2BM3A

Structure of the type ii cohesin from clostridium thermocellum sdba
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
162
structure length
162
Chain Sequence
b'KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCAFFOLDING DOCKERIN BINDING PROTEIN A
publication title Insights Into the Structural Determinants of Cohesin-Dockerin Specificity Revealed by the Crystal Structure of the Type II Cohesin from Clostridium Thermocellum Sdba.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Nuclear protein
total genus 34
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bm3A00
3GHPA 3FNKA 4FL4C 3KCPA 3KCPB 3L8QA 3BWZA 4U3SA 2VO8A 1ZV9A 4UYQA 1AOHA 4IU3A 2B59A 1OHZA 4WI0A 4WKZB 4IU2A 4UYPA 2W1NA 3UL4A 2JH2A 4UMSA 1QZNA 1ANUA 2O4EA 5K39A 3F2LA 4DH2A 5AOZA 4N2OA 1TYJA 4FL4B 5G5DA 1G1KA 5LXVA 2VN6A 2XDHA 2BM3A 2VN5A 2ZF9A 2Y3NA 2OZNA 2CCLA
chains in the Genus database with same CATH superfamily
4K3EH 3HAEA 3T6ZA 1DN0B 2VABA 5KYUA 3LRSA 1CL7H 5FCUL 2A6DB 3AY2A 3QO0B 1E8WA 1YSOA 3QQNA 4JX0A 3FYEB 1XH0A 4DGYH 3DUHA 5F7EH 3QDGD 5HXMA 3G5VB 4K8RL 3K2UL 5HYSA 2GHWB 2WCSA 5C0RL 1ZD6A 4IOFD 1MIEL 4PLOB 5BV7C 2NY4D 4AK1A 1A0QL 5GS0D 2KLRA 3SGJC 5LBSL 2MCAA 1TTFA 1U8QA 3WEBA 2VDRB 2BIPA 2COVD 2PPFA 5HI5D 1WD8A 3B83A 3QPXH 3RDJA 3T3PF 4LCWB 4MVBD 3TBYA 3X1FA 3ZE2F 4F20A 1A14H 3L3JA 1DBAH 3Q48A 5FA3A 5F6HI 3DV6A 3OXRB 3MYJB 4TVPL 1Y6NR 4N26A 5C0BA 2NYZA 1PZDA 1L9MA 3UZQB 4M43L 4RFNC 2AF2A 3JVFC 2XV3A 5EU6D 5IREA 5EF1A 5IR1B 1AHKA 5LBVA 1IARB 3QIWA 3ZE0B 5JPMA 2JF1A 3U9UB 4G8EB 1H8NA 3FRUA 2C9RA 4UQ9A 1KIPB 4DP4X 5FHBH 5D1QB 1OE2A 3DXAA 4ZUSB 5TE7H 1TDQA 3BZFA 1RCYA 4DO4A 1MQKL 4XXWC 1HHJB 2ZUVA 4M61A 5DVLA 5IB5B 4MA1C 1WWAX 4IDJL 3EBAA 5HYJE 4PJ7F 2FLRT 5JNYB 1G7LB 1T04A 1W0WB 3KPRA 1U93B 2W65A 3LMJL 4PJDE 1ZA6B 1B4TA 1NDMA 5L2JA 3GNML 2TSBA 4AYBA 4XE0A 2V2XA 4JY4B 5EN2A 4C83A 4OZ4A 1MCNA 4GKSB 2WQAA 1HILB 1O9VA 1DN2A 4LVHC 3BH9A 4WI5A 4X7CC 2Q87A 4IQHA 1SOQA 1U8OA 4X99A 3MA9H 3N50A 5GISL 2GTWB 1ULVA 3ARBD 3QEGL 1HSAB 1EBAA 5F6HJ 1NBCA 5IB3B 1I1AA 1NWPA 3SDCD 3HE7C 1ZPLA 1AP2A 4XVOA 5C0GB 2WYHA 3E2HB 3AC0A 2XSKA 4JKLA 4JFOA 3UPCA 3LKPB 5F72S 4RFEB 5F7FA 5AD0A 2HWZH 1HL4A 4Q6YA 2UWEE 3RP1A 4Z9KB 3S48A 1JYVA 2ZUQC 4TL5A 1T66D 1QABA 4X9GA 3OLGA 4NPYB 1NMAH 2BNQD 2X1PA 2CJTA 4ZO9A 1A6VH 2EH7L 1OOAA 3X14A 1PLGL 4HJ0C 4P4KC 3CD4A 1UKTA 3GSWB 2QKIC 4JRXA 4MCYB 4U3XA 5DC2A 5KZCB 3WSQH 4JO3H 3NMEA 1NAMA 3PWUA 3QGVA 3T0WA 3BKYL 3T1WA 1NH6A 1HL8A 5AAMA 2DY2A 1OZUA 1Q0XL 3MLXL 4F33B 1I9RH 4YHPA 4RDQG 3LVEA 5BVJB 4LKXB 3LVTA 3OB0H 1FV1A 4H4NA 1QLFB 3L5XL 1S9VB 3R4RA 4JJ5A 4NDMB 3ZYIA 4KY1L 4OIIL 3VW3H 2I24N 3CFJA 3H0TA 3MJ6A 2LTQC 4G7VH 3C60B 1LO2L 3KJ6L 1LO0H 7PAZA 2BRRH 4MJHA 1DN0A 3DDGA 4NCC2 1J11A 3KGTA 4N2KA 2Q76B 2XETA 2A6DA 3QO0A 1AE6H 4IU2B 4TYUA 3FB6B 1PVHA 5JUEH 3OGCB 3WLWD 4JY5H 4XO3A 1T4WA 4F5CA 1DYZA 4R26L 3WKYA 3PREA 4KTYA 3UTPE 5EZOL 3MOAH 1V3MA 2WXKA 1ACYL 2BC4A 4M7JH 3SKMA 5JW4R 1KNOB 4PYGA 2DBJA 2WLYA 2C9UA 4BQ8A 5D7KD 2Y7QA 3WHE1 1ZLVK 4FTDA 3IPBA 1S7UA 4LCWA 4DK5A 3T3MB 1MUJA 5FYJH 2NX5E 5E6YA 4CU6A 4WK2B 4K7PL 3GD1C 3MYJA 3IMVA 1FLRL 3U6XS 1CQYA 3WIHH 4CC0A 3PUCA 1VZIA 3QNXA 4Q9QH 4EXPX 4X7SH 5J57B 2MNJB 5FOBA 4YQXL 1UD2A 5CM1A 1X5MA 1YEGL 5IR1A 2FX7L 1JZEA 2D31A 4IOSD 1WPCA 5DLML 3U9UA 4G8EA 5L0QB 3PE9A 3DHUA 4LSVH 5FGCE 1KIPA 3FH5A 3MRRB 5JHAA 5D1QA 4ZMLA 3Q2LA 4KPHH 1HFUA 4A2EA 2KQMA 4ZUSA 4Z7VB 2IAND 4RWYL 1ITCA 1IVTA 2ZCKH 5IB5A 4MAYB 3TZVD 2RMNA 3WDJA 4XO9A 3EUDA 5LAPA 5JNYA 1G7LA 2GJRA 2P4AB 1W0WA 1II4E 1JPTH 4WHCA 2QQNH 4H13C 1XCWA 4H8WC 4H1LH 1ASPA 2R15A 4XGZB 5KN5B 1ZA6A 4QOKB 1BZDA 2CJ3A 2ZICA 4RH4A 2F61A 4YHYC 3BEWB 4JY4A 1P7KA 3MXVH 4ZMAT 5KS9F 1W0YT 1FYTD 4UV4H 3HBPA 3T8VA 2N01B 3VB8A 2ZT9C 4GKSA 5E5RB 1HILA 1XAKA 3JWDC 3NP4A 5FWRA 4N2AA 2GTWA 3QCTL 4ODHH 3FAXA 1HSAA 2R1WB 3C6LC 4L4TD 3V0WH 5IB3A 5BO1H 5D1XD 3CXDH 5C0GA 1F86A 5IMKB 3Q1EA 4RAUB 3LKPA 3B9KD 4RFEA 1ACZA 3ASNB 1Q4NX 3MRMA 3C9NB 4I87A 2BOBB 4Y9FA 2O6FA 3DHMA 3EFOB 3MRBA 5I6PA 5CJ8A 4PBXA 1U8PB 4BDVB 3RVWC 4BFIB 4NPYA 1TSRA 3JVGC 2BJMH 1I8IB 4IBQA 3DTUB 4NQDE 5LXGL 1EWHA 3HG4A 4AGOA 3QDMD 3GSWA 3LXBA 4MCYA 3X1GA 4Y4KC 3MI6A 4HH8A 4L23A 3ZTNH 2QELA 1L0QA 1XGZA 3RY4A 4F33A 1N5YL 5BVJA 4LKXA 1JGDB 3SEPA 3V4VB 4KXCA 1QLFA 3QEQB 1S9VA 4NDMA 1HHHB 2K4AA 4F8PA 3C2AH 1HINL 2YD5A 1GYAA 1GCYA 2TSAA 1QEWB 4FLOA 5GJSH 5I1KH 4GG6E 3KPSD 1PD6A 3IFLL 3EO9L 5K9JH 1YNKH 3K7UA 2WTPA 1PEZA 3I9GH 4QRTB 1AOZA 2Q76A 3MRGA 3L1OL 3V0DA 4IU2A 2HT2D 2F5BH 3TJEH 3OGCA 3PWNB 2QPFA 1FGVH 1O7DE 1SMOA 2HUHA 1F8TL 1MFEL 1J05A 1RZJH 3CLFH 2J44A 4AYMC 3V6OA 5IT2H 3TTYA 1V8HA 2F2HA 4AVHA 5EIVA 2C3XA 4OIFA 3D4GA 4OCWL 4XT1C 4GIOA 5E9NA 2W80C 4WNSA 1KNOA 4RFOL 2YKKA 4F7TB 1CR9L 3VXRE 2CK0L 3GBNH 3ZN6A 1CPUA 3JWOH 3NCYS 4S1DD 2HRHA 4B9ZA 4M8VA 4OB5H 4NOFA 3GI8H 1IBGL 1DJSA 3H3PH 4H8HA 4LDEB 4BZ1H 3HN5A 4LSTH 3TT1L 5CHNB 2CQVA 2XPGB 3CVDA 3TVMD 3T3PE 3Q44A 5IBTH 3WXVL 5CEZD 3SBWC 3O8XA 2YS4A 3HMXH 2UXVA 4N5EC 3BQUB 3MRRA 3VFGL 3WEXB 3T08A 1LP9A 1U9KA 3BUBA 2P5PA 2OZ4H 3HHRB 1KB5B 3OXSB 4MAYA 4RMBA 3SE6A 2VW6A 1OSYA 3HN3A 4L1LA 5IMOB 3IAQA 1TMCB 3QDGE 1XMEB 5F7BA 3VXTB 1WZLA 2WD0A 4GRLA 3RPIA 4QJ3B 1IO4C 4MJ5B 4XGZA 1N5AA 4AV0A 2GBVA 4DO6A 5KN5A 4QOKA 5BW7A 2X3AA 4JG9A 4EI5A 5GGTH 1KYUA 1GPOH 3RTQC 1D2PA 4K23H 3FH8A 1FNAA 5DURB 1WDAA 4L18A 4PJ7E 1Z0NA 4LDCA 3VQ1C 5KBLA 1HESA 4IKNA 4WF7A 2OJ1A 3S97C 5KVEH 4OFYD 4TLUA 5LNEA 3WELA 2R1WA 4OT1L 3SDDC 4UQEA 5JQ6L 1TIUA 2QQKL 5JXEC 1NIDA 1HZHH 1V7ML 5IMKA 1YUHB 1Q0YH 4RAUA 3ARPA 5E6SB 5CCHE 1C1EL 3LV3A 3ESOA 5C08E 3MLWL 3BW9A 5SWZD 2VNCA 3ZT5A 4ZAKD 4U05A 3EFOA 3QISA 2WBKA 1MREL 1U8PA 4BDVA 3BVNB 1IAMA 4B9GA 4GXFA 4JFEE 4HGMA 4BFIA 5K1NA 5MENE 3NAAH 3OJMB 1AS8A 1I8IA 2DLGA 1JNNH 4HD9A 2CKBH 2MJWA 3T09A 4LU5L 4Q6IC 3QQ4B 5HVWA 1PDKB 1UKSA 5EEYA 5F9OL 4P2RE 1CF8L 5EU3B 2BIOA 3U36B 3LKNB 2A0LD 2J6EH 5E95B 1L7IL 4DW2H 1EJOH 1WTGT 2J43A 3II1A 4QAWA 4LASL 1JGDA 3C8DA 3V4VA 3QEQA 4OV6F 4TNEA 1HHHA 4NUMA 3U0TB 3QI9B 1SHXA 1R3JB 2YUVA 1QEWA 3FF8A 2B9BA 2XN9D 1AIFB 1YEIL 3KLAB 3NPZB 3Q05A 1BQ5A 4OQ1A 4N20A 5EEWA 3Q2WA 4QRTA 4XRCB 3BUDA 5E2UL 4YHZL 1S3RA 2OM5A 5EZIH 3PWNA 1MEXL 4JFDE 3V4PB 2DV6A 2V3EA 4AX3A 4W6XB 2PXYD 2QQLH 1UM6H 3E2HC 3RI5F 5DWUH 2DI7A 4B27A 4DEPB 5D2LB 2BNQE 2ZXBA 4GQQA 5SX4H 3SOBH 4BQCA 1JVLA 5TPWH 1G9MC 4P5RA 5F7KC 4K8RD 4OCYH 3BT2L 4FHKA 4F7TA 5GZNA 3RX5A 2LU5A 3H56A 1ZCRA 3OKEB 2ZKWA 4RGNE 5LNGA 1KXVA 4G2AA 3V55A 1W72B 4L48A 2EDBA 3N04A 4WI7A 1JWSB 3ZLQC 4X7TB 5CHNA 1F1GA 3TONA 5E6IA 3IDYB 4G6AD 9PCYA 5SWSD 2XPGA 2KH2B 3CPUA 4MNHB 1OB1B 2RQEA 3OMZA 3C09C 2DLFH 3SE8H 4TVPD 3BQUA 4ICWA 4KUZL 4MSWB 4K2UL 3WEXA 1AD9B 2BVQB 1FP5A 1REIA 2N7BA 2IMMA 3DPBB 4BA0A 4XCEB 2Q7YA 1KB5A 2R59A 3OXSA 1KIQB 3C60C 4FXLA 3EDEA 4JJOA 5HPMA 5AZ2L 4J3OH 1KTBA 5IMOA 2IAAC 4HLZH 4HV8B 1THCA 4PJGF 4V11A 3RDTB 3EHBD 3VXTA 4K94C 5IBLC 4MJ5A 4S1RH 3VD4A 2HAZA 1VGKB 3QJZA 3QG7L 1WLHA 1FAIL 1Q72H 1DO6A 1JK9B 5I8EB 2X87A 3NJHA 4BFOA 5HVHC 2A4ZA 3FT4B 5DLLA 1LM8V 4HQQL 1F1AA 4EAEA 1WWWX 4NIYE 1AHMA 3Q01A 2C9XA 3ELQA 2WXRA 2NPLX 3F7YB 5C0NC 5KS9E 3RGHA 1QBMH 2IOMA 1G1YA 1YUHA 2B1HL 3U7YL 1T1ZB 3NK4A 4F8QA 5IY5B 1VADB 5FC9A 3DURB 1A6UH 3KHOA 2W92A 4QO1B 3IFNL 2BOCB 3FQ2A 4U1KB 2E27L 3QNYB 3BVNA 4F91B 1CGUA 4DQAA 2DD8L 1NGXB 4NN5C 2IANE 1MCPL 4JFFE 2WQRA 2VM3A 3ET9F 4F92B 4I13B 1XZ0B 4Y19E 4XNXL 1DLFL 2A9ML 4JS7A 1KYOK 3ZHLA 3HBGA 2VN4A 3HNSH 4ZXBC 3TN0D 3BRGC 3MBXH 3QQ4A 4JQVA 1PDKA 1C5CL 3OZLA 3DIDA 3KG5A 3Q3GB 4YLQT 4HKBB 3G5WA 3FSWA 3LKNA 3U36A 3U4AA 3SO5A 3BAWA 2EIEA 2DPKA 2EZ0C 1H6FA 1LJMA 3S5ZA 2QSTA 1GKOA 4NRXB 3FFCB 1P6AB 1SXCA 3K1DA 3QI9A 3U0TA 5DFVD 1H6EA 1YJDC 4HIJB 4Q58C 1R3JA 4H8WL 5A7BA 3QZWG 1AQ8A 1AIFA 2CNYA 4I9WD 3BH8B 1EUUA 4E68A 3KLAA 4JPQA 2EE3A 4RZKA 3ZIMA 4DP6X 4ORGB 5I1CH 2XJLA 1G9NH 3B43A 5IGXL 4NCC1 3C8KB 5KAQG 3HN8A 4WWPA 1BD2A 3F7LA 4KH9A 1ZJBA 4XMLH 2X10A 1P5UB 1I9IL 3N06B 4NKMB 4LGRB 3DETD 5TF1L 5D2LA 1UKQA 2D7TL 4KAQL 5DS2A 1C7TA 2ZSVB 5AQ0A 4PAZA 1TT6A 2JI3A 3EOTH 5LCVH 3OKEA 5D6CB 3GO1H 3GXUB 3QORC 3QXAB 4UNUA 3VU2A 5F6IB 5KOVC 4IMKA 4DTGL 1W72A 1WT5A 4FQPA 2EO9A 2YRZA 3HG0A 2VXQL 2O93L 1S78D 2P8LB 1JWSA 4X7TA 1RSYA 4PLJD 3SO3C 4GMTH 4LP8A 5KVGH 4OLXL 2P43B 1OB1A 5AVUB 4PJ9D 4KHXL 5KAQF 5I6LA 2X70A 5JOPE 2VXVH 4MSWA 2BVQA 1NANI 3DPBA 4KK8C 3M46A 4XCEA 3HVDA 1AZUA 2F68X 3R0MA 5BUAA 2LLNA 1KDJA 1P53A 1KIQA 5J6HB 5IHUH 3KLSA 4HV8A 5JHDE 2G5UA 1KZQA 5E8PB 4Y1TA 3MO1B 2IPTL 1VGKA 1R4XA 3AQXA 2RJMA 3LEVL 4PLKD 1TENA 2YMOA 3CNKA 3QDJB 1HXMB 3FU7B 5ACLA 3V0AC 1JK9A 2ZXEB 5I8EA 3CFMA 4UZGA 1JZHA 3QG6A 1G84A 2YRLA 3FT4A 3B7YA 3GWJA 1RSFA 4YJZL 5I5JA 1SYVB 4L4VB 1PKOA 3QAZB 2R0LL 4L5FH 4OGQC 4OFKA 3F7YA 3L2MA 4PREB 2DYSB 1ZV9A 2JKJA 2EYTB 1KGIA 4U6XB 2IGFH 3T0AA 1NFIB 4PJEF 1A1MB 5MEPB 3KLHD 2DWSA 3OL2A 2E9IA 4IK6A 4ZFFB 2ZOUA 1S7QA 1KBWA 4F8LA 1VADA 5DD1H 3DURA 4UOZA 2K8QA 5DUBB 3MV8A 4QO1A 2BOCA 4U1KA 5J06A 4Q9RH 5DVMA 1EFQA 3BD4A 3QNYA 5DMKB 1OAYL 1UWXH 4OJCA 2EUWA 4OCSL 1NGXA 4PRNB 4K9EC 3DRQB 4QMEA 4R3SB 1ZJAA 1F18A 4C4KO 1XZ0A 2B4CH 4XXCC 2OQJB 2Y23A 4NT6B 5DJCB 2AQ1A 3QWRA 5HYIA 2NY5C 1YLBB 3Q3GA 3WY2A 4HKBA 4FN0A 2P8PB 1EFXD 4OGYH 4X5PA 3C12A 2VUOA 2VDKL 5DYOB 1IGCL 2WUBL 1QOKA 2ZX6A 5D8JH 1QZ1A 4NRXA 1MI5E 4RETB 4E5XB 4FFTA 5BOPA 4NWUL 2XVKA 4BA8A 4HIJA 1TJHH 1E0OB 3MBEC 3BH8A 4F9PA 4ONHB 3WV0A 1G4MA 3TBCA 3O3AB 3T2NL 2ZOLB 1J48A 1HHKB 3MV7E 1OSPH 4ORGA 5ID0B 3ILEA 3KVQA 4CBZA 3C8KA 5C0CE 5HPOA 3ZK0A 2WZAA 4ACTA 3FO0H 3VI4E 4NQXB 4NKMA 2HJLB 3OR6B 4NQSA 2AI0H 2HJFB 4OR1A 1NIFA 5JPNB 3LIZL 2A4CA 2ZSVA 3SKJH 5AFAA 1JSYA 1NFDF 4UINL 2EKSB 3NYKA 4WUUE 1AJ7L 2DBLH 4WUKH 1U3ZA 3ILQD 3QXAA 4ATTA 5I73C 4J8QA 4LKCA 3FO2B 3H53A 4LO9A 2YQ3A 2OR8A 4OI8A 1WUZA 3LHPL 1PQZA 5LG6A 2BZ7A 2P8LA 2AK4D 4KHTL 1AMXA 4EBQL 1MG3C 2DDQL 5HDQH 3U79A 1HCZA 3C2SA 3ZTJH 2IAMD 3H9SD 4YDLB 1XH3B 2CGYA 1CIUA 5I0XA 1FNSH 2AXFB 3H2WA 3OQRA 3SPHA 4S0HA 2AVFA 1MFDH 5CF3A 3HAEH 4L3ED 4L8BA 3FOMB 2NXYB 3SBQA 5I1EH 3VSQA 4BFBD 3WLBB 5J6HA 3GHBL 1CE1L 1M7DB 1E27B 4EIGB 5GGVH 5E8PA 1BXVA 5H37A 3A24A 3MO1A 2HT3D 1OPGH 1N4XL 3K8MA 4KKNA 3CVIH 4DERA 2ZONA 1F02I 1KJMB 2EUXA 3QDJA 1HXMA 2AMUA 1HL9A 1IGJB 1CJYA 3FU7A 4JG1L 4DEPC 2ZE0A 2J2ZB 4AY0A 4LZKA 1TPXC 1YEFL 1SYVA 4L4VA 1HNYA 5CJOH 3PHOA 4PREA 1W9XA 4U6XA 2EYTA 1BEYL 1MCSA 1NFIA 2OMBA 3LX9A 2AFNA 5EDSA 4UNVA 4PWGA 5MEPA 2R0ZL 2ZKYA 4ZFFA 3VJ6B 1DZ0A 3KWUA 1ZS8A 1WT5C 2GYSA 4H8QA 5DUBA 2N1KA 4F2MB 1QFWM 4TVPE 2UUDK 3W38A 3KE0A 2HFTA 5DMKA 3BWUF 2W88A 3IDYC 4B9IA 3CDFA 1BWWA 3QQXA 2Y4SA 3DRQA 4R3SA 2VKWA 5D1ZC 3QH3A 2NY3B 2H2SD 2OQJA 2OP4H 4AQAB 4NT6A 1DBBH 5DJCA 4I2XB 3FONA 2XICA 4JUSA 1YEEH 5LKNA 2VZSA 3F01A 1CTOA 1IC0A 1X9LA 4WI0B 4FQHB 3BI9X 2J1XA 3GMNB 3WUWB 2CDEB 3GEWB 3RDTC 1RPQA 1FUNA 2VSMB 3RJDA 5KVDE 1E5YA 3DMMC 4E5XA 1EA9C 3UTSD 2FQEA 4F27A 3B8YA 4BK4A 2B5IB 4NAQA 3D3VD 1NKRA 4K94L 3WIIL 2P52A 4AH2B 3GXPA 1TQSA 4WEBH 2BM3A 3A6CL 2YAEA 3SPGA 1CICB 3Q5TA 1ORQB 1NCIA 4L0PB 5EORL 3O9WC 4ONHA 5EOTB 4BSVB 4MLIA 4LOEA 3ASWA 3O3AA 4LHUG 2ZOLA 3U82B 1HHKA 5D1ZI 5ID0A 5KBKA 2G0KA 5FOJA 4OGAC 4G6JH 4GKZB 3D9AH 1KBGL 4U1GB 3VRLE 5C07B 3KJ4C 1DSWA 3WNIA 4CDHA 1R24B 1ZLDA 1XR8B 2B2XH 2CLVB 2HB0A 4FQCL 3OMAB 4YVNA 5E7BA 1IQWH 4OLVH 5ISZE 2HJLA 4WI6A 3OR6A 2HJFA 1TQVA 3FRPG 1XGUB 2AZUA 2H8PB 4WK4B 2EKSA 1HN1A 4LRNL 1FIEA 3D4CA 4NFBA 3O4LE 3FO2A 2CALA 1NAMH 4KXZI 1RZKH 2WINA 3GSQB 3HE7D 4IBVA 4H0GA 5E4OA 3V4LA 4E42B 5E8NB 3GXFA 3FCGA 5D7IF 5IP4A 1RFDL 2E7CA 3GM0A 3HNTH 3N1MC 1KGXA 3UTTD 1OCWL 1MFBL 4BH7B 3EO0B 1N26A 2QHRH 1XH3A 3F64A 4WCYH 5JOFB 2AXFA 3VH8G 1WZMA 4C59B 2NZIA 5IOPB 3CWGA 3KWVA 4PS4L 3V0FA 4HJ0D 3BSZA 4P4KD 1J7VR 3KXFA 1OKEA 4MXWL 4R96B 1M7IA 1M7DA 1F4YL 1E27A 1GOFA 1OOWA 4P9HH 4QDGA 3VQ2C 2AAVA 3CXHK 1D5MA 2X09A 4G6FB 1S9XA 1YJDL 3L3OC 3IDNB 4LF3B 4RMUA 4G6KH 2J8OA 2CR0A 1HDMB 1BVLB 5JO5B 1UD3A 1GMIA 2APBA 2ESVE 3UZVB 1UQSA 3L1GA 1Z9PA 3IMSA 2R2HB 2VB5A 4JM2C 1KJMA 1IGJA 5I17A 2G2NA 1SEBA 2ZXCA 1P5UC 2CHXA 2VDRH 4GAJH 3S4SB 4W9FC 5JIPA 2RCSL 4FLSA 4N2LA 1RZJC 2UZYB 5FM5M 3LN5B 3NJNA 2DQIL 4JW3A 4ZMOA 4WJ5B 4IRZA 5GPRA 4GO9A 4NJ9L 4Y9EA 1QSEB 5TDNB 1ES0B 1OHZA 3BPLB 3ESMA 2J8UF 1EJ6A 4N8VG 5F6IC 3VJ6A 1KG0B 1IBDA 2X6MA 5EEZA 1TQBC 4Z0XB 2DQCL 4YDKH 4BXVA 1MKFA 4OM1H 4N2BA 4C58B 2NYYC 4UNIA 12E8L 4PJEE 4EUPB 1MRDH 7FABH 4Y16C 4GAYB 4PJCF 3AITA 5IJDC 3U2JA 1XEDA 1TF4A 4AJVA 4YN3A 1K6QH 3AUWB 2PR4L 1QW8A 2OYMA 4I2XA 1R0AH 3VD2A 2VDPL 4D0CB 2XX1A 1HCVA 1WIOA 4FQHA 1SDYA 3GF8A 3GMNA 1PJWA 1UZ8B 3UC0H 3UO1L 3VXMD 2CDEA 3WUWA 2XTJB 5JXAH 2Z6FA 2EE2A 1U8MB 4DSYA 1D9KB 3AS0A 1IJNA 5IUSA 1TVBB 4QXTB 2KQNA 1JF5A 3VXQB 4XCFL 3SGEI 3GIZL 4Y4HB 2O26U 4R8WH 1UEMA 3AY4A 3DJTA 4Z95L 4AH2A 2Q9OA 2E7LA 2VN6A 4K3EL 1CICA 4KROB 4KJQC 1ORQA 2Y5TB 4JRLA 5EOTA 4MHHI 3BAKA 4BSVA 1CL7L 4GSRA 4JO4L 4M8QA 2QSCH 2XKNA 1F41A 1YHPA 1OAUH 3CSFA 1GVIA 5F7EL 3TIEB 1JHTB 3UAFA 3HJEA 4Q6KA 5F9JB 4GKZA 1WK0A 1CDYA 4HIXL 4ZI8A 2EYSB 5C07A 4WGVB 1N70A 1R24A 1XR8A 2CLVA 4TM9A 1BZOA 4IRSB 1HEHC 3LAFA 4UAHA 4JQXA 3T0EB 4PMEA 1C5BH 4F2EA 4PGZA 1CYWA 2VZTA 4RX4D 1N8OE 1XGUA 2H8PA 4YSQA 1WFTA 3AXIA 3QPXL 3KVPA 4AYFB 1K9TA 3WO4C 3C6LD 3D5OF 1BLIA 1NSNH 4K9JA 1DBAL 3O3UN 4E42A 1KIUB 4EF3A 3NCFB 1MY7A 3O3BB 1FSKB 4BH7A 3RB7A 2CWRA 5JOFA 4L37B 1NLBH 4P9MH 5FHBL 4FKHA 5IOPA 3QQDB 4YPGB 4P2YA 5TE7L 2Y2WA 2XV2A 4A39A 1B2YA 2XQYG 4CVZA 5C09B 1OGAB 3ZMRA 4ELDA 4Y4KD 4R96A 1OALA 3K2KA 4P59H 1LYQA 3FQRB 4OH2A 2Q86B 5GZOD 3LZFH 4FEMA 4EN3C 3IDNA 1QWNA 3KZ8A 1BVLA 2YUXA 5T3ZE 5JO5A 3TM6A 4E9SA 3B7TA 1E3ZA 5DJYB 3UZVA 3BOVA 4G1EB 4UT7H 2R2HA 5DS1A 4LNRB 1IAOB 3BKJH 3DGCR 3FO1B 4HJEA 1EK3A 2F7PA 1A6WH 2JI1A 2L7UA 5KVFE 3K1KC 5IJKA 1PD0A 4M7LH 5CNHA 4NQEB 3HRZC 3S4SA 1NUGA 1IRAY 4S1QH 2RIKA 2UZYA 1JZ3A 4JGJA 3LN5A 5JPNC 3KPQA 4AXWA 1VAHA 1AKJD 3RFRA 4M6AA 6TAAA 2P44B 1QSEA 2EEXA 3A4FA 3EG9A 5TDNA 3VFMB 3WJLC 2C34A 4DKTA 1ES0A 1YNTB 4U1JB 1EEQA 4LNVA 1ORSB 1OIOA 4LQ1A 4OZGB 5EFIB 2ZKMX 1KG0A 3SJVD 5LDUA 4C56B 5I1LB 2FCBA 3H9SE 4M6NL 4RNRB 4ATWA 2WZ0A 2CO7B 2DQEL 2VDQB 2P5EE 2ID5A 4XNBA 1RIHH 3ZDYE 2Y1ZA 1NMAL 3NRFA 4EUPA 3BAJA 4WY7H 4JFVA 1KY7A 2GC4C 4L3EE 4XMVA 3MTRA 5EIIB 4DVRH 1ZOXA 3VFTB 5AW1B 3WSQL 4FNUA 1I53A 5F7YC 1J1OH 4YWGH 5C2BL 4QWWC 3AGVA 4D0CA 4RZCA 5I75B 1IILE 1YMMD 1P1ZB 1I9RL 1UZ8A 2AJVH 4N0YL 3QK0A 4HISA 3TH2T 2GBAA 4BZ2A 3G5YB 3F04A 5DHEA 3B9AA 1TVBA 4QXTA 3VXQA 4PGCB 3VW3L 4N5ED 4Y4HA 4G7VL 4LPYA 2F15A 5G5DA 3L3DB 4X5LA 1JZ7A 4C55A 4J4PC 4ELKB 2Y5TA 3RILA 2PCXA 1B88A 5J13C 2H6OA 3D39D 3DX0A 4HEPG 1Q90A 3T6XA 5HDLA 1D5BB 3K81A 1ZHNB 1JHTA 1J86A 3K91A 4XPFH 3TIEA 4XN9A 5F9JA 1PU0A 2EC9U 5E4EC 2EYSA 2EXWC 3RTQD 2A6IB 3IRPX 4IRSA 1TFHA 1QFWH 2J88L 3T0EA 4Y5VB 5I0ZA 1J87A 2ICEA 2WZPD 2IFGA 4FQXC 4GO8A 3ZOAA 1HWWA 4FKEA 1CXHA 2FO1A 2DTMH 2XRAH 2BNRE 4UT9A 1DSYA 3T4AB 3M7FB 3TF4A 3SDDD 4BJLA 2YBRB 5F2FA 5JXED 3US0A 2NY3C 1KN4H 2YJLA 1KIUA 3WIHL 4MQXC 2APTA 1JPSL 1J9SA 1YN6B 4X7SL 3O3BA 1IC1A 4QRSB 2VQUA 3V4VH 2QMKA 1PSKH 2VWEC 4L37A 3QP3A 3QQDA 1IL1B 2JWYA 4AOFA 1NA8A 4EJ1C 1VEOA 5D7IE 3EIFA 1EGJL 4BQBA 1B6UA 2B5IC 1OGAA 3DYPA 4Q4EA 5HJDA 1FRGH 2O5YH 2AP2A 2EDQA 5C09A 1QLEH 2VE6B 2NY6C 5AOIA 1CICC 3FQRA 1VACB 4FQIL 2JJSA 2Q86A 2AJYL 4ANUA 1O6SB 2QQNL 1J5CA 4DEWA 3MLUH 3ZPDA 4OI7A 5D7LB 3EYUH 2ITEA 3HZKB 3VD1A 2X2IA 5DJYA 3KL5A 3MODL 4G1EA 1F56A 1NEUA 1IAOA 4LNRA 3FO1A 3NCYP 4O2FB 1I4FB 2L4OA 2YD0A 4U1GC 4UV4L 1BXAA 1WO2A 4XAKE 4TKWA 5J4MA 4FFYH 4YGVB 2Z65C 3DX2A 1KTDB 3OKLB 2XTSA 4JAMB 1ESOA 1RUMH 4U0RB 3PF2A 5C6WH 1BFOB 3VXSE 4ODHL 4Z7UF 1Y1UA 3HA0A 1ODUA 3NIGB 3V0WL 3GSUB 1IM9B 4XP1H 5BO1L 4Z3GA 5B1AB 3VQMA 4HG4J 1MZZA 2VO8A 3CXDL 4IGBC 3UAJC 4HXAH 1YNTA 4U1JA 2BPBA 3UTTE 3HZVB 1ORSA 1T2QH 1Z32X 4GAAA 5EFIA 1E4WH 4I0PA 1QX1A 1ZAGA 5I1LA 4LFHD 4RNRA 3RBSA 3RHWK 2CO7A 3UC2A 2DJSA 4XCCL 5A3IC 4BFKA 5CCJA 1V54B 4HS6B 3BKML 2BJML 3MLTB 2J8UE 3NCBB 4V1DE 4JO1H 1Q94B 5EIIA 4YXKH 1ZTXH 1F4WH 1KB5H 3VFTA 3VFUB 3LQAH 1QNZL 3W1ZA 4NQCB 1B4JL 3ZTNL 4MASA 1YEKH 3J2PA 1AGEB 1ZTMA 3ENEA 4UB0L 1P1ZA 2PYED 4PJCE 1TYRA 4PSPA 3G5YA 2XWDA 2Q8AL 4FQQB 4UTBL 3BGFB 2DL2A 3C2AL 4ZYKB 4DH2A 1WBZB 4J28A 4OZHA 4PGCA 5DD3H 1F58H 2VLJE 3QHFH 2X88A 5BS0A 3F7PC 3L3DA 4HUUB 5GJSL 4JGMA 4RSVA 1ECYA 4ELKA 3BVVA 4HS8L 1YNKL 3GUTB 1NM9A 2FUTA 1RIUL 3I9GL 4AMWA 1S4IA 2X6CA 3WKPA 1D5BA 1E9PB 5D93C 1ZHNA 2QVMA 3TJEL 5IBLD 3Q6GH 3GHEH 1FGVL 3GLDA 2VR3A 4FCHA 4LQFL 5TK4A 4DPRA 5ECJE 5D96B 1RZJL 3CLFL 2GIMA 4J3BA 4YDIH 5D2NC 2YGQA 5IT2L 1IQDB 3LD8B 3KW8A 3BPLC 3F7QA 2YPVA 3ZHKA 3BDXA 3DJSA 4PV8B 1SHWA 2YGPA 5CWSB 1QTSA 4C47A 1VFAA 3T77B 4GBXB 5CSBA 4PG2A 2FZ3B 5DI8B 5FECA 5I2IB 1ZVNA 4KTGA 4HWZB 3GBNL 3JWOL 2CO2A 3T4AA 5C0ND 3B2UD 2YBRA 4W9EC 3LSOB 4JO5A 4OB5L 5DZPA 1BVKB 1R17A 5TFSH 4LSTL 2QTVA 2MHAB 4YDVB 1YN6A 2WUCH 5DQJB 2ZG2A 1YRKA 2MQCA 4CU8A 5CLWA 2YXMA 2EJ1A 1VPOH 2CHWA 2ZOKB 5IBTL 2EDKA 1VEPA 2ITFA 3HMXL 1CGTA 3I6GA 1L9NA 4JPWL 1D9KC 1IL1A 5F3HB 4MZ3A 2VW4A 4W6YB 1JP5A 4ZXBD 4OD3H 5HVFB 2R1YB 3P0GB 2VE6A 3NJIA 2VZOA 1FG2B 4KROC 1VACA 3NJFA 2AXHA 2DL9A 2Q10A 3V8CA 3BIAX 3CCHB 1O6SA 2CU9A 3V7AG 3TNNB 1F6LL 5F7WC 5D7LA 4ZO7A 2EZ0D 3HZKA 5GGTL 1KZYA 1GPOL 5I76B 1QSFD 5EEUA 4K23L 1BOYA 1G7JB 4Q97A 3ULVH 4O2FA 1I4FA 1OGTB 1IGFL 4G11A 1CDBA 4YGVA 3IKCB 1DQTA 1KTDA 3RL2B 3OKLA 3GYRA 4FOMA 4JAMA 4Y5YC 5FDWB 3WMSA 5KVEL 2ADYA 3T0EC 3S6CA 1BFOA 4F37K 2A6JB 4WV1C 3ULSB 4FCAA 3SPVB 3MA7B 3Q8CA 4APQB 1E43A 2GJ6B 4JJHA 1W72H 3G7TA 1IM9A 1NBYB 1PFOA 3GSUA 3VDBA 2WWOA 4X7DC 1RZFH 4LL1A 1HZHL 4AV5A 1J8KA 1Q0YL 5AAWC 2A9NL 1WZ1H 1U6AH 1R1CA 1ZXQA 4Z7VF 2ZWZA 5KANI 5J89A 4O02B 2CM5A 2QQQA 3P30H 4NM4H 2EE6A 4PUBL 1M42A 4WZ9A 3HR6A 4HS6A 1FSKC 3W5MA 3NAAL 4OIAA 2JE8A 3MLTA 2D7MA 1JNNL 4UWQB 1JPEA 2ZF8A 3I50H 1CFNB 1Q94A 3DXAE 3QORD 5B3JF 3VFUA 1MVFA 1PF3A 1Z9SB 4KOCA 4I1PA 4NQCA 1DLHB 3G6AA 2VLRD 4Z7OB 1G43A 2ADFH 2NY2B 2QLVB 1OP9A 2OPCA 4NAJA 4G8GB 3RY6C 1GAFH 1AGEA 5CU9A 2OSYA 1BGXL 3X3GH 5CEXB 3VGFA 4Z7WF 2OMZB 1L3WA 3WEAA 4BFRA 2J1ZA 3MLRH 1DBMH 4I18B 4M6OH 2WO2B 4FQQA 1CO1A 4ZYKA 1WBZA 3U0PB 4IBLT 3VM5A 1HVXA 5HBBA 2F18A 3S36X 4KK8D 4HUUA 3OF6D 4XPHH 5BVPH 3U4KA 3BPOB 2C4FT 3LZNA 3VUAA 3GUTA 3QJTB 1YECL 5KSVB 4OLZH 1E9PA 2NUTB 4JO2H 1SY6A 3T5WA 3VXUB 4A2FA 3SJVE 3GMRB 2R39A 4AL8H 4P48A 4GFTB 2SODB 4WI2A 3SYAA 1HHGB 1UM6L 5DWUL 2Q7NA 1ADQA 1FO0B 1FZMB 4PV8A 5CWSA 5L8LB 4OCYL 5DO8A 3BCFA 3T77A 4GBXA 3A4AA 1OAJA 1IMHC 3TYGH 1FF5A 2YEZB 4R4BB 4Z23A 4A2DA 1MRCH 2VN5A 5DHVA 4DVBB 2MOGA 4HWZA 3DTDA 3LY6A 4EQ2A 5I2IA 1T7WA 4QPEA 1XF3A 2WXIA 3MXWL 3TJHC 3TBSB 3MLVH 1PZBA 1WYJA 1WCBB 1LVEA 4FFWC 4ETYA 1YMME 4PTTA 4NQQA 2MHAA 3NJKA 4M6MH 4MCNA 5DQJA 5CJBA 3ZYJA 1P9MC 1YY8B 2QR0B 2ZOKA 4R7LA 4Y4FA 4PIBA 2AXJA 5E1IA 4Z3EA 3SE8L 2F53D 4BK5C 4TSCH 5F3HA 1B3JA 1XCXA 3RWFB 4LP5A 3LNIA 3D39E 2OXGB 3VFNB 4BK8A 5DD5L 5IB2B 3FULA 2R1YA 2V5YA 2YKLH 2B3RA 2Z7YA 3QHZH 2BP0B 5AENA 3M6DA 5DJ8A 4N2CA 1JNLH 3CCHA 1YUKB 2X1QA 1MQ8A 4YR6B 1EO8L 4KKLC 3CUPB 3TNNA 3WBDA 1Z1WA 2X0VA 5CD5C 5I76A 4GRWB 3GPSA 5DZVA 3S3BB 1QMUA 4QRPD 3QUML 2ROXA 3AM8A 5HD8D 1KEML 1NC2B 3AW5A 1AACA 4OZFB 5D7JB 3WFHB 3MBED 3IKCA 4KZEH 5DURD 1OK8A 5FDWA 4HJTA 3NSXA 2OJZH 3GTTA 4Y5VC 2A6JA 3ULSA 4KMTH 2WW8A 2WLNA 3E3QC 3RQ3A 3MCKB 3MA7A 4APQA 1J8SA 4P4RB 5JW4N 2VC2H 2GJ6A 4AV4A 4LCWE 5HYFA 1YPZA 2C1OA 3TH4T 1NCHA 1KGUA 2HPOA 3IMWA 4IW4C 3LEXB 5T1LA 4EQ3A 2OMTB 3SQOL 4CDGC 2E3VA 2X05A 1A6UL 5FF6B 5GS3A 4DK3A 4Z7UE 4O02A 3EBIA 3P0VH 3MC0A 2J20A 4ADJA 4KGLA 1CD9B 3ZE0E 1DQQB 4M56A 3CFEB 3V6FB 4PJAA 5CZKA 1UJ3C 3A22A 2R69A 4HCRA 3AZUA 1RQ5A 5D1QE 3S3PA 4JNXA 1CFNA 5IF0B 4XNAA 1Z9SA 3HMWL 3HNSL 2IH3B 4NNPH 1DLHA 5IBUG 1HCYA 1QUPA 3MBXL 1M57B 4ZOCA 1T4KB 2ZCZA 3JTTB 3HLKA 4G8GA 2XFXA 3L1EA 5H37H 1A5FH 5CEXA 3MR9B 3O4OC 2WSPA 4I18A 4HUKB 1QTYT 3TBTA 3TLRA 1URLA 3L7FB 4ABWA 1KDIA 4HOMA 2IQAB 4U2YA 1I1RA 3APFA 3DYMA 4X6DB 3MJWA 2VMFA 3MLZH 5I5MA 1JXFA 3ESPA 2Y5QA 1J8HD 3T2OA 2X89A 2YFOA 3KH4A 3GIVB 1CXLA 2EXTA 4WTXA 1WG3A 4Y1AB 5KSVA 2XN0A 4KJWC 4OTXH 5I1CL 5TE6H 1G9NL 3NH7L 3UJTH 1GZHC 2ED9A 3MTXA 3OKMA 2NUTA 3VXUA 3WENA 2FEDC 3KYKL 1Y1DA 2NY7H 4P2QB 1HHGA 2WIIB 4PD4J 1JGLH 1OD9A 1FO0A 2BWDA 4EOWH 1FZMA 3BRFA 5IROC 3EH1A 4W4OA 2UY6B 2YK1L 3NJGA 1N6VA 3RIAK 2JCWA 3CJJA 4R4BA 2YEZA 2AQQA 3IN0A 1WAAF 4L3CB 3EOTL 2WO3B 4DVBA 3GO1L 3WFDH 3LS5H 3F6JA 1WICA 3FAWA 3RJOA 1NUFA 3TBSA 1OLZA 2YAHA 1AZVA 3CFCL 1NFAA 1NINA 1WCBA 4K0OA 2VTFA 5JYMA 1EAJA 1KN2H 1TZGH 3GQFA 3K5SA 1FE8H 1JK8B 5CLXA 4HPOH 4XNMB 5L9DH 1JPST 4GMTL 8FABB 3W0WB 3CLEH 3UL4A 1YY8A 4HT1H 5KVGL 3FOLB 2QR0A 2FTAA 2VJ0A 4FFVC 1T7VA 4YX2H 2AEWA 3PQYB 1OT2A 2KT6A 1LQSR 2W94A 4LPTA 3S5YA 2VXVL 3BN9C 1BQLL 4ACPA 1I7RB 1Q9OB 4XP5H 3ZZSA 4EO5A 5D1ZD 3RWFA 4I9XA 3CXFA 4B60A 1WH0A 4I5BB 5IFJB 2CD0A 2OXGA 3VFNA 3S5LG 2BNUA 5IB2A 1U3YA 4PB0H 4G71B 1FH2A 3P40A 1NEZB 4X9BA 4HKXB 2O6PA 1LMKA 2AJUH 1SDDB 5EUOB 1WHOA 5I8OH 5HYJB 5B7MA 4F9LC 4YR6A 3FKUS 3CUPA 1RH8A 1GHFH 4GT7A 3RDTD 4UANA 4PJDB 3DMMD 1R6VA 4HJUA 4S0SD 3V6OE 2YIHA 1SRDA 4OZFA 1F0LA 4NRZB 5D7JA 4CJ1A 2Z4TA 5LJYH 1X5FA 3O9WD 4H1LG 5A1AA 4NJAL 4UF7C 3UBGA 5CR8A 3MCKA 1G5AA 1KGCE 3VXPB 4GBXC 4L5FL 4JQIA 1MW0A 1SQ2N 3T3ME 3LH2H 3AREC 3LEXA 4X8GA 3MVSA 5AW5B 5CIPB 4BFNA 4ZMVA 2OMTA 3MACH 4P2OA 5DD1L 5FF6A 3P77B 4Q9RL 5F7NC 1DQQA 1MRFH 4PB9H 4QHLB 3CFEA 3V6FA 5HHNB 3QUZB 1K8IB 1UA7A 2JJWA 1EVTC 3BSZH 4B9PA 5IF0A 3VWKD 2FR4B 4Z7VE 2ED8A 3GXNA 3V7MA 2IH3A 2WYIA 4ODVH 5B21A 3PFQA 4WEMB 1T4KA 2D4DA 3MLYH 2Z8RA 1JE6A 3JTTA 1OAKH 4QXGH 4OGYL 4NRYB 1M1XB 4A2GA 3MR9A 5E94A 1TCMA 4PY8J 5B3JE 2EO1A 1ICTA 4R0LB 3L7FA 4ETQB 3BWAB 4OW6A 2QADB 2HVJB 4ZSOB 4X6DA 1TJHL 2XCMC 3I9IA 5EBGA 3UJJH 3OSKA 3LS4H 4KDVA 4LCCA 4W68A 2IPKB 3SCMA 2KDGA 4BE5A 1PG7X 5FYLH 4IRZH 3SE4C 3ABLB 1OSPL 4XMZA 2JQAA 1GW6A 2BFVH 1PKQB 2WIMA 3N40P 4APQC 4HWBL 4HW6A 3NTCH 3TS8A 2XWXA 1SM3H 2G60L 4P2QA 1A8JH 2WIIA 3LHAA 4JM2D 4HKJB 5CR1A 4KV5F 2UY6A 5JIQA 3FBQA 4MJ2A 5ILTH 1NCDH 1VESA 3QB7C 4L3CA 3FSAA 1EHLH 2DBLL 3H42L 3GDCA 4N22A 1KPUB 2O6DA 3L7EA 1XF1A 3JV5A 2B9AA 3DX3A 1OGSA 2NX5B 3T8XB 2MTAA 4AUUA 2O30A 3FQ4A 4X7EC 1JK8A 4P06A 2B59B 4XNMA 3ALWA 3W0WA 1LNUB 1GC1H 2CK2A 4U2ZA 1UXSB 3FOLA 2Z64C 5HHOB 2LVCA 1NIEA 3MX0B 5EBWB 3PAVA 1FNSL 1P7QA 2NYYD 3QEQE 5HYEA 5D7HA 1I7RA 1OW0A 4MHHG 4Y16D 2Z34A 2WLLB 1L7TH 1N2RB 4GW4B 4JM2F 1LD9B 1T3FB 5IFJA 3G5XB 1CG9B 1KFAH 4TL4A 5I1EL 1TFPA 4HJJH 1NEZA 3BPOC 3Q9PA 4HKXA 2FWLB 3L8QA 3CDZA 5GGVL 4Z3FA 3JT0A 1SDDA 5EUOA 5HYJA 1E30A 2CHNA 1UC6A 1SMDA 1YYMH 3WNOA 4ZNEE 1KJVB 1ZK9A 1KWKA 1OPGL 4DZ8B 1W8NA 4ZOBA 4AQ8A 4PJDA 5FM5O 2XVLA 1NPUA 3TA3B 4RISL 3FDWA 5AVXB 2D9CA 4NRZA 3WYRA 2JK5B 2JCCB 3O2VH 4P46B 2FSEB 1U8LB 1MFAH 4KJQD 2OTPA 2QGDA 3V0HA 4KZDL 4NHCH 1MHHB 3CBJB 1RERA 4MNGE 5CJOL 1N18A 3DX7B 5CSZA 2V5SA 1BXUA 2EIZA 1Y18B 2Q7AA 1J1XH 1G1CA 2WXFA 3ECWA 4XN8A 3K5RA 4CN4A 3MQIA 4BCXA 2I26N 3DVIA 5JHBA 1LE5B 3T2QA 4WTWA 2D0HA 5LGJB 4AE1A 2F8IA 1W0VB 3P77A 1IKOP 3TF7C 1AVAA 2PTTB 5LWYH 2UWEA 3FUKA 4IRJC 4QHLA 4YC2C 5A2BA 5HHNA 5KSAA 1OV8A 1KJ2B 5F1NB 5IG7B 1K8IA 1S46A 5DSCB 2D7PA 4NC0B 4YE4L 3F65A 4HHAB 5BUPA 4CGTA 2CCVA 2FR4A 2OP4L 2NY0B 1DBBL 3QVAA 4U1MB 5JOEA 1ZTXE 1CB4A 1YEEL 1M2OA 4F1ZA 2NDFA 5HHXH 1H3VA 3IJEB 5MI0B 4YS4A 4ZZKA 4R9HA 1C12A 1U4FA 1M1XA 4HPYH 3REVB 3HPJA 5E9DB 5ESVB 4R7NB 4XN5A 1NCUA 4R0LA 3P9LA 4KKRA 4ETQA 3BWAA 3FTYA 3MOBH 1FJ1B 5DMGC 4JUTA 1MSPA 2F8OA 2VR4A 4HOXA 2NT0A 4NXSA 3DVGB 4ISVB 2ICWI 2IPKA 4XO4A 4GG6B 5LQBH 2YSSB 1SHMA 3F84A 1WTLA 1GGBH 3GXIA 3VFVB 3GSRB 3TCLB 4EN3D 1ASQA 2YXVA 1I3GH 4G6JL 3VGGA 3D9AL 1ET8A 5LAXB 2VO5A 2CGRH 2B2XL 3X2QB 3CN0A 4HKJA 4OLVL 1FNHA 4JVWA 5GRJH 5DGQA 4EUPH 1XSOA 1MAKA 3BDYH 4AITA 5D6DA 1HQRB 3D25B 5PCYA 1BJ1H 3MRPB 1DUYA 1KPUA 4Z78B 3AS3A 3VXRB 3BMWA 1NAML 3KM2A 1RZKL 3GK8H 5C71A 4X50A 3SZKC 2NX5A 2BS9A 3T8XA 1E2ZA 2X6AA 4NLAA 4PQXA 1E3FA 4MJIB 1CZ8H 1WAAE 4R5TA 4BZ2H 1LNUA 4XX5A 1UXSA 1UD8A 4KTDL 5HHOA 3MX0A 5EBWA 4WCYL 2G5BB 3ZE2B 5IOKA 1QZNA 4A7QA 2NY1B 3PPEA 3LRGA 1RV6X 2ICWJ 2WLLA 3B1TA 1N2RA 4GW4A 1HHIB 1FGNH 1XCTB 1OM3L 1D2OA 1LD9A 1T3FA 4M3KB 3G5XA 1CG9A 2NW2B 4J3XA 2R8SH 3M8OH 5EO0A 5I9QB 1OARL 1OCOB 3UBXA 1EZVY 4MD5B 5GGQH 4ODWB 3QDGB 4G6KL 3EADA 3WJJA 1KJVA 5FFOA 3DX9A 3I74A 4DZ8A 2WVVB 2BZCA 1YO4A 4HA1A 5SX5K 2V8LA 3TA3A 4HZLB 4MAUL 5I15H 1ANUA 4OBRA 2ZP8A 1URZA 1A65A 3ULVE 1DSFH 4PJ7B 4P46A 4YFLI 1J1PH 4K73A 1U8LA 4J4PD 5IFHH 3GMQB 2I5YH 1EEYB 4UT9H 4XNUL 1SN0A 5FPIA 4PP1C 1RAMA 4ZFOB 3DX7A 1L3NA 4WJKB 1Z9MA 1TVHA 5ECGA 3NOIA 4LEXL 3AU0A 5AKRA 3CQPA 2BVTA 2FB4H 1Y18A 3RNQB 3NACH 1ZE3C 3D1MC 1LE5A 2EXWD 4GI6A 5LGJA 5A2KH 5EN3A 5EU6B 4YDKL 2JNZA 5F9AC 4QRUA 1W0VA 3VB9A 1JI1A 4OM1L 3H8NA 2PTTA 4TSBH 5FV1L 4NENB 1ZLEA 1R47A 4FQXD 2NQCA 7FABL 1KJ2A 1E4XI 1VFUA 5F1NA 5DSCA 4ZMYA 5IG7A 3R4DA 4L3FA 4HHAA 3GBDA 1K6QL 2K70A 1PTZA 3JWNC 4YSCA 1R0AL 2WLHA 5ICZB 1OXYA 1IAKB 4WK0B 4MQXD 3IJEA 1E9OB 2ATKB 2OL3B 3KGSA 4JMXA 3UC0L 2HVKB 3CFIC 3REVA 5JXAL 5E9DA 5ESVA 3ULAB 4R7NA 2K45A 1IBYA 2XHNA 1QLRA 1BYNA 4LMQI 1Z3GH 3TBWB 3KPOB 4A55A 2HKFH 1FJ1A 1RKRA 4Y9CA 1LDSA 4NKDB 3DVGA 4ISVA 3SPJA 3QIUD 5BUGA 4F3FB 4QXWA 3OG6B 5CGYC 4GG6A 3EJTA 3TNMB 2YD6A 2YSSA 2ZZUT 2NY6D 3RI5K 1OAUL 3NCJH 1T80A 1UWEL 3TCLA 1RURH 3SDCB 4N9GB 5MEOB 3IWVA 2Y3AA 3GZQA 5IVXF 5L4MA 3C5ZC 5LAXA 3CGTA 2HTLD 1XD1A 5GRVK 2FIKB 1BAFH 2X6BA 3C08H 3D07A 3FBKA 4D9QD 2WTRB 4QY8B 1IC5H 2KLSA 2VDQH 4XXDA 1Q1JH 1GXEA 1TZAA 5IEHB 2BNQB 4U49A 1HQRA 4OVUA 3LEYL 3ESUF 3MRPA 4X5WB 2A83B 1IT9H 4Z78A 3QUZC 1NSNL 3VXRA 4ZW8A 4O2EB 1YY9D 3AB0C 4IGBD 2ARJB 3UAJD 3VRIB 3GTVA 4HETA 3G08A 1T22B 3DECA 4MJIA 4PRPD 2CRIA 5CFHA 1RMFH 2WLKA 1EHKB 3O0RL 3L9BA 2G5BA 5A3ID 1DQMH 2X4TB 2GSGB 1S9WB 5J12B 4UZUA 2W0FB 3GMPB 1NLBL 4P9ML 3FFCE 2YAFA 3IDXH 1N7MH 4AQ1B 2CHZA 1HHIA 5B3SB 5FFLA 1A3LH 3NEEA 4AIEA 2NW2A 1H3TA 5HHMD 2GK0B 3LKQB 4P59L 3S2CA 4XCNB 1T5KA 1LO3H 1T83C 4PMFA 3WKMH 4MD5A 4ODWA 3QDGA 4Z3HA 4F58H 2D7QA 3EJZD 2WVVA 1X5ZA 4FNSA 4P57B 2C7UB 4UILL 4Y9GA 5D5MF 2XZQL 2YPVH 2FRGP 4YBLB 3CC5B 4HZLA 1X6LA 1XIWC 5HGAB 2WSKA 1A6WL 4TQ8A 2G3ZA 4LLQA 4M5TA 4M7LL 2H26A 4PJ7A 5AVWB 5CLYA 2C26A 4LRIC 2FJSA 3GMQA 3QUKB 4S1QL 1I8MB 1IAIM 1EEYA 5C0AD 5JZ7C 2YD9A 4ZFOA 2CJUH 1GKEA 4S0TD 4HXBH 4OFPA 3RNQA 2FT6A 2HX9A 3N44F 4LAQH 4W9LC 5ICYB 2JJTA 2J55A 2H3KA 1MLCB 1RJYB 5EU6A 5C08A 4KJPC 5GS1B 1B4RA 4P23D 2B08A 1MJJB 1M56B 2AV7A 4NENA 1SJEB 4J3VA 4EIUA 4OI9A 2J4WH 4WY7L 5B8CB 5E6UB 1H8LA 1EERB 2IANB 4AE0A 4ODSH 4AMXA 2EACA 4YWGL 4HU2A 3TZVB 4OAWB 3D52A 4GQ9L 5ICZA 1O6VA 2FDBP 1IAKA 3JV0A 2EDNA 2J71A 3QDAA 4M1CC 5DD6B 2WKGA 3RIKA 2ATKA 1F3JB 2B3IA 2OL3A 3DIFB 3VSVA 4P2RA 1FAKT 4YHKH 4PG9B 1KBKA 1UEYA 2CPUA 3HBQA 4X6CF 3DI3B 1BQUA 3KPOA 1WV7T 4DP5X 1FYTB 1ZHBB 4NKDA 1KOAA 3QDJE 1JDDA 3TA3C 3M17B 3CAFA 2PWDA 5EF2A 2V7HA 4PJ5D 1R34A 4F3FA 4YZWA 3OKDB 3ARBA 4GMSH 3TNMA 1G7HA 2G75B 4L4TB 4N3UA 3ZDXF 5DQ9B 5T1KD 5D1XB 1GIGL 3QJHB 3SDCA 1SVZA 1XL4A 1IKNA 4N9GA 1KCRH 5KANG 3UZEA 4ELMF 5FR3A 5MEOA 3B2PA 3B9KB 2Q8BL 4JFDA 1W80A 2FIKA 5I23A 2WTRA 1NCJA 4QY8A 5AB1A 2BSED 4YLCA 2UZPA 4M93C 4FYQA 2BNQA 2HP4A 2A9DA 4WO4C 4L1HA 3O3DB 3EFDH 3O2DL 2N56A 4X5WA 2DKUA 3QDMB 3PDOB 3V9FA 3LXAA 1AC0A 4O2EA 5GGRY 2H3NB 2ARJA 3W39B 1XGYH 5BRZD 1T22A 5GS2D 2R23B 4M4RB 3WS6A 2A5UA 5I1GH 5MI0C 3BD5A 3Q6FB 3RYMA 5SWQB 2X4TA 1S9WA 1MWAB 3GMPA 1Z6JT 5EOQH 4AM0A 4AQ1A 3KNBB 4UCFA 2GSIB 3P2DA 2QDVA 2N3JA 4FS0A 4K3DH 4X6EB 5IW6B 3HI5H 3KPSB 1FRGL 2O5YL 2GK0A 3HS0C 4X4YB 3CFKB 1QLEL 4MDIB 1G94A 3LKQA 3MJ9A 4XCNA 3TXAA 3PYCA 4WI8A 1TCRB 3B5HA 5HJ3B 3QUYA 1SY6H 3MLUL 3GJFB 3SPIA 3EYUL 4P57A 2DWDB 1ADQH 1D7DA 1FPTL 3CC5A 4KGJA 5HGAA 2NUPB 2QZ5A 5FO7B 4BFJA 2ZQKA 3F2LA 4FFYL 5F7LB 2F19H 5KUKA 3ZL1A 2IV8A 1RUML 5DHVH 1I8MA 2WK2A 5EIQA 4R97B 3Q5YA 1UYWL 4NQED 5EU7C 4XP1L 1UD6A 1NCWH 2MCPL 4HXAL 2M26A 3LKSA 5AW4B 5ICYA 3RPBA 1U2YA 1FLTX 3E80A 5CMAB 1E4WL 3C8HA 4W6WB 1MLCA 1RJYA 5F7AA 3TVMB 1RLBA 5GS1A 5IQMA 5B1JA 3H2QA 2DWEB 1MJJA 2KMWA 5EUKB 4C56D 3KBEA 4IS6B 4TTDC 1SJEA 4W9HC 5KOMC 2DH3A 4QYAA 1UZ6F 1E7UA 5B8CA 2CIIB 5DHMC 5HGDB 4HJSA 1ZMYA 4CKVX 3WFCL 1CK0H 4K7PX 2IANA 4JO1L 3VD5A 3CN2A 4M02A 3TJHD 4PHZA 3TZVA 4FC3E 4OAWA 1E50A 4FFWD 1YEKL 5DD6A 1F3JA 1UXMA 2XIBA 1UOLA 3DIFA 4FADA 4PG9A 2DQHL 1K3IA 4M7KH 4YNYB 2L7JA 3QWNA 4MB4A 4OJFL 5I1AB 2CDFB 2P46B 1S7WB 2J1WA 1FYTA 1F58L 1ZHBA 5DD3L 2FWUA 3QHFL 4Z77B 2P28B 2R56L 5D55A 5F9WB 1YNTF 2X4RB 5GS0C 2DQGH 4H26A 1SZNA 4OZGF 3OKDA 2MNUA 1F4XL 1E4XL 5AVZB 2DJMA 1E4KC 2G75A 5HI5C 3CPLB 4JZJB 5DQ9A 5D1XA 3QJHA 2Y7NA 5BRPA 4KKLD 1NOFA 5T5FA 3B9KA 4YDIL 5CD5D 1DZBA 3B37A 5SWZB 3GC3A 4TUJB 2R51A 2QSVA 3IMUA 2XT1B 4O02H 4PRBB 4ZAKB 4FZEH 1JYWA 2B8OT 3BC9A 4GS7C 4N6QA 4X8CA 3VRJA 5C6PB 2C9SA 4F2ME 2YA1A 4E2OA 1W8EA 5DRNB 1AGDB 2R69H 2X9ZA 4HCRH 1JVKA 4P3WA 4WHYH 4DKAA 4NO3B 3O3DA 2JB5L 4AI7A 4Z7AA 1A7OH 3V6BR 3QDMA 3PDOA 1E7VA 5AKTA 4BFGA 5A6IA 1PYWB 3PFUA 3MSPA 4I2XE 4YBQD 5MHSE 4LIQE 3RRQA 2E47A 2R23A 3VAEA 2EC9T 4H5SB 4Z7NB 4JRXD 1DCEA 1VPOL 2IWKA 2VWEE 4H8PA 1MIMH 1UOVA 3Q6FA 3FMGH 5SWQA 2PMZA 1NCBL 1AD0B 2I60H 2YPLD 1PW3A 3PGCB 3KNBA 5IW6A 2GSIA 4UDUB 4HWNA 4M03A 3KPSA 4JPVH 2XN9B 4OJEH 5DQDH 1BP3B 4LBAA 2GABA 4FNQA 2ZPKL 4G1MA 4OD3L 3CFKA 4MDIA 4X4YA 5FIEA 1IFGA 1TCRA 3QS3A 4XWGL 4LSRH 4CN6A 5HJ3A 5MERB 4GY4A 3WN5B 3L3IA 3L3GA 1PY4A 4D9QE 5FGBC 2IWFA 8CGTA 3FSVA 2PXYB 2YWZA 3SQRA 4NGHH 1MCKA 4W70A 2VL5B 2NUPA 2QJDA 5FO7A 4DGIL 3VACA 4I0CC 2EIMB 1CFTB 4ZOEA 1FDLH 3MNZB 4RSYA 4X80H 2Z8SA 3GRBA 4PJGB 4YAQB 2JMRA 3IU3B 3NJJA 5D5ME 3ULUC 2KHAA 4GO6B 4LVNB 5A2CA 1PEWA 1W72L 4Z8FH 2WP3T 3MNWB 1NMCB 3BZDA 4KJWD 4XNQB 1EXUA 1RZFL 4LPXA 1D5ZA 5E0FA 4PRPE 1PPIA 3BP6A 3RE0A 2FEDD 1X5KA 2O1AA 2ENYA 2W1NA 1Y0LB 3B4NA 5SWSB 3TVMA 4AKOA 3P30L 2DWEA 4NM4L 5EUKA 4F7MB 5IROD 1E5ZA 1JOIA 2G2PA 3CZLA 1F1DA 3RZWA 3WS6C 5KYXB 1NCCH 3WAJA 4KMLB 2CIIA 2Z0BA 2NZ9C 1KB9J 1RHHB 1CDIA 5HHME 5HGGS 3DO7B 1HSBB 1CI5A 4ESKA 2VT0A 2XXGA 2ADFL 2FQFA 4U1NB 3EHBB 4QHMB 4L3AA 5AB9A 1TJIH 2FT7A 4P5MB 5J3HC 3X3GL 4YNYA 1VZGA 3ZX1A 1KENH 1SVCP 4FFVD 4M6OL 4WO0A 4J2XA 5GGRB 5I1AA 1ZRUA 4V2CB 2APXA 3ISRA 1S7WA 2OTUB 4KRPC 3BN9D 3NIGF 1M7XA 4OZFH 3IDIB 4YHOL 2KL6A 4Z77A 5FYKH 5BVPL 3ARVA 5C0AE 5GRUH 2P3YA 1FC1A 4OFYA 2VDLL 2ZKHH 4JQIH 5KJ7E 1BZ7A 3CPLA 4JZJA 5CILH 2XKSA 4U31A 2BVOA 2GAZB 4KC3B 1IC7H 5D2NE 4CNIB 3DVNB 4YFEA 5JHLL 3NIFF 4JFSA 2WYZA 4IBZA 5SWZA 3N85L 1AR2A 4TUJA 3UBFA 2CBQA 4ZAKA 4Q14A 2DIEA 2Y7OA 5I1HH 2YUZA 5KTEL 1E42A 4FLRA 1TLMA 5E0QA 3ZDXE 2CAKA 3IDMB 3WMPA 3HNVH 4QLWA 5D7SH 4ELME 4NO3A 4L1DA 2KPNA 3K0WA 5F88B 1FVDA 3TN0B 2J56A 4WENB 1LEKB 1NGYB 3ARED 3LKRA 5C0DB 4GSQA 3TZVC 2GB2A 1J10A 1UENA 1QQDB 1E65A 4H5SA 2VXTL 1AGBB 3IMBA 3G6JF 3UYOD 4GLRI 3WG7B 3L4YA 2XTJE 5IESL 2JKSA 4H20H 3SE3A 3PGCA 4F24A 3RUGF 4UDUA 4PM1A 4F7CB 3EJRA 3UP6A 1IGYB 4XVJH 3U7WH 2XN9A 1CU4H 2YD4A 5HYQB 4K5NA 2YKLL 4QKXB 4J3UA 3QHZL 4I3GA 1Q9KA 4XNYH 1VA9A 4J3WA 3FC8A 3RVTC 5MERA 5ESQA 3WN5A 5HDRA 4Y5XC 4FQLL 4PI2A 1W8OA 4HHWA 4PS3A 4MLSA 1IE5A 2X1WL 4ALAH 5C7XL 2VL5A 4W9DC 1ZHLB 1EDQA 3MV11 1CFTA 1DQVA 3MNZA 3T0EE 4PJGA 5ITBL 4M7LT 3SDAA 5KW9H 4YAQA 3FTVA 2I69A 4PPTA 4BKTC 3WE6B 2EVHA 1M6OA 1B0GB 2KERA 2VC2L 1I7TB 3MNWA 4XNQA 3GSVB 5TDOB 3CBRA 4F2FA 3ZHNA 1FORH 1J9RA 3Q9QA 4DFHA 4MA8H 5SWSA 1Y0LA 2OCJA 5I28A 5AWNH 4F7MA 4JG0H 4PJ9B 2MRYA 4HCGA 5KYXA 1V55B 5LNDA 2YMXL 4OUOA 1OT1A 4XMUA 3NESA 5J11B 4HEME 4PJEB 1RHHA 3L5JA 5IM7B 1RD6A 3CZFA 3SD5A 1OAZH 3DO7A 4P3DB 1N64H 3O8XD 5C09E 1OGAE 1BZ9B 2E4FA 3UAAA 1KC5H 3NFSH 4U1NA 5JMRA 2IDSA 1UZ6E 4QHMA 2OSLB 1A5FL 2GQHA 3BZ5A 3QWOB 5DZAA 1JD7A 3ESVF 2HT2C 2H32A 3OAYK 5GGRA 4FLHA 3V52L 2H3XC 3JT2A 2WVUA 1XGRA 1EDHA 2F74B 2OTUA 2VH5H 3FTGB 3GXDA 4NZRH 4HSCX 4PJHF 4GRLD 3IDIA 2A73B 4DFIA 3TA4D 2BSDA 4QHNB 2M1KA 2ZIDA 1UACL 4NX0A 4NQEE 3IYLW 3B1UA 4HMEA 4OTXL 4N8UA 4L8SA 5TE6L 5E99H 3UJTL 3D87B 1RU9H 2GAZA 5DHXB 4CNIA 1F90H 1GJIA 3DVNA 4S1DC 3ZKNC 3DX1A 5FS5A 3GSNH 2QEJA 4OZGE 1JGLL 1BZ8A 1VJSA 1F3RB 1OSZB 2VN3A 4M5ZH 1M1SA 4C56E 5I16B 4WGKA 3HHMA 3S35L 4PWJA 2DQMA 4Z7OF 4Y2NA 2E5EA 3IDMA 3TVMC 4BQ9A 4Y8DC 1CUOA 2K8MA 2ZUTA 1WCQA 3V95A 4PGJA 5I18H 4EIBA 2EQDA 3BLPX 4GRMB 3FHEA 3BE1H 1BG9A 6PAZA 3TN0A 1FL3B 3MCLH 4DUXA 1NGYA 2XC8A 4XNZC 1LEKA 5C0DA 1KN2L 1TZGL 1KTLB 4I1RA 4I3RH 5A6MA 4DNLA 3VYPA 2GHZA 2JQMA 2D0FA 2Z8WC 3M07A 1QQDA 4X4ME 3MPCA 1AGBA 1R5IB 4HT1L 1NFDB 2F1BA 3S36H 2WO4A 1BJ1J 1CVRA 4IRJD 4YXLH 1EHXA 3QZWA 4XP5L 3TCTA 2DW5A 4F7CA 1IGYA 1GGCL 5HYQA 1THAA 2CBTA 2F54D 4ODXB 3L9RA 4TRPH 4M5SA 2CNZA 4LLWA 4PWHA 1JDCA 2QFRA 2ZAHA 2AJUL 3B34A 3F7VB 3UYPB 3VFOB 4G5ZL 4A1RA 3ZYZA 4FA7B 2PNDA 3WOVA 3NGBB 5DRZB 3E0GA 5AOMA 1RULH 2OMYB 1GHFL 2K1MA 3B56A 1K8DA 3ROOA 5BPPA 4ZTEA 2V5RA 3U30C 4O58H 1DR9A 1IIIA 5E8OB 3U6RB 1SBSH 5HHQB 5I1IH 1JTTA 4U6YB 5DMGD 1ZHLA 1N59B 5IEKB 3WNKA 1J0HA 4ZAKC 3JUYA 4LCVA 4NSKB 3DDFA 3E3QE 4KOBA 4JHZA 2H1XA 4Z7QF 4ZMQA 5CINL 3WE6A 1Z3RA 2EDDA 1MCOH 1B0GA 1NEPA 4AIOA 2MKLC 1RK7A 5AALA 3OMNB 5I71C 4PSRA 3FF7A 3GSVA 2FSDA 5TDOA 3LH2L 4ENZA 4G3YH 1JMXA 1E28B 3FN0H 1X5JA 5ITFB 5J1AB 2AK4B 3MACL 3N1GC 2ZCLH 3D4ZA 1DFXA 3RVVD 3GSXB 1FFRA 1G7PB 1T2JA 4MWFB 2HPTA 4KDTA 1RJZB 1J8RA 1SXBA 2BHZA 5LUMA 2IAMB 3H9SB 2YPLE 2WY3B 5SV3A 1MRFL 4FTVD 4PB9L 4XMKH 4L8CB 4OKVB 2WNWA 3S98A 1F3DH 4IKJA 3OHXB 4QYOB 2Y2TA 5E6ID 4PJEA 2LABA 3TESA 3LJ3A 5IM7A 1A3QA 1NGPH 3NCWA 3MUUA 3SE3C 1QD0A 3AXHA 4ODVL 4P3DA 3RZCC 4GRWF 2DS4A 2EVIA 2J72A 1BZ9A 1CGSL 1U8IA 1H5BB 1RIVH 4QXGL 3D06A 5SV4A 3QCUL 3QWOA 2YZ8A 3BN3B 2HRGA 5AL8A 2BHUA 5D7LE 1LHZA 3EOBB 1YVLA 2I7OA 4PWEA 4UZSA 2FK9A 4TULH 3X11A 3II3A 2F74A 3HZYB 3EJYD 5TDPB 1TOXA 1I8AA 2PXYC 3HB3C 3IM1A 3LS4L 2A1WL 3KPNB 4QHNA 5K9QI 2OK0L 4C54A 3LH8A 5F96L 4HC1H 5IV2A 5JA8B 1X5GA 1U2HA 3IFPB 2CHDA 3CVCA 4PY7B 3NIGE 2AGJL 3K6FA 2AC0A 1G7IB 1WFUA 2FATH 4LVNC 2O6EA 2RA1A 2YFNA 3HG1D 3NTCL 4Y1AD 1NMCC 5DEZA 1F45A 4NQVA 3FT2A 4AT6B 4JPIB 5DUPH 1OSZA 1J5IA 2BVUA 1E67A 3JXAA 3R7QA 5JW3L 3WKQA 1F11A 5I16A 3QCVL 2FO4B 5CUSL 1T0PB 5I19H 4G6AC 1KV7A 2V6HA 5ILTL 3QXDB 5EF0A 1KJ2H 1NCDL 4D7PA 1E90A 4YFLF 3RA7H 1MCWM 1JZDC 1WS7A 3NIFE 3AWEA 4D0DB 4GRMA 3KYMB 4CJ0A 1NTDA 4GUQA 3GINA 1UURA 4JPKH 4N2HA 1FL3A 5EO1B 4B41A 2BRQA 2AANA 4XX1G 4KNUA 3KDMB 4HK3N 4KXBA 1KTLA 4S1SH 4KFMA 1EFXA 4RFNB 4DN4H 4X6BB 1GC1L 1R5IA 1NFDA 3EHBC 1IM3D 3BSHA 2EDEA 5D9SB 3UTSB 3FO9A 1JRHH 4JR9H 4FXKC 3MRKB 4K4KA 4C4UA 3D3VB 1B0WA 4D0BB 1AFVL 3APMA 3O81A 4ODXA 5DRWB 1KFAL 4ZTPH 4AGNA 2FYYA 1IKFH 3ABGA 4MA1B 4HJJL 1YMHB 3G6JE 2P7TB 4ZOAA 3JWNG 3VFOA 3UYPA 5E1QA 3F7VA 3EDJA 3ETBJ 3EJSA 1V27A 5I1JL 2OMYA 1HIMH 3KBFA 5E8OA 3U6RA 4FD0A 2H2PC 3K4DA 1XTLA 2GEQA 4U6YA 3L1FA 2R1XB 1QKZH 1DQLH 1N59A 3FRPB 5IEKA 3PL6C 3O2VL 4LVHB 4NSKA 5F8RC 1BD2D 2DYPD 2FL5B 5CGYD 4NHCL 3NA4A 1BFVH 4KKPA 1UA6H 3FTXA 1NCAH 2VRKA 4HCFA 5IVOA 3X1EA 4P8QA 1CLZH 4IYKA 1XXFC 3N0AA 3HE7B 1A7QH 3P3RA 4U6VH 1E28A 4U7MA 4P99A 4UM8B 1J1XL 4ONGH 2E9GA 5J1AA 5ITFA 3KPLB 5EA0H 1ZV5A 2F8VA 3C5ZD 3GSXA 1G7PA 4ZW6A 4MWFA 3BISA 4IM8A 1RJZA 1QFPA 1JD9A 2DMHA 4JFZL 2IAMA 3H9SA 5LWYL 1BF8A 2ZUQB 4KO6A 4L8CA 4G80B 4OKVA 5ALCL 2HTKC 2P5EA 3RU8L 3OHXA 4K71C 5C2UB 3QW9A 4HUWB 2GT9A 4P4KB 4L3EA 2J8UB 2PCFB 5DFVC 2P80D 2QKIB 3HG3A 4NM8H 3WHXB 2K6WA 3IGLA 3UMTA 5FAAA 3II2A 4NHUB 1H5BA 1P4BH 3V6ZB 4XVUC 3OPUA 2EVGA 1EVUA 3EOBA 1S6NA 3U46B 1L0PA 3PDDA 3MOBL 1F97A 2VDMB 4OCXH 2FAUA 3K74B 3KYNB 1XBRA 3DJ9A 3DSNB 5D4HA 2AS5M 1MCJA 3PIQB 2CCWA 1A4JB 1UJTA 3UFIA 1LWHA 5LQBL 2XDHA 1N3NB 1GGBL 3D0VB 2PETA 3IFPA 2HFEB 3N5AA 4LDLB 4PY7A 1I3GL 1PNCA 4N8VB 2XV6B 4PJHE 4BWTA 3QC5X 1XF5B 2N7SA 5KSBB 4LLMB 1JFQL 4PGDB 4I3SL 2AJ3B 2CGRL 4JPIA 3EBGA 1XIWD 3Q13A 3QA3B 5E08L 4N0RA 3BSGA 5BMFH 4YDJB 5GRJL 2FO4A 1TQUA 3PV6B 4PLJC 3SGJA 1HKFA 3RLSA 4CSSA 4HIHA 2X7LA 3BDYL 3QXDA 5LBGA 4PJ9C 4OCRH 1Q1PA 3CXHJ 3FQ1A 4HZ1A 4Y7OC 3MV8D 4LARL 4UQ3B 4XI5C 1DCLA 4D0DA 4JK0D 1K5NB 3KYMA 5L2KD 2GI0A 4UIMB 5EO1A 4FQ1H 1SF3A 3PABB 4F7PB 1UATA 4Z7OE 3KDMA 4LLVB 3RVXD 2V3DA 1UA3A 2OL3H 4WFFD 1CWVA 4G8GE 1QR1A 1EO7A 2QGEA 4X6BA 2R4RL 3TV3H 3VXMB 4KJPD 4X4KA 1U21A 5FO2A 1RP8A 1LXMA 2AQ3A 3NPSB 5D9SA 4PW4A 3UTSA 1A9BB 1PG7W 3MRKA 5C3IA 3D3VA 4XP9H 1PG7H 4PLKC 4D0BA 4DAGH 3F6IA 1FL6B 3EGSB 4XXWA 4LHUA 2CDGB 5CJXA 2Y0SA 2P7TA 4PCYA 3UX9B 1JYNA 4M1CD 3K71B 4L0YA 4DK6A 3CVBA 4LCUB 3LNDA 3H54A 3NSCA 3F00A 5H35A 3VXUE 1IEAB 3LYRA 4YHYB 4AIXA 2R1XA 2YN5A 4YEFA 5I8CA 1CGXA 3FRPA 3S8GB 2HJKB 2N59A 1J1PL 1XL6A 1OK0A 5JIKA 5IFHL 4S2SB 2FL5A 1CDHA 2MFNA 1S7SB 2PABA 3UCRA 1BVNT 1UCBH 3DRTB 3QZNA 4TSAH 1O6TA 1SJXA 3C6LB 2MPAH 1A6AA 4I1NB 4M3JA 2V3FA 4HFUH 2RD0A 3HE7A 5T3XL 3WFZA 1VFOA 4UM8A 3QJFB 3HCVA 3KPLA 1DQIA 3UTTA 1BF2A 3A23A 4Z7QE 5DZOA 3VH8A 1E4HA 5AZUA 2CBMA 4JO8A 3DROB 4TSBL 1FBIH 4X0NA 4BWUA 3TWYA 1IFRA 4NWTH 1IE4A 1ZLSH 1I1CA 1NM4A 1ONQA 3IETB 2VITB 3WD5H 4WO4D 1MCFA 2NQ3A 4HUWA 1DQDH 4P4KA 4XB3A 2J8UA 4V1DA 4PV1C 5CP7B 2QKIA 3WHXA 5A16B 4Y4KB 4QI3A 3MJ9H 3MHZA 1JNHB 4IKIA 3ATFA 1JUFB 1D6VL 4NHUA 4JN1H 3VFRB 4FG0A 1Z5LB 4IBSA 5C0EA 5TGBB 1T0MB 2JCCF 1AQKL 1WC7B 2IV9A 3BHBB 1XFPA 5ESAA 3ZYOA 3GBEA 1G6VK 6FABH 4PJCA 1I85C 3U46A 1Z2KA 2IPUG 2HKFL 4GRWE 3THMH 2FBOJ 1DDTA 1W91A 2UZIH 3KYNA 3DSNA 3TH3T 1P7HL 3CC1A 1A4JA 5FYKE 4GQPH 1L9TA 2PO6D 2E9WA 1AKJB 1HE7A 1N3NA 2HFEA 5KG9B 4LL9A 2A99A 3U1PA 1RURL 3B9VA 4N8VA 5E2TH 1UB5B 1CLYH 1VLXA 4BM7A 1G0YR 1XF5A 4OIBA 4LLMA 3Q1SH 3SJVB 3C08L 1XR9B 4PGDA 3VX1A 3MN8A 1JXDA 3K6OA 4Z0BL 3QA3A 4FTVE 4Y1SA 3QNZB 5ICUA 4YDJA 5F71A 3QRLA 3PV6A 3AABA 1Q1JL 4NAMA 5AKSA 4O5LH 1FCGA 3L08A 4APXB 2EDLA 4UQ3A 4U7SA 4YE0A 4G7YH 1K5NA 4TNFA 5IB1B 2E6PA 2L0DA 4UIMA 2DQJH 2NW3B 3ZZQA 1G0XA 2J1YA 4K07A 3UIYA 3PABA 2YPKB 4F7PA 1UM5L 1AHWC 3FUJA 3A67L 4LLVA 1YQVH 1P0SE 1QO3B 2DIAA 4XAWH 1CLCA 1YMMB 3VXMA 1RMFL 3L54A 4GW1B 1H5BC 1UWFA 4U7KA 3GLAA 4TTDD 3SKUD 1ZVYA 2UXTA 2HT3C 3C5SB 2ARJQ 3OZKA 4RAVB 2IQ9H 1A9BA 3TOPA 1BMGA 1N7ML 2X4OB 3GEFA 4Y2LA 4ABQA 4HFWB 1GS8A 4ONOA 1A3LL 2MEJB 4X6DE 2PLTA 2VDKB 1TNNA 2C3HA 1Y6KR 2XN2A 4NKIH 2CDGA 3D39B 3PP4H 4MGXA 5FUCC 1RZGB 2FBJL 3FH7A 3WKML 3DNKA 2HKHH 4AM0Q 3K71A 4Y1AE 1PZ5B 4LCUA 4F58L 1TNMA 5T5FH 2GG1A 3SYCA 2WWMC 1IEAA 3VE0B 2YPVL 3RTQB 4YMPA 4MA3A 4P2QE 5AW0B 2EEDA 5ABDE 3MKKA 4J8RB 2WM0A 4D94A 1JHLH 4RX4A 1DVSA 3OKNB 1WD9A 2QPDB 2VRQA 4LEEA 3LXCA 2H1PL 1S7SA 4XX1E 3DRTA 1A7NH 3IE4A 2CO4A 4FX5A 2CJUL 3C6LA 2EH8L 3SDDB 5I6XC 5B22A 4J39A 4EDXB 4LMQE 5GGUB 4HXBL 4A66A 1U42A 1QAWA 3ABKB 1ETB1 3IXAB 4BV1A 3BAEL 4RGOL 2H2SC 3QJFA 5ES4B 1KXHA 5T1JA 4LAQL 4E0RB 1TYEB 2GTQA 2HMIC 3LB6C 2X28A 3RB5A 2VJXA 5CJQH 4N85A 3JV6B 1QATA 1IEBA 1U33A 3DROA 4G8IB 3W0WE 3HC2A 4Z7UB 5F1SA 2LT9A 2VXQA 5J1TC 2J4WL 3JVGA 3PQYE 3IETA 3OTTA 5H8DA 2VITA 4QTIL 2XQYA 2DOCA 5CKGA 5HVGB 4G9FD 3KWWB 3JWNE 4ODSL 4PP2B 5CP7A 4JANA 3F83A 1UCTA 4Q6IB 4Y4KA 4GAGH 1JNHA 3B2VL 5AVQB 1EHAA 5KBPA 3D2TA 1JUFA 3BAXA 4PJIF 3VFRA 3SPCA 3VWJC 1Z5LA 4KKQA 4ES8A 1XTMA 4FA8A 4F57H 1M71B 3L9YA 5EUOE 5CJXC 4YHKL 3GRWL 1T0MA 2Y2YA 3SGDI 5FUOH 2VSDA 3HKFA 3F58H 5HDOA 1C16B 4ZS7H 5DUMH 2YD2A 3ARZA 1G7MB 1F00I 3HS8A 4EE2A 2J6WA 2J5LC 3MV9D 4MJJA 2X4QB 4ODBD 3MNMA 1JERA 3BUYA 3EOYG 4GMSL 2KI6A 4YSAA 3ARYA 1AKJA 5TQ0H 1GW0A 3MGAA 3N41B 2GJZB 3FUNA 5KG9A 4N2FA 2PF6A 3SYOA 1CFMA 4JDTH 5TQ2H 3W37A 1TTUA 1UB5A 1U0QA 3PGDB 4UIKH 5IMMB 3EW3B 3SJVA 2O5ZH 1XR9A 4ZG1A 5SX5H 1GCFA 3HC4H 5DS8B 2CBOA 1H3PH 3QNZA 3SOTA 5IMLB 3C6EA 3DWTA 1VFBB 3AG2B 4PBDA 2GJJA 5BJTB 2Y07H 1A1NB 2W9DH 2Y22A 1KPRB 1MOEA 4APXA 1S7XB 3AQZA 3ULUD 3DK2A 1R3LB 43C9B 4H0IA 5IB1A 1U95B 3CFTA 3L4XA 2NW3A 5AVRB 2YPKA 1XGYL 5EF3A 4TS6A 1EJ8A 1QO3A 3UAEA 3D05A 1YMMA 4LLYB 2PYEB 5I1GL 1QTPA 4YSDA 3L48A 3TEXA 2OMXA 5KBDA 3C09B 1MPAL 5AZEL 3SBWA 4PIRF 4HGKC 3VFPB 2BSSB 4KJYB 4BKLB 2X4OA 3PXLA 5HY9B 2NZ9D 4HFWA 2A74C 4RAHA 3IXTB 4ZSOE 3UH8A 4B50A 2PWHA 2V17H 2P9RA 4Q56A 1VGEH 4HEPA 2F0CA 3S37L 3D39A 3VI3F 3HHSB 1RZGA 2B1AL 3A3YB 3PHAA 1R9FA 3ZKSD 1SY6L 1PZ5A 2NR6C 2ZWSA 5J3HD 3ULUF 1U8NB 3A6BH 2BDNH 4WRLA 1CXKA 1PKQE 3IU4H 3VE0A 4CMHC 3VVWA 3RTQA 4UNTA 3CZGA 3G5VA 5T33H 1E6JH 4EIZC 4KRPD 4J8RA 3CDGB 1JGVH 2VXUH 3TV8A 2WZPA 4AVJA 3OKNA 5HVHB 2VERA 1WITA 4LE8A 2V37A 1N19A 4RDQF 5L2KE 1OT4A 1JBJA 5C0JB 1JJUA 3I6SA 1KLUB 3SDDA 1DL7L 1NCWL 4EDXA 5GGUA 2OFQA 5JXEA 3IXAA 3VGHA 1N6QH 3D2UD 3LIZA 5DJZB 4E0RA 3F7KA 5F8QC 3NCCB 1V3LA 1AY1L 3OXRA 5EDXA 5EBLB 4B5EA 1KFGA 2JKIS 1QPXA 3JV6A 1CDUA 4G8IA 3MZTA 3UZQA 1UH2A 5HHOE 4Z7UA 1AXTH 2E0PA 4BYHA 4NN5B 1T1WB 3NPSC 4XHJC 1CK0L 2Y6SD 3KWWA 4IIQC 3PG2A 4P0DA 4PP2A 5B7EA 4Q6IA 4ZXBB 1J5OH 4D9RE 1GGIH 3RX7A 4XR8C 1ZT7B 1SDAB 1HHJA 4MMXC 3WXWH 5D4JA 1MNUH 5CAYB 1OWWA 3ZW3A 3AT8A 1BMZA 1U93A 4W93A 5LDSA 5LGHH 1QSFB 3CX5J 5FCUH 5AUMB 1C16A 1U92B 4G83A 4AQEB 4TOYH 4M4PA 3QSKB 1A21A 3P73B 4UOQA 1G7MA 3APCA 5DT1L 4K8RH 3K2UH 2H0EA 4O4YL 3ZRCC 3QDHA 2X4QA 3QULB 1MIEH 2JCCE 3TIDB 5IHWA 4Q4IA 3B3IB 2HZHA 2QGCA 4Z7WB 1TQCC 3O6LH 1CT8B 2GJZA 3QWQB 2Y1AA 5JTWA 3RVTD 3R7RA 3ZT7A 5H4ZA 3EJPA 1DBKH 3PGDA 1U3NA 3C6SB 4J6RH 4LAJH 4O02L 4XBEL 3FB8B 4ZMPA 4IBWA 4TVPH 1VFBA