2BM6A

The structure of mfpa (rv3361c, c2221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
178
structure length
178
Chain Sequence
QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
molecule tags Pentapeptide repeat protein
source organism Mycobacterium tuberculosis
total genus 76
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm6A00
2J8IA 2BM7A 2BM5A 4JRAC 2F3LA 2G0YA 5JMCB 5JLVC 2BM6A 3N90A 2BM4A 2W7ZA
chains in the Genus database with same CATH superfamily
2J8KA 2VFOA 1KQ5A 2UVEA 2X85A 2V5IA 3VSTA 1O8DA 2XC1A 1O8GA 4XMYA 3VSUA 1CZFA 3SZEA 2BM6A 2IOUG 2PYGA 4YDTA 1O8HA 2W7ZA 5DNSA 3TH0A 1DABA 4OJLA 4V02C 2BM7A 1HG8A 1IDJA 1RWRA 1O8IA 2F3LA 2XTYA 4OZZA 2XTWA 3EQOA 3GQ7A 1IDKA 3T9GA 4YEJA 2QXZA 1DBGA 2NTBA 3DU1X 1IA5A 4XR6A 4HWVA 1QA2A 4XKWA 1LM1A 4C2LA 3SQVA 1OGMX 3GQ8A 5AMVA 1H80A 1HF2A 1O8FA 1TYVA 3FY3A 3BH6B 2NZMA 1VBLA 4W8TA 5C1CA 1KTWA 4U4BA 4YZXA 1QRCA 3N90A 4URRA 4PMHA 2XTXA 2UVFA 4XLEA 3SYJA 4AVZA 3PSZA 2O04A 1EA0A 4YCQA 3SY2A 1EE6A 5JMCB 4YC5A 1CLWA 1QJVA 3GQAA 2YUHA 1EZGA 2QYUA 2INUA 2X6XA 2QZAA 4XKVA 2BSPA 3GQ9A 2IQ7A 1RMGA 4OJ6A 4YZAA 3ML3A 2BX6A 4XLHA 4XORA 1O8EA 3KRGA 3N6ZA 4OZYA 4XN0A 4OPWA 2NSPA 1PLUA 1K8FA 1QA3A 1QQ1A 3NB2A 4OJ5A 3UW0A 2G0YA 2O17A 1OGOX 1OFEA 2Z8GA 4XLAA 1QRBA 2XT4A 4KH3A 3B8YA 1TYXA 2PECA 1TSPA 2VBKA 3JX8A 1OFDA 4MXNA 4YEIA 5JLVC 1DBOA 4W8SA 2VFPA 2NSTA 4U49A 4XM3A 4OJPA 4YFOA 4XNFA 4XL9A 3B4NA 2O1DA 3PSSA 2VBEA 1GQ8A 3B90A 3VMVA 4EW9A 1JRGA 2XT2A 2O0VA 1KCCA 1OOCA 2EWEA 1O8LA 2QX3A 1IB4A 4NK8A 4XQFA 4I84A 1O8JA 3VSVA 2BM5A 1PE9A 2QY1A 2VJJA 3ZPPA 2NTQA 3NAWA 1LLZA 4NK6A 1XG2A 1KCDA 3JURA 3P4GA 2J8IA 2X6WA 3EQNA 2O0WA 2NT9A 4YELA 1O8KA 3SUCA 1NHCA 3AK5A 3LYCA 4XN3A 4Z03A 2VFQA 3WWGA 2BM4A 4YZ0A 4XLCA 4JRAC 1LLWA 1OFLA 4XLFA 4OJOA 3RIQA 1TYWA 5C1EA 1BHEA 1X0CA 2VBMA 1K5CA 1QA1A 1O88A 4XOTA 3PETA 4YZQA 2B0RA 4W8RA 1QCXA 2NTPA 3BH7B 1OFMA 1PXZA 1RU4A 2PYHA 4XONA 1K4ZA 2X3HA 3ZSCA 3LJYA 4Z06A 2NT6A 2VJIA 2VFMA 1L1IA 2VFNA 2ODLA 1BN8A 2INVA 2X6YA 3LMWA 1AIRA 4W8QA 4Z05A 4OM9A 3H09A 1WXRA 1O8MA 4MR0A 3GRHA 3VMWA 1JTAA 1TYUA 4XOPA 2O6WA 1WMRA
chains in the Genus database with same CATH topology
2VFOA 3SYJA 4JRAC 4OJPA 1KQ5A 3RIQA 4OJOA 2V5IA 1TYWA 2XC1A 5JMCB 1CLWA 2BM6A 2IOUG 3SZEA 2YUHA 1QA1A 3PETA 2W7ZA 2B0RA 3TH0A 1DABA 4OJLA 4OJ6A 4V02C 2BM7A 3BH7B 2F3LA 3ML3A 2BX6A 1K4ZA 3LJYA 3N6ZA 4OPWA 2VFMA 2VFNA 2BM5A 1K8FA 1QA3A 1QQ1A 4OJ5A 2G0YA 1QA2A 4OM9A 3H09A 1QRBA 4KH3A 1HF2A 1TYVA 2J8IA 3P4GA 1WXRA 3BH6B 1TYXA 3AK5A 1TSPA 3JX8A 3LYCA 5JLVC 2VFQA 1TYUA 1QRCA 3N90A 2BM4A 2VFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  2BM7 A;  2BM5 A;  4JRA C;  2F3L A;  2G0Y A;  5JMC B;  5JLV C;  2BM6 A;  3N90 A;  2BM4 A;  2W7Z A; 
#chains in the Genus database with same CATH topology
 2J8K A;  2VFO A;  1KQ5 A;  2UVE A;  2X85 A;  2V5I A;  3VST A;  1O8D A;  2XC1 A;  1O8G A;  4XMY A;  3VSU A;  1CZF A;  3SZE A;  2BM6 A;  2IOU G;  2PYG A;  4YDT A;  1O8H A;  2W7Z A;  5DNS A;  3TH0 A;  1DAB A;  4OJL A;  4V02 C;  2BM7 A;  1HG8 A;  1IDJ A;  1RWR A;  1O8I A;  2F3L A;  2XTY A;  4OZZ A;  2XTW A;  3EQO A;  3GQ7 A;  1IDK A;  3T9G A;  4YEJ A;  2QXZ A;  1DBG A;  2NTB A;  3DU1 X;  1IA5 A;  4XR6 A;  4HWV A;  1QA2 A;  4XKW A;  1LM1 A;  4C2L A;  3SQV A;  1OGM X;  3GQ8 A;  5AMV A;  1H80 A;  1HF2 A;  1O8F A;  1TYV A;  3FY3 A;  3BH6 B;  2NZM A;  1VBL A;  4W8T A;  5C1C A;  1KTW A;  4U4B A;  4YZX A;  1QRC A;  3N90 A;  4URR A;  4PMH A;  2XTX A;  2UVF A;  4XLE A;  3SYJ A;  4AVZ A;  3PSZ A;  2O04 A;  1EA0 A;  4YCQ A;  3SY2 A;  1EE6 A;  5JMC B;  4YC5 A;  1CLW A;  1QJV A;  3GQA A;  2YUH A;  1EZG A;  2QYU A;  2INU A;  2X6X A;  2QZA A;  4XKV A;  2BSP A;  3GQ9 A;  2IQ7 A;  1RMG A;  4OJ6 A;  4YZA A;  3ML3 A;  2BX6 A;  4XLH A;  4XOR A;  1O8E A;  3KRG A;  3N6Z A;  4OZY A;  4XN0 A;  4OPW A;  2NSP A;  1PLU A;  1K8F A;  1QA3 A;  1QQ1 A;  3NB2 A;  4OJ5 A;  3UW0 A;  2G0Y A;  2O17 A;  1OGO X;  1OFE A;  2Z8G A;  4XLA A;  1QRB A;  2XT4 A;  4KH3 A;  3B8Y A;  1TYX A;  2PEC A;  1TSP A;  2VBK A;  3JX8 A;  1OFD A;  4MXN A;  4YEI A;  5JLV C;  1DBO A;  4W8S A;  2VFP A;  2NST A;  4U49 A;  4XM3 A;  4OJP A;  4YFO A;  4XNF A;  4XL9 A;  3B4N A;  2O1D A;  3PSS A;  2VBE A;  1GQ8 A;  3B90 A;  3VMV A;  4EW9 A;  1JRG A;  2XT2 A;  2O0V A;  1KCC A;  1OOC A;  2EWE A;  1O8L A;  2QX3 A;  1IB4 A;  4NK8 A;  4XQF A;  4I84 A;  1O8J A;  3VSV A;  2BM5 A;  1PE9 A;  2QY1 A;  2VJJ A;  3ZPP A;  2NTQ A;  3NAW A;  1LLZ A;  4NK6 A;  1XG2 A;  1KCD A;  3JUR A;  3P4G A;  2J8I A;  2X6W A;  3EQN A;  2O0W A;  2NT9 A;  4YEL A;  1O8K A;  3SUC A;  1NHC A;  3AK5 A;  3LYC A;  4XN3 A;  4Z03 A;  2VFQ A;  3WWG A;  2BM4 A;  4YZ0 A;  4XLC A;  4JRA C;  1LLW A;  1OFL A;  4XLF A;  4OJO A;  3RIQ A;  1TYW A;  5C1E A;  1BHE A;  1X0C A;  2VBM A;  1K5C A;  1QA1 A;  1O88 A;  4XOT A;  3PET A;  4YZQ A;  2B0R A;  4W8R A;  1QCX A;  2NTP A;  3BH7 B;  1OFM A;  1PXZ A;  1RU4 A;  2PYH A;  4XON A;  1K4Z A;  2X3H A;  3ZSC A;  3LJY A;  4Z06 A;  2NT6 A;  2VJI A;  2VFM A;  1L1I A;  2VFN A;  2ODL A;  1BN8 A;  2INV A;  2X6Y A;  3LMW A;  1AIR A;  4W8Q A;  4Z05 A;  4OM9 A;  3H09 A;  1WXR A;  1O8M A;  4MR0 A;  3GRH A;  3VMW A;  1JTA A;  1TYU A;  4XOP A;  2O6W A;  1WMR A; 
#chains in the Genus database with same CATH homology
 2VFO A;  3SYJ A;  4JRA C;  4OJP A;  1KQ5 A;  3RIQ A;  4OJO A;  2V5I A;  1TYW A;  2XC1 A;  5JMC B;  1CLW A;  2BM6 A;  2IOU G;  3SZE A;  2YUH A;  1QA1 A;  3PET A;  2W7Z A;  2B0R A;  3TH0 A;  1DAB A;  4OJL A;  4OJ6 A;  4V02 C;  2BM7 A;  3BH7 B;  2F3L A;  3ML3 A;  2BX6 A;  1K4Z A;  3LJY A;  3N6Z A;  4OPW A;  2VFM A;  2VFN A;  2BM5 A;  1K8F A;  1QA3 A;  1QQ1 A;  4OJ5 A;  2G0Y A;  1QA2 A;  4OM9 A;  3H09 A;  1QRB A;  4KH3 A;  1HF2 A;  1TYV A;  2J8I A;  3P4G A;  1WXR A;  3BH6 B;  1TYX A;  3AK5 A;  1TSP A;  3JX8 A;  3LYC A;  5JLV C;  2VFQ A;  1TYU A;  1QRC A;  3N90 A;  2BM4 A;  2VFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...