2BM6A

The structure of mfpa (rv3361c, c2221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
178
structure length
178
Chain Sequence
QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 76
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm6A00
2J8IA 4JRAC 2BM4A 2BM6A 5JMCB 2W7ZA 3N90A 5JLVC 2BM5A 2F3LA 2G0YA 2BM7A
chains in the Genus database with same CATH superfamily
2BM4A 3PSSA 2UVEA 4XONA 1QQ1A 1WMRA 3BH6B 3T9GA 2IQ7A 2VJIA 4YFOA 3N90A 1EA0A 1RWRA 3PETA 1TSPA 4C2LA 2VBEA 1O8GA 1DBGA 1LLWA 2EWEA 3H09A 3BH7B 4U49A 3SY2A 4V02C 4W8TA 4XN3A 5JLVC 1PLUA 4XL9A 2J8KA 2QXZA 1BHEA 4OZZA 3SUCA 2NZMA 1NHCA 4XQFA 4YZXA 1QCXA 1O88A 2NTQA 2PYGA 2X6XA 4HWVA 1LLZA 1O8EA 3VMVA 4XLCA 3KRGA 3ZSCA 4YC5A 2W7ZA 3GQAA 2BX6A 1AIRA 3GQ8A 2NSPA 2VFMA 1QRBA 2XT4A 1CLWA 5C1EA 4I84A 2BM6A 1JTAA 3ZPPA 1IA5A 4YELA 2VBMA 1H80A 1OFDA 3B90A 3ML3A 3N6ZA 4OPWA 3VSTA 3B8YA 4XORA 3RIQA 4XKVA 3LYCA 4XN0A 1TYXA 1K5CA 2VFPA 3LMWA 4XOPA 2O17A 2XTXA 4OJOA 4XLHA 5DNSA 2O6WA 2Z8GA 1QA2A 1O8LA 3NB2A 1QA1A 2O1DA 1IDJA 1PXZA 4OM9A 2NT9A 5C1CA 4OJ6A 3AK5A 4XLFA 2F3LA 1KCDA 1DBOA 1KTWA 1O8KA 2QX3A 2XT2A 3B4NA 1OGOX 1OOCA 1RMGA 1LM1A 2O04A 4XM3A 4XMYA 1EE6A 1PE9A 2B0RA 2VBKA 2PYHA 3JX8A 4XKWA 4XR6A 4YEJA 1WXRA 4U4BA 3NAWA 4OJPA 2V5IA 4YZQA 4PMHA 4OJLA 2VFNA 4YDTA 1O8MA 2NSTA 2XTWA 2IOUG 3EQOA 3PSZA 1KQ5A 4W8RA 3SQVA 2QY1A 1KCCA 4URRA 1TYVA 2NTBA 1EZGA 1IB4A 2PECA 1X0CA 2X6YA 4NK6A 3GQ7A 2NTPA 3EQNA 5AMVA 4OJ5A 4YZAA 1HF2A 2X3HA 3GRHA 3JURA 1OGMX 3LJYA 2QYUA 2O0WA 3VMWA 2INVA 2G0YA 1O8IA 2O0VA 4XLEA 4XNFA 3WWGA 1QA3A 1TYWA 4JRAC 1O8HA 1O8JA 2XC1A 4W8QA 5JMCB 2XTYA 4YEIA 2VFQA 2X6WA 1TYUA 2VFOA 2QZAA 3VSUA 1JRGA 2J8IA 4NK8A 1K4ZA 1VBLA 4Z06A 3DU1X 4MXNA 1QRCA 1QJVA 4MR0A 4W8SA 1CZFA 3GQ9A 2INUA 2YUHA 4AVZA 3SZEA 4Z03A 1IDKA 3TH0A 3VSVA 4OZYA 1K8FA 2NT6A 3UW0A 1OFLA 3P4GA 1OFMA 1BN8A 2UVFA 2BSPA 1XG2A 1O8FA 1OFEA 4XLAA 3SYJA 4EW9A 2X85A 2ODLA 1O8DA 2VJJA 1DABA 1RU4A 4KH3A 1GQ8A 1L1IA 2BM5A 4YCQA 4XOTA 4YZ0A 4Z05A 2BM7A 1HG8A 3FY3A
chains in the Genus database with same CATH topology
1QRBA 2J8IA 1CLWA 2BM4A 1K4ZA 2BM6A 1KQ5A 1QQ1A 2IOUG 3BH6B 3AK5A 1QRCA 4OPWA 3N90A 3ML3A 3N6ZA 3PETA 1TSPA 1TYVA 2YUHA 3H09A 3RIQA 3BH7B 3SZEA 3LYCA 4V02C 1TYXA 3TH0A 2VFPA 5JLVC 1K8FA 4OJ5A 3P4GA 4OJOA 1HF2A 1QA2A 1QA1A 3LJYA 4OM9A 4OJ6A 2F3LA 3SYJA 2G0YA 1QA3A 1TYWA 4JRAC 2XC1A 1DABA 5JMCB 2B0RA 2W7ZA 2VFQA 2BX6A 2BM5A 2VFNA 1TYUA 2VFOA 3JX8A 4KH3A 1WXRA 4OJPA 2V5IA 2BM7A 4OJLA 2VFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  4JRA C;  2BM4 A;  2BM6 A;  5JMC B;  2W7Z A;  3N90 A;  5JLV C;  2BM5 A;  2F3L A;  2G0Y A;  2BM7 A; 
#chains in the Genus database with same CATH topology
 2BM4 A;  3PSS A;  2UVE A;  4XON A;  1QQ1 A;  1WMR A;  3BH6 B;  3T9G A;  2IQ7 A;  2VJI A;  4YFO A;  3N90 A;  1EA0 A;  1RWR A;  3PET A;  1TSP A;  4C2L A;  2VBE A;  1O8G A;  1DBG A;  1LLW A;  2EWE A;  3H09 A;  3BH7 B;  4U49 A;  3SY2 A;  4V02 C;  4W8T A;  4XN3 A;  5JLV C;  1PLU A;  4XL9 A;  2J8K A;  2QXZ A;  1BHE A;  4OZZ A;  3SUC A;  2NZM A;  1NHC A;  4XQF A;  4YZX A;  1QCX A;  1O88 A;  2NTQ A;  2PYG A;  2X6X A;  4HWV A;  1LLZ A;  1O8E A;  3VMV A;  4XLC A;  3KRG A;  3ZSC A;  4YC5 A;  2W7Z A;  3GQA A;  2BX6 A;  1AIR A;  3GQ8 A;  2NSP A;  2VFM A;  1QRB A;  2XT4 A;  1CLW A;  5C1E A;  4I84 A;  2BM6 A;  1JTA A;  3ZPP A;  1IA5 A;  4YEL A;  2VBM A;  1H80 A;  1OFD A;  3B90 A;  3ML3 A;  3N6Z A;  4OPW A;  3VST A;  3B8Y A;  4XOR A;  3RIQ A;  4XKV A;  3LYC A;  4XN0 A;  1TYX A;  1K5C A;  2VFP A;  3LMW A;  4XOP A;  2O17 A;  2XTX A;  4OJO A;  4XLH A;  5DNS A;  2O6W A;  2Z8G A;  1QA2 A;  1O8L A;  3NB2 A;  1QA1 A;  2O1D A;  1IDJ A;  1PXZ A;  4OM9 A;  2NT9 A;  5C1C A;  4OJ6 A;  3AK5 A;  4XLF A;  2F3L A;  1KCD A;  1DBO A;  1KTW A;  1O8K A;  2QX3 A;  2XT2 A;  3B4N A;  1OGO X;  1OOC A;  1RMG A;  1LM1 A;  2O04 A;  4XM3 A;  4XMY A;  1EE6 A;  1PE9 A;  2B0R A;  2VBK A;  2PYH A;  3JX8 A;  4XKW A;  4XR6 A;  4YEJ A;  1WXR A;  4U4B A;  3NAW A;  4OJP A;  2V5I A;  4YZQ A;  4PMH A;  4OJL A;  2VFN A;  4YDT A;  1O8M A;  2NST A;  2XTW A;  2IOU G;  3EQO A;  3PSZ A;  1KQ5 A;  4W8R A;  3SQV A;  2QY1 A;  1KCC A;  4URR A;  1TYV A;  2NTB A;  1EZG A;  1IB4 A;  2PEC A;  1X0C A;  2X6Y A;  4NK6 A;  3GQ7 A;  2NTP A;  3EQN A;  5AMV A;  4OJ5 A;  4YZA A;  1HF2 A;  2X3H A;  3GRH A;  3JUR A;  1OGM X;  3LJY A;  2QYU A;  2O0W A;  3VMW A;  2INV A;  2G0Y A;  1O8I A;  2O0V A;  4XLE A;  4XNF A;  3WWG A;  1QA3 A;  1TYW A;  4JRA C;  1O8H A;  1O8J A;  2XC1 A;  4W8Q A;  5JMC B;  2XTY A;  4YEI A;  2VFQ A;  2X6W A;  1TYU A;  2VFO A;  2QZA A;  3VSU A;  1JRG A;  2J8I A;  4NK8 A;  1K4Z A;  1VBL A;  4Z06 A;  3DU1 X;  4MXN A;  1QRC A;  1QJV A;  4MR0 A;  4W8S A;  1CZF A;  3GQ9 A;  2INU A;  2YUH A;  4AVZ A;  3SZE A;  4Z03 A;  1IDK A;  3TH0 A;  3VSV A;  4OZY A;  1K8F A;  2NT6 A;  3UW0 A;  1OFL A;  3P4G A;  1OFM A;  1BN8 A;  2UVF A;  2BSP A;  1XG2 A;  1O8F A;  1OFE A;  4XLA A;  3SYJ A;  4EW9 A;  2X85 A;  2ODL A;  1O8D A;  2VJJ A;  1DAB A;  1RU4 A;  4KH3 A;  1GQ8 A;  1L1I A;  2BM5 A;  4YCQ A;  4XOT A;  4YZ0 A;  4Z05 A;  2BM7 A;  1HG8 A;  3FY3 A; 
#chains in the Genus database with same CATH homology
 1QRB A;  2J8I A;  1CLW A;  2BM4 A;  1K4Z A;  2BM6 A;  1KQ5 A;  1QQ1 A;  2IOU G;  3BH6 B;  3AK5 A;  1QRC A;  4OPW A;  3N90 A;  3ML3 A;  3N6Z A;  3PET A;  1TSP A;  1TYV A;  2YUH A;  3H09 A;  3RIQ A;  3BH7 B;  3SZE A;  3LYC A;  4V02 C;  1TYX A;  3TH0 A;  2VFP A;  5JLV C;  1K8F A;  4OJ5 A;  3P4G A;  4OJO A;  1HF2 A;  1QA2 A;  1QA1 A;  3LJY A;  4OM9 A;  4OJ6 A;  2F3L A;  3SYJ A;  2G0Y A;  1QA3 A;  1TYW A;  4JRA C;  2XC1 A;  1DAB A;  5JMC B;  2B0R A;  2W7Z A;  2VFQ A;  2BX6 A;  2BM5 A;  2VFN A;  1TYU A;  2VFO A;  3JX8 A;  4KH3 A;  1WXR A;  4OJP A;  2V5I A;  2BM7 A;  4OJL A;  2VFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...