2BM6A

The structure of mfpa (rv3361c, c2221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
178
structure length
178
Chain Sequence
QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
total genus 76
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm6A00
2J8IA 5JMCB 2BM4A 2G0YA 2W7ZA 2BM6A 5JLVC 2F3LA 2BM7A 2BM5A 3N90A 4JRAC
chains in the Genus database with same CATH superfamily
2VFQA 1IDKA 3TH0A 3H09A 2VFOA 4Z03A 3LJYA 2UVFA 3RIQA 1HF2A 1TYUA 1O8DA 4XLFA 4XR6A 1DABA 1X0CA 1LM1A 4XN0A 3SYJA 2QXZA 1KCCA 1TYVA 4XLHA 1XG2A 4XOPA 1PE9A 1VBLA 4OJPA 5JMCB 4W8QA 1KQ5A 2INUA 3JX8A 4NK6A 3SZEA 1DBOA 2XC1A 2UVEA 3ML3A 1AIRA 4URRA 4W8RA 2O1DA 1L1IA 3GRHA 1HG8A 5C1EA 1EE6A 1TSPA 2J8IA 2XTXA 1O8FA 3T9GA 1BHEA 2YUHA 2O0WA 2PECA 1OFDA 3GQ8A 4YZXA 2VBEA 5DNSA 3BH7B 4OZZA 3AK5A 3DU1X 2X85A 1PXZA 1JTAA 1K4ZA 4OZYA 2QX3A 4YZQA 1O8JA 4EW9A 3VMVA 2NT9A 2XT2A 3JURA 3SQVA 4YZ0A 4YFOA 1IA5A 2G0YA 4YC5A 3VSVA 2X6XA 2IQ7A 1H80A 2J8KA 2NZMA 2ODLA 1GQ8A 2BM5A 1EZGA 1QCXA 3EQOA 3VMWA 1OFLA 1JRGA 2V5IA 4OPWA 3B4NA 2VJJA 1CLWA 1RWRA 1WMRA 1PLUA 4XLEA 1LLWA 2BSPA 3VSTA 4OM9A 4XNFA 3LMWA 4XORA 2PYGA 3SUCA 1DBGA 3WWGA 3B90A 3EQNA 2Z8GA 4NK8A 4AVZA 2BM7A 3VSUA 2VBKA 1CZFA 1IDJA 2EWEA 1TYWA 2INVA 1QA3A 2O17A 2XT4A 4MXNA 4OJLA 1RU4A 2X3HA 4Z06A 5JLVC 1QRBA 4YDTA 2X6YA 3PSZA 4C2LA 1O8IA 1EA0A 4YCQA 5AMVA 1OOCA 1QRCA 1TYXA 2BM4A 4XLAA 1QJVA 2W7ZA 4YEJA 3ZSCA 4U49A 1WXRA 4W8TA 1OGMX 2NSPA 2NTPA 3P4GA 1K5CA 4MR0A 4OJ5A 2O6WA 4I84A 1RMGA 1KTWA 4XQFA 1OFEA 3ZPPA 2NTQA 3LYCA 1NHCA 4YEIA 4XN3A 1O88A 1K8FA 1O8MA 3NB2A 1KCDA 2VFPA 1QA1A 2BM6A 2VFMA 4XONA 3PSSA 2BX6A 4V02C 2VFNA 2QZAA 1O8KA 3NAWA 3GQ7A 2QY1A 2VJIA 3GQ9A 4XMYA 4XM3A 5C1CA 2IOUG 2O0VA 3GQAA 4KH3A 4XOTA 4YELA 1BN8A 1O8HA 4OJOA 1O8GA 3SY2A 4Z05A 4U4BA 3FY3A 4XLCA 1QA2A 3B8YA 2O04A 1QQ1A 2PYHA 3UW0A 1O8EA 4XKVA 1OGOX 2NSTA 3KRGA 4OJ6A 3BH6B 2XTYA 1O8LA 4XL9A 2XTWA 2QYUA 1LLZA 3PETA 4XKWA 2X6WA 4JRAC 2NTBA 4HWVA 4YZAA 4PMHA 3N6ZA 1OFMA 1IB4A 2F3LA 2NT6A 2VBMA 2B0RA 4W8SA 3N90A
chains in the Genus database with same CATH topology
2VFQA 1TYWA 2VFNA 1QA3A 3AK5A 4V02C 3H09A 3TH0A 2VFOA 3LJYA 4OJLA 2IOUG 3RIQA 1K4ZA 1HF2A 1TYUA 4KH3A 1QRBA 5JLVC 4OJOA 1DABA 3SYJA 1QRCA 1TYXA 2BM4A 1TYVA 1QA2A 2G0YA 2W7ZA 1WXRA 1QQ1A 2BM5A 4OJPA 3P4GA 5JMCB 4OJ6A 1KQ5A 3JX8A 2V5IA 3BH6B 4OPWA 4OJ5A 3SZEA 2XC1A 1CLWA 3ML3A 3LYCA 4OM9A 3PETA 1TSPA 4JRAC 2J8IA 1QA1A 1K8FA 3N6ZA 2VFPA 2YUHA 2BM6A 2VFMA 2BM7A 2F3LA 2B0RA 2BX6A 3BH7B 3N90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  5JMC B;  2BM4 A;  2G0Y A;  2W7Z A;  2BM6 A;  5JLV C;  2F3L A;  2BM7 A;  2BM5 A;  3N90 A;  4JRA C; 
#chains in the Genus database with same CATH topology
 2VFQ A;  1IDK A;  3TH0 A;  3H09 A;  2VFO A;  4Z03 A;  3LJY A;  2UVF A;  3RIQ A;  1HF2 A;  1TYU A;  1O8D A;  4XLF A;  4XR6 A;  1DAB A;  1X0C A;  1LM1 A;  4XN0 A;  3SYJ A;  2QXZ A;  1KCC A;  1TYV A;  4XLH A;  1XG2 A;  4XOP A;  1PE9 A;  1VBL A;  4OJP A;  5JMC B;  4W8Q A;  1KQ5 A;  2INU A;  3JX8 A;  4NK6 A;  3SZE A;  1DBO A;  2XC1 A;  2UVE A;  3ML3 A;  1AIR A;  4URR A;  4W8R A;  2O1D A;  1L1I A;  3GRH A;  1HG8 A;  5C1E A;  1EE6 A;  1TSP A;  2J8I A;  2XTX A;  1O8F A;  3T9G A;  1BHE A;  2YUH A;  2O0W A;  2PEC A;  1OFD A;  3GQ8 A;  4YZX A;  2VBE A;  5DNS A;  3BH7 B;  4OZZ A;  3AK5 A;  3DU1 X;  2X85 A;  1PXZ A;  1JTA A;  1K4Z A;  4OZY A;  2QX3 A;  4YZQ A;  1O8J A;  4EW9 A;  3VMV A;  2NT9 A;  2XT2 A;  3JUR A;  3SQV A;  4YZ0 A;  4YFO A;  1IA5 A;  2G0Y A;  4YC5 A;  3VSV A;  2X6X A;  2IQ7 A;  1H80 A;  2J8K A;  2NZM A;  2ODL A;  1GQ8 A;  2BM5 A;  1EZG A;  1QCX A;  3EQO A;  3VMW A;  1OFL A;  1JRG A;  2V5I A;  4OPW A;  3B4N A;  2VJJ A;  1CLW A;  1RWR A;  1WMR A;  1PLU A;  4XLE A;  1LLW A;  2BSP A;  3VST A;  4OM9 A;  4XNF A;  3LMW A;  4XOR A;  2PYG A;  3SUC A;  1DBG A;  3WWG A;  3B90 A;  3EQN A;  2Z8G A;  4NK8 A;  4AVZ A;  2BM7 A;  3VSU A;  2VBK A;  1CZF A;  1IDJ A;  2EWE A;  1TYW A;  2INV A;  1QA3 A;  2O17 A;  2XT4 A;  4MXN A;  4OJL A;  1RU4 A;  2X3H A;  4Z06 A;  5JLV C;  1QRB A;  4YDT A;  2X6Y A;  3PSZ A;  4C2L A;  1O8I A;  1EA0 A;  4YCQ A;  5AMV A;  1OOC A;  1QRC A;  1TYX A;  2BM4 A;  4XLA A;  1QJV A;  2W7Z A;  4YEJ A;  3ZSC A;  4U49 A;  1WXR A;  4W8T A;  1OGM X;  2NSP A;  2NTP A;  3P4G A;  1K5C A;  4MR0 A;  4OJ5 A;  2O6W A;  4I84 A;  1RMG A;  1KTW A;  4XQF A;  1OFE A;  3ZPP A;  2NTQ A;  3LYC A;  1NHC A;  4YEI A;  4XN3 A;  1O88 A;  1K8F A;  1O8M A;  3NB2 A;  1KCD A;  2VFP A;  1QA1 A;  2BM6 A;  2VFM A;  4XON A;  3PSS A;  2BX6 A;  4V02 C;  2VFN A;  2QZA A;  1O8K A;  3NAW A;  3GQ7 A;  2QY1 A;  2VJI A;  3GQ9 A;  4XMY A;  4XM3 A;  5C1C A;  2IOU G;  2O0V A;  3GQA A;  4KH3 A;  4XOT A;  4YEL A;  1BN8 A;  1O8H A;  4OJO A;  1O8G A;  3SY2 A;  4Z05 A;  4U4B A;  3FY3 A;  4XLC A;  1QA2 A;  3B8Y A;  2O04 A;  1QQ1 A;  2PYH A;  3UW0 A;  1O8E A;  4XKV A;  1OGO X;  2NST A;  3KRG A;  4OJ6 A;  3BH6 B;  2XTY A;  1O8L A;  4XL9 A;  2XTW A;  2QYU A;  1LLZ A;  3PET A;  4XKW A;  2X6W A;  4JRA C;  2NTB A;  4HWV A;  4YZA A;  4PMH A;  3N6Z A;  1OFM A;  1IB4 A;  2F3L A;  2NT6 A;  2VBM A;  2B0R A;  4W8S A;  3N90 A; 
#chains in the Genus database with same CATH homology
 2VFQ A;  1TYW A;  2VFN A;  1QA3 A;  3AK5 A;  4V02 C;  3H09 A;  3TH0 A;  2VFO A;  3LJY A;  4OJL A;  2IOU G;  3RIQ A;  1K4Z A;  1HF2 A;  1TYU A;  4KH3 A;  1QRB A;  5JLV C;  4OJO A;  1DAB A;  3SYJ A;  1QRC A;  1TYX A;  2BM4 A;  1TYV A;  1QA2 A;  2G0Y A;  2W7Z A;  1WXR A;  1QQ1 A;  2BM5 A;  4OJP A;  3P4G A;  5JMC B;  4OJ6 A;  1KQ5 A;  3JX8 A;  2V5I A;  3BH6 B;  4OPW A;  4OJ5 A;  3SZE A;  2XC1 A;  1CLW A;  3ML3 A;  3LYC A;  4OM9 A;  3PET A;  1TSP A;  4JRA C;  2J8I A;  1QA1 A;  1K8F A;  3N6Z A;  2VFP A;  2YUH A;  2BM6 A;  2VFM A;  2BM7 A;  2F3L A;  2B0R A;  2BX6 A;  3BH7 B;  3N90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...