 1HZKA 1FC2D 5L4FA 2X89A 4IK7A 3KE0A 3D30A 1ADQL 3OR7A 3LXAA 5DC4B 1PDKA 5A40E 3V5KA 5CCKH 4R4NC 2DWDA 1NBYB 1FNGB 2X4SB 1UG9A 4HD5A 3HCVA 4H8VA 5GRVK 3DTUB 4JY5L 4NHUA 2VZSA 1PTZA 1N26A 5IMLB 1G6RH 4HXAL 3DGGB 3BHBB 3F3HA 4OZFB 4J6RL 1Z3RA 2EVFA 2VLJA 2B4CC 3BKYL 2Z9TA 4HWBH 4BJLA 4Z7WA 3UPRA 3P2TA 4Q0XH 4ZAKA 1E5YA 3CMOL 5F1NB 3HMWH 4D7BA 3V5HB 4FQQB 1OK0A 4QHKI 4ZRGA 4L3ED 5DVNA 1P5UC 5MEOB 3WKNA 4PJFB 5D70H 5DQDH 1Z66A 2ZKYA 5D1QA 1PL3A 4G1EB 4NQCD 5B1CA 1KLUA 1K5NB 1S4IA 2OW7A 4LEXH 1F2XK 4XXDB 4F2MA 2CGRL 3SKUD 4IW4C 2KT6A 3UJTH 3HG1E 3WHXB 5LBGA 4IBTA 3T1FA 4JANB 1RZGB 1UZGA 3B9KA 4FYQA 3WFHB 3ARFB 5AVZB 1F00I 3TBWA 1KENH 3HS0A 2Q8AL 1JPSL 1Q1JH 3LZFH 1LO4H 2VXQH 5KANG 3KXFA 3U0TA 2IPUG 3LKRB 3Q9PA 3TXAA 3WIIL 3I75A 4LSQH 2OXGA 5GHWH 3BC9A 3L9BA 4Y19D 2WP3T 1CL7H 4YHOL 4I4WA 1INEH 4NN7B 2WSKA 4R0LA 3T6VA 1OF2B 4ILDA 1I9IH 4QHLA 2QGBA 3L3OB 2VDPL 4LPCA 3NAAH 3JVGA 3QUXB 5BZWB 5ADOH 4PWGA 2G30A 4ABVA 2VRAA 5BRZE 3VD9A 1JV2B 1D7BA 3FB8A 1K4DB 3K71A 5D4HA 2V0AA 3P3TA 4KK5C 4XP6H 5CKAA 2AJSH 3PYCA 3AAZB 4JFVA 4X7TB 4Y4HC 2EICA 2D9CA 2H4EA 2IQAB 4OZ4B 5K1NA 3AT9A 2P52A 5KSAD 4IHBA 2R0WH 4JFHE 1VESA 4DGIH 1M2OA 2XQYK 3Q8CA 3OJMB 3FMGH 4PCKA 5FUOL 3SGKA 3D6GA 1DUZA 5C0GA 5KSVB 1ZEAL 4QLWA 2V7HB 1RK1A 2GBUA 4DO4A 3Q8EA 2HVBA 3NA4A 4YPGB 1EEQA 2VXSH 4YHPA 5TFSH 3QI9B 3ECUA 4RMUA 2I9TB 4PJIF 4YBQD 5DEFA 3TPUA 2F8XC 4U4IA 3RFZA 1AS6A 4X5LA 1UZ8B 1T21A 3IDYC 1A6TA 1VEMA 4Z3JA 1IGMH 2UWEB 3GB7B 3UYRL 4JDZB 4GBXD 1BQHG 3FOLB 2H1PL 2XXCB 3BW9A 4BGDA 1GJUA 1NFDA 2FJFA 2Z0UA 2L7UA 3PWJA 4LP8A 1I1YA 4HKJA 3DPBA 1QWHA 5MP6H 3PXLA 4XAKD 2JKJA 1GTFA 1OV8A 5IF0B 3O6FA 4O2FB 1YYLL 2AI0H 2EKSB 4YHZH 2XWBA 3WIHL 4YSCA 1INDH 1CURA 1D5MB 4QJ3B 4ZOCA 3ZZLA 4C4BA 1KPRB 1BYPA 3LEVH 1V27A 4WHTA 3EGDB 1TZIB 3CSTA 5AW7B 3PAYA 4MX7B 1FAIH 4DSYA 4NUMA 2X9YA 1XGRB 2W80C 5GRUL 2AK4A 3UJJH 3OKDA 2Y0SA 2A77L 1UH4A 2MQ3A 3TBTB 1KYDA 5LNGA 3WXWH 1ZHBA 2F58L 2BNQB 2ARJA 4U6YA 4DAGL 4YR6B 4PB9H 2VXQA 3RYMA 2HSIA 4M5ZH 4PVMA 3LYRA 1CMOA 2NNRA 3ARWA 3PIQB 2V9RA 4L4TB 4LASH 1NCIA 4WI0A 4I48B 1CBJA 3CFKB 2M1KA 3EH2A 3LS4H 3QQDB 3VFMB 3QIUD 4AV4A 4ONOA 5IEHA 1SMDA 3L3JA 4LCUB 4X8JB 2ZXDA 1XVSA 3TTSA 4MJ6A 3SGDH 3VFTA 5IJDC 3N44B 4JZJB 4YLQT 1TQCB 3PL6B 3V7AG 1LLAA 4DPBX 4ZMZA 1KCWA 1GYWA 3KYKL 5KSAC 4JMXA 2X6UA 4XNYL 1ITBB 5GGRB 2YPLA 3A3YB 3Q6FB 4HS3B 1E50A 4ANXA 3N1PC 4JRFA 1JDDA 1JTTA 4Z77A 2BK8A 5I1IL 2DL9A 4LO9A 1BG9A 2WQSA 2NUPA 3MAWA 5BV7L 4KPHH 5EBWB 4GG6B 1HN1A 1R46A 4L1DA 1WS8A 2XJKA 4YBQC 5I1DB 5JW3L 1XAKA 3BLKA 1EIBA 3DARA 5ENWB 5D6CA 2UZXA 3B2PA 4XCYB 4EBQH 1XGYL 2COQA 4I88A 4OQTH 4U1IB 4GBXC 1CQKA 2AVGA 1A4KA 1BW8A 1AY1L 2J55A 1IUZA 2XACC 2ZYHA 4HKXA 4KMLB 1OAUH 4LGSB 4KGLA 4PWIA 3ZZSA 1YPZE 2EDNA 3FT3B 3AWFA 4P4RB 4JPKL 5A43C 5C1MB 3RNKB 1DQDH 3ESPA 3IFOA 2MCMA 5AFAA 2MEJB 5IK3A 5I15L 4PJDA 5E6SB 5KVDH 2LFGA 4L4VE 4X6BB 3NH7H 3BKML 2AC0A 1E5AA 5JIMA 2QVTA 3GK8H 2A6KB 2HPTA 3RNQA 1WP6A 1NTDA 2R2EB 1QFHA 4AMKL 3VFOB 1DANU 5E9DB 1A3LH 4XRCA 5ECGA 1ETZA 2APWA 1AE6H 1ZVSA 3TBVB 5CU5A 2GJJA 1H8OA 3TTYA 1ZCRA 1BQHB 1SLXA 1S7QB 1BVLA 5KSBB 3QIUC 4MZRA 1JUFB 4V1DB 5IUSA 4ZYKB 2RFXB 3U6RA 4FNPA 4EUPG 3WY2A 3UPAA 1QKZH 4MNQE 2IWKA 1CS6A 1XH3A 4R90H 3RZCA 2UYLA 5K59F 3NCEB 5I26A 2ZWLT 5KBKA 3F7LA 2CG9X 3IDUA 4N2KA 3UL4A 4NNYB 4KKNA 1KN4H 3LD8C 4WV1C 4YSOA 2X4PB 1NGYB 1BZ9B 2VDKH 4XC3L 1S7RA 2R2BA 3TP4A 1BPVA 3MJ6A 3EYVB 3HE6A 5FA4B 3O3AA 5JO5A 2DYPA 3AREB 1HILA 2GTZA 3NACH 3EHBB 4BKLB 3QXWA 4NKQB 4QTHB 2RQEA 2B59A 1E8XA 2BIHA 4N1HB 1ND0B 3T3PB 5I5MA 2EYSA 3OL2A 4Y1AD 2A1WL 3WFEL 3G5VA 1S7UB 5GS1B 3QDMB 4F7MA 3QAQA 2HH0L 5E8OA 1IC4H 3GUFA 2ZUQB 1L7IL 4CKQA 3BFOA 1WVZA 2IAND 3N55A 4XPFL 1E7UA 1OAYH 3LRMA 2Z1KA 2CDFA 4UU9A 2X70A 3GMLA 1SDAB 4UIMB 4OQTA 3REWB 1IQWL 3LKNA 1U8OB 4O4YL 1A1MA 4KV5F 3WG7B 2XKUA 3NBNA 2I27N 1JWMB 4MJID 5C0IB 4M29A 4IOSD 3V4LA 4M8QB 2B3IA 1MCDA 1VFAB 1WFUA 2QVFB 3OHXB 3D8MA 3Q48A 2BVUA 2YUZA 4P2OD 1E5UI 2G3NA 3GJFB 4TLKA 1QBBA 1PZAA 3GMPA 3N0PB 4QRPE 1ZLWH 1FBIL 1NEZG 1R3JB 3R18A 4WZ9A 4CU6A 1YMMD 3EO0B 1LDPL 5LHDA 3QXVA 5DF0A 5E0QA 3OTTA 4FQHA 5FFLA 3JWDH 3QQ4B 2Y69B 3O4OC 1H3PL 4IDLA 4HOXA 2ZG1A 5JMOC 5D7JB 4OIAA 2H0EA 4RISH 2A9BA 3FFOA 3ZE0B 1AYRA 2OMBA 2YN5A 4GRWE 1EBAA 3UFIA 1RZKC 1N7MH 4W6XB 1M2VB 3D18B 4JFOA 1GGCL 1NAMB 4LSSL 2GJZA 5AENA 2WLKA 3BDBA 4FKEA 1R5WB 2AGJH 4P07A 2ZNXA 2A73B 5FYJH 1MIMH 4PJ9B 1QLEB 1UOWA 6PAZA 4WU7B 4IBZA 2UZYB 4PWFA 1EMTH 4NRXB 3D34A 4PBWD 3MDJA 5CINH 1E9PB 1II4E 3DX8B 4PJ7A 2FEJA 2EZ0D 1EH9A 3GLZA 3ABKB 2OL3B 3O8XD 5BOJA 5AWNH 4L29B 3Q43A 1P4LB 1ZS8B 2NZIA 2WINA 2XN1A 4G6JL 4HCGA 4W81A 2ZAIA 5EO9B 4OZHE 5IG7B 1NGXB 2IPUK 2NY5L 1YEHH 3DWTA 1T66D 4FKHA 4KHTL 5HSFA 4YHIB 1A6VH 1UUNA 2IH1B 4YDVB 5I1KL 1UOKA 3PGDA 4XPTL 4X5PA 1INQA 2J6EL 4K94C 1OOAA 4L5FE 2OMYA 5AD0A 3L9EA 5E5MB 3HPJB 2NTSP 5DS8B 3ZDZF 3LIZL 4KKCD 3CHOA 4DW2L 1NCNA 4P99A 1WT5A 1LMKA 3VYNA 3ETBJ 4NKDB 3ZY7A 5JR1L 5DJYB 1IM3B 3TEZA 4P2OC 4HJEA 3MV9D 3LMJL 3EYQD 2YWYA 3K81A 1JWUA 2J57A 4KQ4H 2IPTH 1A9EB 2I5YH 4U4BA 4ODSL 3MBEA 5EG6C 4QI3A 1FAKT 4FERA 3T4AB 2LU3A 2VIRA 4NRYA 5MENE 5E08L 5KVEL 1IC1A 3HRPA 5C0DA 5A3IC 4XBEH 1AD0B 3HBZA 4ONHB 1BV8A 1KCVL 5SX4I 4G82A 5IV2A 3O6ML 5HI5C 4ZTOL 3NPSB 5T3ZE 2ZICA 3ZT5A 3PUCA 4KXZI 3T0DA 1NC4A 2BHUA 1F2QA 3FRUA 4GW4B 3EYFB 3LXUX 1SNRA 1P6WA 1UQSB 3N43F 1M7DB 3NFSL 2SODB 1RZ8A 3TF4A 2L7JA 4HHAA 4YC2C 4L8DB 1DJWA 5C09B 2L8AA 3U4BL 4KDVA 4FQCH 5TDPA 1AHWA 1EVUA 1CXIA 4YK4C 2VSMB 3FBQA 4WI3A 1UM6L 3QEHB 3CVIL 4I1NB 3F04A 4MQTB 2OYPA 4JHAH 4PJEA 3OAYH 4W6WB 4B9PA 4Z0BH 2EZ0C 1IC7H 3BVDB 4H88H 1S9WA 3N6YA 2O5XH 3O8XC 5GS0L 3MRRA 3ZKSD 1UM4L 1AQDB 1SBBA 2AEPH 2QPFA 1P84J 4LCCB 2A6DB 4HK0B 1NCWH 4XNMA 4GO9A 4IGBA 3SBQA 5E4EB 1ZE3C 4XMZA 1T66C 3E9UA 4CMHC 2WLHA 5D4QA 5KZCD 3TO4D 1ZLSH 5FYJU 4JBSA 2ZONA 4UB0H 4ZNEA 1CXKA 3ABGA 5I82A 3GUTA 4H4NA 1XTMA 4OIBA 3PGCB 4ANKA 4G11A 3PNRB 1DBJL 3VD7A 1YJDC 3P1VA 1C08A 4WI9A 5LN4A 1N5AB 3TBYA 4KJWD 1HHHB 2WXGA 3O4LB 4HU8A 4R4FL 1MFEL 1G7PB 5AUMB 2Z7ZA 1ICTA 4HKBA 3EYQC 4IHOB 4G8GD 1UTDA 4A04A 4KTDH 2AQPA 3VMPA 3KBEA 1SEQH 1I9JL 4QY8B 1AR1B 3BT2L 4TVUA 1VFBA 2IAMA 1DR9A 2PXYB 2AJ3B 4QTFA 1MI5D 2HRPL 1MW1A 4HJ0D 3CNKA 3BN3B 2OMXB 5ISZD 2AXJA 2R0LH 3N42B 4QF1B 3GJEB 2Z8RA 1CCZA 1QATA 1X5XA 3VE0A 3ZDXE 4DKTA 3TT1L 3HLAA 1ZT1A 2NY6D 1KYAA 1HKFA 4KNSA 3EYUL 3FJTA 2UY6A 4ODTL 4W4OA 4P57B 3SJVE 5L4MA 2MJWA 2GIYA 4J23A 4F7PB 3LPGA 1I7RA 1GL4B 5BRQA 3VJ6B 3QQXA 4KNQA 2B4CL 1QEXA 5ID1A 1UURA 5TK2A 3RUGE 3OXSB 4P2RB 4W9ZA 5F3HA 1EWHA 1P9MC 3RIFK 4AWJC 3RLSA 2Z3FA 1RZ7L 2KHAA 5DFVC 5GXBB 1EK3A 3QC6X 4ELMA 3VFNA 1JHLH 2BS71 4JG1L 4K23H 1OL0A 1FFRA 5KYWB 4A7UA 4K3JH 3RPBA 3EOAB 3JT0A 1U92B 4HUNB 5J56B 3STLB 2W8CA 1T20B 1QLRB 1VA9A 2W9EL 2B8OT 3CN4A 4JFFD 4X6CE 5GJSH 3ESMA 4QRQA 2FR4A 1XB3A 1Q94A 2XXMB 2OYKA 3O9WB 4TUKH 4YHLL 1TZHB 4W9LC 3A4EA 5EDXA 1UJ3C 1MJUH 5F9AC 3TO4C 1N5YH 4MQ7A 3HKZA 4PGDB 2PO6B 4MS6A 3IM1A 3SE9H 4OZGE 5E03A 5FKAB 2NTFA 3FUHA 1T5XB 1FL5B 5LGJA 4JFYB 5EB9A 4KJWC 3NJGA 1DSFH 3BGAA 3L5IA 3KAAA 1ZS2A 4JAMA 4JQVA 2VN3A 2PYFA 3MRLA 3C60B 4JO1H 3G7TA 3MNWB 3WKMH 4HC1H 5CJ5A 3RVXD 2ZPKH 4G5AA 1BM3L 2PNDA 5J1SC 5HYQB 2X09A 1GYAA 4XVJL 4XT1C 4OM1H 4ZFOL 4U1MB 3CFCH 3F84A 5E00B 3MBWB 1IQDB 1L9QA 1NBYA 2X4SA 2XBTA 2ZOUA 4HJ0C 4DPCX 2EE0A 4YFLF 3KJ6H 3X1NA 1I1CA 3Q2NA 2CRMA 1SHXA 3DHUA 1QI3A 1ORSB 5IMLA 5TH2A 1NMCB 3DGGA 3BHBA 4OZFA 1OE3A 2K8MA 3BD5A 4UDTB 4YFLI 2NY6C 5D5MB 4ZFFB 4F3FB 2R4RL 4GP8B 4EZLA 1HL5A 2BXZA 2HTKD 4OZHB 4WTZG 3PFUA 3F7VB 4OLVH 3CIQA 1CXFA 1ZK5A 5F1NA 3UX9B 5DMIH 3V5HA 4FQQA 4DOHE 5MEOA 2G4EA 1KJMB 4X9GA 2F19L 2V9UA 4PJFA 2GY5A 1TQBB 3G6JE 3LKSA 1B88A 2D2OA 1HHIB 2VR6A 3F6LA 3ASWA 3BO8B 3CMGA 3QFJE 4KKRA 2DTMH 3QFGA 4BXVA 1QBLL 3WHXA 1VGEH 5I73B 4PTUB 4JANA 1F41A 4QOKB 1RZGA 3NQIA 5DUPL 2BFVH 4NUQA 4CJ1A 2VAAB 1WUNT 4XBPA 5T33L 5EEYA 1U0QA 5BUAA 4DJMA 2RH0A 3K72A 1MHHA 2F54E 1U9KA 3QXAB 2DI8A 3TESA 2AEQL 3LKRA 1CLYH 1HESA 2DQHH 2QV2A 3LXCA 2NZ9D 1OAXL 2XZAH 3L5JA 4RWHA 2NNFA 5FUZL 4IJTA 1F3RB 1TJIL 3VQMA 4M6MH 5ACZB 1OF2A 5E95B 3L3OA 1B2YA 4HXBH 2NY4C 3QUXA 5BZWA 3FONB 4FDWA 1QEWB 1UCBH 3VXQB 5I6XC 3RHWK 1JV2A 3FFCB 5IW3A 1GAFL 5K9KA 1K4DA 3F2LA 1E65A 2HFGL 3B2VL 5IROA 3RVXC 1O9VA 3OXRB 3N1QC 4X7TA 4LCIL 1FCGA 2AJYL 2IQAA 4OZ4A 1W16A 1T4WA 2XA3A 1G94A 3S8GB 2WIIB 4IJ3C 1U36A 1KN2L 4FHKA 4PJXF 4JFTA 4L37B 1SN2A 4M93B 2H7WA 4ZOAA 3D3VD 4MXQC 3T08A 3C8DA 1ID2A 3OJ2C 3Q1SH 3BGFC 3PABB 4HC1A 4IK6A 1DUYA 4QHKJ 3LN9A 4YPGA 1IGCL 2YBRA 5JOFA 5L2JA 3NQKA 4S1SH 3TV3H 5BO0D 3QI9A 1OK8A 3AABA 3AXHA 2I9TA 3WDJA 1T22A 2HTKC 4OF3A 1QWNA 4XMKL 4E41E 5AQ0A 4Z6AT 2HN7B 1NAKL 4N3UA 2Z91B 5F7YC 4C57C 2VLRD 2UWEA 3GB7A 5ICYB 2XWTB 2GKIA 4JDZA 4G8FB 3X13B 3FOLA 3VB8A 5AB9A 4BZ1L 4XNAA 2Q7AA 4KJQD 3QUMB 1UEMA 4WHYG 2ZUTA 1FNAA 3ZHKA 1P6AB 4U3HA 4CVXA 1J05B 4DIXA 1U8JB 4J1UA 4O2FA 2EKSA 3BAIA 4RMSA 1T2XA 2KDGA 3OVUB 3C8HA 1D5MA 1QRND 4FNSA 1SOSA 2QHRL 2EDFA 1TZIA 4HA1A 2HLAA 3G5YB 3VFGH 3Q5YA 1XGRA 2O5YH 5MERB 3MV8B 5C9JB 1F4YL 1SXCA 2NZ9C 3ARSA 3UTSB 2ZUUA 2QVMA 4ZXBB 1OT4A 2O1AA 4HWZA 5EF3A 2BNQA 4AIEA 1OKEA 2YAHA 4BQBA 4NQSB 4YR6A 1IM9B 3WJJA 4QNPE 4TKWA 1ZLUK 3MA9H 3UH8A 3CQQA 3SPJA 4L4TA 4I48A 3QQDA 2FTAA 3CFKA 5DZLA 3UAJD 1TSHA 4F7CB 4JRXD 3PU7A 1MY5A 4XVTL 4M7KL 3V6FB 5DSCB 1NJ9A 4X8JA 1IVTA 3LVTA 5I71C 5KEZA 3NK3A 3H3KA 5HJGA 1AIFA 4ES9A 3W2DH 2H1XA 2X0UA 4JZJA 3WE6B 1AQHA 4XPAL 2HLFD 1XSKA 4HMDA 4Y5YA 2OZ4L 3EFDH 5HYEA 4N8VB 2JXMB 2O5ZH 5C0CB 4HJJL 2ARJQ 4P46B 4JCMA 4PMEA 4JFSA 5GGRA 1TYJA 2EIEA 4AW4A 3L7EB 5KJ7E 1RUAH 3Q6FA 5BVJA 4AKOA 4MTMA 3GDBA 1U95B 2DQ6A 4AYMC 1DSWA 1NINA 1DHKA 2VDLL 3T3MF 2CDGB 4LIQL 2HKHL 1FO0L 4GMTH 1MFCL 3O6LH 4FP8H 5EBWA 3IAGC 1A1OB 1FH2A 4BHUA 4GG6A 3QG7L 4GT0A 3GBML 1MUJB 1WBZA 1KMGA 3GC3A 5AAPA 3IFNH 4E0RA 2J12B 5ESVB 1F6AB 2BSTA 4XCYA 4U1IA 5E1HB 3CSYB 1MHPL 5L7XL 2Z31D 5G5DB 4RAVA 1KV7A 1WJ3A 4DWHA 4ICXA 4XTRD 4DEPB 1G1YA 4KJQC 1NCJA 5CIPB 4Z7OF 4X9BA 2CRZA 3UOAB 4I1RA 5HYSG 4P4RA 1JCKA 4HUMB 3GJFH 3R8BB 1LEGB 3U1SL 4ZW5A 3RNKA 4N8UA 2FQGA 3ZQWA 3EADA 2L3BA 4RFEB 4W9HC 4BFIB 4L3AA 3THML 3HZVA 3UBHA 1BQKA 2ADJB 3QNXB 3CSPA 5DURB 5IHUL 4B60A 1UWEH 5EWIL 4G7YL 2Y7LA 2A6KA 2X2JA 5K1JA 2R2EA 4UQ2B 4MBRA 3S0PA 2JB5L 3VFOA 1T03L 3KVDD 5E9DA 3BFQG 4MKMA 4HPOL 4GKZB 3NT0A 2WTRB 4NP4H 4ANUA 2P7TB 1RUPH 2DBLH 1OM3H 3MLPA 3PHSA 4RFOL 1QYGL 3BE1L 3F7QA 1QLFB 4I3SL 2XCMC 2IFFH 5DJAB 1S7QA 3UAJC 5KSBA 3EUDA 3G5XA 3Q8BA 2WUCH 1NAMH 1JUFA 4V1DA 4EI5B 5CLWA 1S3RA 3VI3F 4ZYKA 2H2SD 2RFXA 1OTUD 4NGHL 3AW5A 2C26A 1Z5HA 1W8NA 4GOSA 3BI9X 4KMTL 3GHPA 4U33A 5AW5B 4Y1TA 3ZKXB 1YEFH 5IVZB 5TD4A 2PW2B 4G5ZL 4NNYA 4QXUH 4RX4D 5FO2A 2ZYRA 1WZAA 2X4PA 1NGYA 4ZW6A 1G9NC 4D0BB 3JV0A 2V7NA 5EBLB 3PGFL 3AREA 1RZKL 4UT7L 1PEZA 5L6YL 1NGZB 3C5SB 1TQUA 2P28B 1QW9A 1VFMA 3FRPG 2IALA 4OSUH 4RLDA 3FB7B 4QO1B 1JE6A 2GFBA 2VL4A 4P59L 1BVNP 5F7FA 1CFVL 4EPSA 4JQIL 3LEYL 3V8OA 2Z31C 4C59B 3S3CB 4PJIB 3A6OA 1WAPA 1WFOA 4XTRC 5I16B 2K7PA 5C6TL 3RBGA 2YLHA 5IMMB 1CGWA 2XRAH 3ZTNH 2VJ0A 4KAQL 4XP4H 6CGTA 1JZ6A 3D0VB 1CBVL 2PPEA 4F92B 3K7UA 1YQVH 3WN6A 2B1AH 3BZ5A 4BZ2A 4UIMA 1PY4A 1JXDA 4H0HB 5SWSD 3REWA 4JFPB 1NCCL 4R6UA 1U8OA 2A7BA 4AGMA 3NGBC 3FSAA 2JKNA 4NZUL 1N19A 3MJGX 2AKRB 4WTQA 5C0IA 3D06A 4K94L 1Y6KR 2GAZB 3D9AH 4M8QA 4XAWL 1VFAA 3OHXA 5D7HA 3INUH 2GSMB 4IBLT 1DJYA 3GJFA 4NUGL 2W9DL 1DQQA 1KIQB 1T1ZB 2IQ9L 2Z65C 4PRNB 4LLWB 4APQD 5JUEH 4UQ3B 1UH3A 1R3JA 4UBDD 5C3IA 4WDIB 3AU0A 5CZRA 3EO0A 3LNHA 4TULL 5FYKH 2R4SL 2AERT 1EAJA 5BS0D 2H2SC 3QR0A 1OTUC 4ZK8A 5HYSB 4MQSB 3BZDA 5D7JA 7FABH 4FTVD 3LEXA 5K39B 1YDPB 1I31A 1VSCA 2JI2A 4U05A 1GHFL 1L9NA 1MELA 1OSEA 2C9PA 5C08D 4OFIA 3ATBA 3QZWG 1F58L 1M2VA 4FNLH 4DVBB 1BFOB 1JZ8A 2ZSWB 4B7IA 4HALA 1NAMA 5L2KD 1EV2E 3BEVB 2FIKA 3FN0L 4LFHD 5TH2B 1N6QH 2A73A 4GQ9H 4PJ9A 2A74C 2F74B 2A4EA 4DKEH 4PIBA 2UZYA 1XGQB 3TM6A 3U6XS 3DX6B 4TV3A 2I7OA 3GMQB 2XVBA 1U2HA 4AQ1B 3DX8A 4UIKH 1PY9A 3LV3B 2BSBA 3HI5L 3ECVA 3OKOB 5EORL 2OL3A 4QXGH 4HG4K 1TVBB 1P4LA 3N2JA 4HHGA 1ZS8A 2EVGA 2PKDA 3V6BR 4IRJB 5EO9A 5IG7A 1Y0LB 5ESQB 3U9UB 1NGXA 3REVB 3IFPB 3C6SA 4KZEL 2AK1L 4YHIA 5CJQL 4YDVA 2IH1A 2FJSA 4JGJA 4IRZA 4JDEB 2X2UA 4HEME 1DN0A 1NMAH 2XQBL 5D1XD 1A7QL 1L0XA 4KQ0A 2ZTBA 1M7IB 1BFVL 3ENEA 3HPJA 2FD6H 1CDGA 2F7OA 4W9GC 5DS8A 1ZTMA 2VLKB 1F1GA 4HWEH 4NKDA 1YJDL 4QMEA 1IM3A 5GS2D 4JY6A 3R19A 1KYFA 3FRPB 4APQC 4YHML 3FT2B 3L48A 4KTEH 1DDHB 1A9EA 1IFHH 4D7PA 4POYA 1LD9B 4UBDC 5DUML 3DXAB 5E8PB 1SOXA 3JZ7A 2Z64C 3UCRA 3W0WB 3ZIMA 5TJWK 3JV4B 2V2XB 1TDQA 1XXFC 1BVNT 1RHFA 1VHPA 4N0FB 3WFBH 1AD0A 2VOTA 4ONHA 5DJXB 4D9LH 5DRZA 3NK4A 2OTPA 4AIZB 1PNCA 4AENB 4YLBA 5EPMB 3HNVH 4OIIH 5C0CD 1DQIA 3EYFA 1UXWB 4LL4A 1Q9OB 3KNBA 1U8MA 1UQSA 3ARGD 1M7DA 3VFSA 1SDDB 1BLNB 4G8AC 2X41A 5TE4H 1I8IB 4L8DA 4MMZB 5C09A 5CWSB 2D7QA 2XV2A 2YAOA 5FYKU 4NAQA 5CO1A 1ADWA 1OP5H 1H19A 3QEHA 3VFPB 3WHE1 4L4VA 1LK3H 3GZPA 4B41A 4JFED 2CO7A 4WENB 1FFNB 5CCJA 3VW3L 2W9LA 2XWCA 2YD3A 5B39G 4AQOA 2F7PA 1JZGA 2YGQA 1WD8A 1XEDA 3RI5F 2ED7A 2FATL 4LCCA 3MOBH 2A6DA 4HK0A 3VNZA 4MJ4A 3I50H 3VMOA 5J11C 1OCZB 4XCFL 3VQLA 2DQEH 1R47A 1LMIA 4PRHB 5HHNB 3SCMD 3Q1EA 4L3EE 1CT8B 1LHZA 2I32A 5AZEH 5EF2A 4HZLB 3BQUD 5D1XC 4BELD 4NQCE 3ESUF 3IFLH 1BD2D 1I8KB 2A83A 3WLBA 1E6OL 1UXMA 5AYUH 3PQYD 2XUWA 4HCRL 5EC1B 1HHHA 3NDYE 3SE6A 3O4LA 5DZJA 2ZCZA 3H3PH 1EEZB 4XNZC 3ZKND 1VB9A 1YAIA 1G7PA 4RA0C 1RIVH 5T1KB 3IDNB 2XLLA 3C5JB 2DY2A 3RAJH 1WQVT 4TSAL 5CJ8A 4C83B 2QPDB 2JI3A 3NZHH 4IOIB 4QY8A 1SZNA 1SM3H 5TGBB 1R0AL 1AKJB 4X0NA 4Y19E 4JKKA 2PXYA 1SJHB 2AJ3A 4H0GA 3SYQA 5AALA 1A0QL 2OMXA 4JJHA 4QF1A 4ELDA 2P5ED 1H6FA 3RX7A 1BAWA 5DRNA 5ERWB 1OPGH 2BS8A 4KZCA 4Q89A 4FNQA 3TBCA 3BAEL 4AXWA 4P57A 3ARGC 4N24A 4F7PA 1ULVA 3VJ6A 3OSVA 3NEOA 2JIXA 3HKFA 4WGWB 3SO3C 4DGYH 2MQCA 3P4NB 3AUVA 4P48A 3PLYA 1J87A 2G5UA 3OXSA 4P2RA 2BP8A 3FT4B 1QWUA 2D2CC 2WMPB 3FOMB 4QPEA 2OKMA 1TTFA 2WBXA 4NO5A 5K5YA 3GYRA 4MMXB 4OCRL 4K7PL 3MGTB 4ORGB 1K4CB 2BJMH 5KYWA 3SGJC 4U0RC 2Z0BA 5EZIL 3EOAA 5JHLH 4KK8D 1TQTA 3FQNB 1T20A 1QLRA 4XWGL 1JPFB 4PRID 1H6UA 4QRPA 2XN9D 5T3ZH 2JKTM 3O9WA 3U4EA 4XXWA 1TZHA 4P5KA 3SCMC 2ED6A 1NANH 2WVUA 1U21A 4PGDA 3BQUC 3EJRA 1ADQH 1X4YA 2D0FA 3B5GA 4WFGD 1HH9B 3IN2A 4YEEA 1PIGA 3WMQA 4HK3N 4B9YA 1KV3A 3V0EA 3R1GL 3HHMA 3DHPA 1T5XA 1FL5A 4JY5H 4XAKE 4EJ1C 1X3DA 3MLTA 5CJXC 3PDOB