2BM6A

The structure of mfpa (rv3361c, c2221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
178
structure length
178
Chain Sequence
QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 76
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm6A00
2BM7A 5JLVC 4JRAC 2BM6A 2F3LA 3N90A 2BM4A 5JMCB 2G0YA 2W7ZA 2J8IA 2BM5A
chains in the Genus database with same CATH superfamily
3P4GA 1LLZA 1KCDA 1BHEA 4YZXA 2O6WA 4YEIA 2NTPA 3PSZA 4W8SA 1O88A 1TYWA 3UW0A 3JURA 1OFLA 3SQVA 3LMWA 3SUCA 1GQ8A 4YZQA 4W8RA 2QZAA 4XL9A 1LLWA 4XN0A 1OGMX 3AK5A 3GQAA 4JRAC 1HG8A 4YCQA 3BH7B 4OM9A 2QYUA 3GQ7A 3VSVA 2BX6A 1WMRA 4YEJA 1X0CA 2XTXA 3ML3A 3SYJA 2Z8GA 5AMVA 4I84A 4XLHA 2BM6A 1O8MA 3VMVA 1QA2A 1PLUA 2VBMA 1CLWA 4YC5A 2PYGA 1RWRA 1TYVA 3NAWA 3EQOA 4XOPA 1QA1A 4AVZA 3SY2A 2UVEA 1O8DA 4XMYA 4XNFA 4YZAA 1O8HA 3JX8A 4XM3A 5DNSA 3ZPPA 1BN8A 4XLEA 1DABA 1RU4A 2NTBA 4XORA 3TH0A 4YFOA 4MXNA 3BH6B 3VSTA 3GQ8A 2BM5A 3PSSA 1RMGA 4OJ5A 2BSPA 2VFPA 3B4NA 4YELA 1O8FA 1XG2A 1QQ1A 4Z06A 3GQ9A 2VFQA 1EE6A 3PETA 3SZEA 1O8LA 1OGOX 2IQ7A 1VBLA 4W8QA 4EW9A 2W7ZA 1H80A 2IOUG 4W8TA 1PE9A 4Z05A 1O8GA 4XOTA 5JLVC 2VBEA 1IA5A 2NT6A 2F3LA 2BM4A 2NSPA 5C1CA 2INVA 4YZ0A 1QJVA 2VJIA 2X85A 3DU1X 4XLFA 1L1IA 2O17A 2X6WA 2NTQA 3LJYA 4OPWA 2XC1A 1QCXA 1OFMA 2B0RA 2O0WA 4XR6A 3WWGA 1JRGA 4PMHA 1HF2A 2NT9A 3VMWA 5C1EA 3EQNA 2X6XA 5JMCB 2YUHA 3ZSCA 1QRCA 2O04A 4MR0A 4URRA 4C2LA 1NHCA 1AIRA 2XT4A 1WXRA 1K8FA 1OFDA 4NK8A 3N90A 4OZYA 2J8IA 3B8YA 1LM1A 4XLCA 1KCCA 4V02C 3N6ZA 1K5CA 1TSPA 1KTWA 1O8IA 2NSTA 3H09A 2QY1A 1QRBA 3VSUA 1IDJA 4OJ6A 2VFNA 4U4BA 2QX3A 3LYCA 1O8JA 1OOCA 2BM7A 4XLAA 2PECA 2X6YA 4KH3A 1TYUA 2NZMA 2QXZA 1CZFA 1TYXA 2G0YA 3T9GA 4XQFA 2XTWA 4XKWA 1QA3A 2PYHA 2VBKA 2VJJA 3KRGA 2INUA 4NK6A 4YDTA 2O0VA 1KQ5A 4OZZA 1DBOA 1PXZA 2O1DA 4XN3A 2X3HA 4HWVA 2V5IA 1O8EA 1IB4A 1EZGA 1IDKA 3FY3A 3NB2A 2XTYA 1O8KA 3B90A 4U49A 1OFEA 4XKVA 1JTAA 2J8KA 2XT2A 1EA0A 4OJPA 4XONA 1DBGA 2EWEA 2VFMA 4OJLA 1K4ZA 4OJOA 2ODLA 4Z03A 3RIQA 2VFOA 3GRHA 2UVFA
chains in the Genus database with same CATH topology
3P4GA 2BM7A 4KH3A 1DABA 3TH0A 1TYUA 3LJYA 4OPWA 2XC1A 1TYWA 2B0RA 2G0YA 1TYXA 3BH6B 1QA3A 2BM5A 4OJ5A 1KQ5A 1HF2A 3AK5A 4JRAC 2VFPA 3BH7B 4OM9A 5JMCB 2BX6A 2YUHA 1QRCA 1QQ1A 2V5IA 3ML3A 3SYJA 2VFQA 1WXRA 1K8FA 3PETA 3SZEA 2BM6A 3N90A 2W7ZA 2J8IA 1QA2A 2IOUG 4V02C 3N6ZA 1CLWA 1TSPA 5JLVC 3H09A 4OJPA 1TYVA 1QRBA 2VFMA 1QA1A 4OJLA 1K4ZA 2VFNA 4OJ6A 2F3LA 4OJOA 2BM4A 3LYCA 3JX8A 3RIQA 2VFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM7 A;  5JLV C;  4JRA C;  2BM6 A;  2F3L A;  3N90 A;  2BM4 A;  5JMC B;  2G0Y A;  2W7Z A;  2J8I A;  2BM5 A; 
#chains in the Genus database with same CATH topology
 3P4G A;  1LLZ A;  1KCD A;  1BHE A;  4YZX A;  2O6W A;  4YEI A;  2NTP A;  3PSZ A;  4W8S A;  1O88 A;  1TYW A;  3UW0 A;  3JUR A;  1OFL A;  3SQV A;  3LMW A;  3SUC A;  1GQ8 A;  4YZQ A;  4W8R A;  2QZA A;  4XL9 A;  1LLW A;  4XN0 A;  1OGM X;  3AK5 A;  3GQA A;  4JRA C;  1HG8 A;  4YCQ A;  3BH7 B;  4OM9 A;  2QYU A;  3GQ7 A;  3VSV A;  2BX6 A;  1WMR A;  4YEJ A;  1X0C A;  2XTX A;  3ML3 A;  3SYJ A;  2Z8G A;  5AMV A;  4I84 A;  4XLH A;  2BM6 A;  1O8M A;  3VMV A;  1QA2 A;  1PLU A;  2VBM A;  1CLW A;  4YC5 A;  2PYG A;  1RWR A;  1TYV A;  3NAW A;  3EQO A;  4XOP A;  1QA1 A;  4AVZ A;  3SY2 A;  2UVE A;  1O8D A;  4XMY A;  4XNF A;  4YZA A;  1O8H A;  3JX8 A;  4XM3 A;  5DNS A;  3ZPP A;  1BN8 A;  4XLE A;  1DAB A;  1RU4 A;  2NTB A;  4XOR A;  3TH0 A;  4YFO A;  4MXN A;  3BH6 B;  3VST A;  3GQ8 A;  2BM5 A;  3PSS A;  1RMG A;  4OJ5 A;  2BSP A;  2VFP A;  3B4N A;  4YEL A;  1O8F A;  1XG2 A;  1QQ1 A;  4Z06 A;  3GQ9 A;  2VFQ A;  1EE6 A;  3PET A;  3SZE A;  1O8L A;  1OGO X;  2IQ7 A;  1VBL A;  4W8Q A;  4EW9 A;  2W7Z A;  1H80 A;  2IOU G;  4W8T A;  1PE9 A;  4Z05 A;  1O8G A;  4XOT A;  5JLV C;  2VBE A;  1IA5 A;  2NT6 A;  2F3L A;  2BM4 A;  2NSP A;  5C1C A;  2INV A;  4YZ0 A;  1QJV A;  2VJI A;  2X85 A;  3DU1 X;  4XLF A;  1L1I A;  2O17 A;  2X6W A;  2NTQ A;  3LJY A;  4OPW A;  2XC1 A;  1QCX A;  1OFM A;  2B0R A;  2O0W A;  4XR6 A;  3WWG A;  1JRG A;  4PMH A;  1HF2 A;  2NT9 A;  3VMW A;  5C1E A;  3EQN A;  2X6X A;  5JMC B;  2YUH A;  3ZSC A;  1QRC A;  2O04 A;  4MR0 A;  4URR A;  4C2L A;  1NHC A;  1AIR A;  2XT4 A;  1WXR A;  1K8F A;  1OFD A;  4NK8 A;  3N90 A;  4OZY A;  2J8I A;  3B8Y A;  1LM1 A;  4XLC A;  1KCC A;  4V02 C;  3N6Z A;  1K5C A;  1TSP A;  1KTW A;  1O8I A;  2NST A;  3H09 A;  2QY1 A;  1QRB A;  3VSU A;  1IDJ A;  4OJ6 A;  2VFN A;  4U4B A;  2QX3 A;  3LYC A;  1O8J A;  1OOC A;  2BM7 A;  4XLA A;  2PEC A;  2X6Y A;  4KH3 A;  1TYU A;  2NZM A;  2QXZ A;  1CZF A;  1TYX A;  2G0Y A;  3T9G A;  4XQF A;  2XTW A;  4XKW A;  1QA3 A;  2PYH A;  2VBK A;  2VJJ A;  3KRG A;  2INU A;  4NK6 A;  4YDT A;  2O0V A;  1KQ5 A;  4OZZ A;  1DBO A;  1PXZ A;  2O1D A;  4XN3 A;  2X3H A;  4HWV A;  2V5I A;  1O8E A;  1IB4 A;  1EZG A;  1IDK A;  3FY3 A;  3NB2 A;  2XTY A;  1O8K A;  3B90 A;  4U49 A;  1OFE A;  4XKV A;  1JTA A;  2J8K A;  2XT2 A;  1EA0 A;  4OJP A;  4XON A;  1DBG A;  2EWE A;  2VFM A;  4OJL A;  1K4Z A;  4OJO A;  2ODL A;  4Z03 A;  3RIQ A;  2VFO A;  3GRH A;  2UVF A; 
#chains in the Genus database with same CATH homology
 3P4G A;  2BM7 A;  4KH3 A;  1DAB A;  3TH0 A;  1TYU A;  3LJY A;  4OPW A;  2XC1 A;  1TYW A;  2B0R A;  2G0Y A;  1TYX A;  3BH6 B;  1QA3 A;  2BM5 A;  4OJ5 A;  1KQ5 A;  1HF2 A;  3AK5 A;  4JRA C;  2VFP A;  3BH7 B;  4OM9 A;  5JMC B;  2BX6 A;  2YUH A;  1QRC A;  1QQ1 A;  2V5I A;  3ML3 A;  3SYJ A;  2VFQ A;  1WXR A;  1K8F A;  3PET A;  3SZE A;  2BM6 A;  3N90 A;  2W7Z A;  2J8I A;  1QA2 A;  2IOU G;  4V02 C;  3N6Z A;  1CLW A;  1TSP A;  5JLV C;  3H09 A;  4OJP A;  1TYV A;  1QRB A;  2VFM A;  1QA1 A;  4OJL A;  1K4Z A;  2VFN A;  4OJ6 A;  2F3L A;  4OJO A;  2BM4 A;  3LYC A;  3JX8 A;  3RIQ A;  2VFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...