2BMKA

Fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
b'DIELTQSPAIMAASPGEKVTITCSATSGVNYMHWFQQKPGTSPKLWIYSTSNLASAVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSTYPFTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT OF CATALYTIC ANTIBODY 15A9, LIGHT CHAIN
publication title Structural basis for D-amino acid transamination by the pyridoxal 5'-phosphate-dependent catalytic antibody 15A9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bmkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bmkA01
4NUGL 3LIZL 3O41B 4OD2A 4P46D 3RIAK 1FNSH 3RIFK 4K7FB 3C09C 4PJGF 3HC4L 3IAGC 5C8JA 1OVZA 4XP5L 1BQHA 1C16A 3NAAH 2VXSL 4DVRH 4CDGC 4ZO9A 3QCUL 2VNCA 4AMKH 1TFHA 4XPAH 2X4UB 1Q9WB 1TZHB 5F72S 1FH5H 1XT5A 4H26A 4YNYB 1Y0LB 2H45A 4PJEA 4YIQA 5DFVC 2OXHA 1QR1A 1NAKL 3MLWH 2YD3A 1FYTD 3HA0A 5GSVA 2DQJH 4KI5D 3KWWA 1CTNA 4PRAA 1QD0A 5CJQL 1NJ9A 4YC2C 5SWZD 4LCUA 1HILB 3BPNC 2ARJA 2E3VA 1CLYH 3BDYH 2H6PA 4L8CA 4HDIA 2V6HA 3EYSL 4X6EA 4Q9RH 1Z9OA 1PLGH 1MCNA 3WJLC 4YBLB 2EO9A 1TJHL 4OIIH 5F88B 3TYFA 5KVGL 3WFDH 4OLWL 1IGML 3NFSL 4YX2H 1DANT 3V0VA 5GIRB 4Q0XH 1XGPA 2OJEB 1MCCA 4WNQB 4KJQD 1K4CA 3MV9D 1Z3GH 4I18C 3GRWL 2YKLL 3T0XA 4DW2H 3MRQA 4HD9A 4JCMA 3WXVH 2XV6B 3B6SB 5CGMA 3D2UB 5JPNB 1R3HA 3GI9L 3I3EA 2DMKA 2VAJA 1IEBA 5BQ7A 4O5LH 4R2GD 4O2EA 2F74B 1MFCL 3BH8A 1BX2A 4DZBB 5IVZB 4S2SA 4XI5D 3HE7A 1YQ2A 5DMGD 3TFKC 5C3TA 3CFKA 4YDJA 5ALBL 5I15H 2E7BA 3MRIB 3MV7A 3JV4B 4DKFH 4Q7DA 4PB0L 2YN5A 5C9JB 1MUJB 4QRPB 4HWZA 2B5IB 1ZWIB 3MOBL 5C0ND 4XCEA 5IQ7L 3EBAA 2AJYH 3QO1B 1VFUA 3FQTB 3IXAB 4IOSD 4WU7B 3B2VL 1A6TA 1WICA 5DRWA 5GRVL 2XIDA 4UDUA 4D0BA 5MI0C 3U7YL 2KZWA 3G6JE 3MRRA 1CLOL 1JNLH 1HOCA 5AYUH 2HVJA 4OAWA 2CXKA 1T5XB 5GGUA 5B38G 1HWGB 1KJ2L 1RULL 1QFHA 1NLDL 3C9NA 4NM4H 1CT8B 2ENYA 5DR5L 2SEBA 2CKBB 4OZIB 3ILQD 3DGGA 5C2BH 3V5HB 4Z7NF 3ME0A 3SE4C 3CZJA 2BOBB 4NO3B 2EDRA 4PJEE 5C7XL 3MV8B 4PGJA 3BT2L 3HZYB 3LS4H 3S35H 2W0PA 1U8IA 5FF6A 5FO9A 4D3CH 4WW2B 2X4TA 2E5EA 4NO2B 3T8XB 3AXLA 4K8RH 3F5WA 3CZFB 1NCTA 4BUHA 2EDEA 5HVHC 4PLNC 3K74B 4QRSA 2GY5A 3DUSB 4MD4B 4HK0A 5D1XA 3VWKB 4Y19A 4GKSB 1NGPL 3Q0HA 5D7KE 2NYYC 5F1SA 1I1AC 3CPLB 5CP7B 1V05A 4GSDH 4QKXB 4CJ1A 4KRMB 3LB6D 4BSVA 4H5SA 3JVGA 3TIDB 4P9HL 4XTRD 5DYOB 1SEBA 1ES0A 1A5FH 1GPOL 4POYA 3HG1A 2YUZA 3HCVA 3PJSA 1KFAH 3M8OH 4JFHE 4NZRH 1L7TH 3ZSTA 3R06B 5I73B 3QP3A 4Y2DC 2FHFA 4FQ2L 4K94C 5GJTL 4UTBH 1B0RB 4ODSH 4X8XA 3MV7E 3RVUC 1LO0L 4P2RA 4O2CA 1IL1A 2YD4A 3MLZL 2V5TA 3KHQA 4JKWA 1XCTA 3ZE1F 4NQCD 4GT7A 3SKNB 3MCKB 3QXVA 1E4XL 1EFXD 2VDML 4HAFA 5AYQA 5B3NA 4OF8A 2DF3A 3WN5B 2DRUA 2HVKA 3QIBB 1JTPA 5EUOF 2IADB 5GGSY 4KK6C 4Y4FD 4P4KC 4ZDHA 3ET9F 3HAEA 4X9HA 4Y4KB 4HXAH 5I18L 3REWB 5BJTA 4GH7B 1HH6B 2HWZL 3QUYD 2C3GA 4CMMB 1ZLUH 3TCXA 2UY6A 4JRYD 5KVFL 4PR5A 3QXAA 1G9NH 1MFAL 1MCWW 2R1YB 3NGBB 4ZFFB 1JPTH 2MWCA 1U3HC 3ZT7A 1BOGA 3DJ9A 2XTJB 3K8LA 2FJGA 2BNUA 2K9UA 2P8MA 5DEZA 5GS1A 5F1NA 2VXQH 4X5XA 1RFDL 1AKJD 1FIEA 3FFCA 1G7IB 2R39A 1I8KB 4FFWC 3SGKC 2J8HA 2YUXA 4CW1A 1OAKL 1E6JH 5D2NB 4AENB 3V79C 1U8KB 2VE6B 1T3FA 2IPTH 2IPKB 4JHBA 4Y19E 2P8PA 3OKOB 2VLRA 2BHYA 4J8RB 3U36B 3LAFA 4YEFA 4A6YH 5JOFA 2O5XH 5EU7E 1F4HA 1NFDA 2P7TA 4HIIA 4X7CC 3NPZB 4Q58C 4LAQH 3HG1E 1EX0A 5EZJA 4H0IA 1GGCH 2ESVD 3UTZA 4MS8D 1RUML 4GRLD 4HHAA 3QI9A 3U7AA 1Q9KA 4MD0A 4HC1L 2GITA 4D8PA 1PEWA 1DQML 4WDIA 5JHLH 1R5VA 3FTGA 2QKIA 3F7VB 4FQ1H 4G7VL 4PJ9B 5TGBA 1FFQA 3INUH 1IZJA 4P2RE 4PJBA 3S3JA 2AV7B 3SDDD 1BD2D 5B8CA 3KXFA 2NZ9D 5KSUA 4GUPB 5T1DH 5ADPL 4QRUB 5CEZH 5AD0A 1OGAB 4RISH 4X99B 1UXSA 2Y36H 2VDKL 1RZGB 3LRSA 4NNPL 1OW0A 2E7LC 4MQXD 2BMKB 1MFDH 4S1QH 2I60H 3NOIA 1T1WB 4DN4L 4PFEA 4WHTB 3DECA 1DLHA 1UM5L 5CZXC 5CWSA 5IK3B 4ONHA 3THMH 5ACMA 1T0MA 3RTQA 5HGBB 1KF9B 5I17A 5T3XL 4KVCH 1BWWA 2ZUQC 4HWNA 5FKPA 2UUDK 3LQZA 1MCLA 4Y5XA 4XNZC 5IB5A 1KJ2A 3KPSB 4GAJH 1AXTH 3QRGL 3I75B 4HJJL 3L3OA 5B39A 1MH5A 3O3DA 1D6EA 4X8JB 5DK2A 3JVGC 3FFCE 2F53A 2FWOB 2WUCL 3RZCD 3VGGA 3IDGB 2AV1B 3AY4C 4YHOL 1WZ1H 5D6DA 2PW2B 4F15C 5E08H 1JPGA 2VLRE 3U0WL 4XAWH 5ESAB 1YNTB 1WWAX 2EYSA 4KWUA 3W0WD 4P5TC 2R1WA 5HHOA 1NFDE 3MC0A 2QSCH 3ARFA 1TZIB 4W6WB 4G3YH 4GRMA 4Z7VF 1ZT1A 1ZEAL 1NAMB 8FABA 4LQ1A 3HR5B 4ODHH 5GGRB 1U8HA 2GJZB 4M6MH 3RWEA 4UBDC 4JZNA 3C6LD 1I4FA 2NY2C 4GMTL 3U30C 4GAYB 1RMFL 3AMKA 4KC3B 1LP9B 3CDFA 3HPLB 2HJKA 4KXZI 3JSSA 4L4TA 5IVNA 4PTUB 3CH1B 5ADOL 4FXKB 4UTAL 3Q6GH 4UB0L 2J8UF 3MJ9H 2YD1A 4PJBE 2MCPH 2PO6A 5DI8A 2AEQL 3KXFE 5HXMA 2DOCA 1PKQA 5FGCE 2MNUA 1DN0A 3AU1A 5DRNB 1IAOA 2HMID 1B0WA 2Q3ZA 1OAZH 3FZUD 1FZOA 1IGCL 3U4BH 3FOMB 4I48B 3BKJH 5C3LD 2Y23A 2I5YL 3HUJF 3WKMH 1C08B 2X70A 4X0KA 4Z0XA 3ZKXB 4F9PC 4P3DA 5L2JA 1P4IH 2VDOL 4WO4C 5EBMA 3BUTA 3DV6B 3JV6A 5DXWA 1T89A 5F8RC 1DBKL 4QRRD 2A77L 3T0EA 4UUJA 4KDVA 4OM1H 5INCA 5A2LH 2DLFH 2CK2A 1WEJH 4LVOB 4AM0A 1MRFL 3BD3A 3CXHK 1OF2B 3QQ4A 1M4KA 5HHNA 1A7RH 4NN5C 3N9GL 4FOMA 5FFLA 4KI5F 3FRUA 1T7XA 3OAZH 3QFJB 5CJOL 1FO0H 1FL6A 1NCAL 3OHXA 3D3VA 1XZ0A 5C0AB 2PNDA 5H37G 1UZ6E 4KKNA 5MERB 4RMQA 4RGMB 2ZCLH 4M7JH 4JRWA 3L7EB 1OAUH 2ITDB 2XZAL 4JM2D 3HRPA 5C1MB 1A1OB 2CDEB 1JMZA 1K8DB 5HJ3A 4D9LL 4TRPH 2F53E 3HNSH 1GXEA 3MNVA 3VXOB 4DJMA 4GKNA 1NLBH 1JHTA 4KKLD 4H88H 2D4FA 3BWUC 3CFDB 3K3QA 4EQ3A 1N6UA 1W2KT 3ARBC 1FNFA 5HHOE 4NC1C 1OP3H 3ZDXE 5JQ6L 2CRYA 1JWMB 5LKNA 4P2OD 1AY1L 2CMRH 3D48R 4MJ6A 2R2CA 1DBJH 4HXBL 3TVMA 3S34L 4YDVA 5FYJL 4RBPH 4KV5E 3G5VB 1T1ZB 1D3CA 3IDMA 5I1IL 2F58H 1NBVL 1LVEA 3U1SH 4QXUH 5KZCB 4Y8AA 2NPLX 2ADGB 3JTTB 3O2DA 4L4TE 1TQCB 2BSSA 4JB9L 1YMHA 2R29H 5D7SH 4HS3B 3JWDH 3MLRH 3EJJX 3P73B 5F9WB 3RAJH 3MJ7B 2FEEL 3VW3L 4M1GH 1NUFA 1PKQE 2HT3C 2EDWA 3GKZA 2EDQA 2ATKA 3HLAA 3QUXD 3STLB 4F33A 2ATPA 1IILE 3FB6B 3IKKA 1D5ZB 4ZQKB 2HKHH 4K3HA 2OR9L 3OPZL 4BH7B 3MRLB 5GGTA 3ARGC 4H1LG 3AAZA 2F15A 5I2IB 5E8DL 3I3DA 2J4WH 3T0EE 1C5DA 3QYCA 4ONGL 3RI5K 4I0PD 1V3MA 4YHKH 3VFPB 2DWEA 3WFEL 3HI1A 3L1OL 1E0OB 2D4DA 3ARSA 3VXRD 3DO3A 1S8DB 1OP5H 5FO8A 1NBYA 4LLWA 4X7TA 1NCBL 2OMNA 5CZVH 5D8JH 5DTFB 5DMIH 4LHUB 2BVQA 1RIVH 3GJFA 2JJSA 4MD5B 4LLYB 4ERSH 4XH2A 5D6DC 1JYVA 2I9TB 4AIOA 3D3VE 3OKMA 3S37X 2ORBL 1K2DA 5F9OH 2Y5EA 3R4DA 3ULUH 2OZ4H 3O3BA 1VGEL 5BVJB 1YN7A 4PS4H 5I8CA 4EN3B 2QADC 3PABB 1NCWH 4Z76A 5KJRL 5BS0D 4R26H 3ARFC 3EYOA 1DFBL 3B9EA 5C0JA 1ZGLM 2YPLD 3GNMH 4YXHH 1U8NA 3RX7A 4HUVB 1TCRB 3EOAA 4GW4B 2QQNH 2DI7A 1Y18A 4JR9H 1BZQK 4DKAA 1DR9A 1AJ7L 3L3GB 3PWLB 4AL8L 2CUHA 2VDNL 4YPJA 4ZPVA 4P9HC 5AZEH 4OGYL 4KZDL 2A6DB 4P49A 3QIUB 1HEZA 5D7LA 2W92A 4FFZL 5DFTA 3K8KA 1G6RB 1F4YL 2W9DL 3PWPD 3HFMH 1PJ9A 3WO4C 1XGTB 4H25A 2A73A 5D5MF 5EUKB 3SOBH 4DUVA 3MOQA 5DQJB 1QA9B 1CCZA 2YOCA 3SCMB 2G5BA 1QBLH 5JIKA 2K3TA 4MNGB 1T89C 3H9ZA 2NY0B 2VDQH 1TVBB 3CVHL 1I1RA 1JWSA 4J1UA 4KRNA 5EOQL 5CBAA 3MROA 1ND0A 3B3IB 3LOWA 4NZTL 1CDIA 4HIXL 4Y5YC 4QTIH 4M7LL 1INEH 5D72H 4NRXB 5DD0L 5IB1A 2QQLL 1A6UH 4TUOB 1A3RH 5L9DL 1F4XH 2DYPD 2RQ8A 1N6QH 5DEGB 1PZ5B 1BFVH 4XC3H 2HT2C 1RURH 4YAQA 1PYWB 3G5XB 4NQDD 1FVDB 4RIRB 4ZUUB 3LCYA 3PDOB 2Q8AH 3UZEA 3WL9B 1DQLH 2EYTB 3TBTB 3MSPA 4Y1AB 3RUGF 4DQOL 1SBSL 1K3IA 4KJPD 4S1RH 4YUEL 3VE0B 5LGJA 5EO1A 4NO5B 3BSZL 5C09A 4N0UA 2H1PH 3SKOB 4IIQC 4J4PD 2OTUA 1MCBA 3D18B 2GJ6A 2RFXB 1OSPH 4OZHB 4PJ8D 2B2XL 3RKDD 1KOAA 1FGVL 1U9KA 4GKOA 4UT7L 3HZMB 1JYWA 1BEYH 1MCSA 3TVMC 1S7WA 2CKNA 5FYKD 3MJ6A 5I1KH 4P5KA 1H0DB 2VZUA 1R3KA 2W65A 5DVOA 1A7NL 5EORL 5EFIA 3CK0H 2EIDA 5GS0D 3T0DA 4Y16A 5E6IB 3O3AA 3JWOL 1K3ZA 8CGTA 4OLZL 3JTSB 1IGFH 3VXMA 3QNXB 4LVHB 4CUCA 5D70L 4DCQA 5BOZG 3EHBD 5D7LE 5FM5O 4NHCH 3UBXG 4D9QD 1KC5H 3EDJA 3VFWA 5JTWA 3QDHA 1T20B 4GRWE 2ZWLT 4HIEB 5F3HB 3LH2L 1C5BL 2VSCA 5F7EL 1Q0XL 4OI7A 1VFAA 2NXYB 3W39B 2IPUG 3OBAA 4ZUWB 3H9SB 3FJTA 3TZVC 2D7TL 3TNNB 3RY6A 4XPAL 32C2A 3FQNB 5E2TL 1RZ8A 2G9HB 2I07A 2YD6A 1XH3A 5HPMA 3C60C 4KROB 3UJIH 1WBZB 2AK4B 3ILPB 3TN0C 1U2HA 1RJYB 3C2AL 4YHYB 1Z5LA 5EO9B 3EOYG 1K6QH 3WLBA 4PJDA 5F6HI 4MXWH 1KLFA 3TA3B 3CDYA 3WHXA 4AZ8A 1KB5L 2BCKA 2JJSC 3RDTB 3ZKQD 2DTSA 4YZFF 2FLBT 4ZAKC 2VAAB 4DUWA 1OTTD 2NY1B 3K4AA 2DJUA 1UFUA 3IFPB 4R4BA 5KOMC 2AP2A 1PAMA 2WLZA 1LDPL 3ZLQC 3FT2A 4P23A 4KFZC 2BVOA 4BA8A 4MAYC 4HUXB 3VXUA 3VXQB 4P4RA 1S5HB 4YX2L 4Q0XL 3VA2C 1KEGL 5A43C 4L1HA 3D2UD 1Z3GL 3GMOA 1FVEA 5GRXG 3WXWL 3HI5H 5DQ9B 3WXVL 1EHNA 2RCSL 2AJVL 5C09E 5GRUL 3U0TA 3G9AB 4N0UE 4R90H 5E4EB 5FDYA 4HKBB 3VD5A 3P0YH 2CRIA 1TVDA 4MWFA 5I1HH 4XVJL 2ZKHL 2GJ6E 4QRPD 1CF8H 4RGNB 4R6UA 4NBXB 5DK0B 2K7QA 2JCCB 2Q76B 4LHQB 1ZLWK 1CGXA 4U1NB 2HN7B 4DKFL 3KLHD 1KENH 2EKJA 1ETZB 4FXGA 4RFOL 2X9WA 2VLKA 3TBWA 1OWWA 4X83A 1KN2L 3C5ZB 4JANB 5ICZB 5J11C 4G9FB 2Y72A 1I7RA 3BIKA 3ZKMC 2RAMA 3ULUD 1G84A 4ZTOH 4TUKH 3VXME 25C8L 4APQA 3QA3B 3PF2A 3IJSA 2AXFB 2G5RA 3PIQA 2ZCKL 3RL2A 5KVEH 4KTEH 1MHHB 3QCVH 1JNLL 5EU6A 2UYLB 5AYUL 1EO8L 4HG4J 1C1EH 4XMLL 1N59B 2E8YA 1HIMH 2HFEB 4FQHB 4P57B 5D1QC 1IC4L 4JZOA 4KKAC 5FOBA 2FO1A 2OL3H 3DVFA 3RGVC 3A67H 3MV8D 1JNNH 5FO7A 1C12B 2FJFA 3GSUA 3H8NA 4PIRF 3BRDA 1NGZB 4MX7B 4Q9QL 4IS6A 3PQYA 2D9QB 3I6LD 4JVWA 1FG2B 1ZV5A 4O02H 3MMEA 2P5WB 2QEJA 2Q6WA 1C5CH 5IIEB 2MKLC 3RWHB 5I1DA 3L5IA 2AJSH 2DDQH 5HHPB 2B39A 3SBWC 5IJVA 4PJDE 2AXJA 4OQTA 3VFNB 1JZ5A 4G8GA 4OZ4A 1N3NA 2OQJA 3VWKD 2EIZA 2LVEA 3WIIH 1R3JB 3QIWC 2MSPA 4NO0B 4RA3A 1YPZF 4LCWB 4WFGE 3OJDB 3V4VH 3VXUE 1AXSA 4V1DB 1IGJA 5EU5B 4KAQL 4QF1A 4R7NA 3VFSA 3Q48A 2F8VA 1ZLSH 1GZPB 3STZA 5D7JB 4Z7WB 1BFSA 2D7PA 2APWA 4L1DA 4L8SC 2D03L 1RZFL 4EDWL 4LSTH 4HIJA 4XVSL 3RIFF 4RAUA 4EI5B 3OAYK 5DVKA 3HPJB 3MX0A 1X6LA 2G60H 5B3JE 1MQKH 1IKNC 5GHWL 4Y16C 4YHIB 3GSWA 4LMQE 4K3DH 3BJLA 2FHBA 4WW1A 1XF5B 5GZND 1DQJA 4C54A 3QXUA 1ZHNB 43C9B 4DTGL 4L8BA 5KOVC 4ZXBA 1UVQB 5FYLL 4ODSL 3B9KC 3BEWB 3VRJB 3O3UN 1SY6A 4IOIA 3IFNH 3GIVB 2VLKE 4H20H 5T5FL 2FD6L 4JFDA 1QFWI 3BD5A 4I1NB 5A16A 3QIBD 3LKQB 3WIHA 1RVFH 1KJ3H 5GS2H 2NW2A 5DJZA 2VISB 4LPVA 5ECJE 3RY6C 3O2WH 3WMSA 1CFQB 4EOWH 2IBBA 4OKDA 4PRPA 4LF3A 3LKPB 1CBVL 4WWID 5EU6E 4Y4KD 3E8UH 2NNAA 4MQTB 1FZMA 3MRJA 3L5HA 2ZSWB 1KCRL 5F6IC 5F70A 3SKUD 4PGBB 5SWQA 2PW1A 4Z7QE 3F6LA 4O2FA 3AS1A 4M62L 1FV1B 3PP4L 4LK4A 1J8KA 3SQOH 4NWUH 4XP6H 4Q74A 3PQYE 2VSDA 3WBDA 3T09A 1JPTL 1AO7A 3P9LB 5F7FA 3BVNA 4HS6B 2PXYB 3H7BA 1I3RA 2VXQL 4NNXB 1VFMA 1CD1B 4FMKA 3QQ9D 4G8GE 3QG6A 4LFHD 2FB4H 3ZYJA 1E6JL 3DX6B 2A74B 3KPOB 5F7WC 1BBDL 4ZFOL 5BW7C 4U6YA 1WIPA 4J7RA 3F12B 3CFJA 5EU4B 3BD4A 5I16A 1UG9A 3D25A 4WI5A 4CU8A 4XNYH 3EJYD 3NCMA 5DJDA 1NCCL 1E28A 1FL3A 3O6FA 2R0ZH 1ZE3C 4W68A 4NJ9H 1SYSA 1OP9A 3QZWG 3I6GA 4U1MB 5EC2B 2XFXA 3CCHB 1U8OA 4PJ9D 4NWTH 5IBLC 5E2WL 2W59A 4DAGL 3C6SA 1X5AA 4WTWA 3IKCA 1DVFA 3UYPA 3VFGH 3U9UB 5GZOD 5K9OA 3INUL 1AR2A 2JB5L 1BD2A 1P7HL 3B9AA 3A6OA 3VXSA 5MENA 4HIHA 4LLQB 1F90L 4JFDE 4NFBA 1U6AH 4FZ8H 4JJ5B 5CJBA 1UCBH 4LVNB 4X6CB 1P53A 2WLYA 1CFNB 4XP9H 3ULVL 5CSBA 5AAMA 1CXEA 3QDJB 5TFSL 5JDJA 1HCVA 5F7DA 1BGXL 4PRPE 4S1QL 3MR9A 4G43B 2I60L 3QUMH 4BYHA 3BYTA 4QTHB 5J6GA 4LBEA 3GSRB 2GSGB 4L9LB 4NCC1 4P5MA 2ZPKL 3FO2B 5ID0A 5JXED 1U8LB 1RHHB 3R0MA 5DURB 4M1DH 5CSZB 4JQXA 2Y5TA 4HWEH 3SKJL 1BBJA 3QHFL 2EDDA 4Z5RA 4UOW1 3SO3B 1DZBA 2IG2H 4JHWL 4MCZB 3X13B 4PP2B 3KPSD 5ID1A 5HYSG 5DSCA 1K5NB 1KPUA 3BZ4B 2AQ1A 2YK1L 1MCQA 1NCDL 1AO7E 1EJOH 2B4CL 4YXLH 2W60B 3KJ6H 1ZANH 1FZKA 3FHQA 3TO4B 1R3IL 4U33A 3TT3H 3EIFA 4U1GC 1WZ1L 1J1XL 2Z31C 2OYPA 3BP6A 1O0VA 3ESVF 3VRIB 2IH1A 2CD0A 5TJWK 4M43H 2HJLB 3VGAB 3D9AH 3GMNA 3K81A 3W0WA 4RRPG 1Q9LA 1MWAL 1RZJH 2NW3B 2ZG2A 3FRPA 4PRBB 3CAFA 4NGHH 4LRIC 4YC2B 2KBGA 2CRZA 1X5GA 4PGDB 4ZPTA 1LNUB 3O2VL 3DVGB 1OAYL 2D2OA 3S88H 4F7TB 5JORB 2P24A 2DQFA 2FIRT 1Q94B 1RPQA 3MRCA 3WUZA 4E0RB 1T21A 1N8ZA 2FHCA 3NACH 4HJ0C 4FQXD 2J12B 4MVBC 1T04A 4M9OA 3MO1B 5C6WH 3NN8A 3EYUL 4HH9A 2PTTA 3EDKA 4LDEB 1A6AA 2F5BH 4X80H 1BD2E 2EH8H 4OZGB 1P7KB 5MENE 3VXSE 5F9AC 2GY7B 3RPIA 1E4XI 3FB8A 3FCTB 4AT6A 5JXAL 3HKFA 3X3GH 2IBZY 2QSTA 1MCEA 5IOPB 2O5YH 4TVPL 4GS7C 3BO8A 4K7PL 3ZTJG 5JO5A 4KQ4L 2FDBP 4KTDL 3SDXA 4HS8L 2X9YA 1A0QH 4HEME 1U91A 4OM1L 4ZO6A 4L9DA 2DLFL 2Q8BH 4ZYKA 3MRDB 4PRDA 4KDWA 3BZFB 3QFJD 1FNLA 2OM5A 1DBAL 3FL7A 3PHOA 2BRRL 4ZSOA 4ELMB 3UX9B 3OJMB 1A3QA 1A7RL 1MHEB 4RMWA 1NDMA 4I3SL 2Q3AA 4R3SA 2IAMC 5DJCA 5MI0B 1WBYB 5DVMA 1J1OL 2XXMB 3T4YA 4HKJB 4BQBA 5HYIA 3V6OA 3F58H 1C7TA 3R1GL 4LEOB 4WGVB 4HUUA 1JN6B 4JZJA 2ZCLL 4Y4HB 5IMKB 1FFNB 1BAFH 4TRPL 2OLDA 4HLZH 1MPAL 1QLEH 3OGCB 4OLYL 4PP1D 3GMMB 4U1KA 4HK3N 2P8LA 4F3FA 1OPGH 4YR6A 3L3JB 1ZVSA 3S4SB 3W0WE 1HSBB 3T65A 3U46B 3WLWC 4ZUTA 3WUWB 1MJ8L 2VC2L 3L6FA 4WI9A 1FORH 5JW4M 3OKKB 3DETC 5H2BB 1A6VL 3ARUA 4KGJA 2D0HA 1DBJL 4EDXA 3SE3A 2HLFD 3QUKA 5J1TC 1H5BC 2F58L 4URTB 3U1SL 2Z35B 1EPFA 4A6YA 1XEDA 1I1AB 3SGJA 4FQJH 3ZDYE 1MJ7L 2CIIA 2D31B 3W9EB 1XIWC 4HUWA 3FHAA 5AUMA 4PJHA 5CIPH 1E27B 2B1HH 3WS3B 3QWOB 3RAJL 4GXUN 5F7MC 4I5BB 1UCTA 4M1GL 5GRJL 1YNKL 1KCSL 1U93A 3GDBA 4QT5B 2BNRA 5L7XH 5ACZA 3HC0A 4PRID 4A2MA 3T77B 1ED3A 4ZD3H 2YRLA 3RWCA 5TDNA 4U6VL 1GGYA 2UWEF 4BK5A 1QFOA 4MQ7B 5E9DD 3T4AA 5FYLE 2HKHL 1CFTA 1OAXH 3UTPE 2UZIH 3VFTB 4OZIF 4OCYL 3G6JB 5E0QA 2FX7H 3DVNA 4UZGA 4JFQB 1ORQA 1VENA 3SDXE 5ANMA 1HI6B 4XWOC 5E24E 4WV1A 4LKCA 3UTQA 4LHUD 4LDLB 4MQSB 2VYRE 5C8JB 4ZSOE 2FJHB 3CLFH 4OM0L 4EBQH 3TV3H 1NEZA 3V52H 3V6BR 3OAUL 4H26B 4G6FB 4TUJA 4EN3D 1QR1B 3DUUA 2BXYA 1MRCH 4JO1L 5BV7L 5IJKC 3V6OE 5GSVB 2AEIT 4P4KB 2BFVL 3KWWB 4Z0BH 3OB0K 1KTLA 4XRCB 4PRAB 1O7SA 1NJ9B 4FXLA 2EDHA 4LCUB 3S98A 1TENA 2ARJB 4X98A 2H6PB 4OB5H 5KSBA 4HDIB 3GNML 4V2CB 5IFHH 4X6EB 1YQVL 4X7SH 5DS8A 5FGRA 2V2XB 3CC5A 1WWBX 3TYFB 1FIGH 3S5LG 5D96C 3V0VB 3QIUD 1XGPB 3KPLA 4MXQD 1ERNA 3A0OA 1QSEA 1J12A 3WJJC 1K4CB 4JN1H 1AQKL 4MA8H 5ACLA 5K9KA 1QNZL 3W81A 2CJUH 3MRQB 1KIRA 5EIIA 4N0YL 1M05A 3HFML 4F58L 3SCMD 4LRNL 1R3HB 3TYGL 5FUCC 3E3QE 1QOKA 5BQ7B 3NH7L 4O2EB 5C0RL 3BH8B 1BX2B 1PSKH 2NY0D 5GPRA 4S2SB 3HE7B 5IFAH 3CFKB 3QFDA 3MV7B 4PJHE 3DRTA 3ZKNC 4HWZB 4QCIB 4JRXA 1GOHA 3SY0A 4XCEB 1S7SB 1HHIA 2BNRE 3MYJB 4PJGA 2GW5A 3LKSA 1RUKH 4QTIL 1A6TB 1INEL 5D72L 4AEHL 5DRWB 4XHJC 3MJ9A 2KQMA 4D0BB 2CO6B 3UC0L 1MHCA 1A6UL 3MRRB 4TSBL 1N6QL 1HOCB 1FAKT 2IQ9H 2HVJB 1P5UA 4ENEC 4OAWB 5ANME 4K3JL 1BFVL 4XC3L 4ZO7A 4BQCA 2W0FB 4FFVD 4K3EL 5DUPH 5CEZE 1LK2A 3NMEA 4Y1AD 3IDJA 2OTPA 4X6FA 2CK0H 3LMJH 3C9NB 2Q8AL 4KUCD 4PJIF 2SEBB 3BW9A 4GFTB 2IPUK 4P48A 3DGGB 1MAJA 4LLUA 4YGVA 4UV4L 4NP4H 3CMGA 4W6YB 4BZ1L 5E2VL 1HKFA 1YY9C 2FBJH 1U8IB 5FF6B 1QO3A 4IDJL 4U0QB 1GAFL 5FO9B 4R9HA 3ULSA 2Z93A 1NMBL 1OSPL 2X4TB 4UOW0 3ZDZE 4PB9L 3AXLB 5IFJA 3F5WB 5KSBE 2ZUQB 5E6ID 5HD8C 2EE9A 4WUKL 5ITBH 5I1KL 1ZMYA 4QRSB 4NT6B 4Q6YA 4WTZA 1S9VA 4HK0B 5D1XB 2VKXA 4Y19B 3R8BB 3I50L 3O9WC 3WFCH 1LO4H 4ZFGH 3SGJC 4N90D 4NYLA 1QSEE 1YY8A 1QEWA 4MA1B 4N1EA 3SDCA 4BSVB 2EXYC 4HMEA 4H5SB 3RI5F 1WF5A 1ZTXL 1SQ2N 1MRDH 3KYKL 1SEBB 1D5IH 1ES0B 4AH2A 1CR9H 4L3CB 2NXYD 3HG1B 4KXZH 5FA4B 3HCVB 2X4UA 4FQQB 3CIQA 3PJSB 4F15B 2O5ZL 4IMKA 1OT2A 5K9JH 2IGFL 2ZG3A 3SDAA 3GMRA 1N5AA 4KROD 4P5TB 4CVUA 4HLJA 2AK4D 4O00A 3BGMB 2MTPA 4G5ZL 4PLJD 5ELIA 1GJIA 1U8PB 1IL1B 2FEEI 4JRXE 4PLKC 2JB6B 4GXVH 5DD3H 4P0DA 1XCTB 1SBBA 3ULVC 3RDTD 4PJGE 4DOHE 5J57B 2NY1D 4G6ML 4FN0A 3CX5J 2HVKB 3QEHA 4XCFH 1YEJH 4TNVF 4POUB 2OJEA 2R0KH 5LGHL 3BJ91 4U1SA 4LMQI 4XBEH 4ZDHB 5C0DA 3RFZC 4ALAH 1JI1A 4XX1G 1JHLH 5DLMH 2AXHA 5BJTB 5JPNA 5IW1B 4N0CD 3S97C 4PV8A 5HGHB 2P44B 4PR5B 1OCWL 4LHJB 1N7MH 4YHZH 3DI2B 2B4CC 4RGND 4G9DA 4N8CL 1BOGB 1XR9A 2QBWA 4YGAB 1DUYA 2FJGB 1ZWIA 5H8DA 5H94A 5JNYA 2P8MB 5F1NB 4X5XB 3MUY1 4GBXA 3QO1A 3C5ZD 4OKVA 2H3NA 2YHGA 3FFCB 5JW4N 4XPGH 1YEFL 4CW1B 1F02I 1U8MA 4WU7A 3J7HA 2YPKA 4WI2A 1T3FB 5KVDL 4BFGA 4TYUA 1U2CA 2OZ4A 5JDSA 4P9ML 2XWJA 2P8PB 3ZKSD 4U7MA 4WHYG 5A3IC 4NDMA 2OP4H 4NQVA 5BOPA 1LP9F 5HI5D 1HKLH 2XPGA 3GMLA 4ZS6C 1MI5A 1NFDB 2P7TB 2ZUYA 4HIIB 4KJWD 5E1HB 3O6KL 1XF2A 4KTEL 3MLVL 3EJZC 4KI1A 5E8NA 3QEGL 3VD7A 2GTZA 3HNTH 1I3GH 1HIML 5EZJB 3UTZB 1P84K 4K55A 1T66C 4HHAB 3V5HA 3QI9B 2Q7YB 1Q9KB 3MV8A 2OL3L 4MD0B 4FG6D 2GITB 4D8PB 3ZL4H 4WDIB 1R5VB 3FTGB 2QKIB 5EUOA 5TGBB 3JXAA 1MOEA 1KBGL 2ZUVA 3RWJA 2P5WD 5I19H 5JOPD 4R8WH 4PJBB 1IAIL 3KXFB 2O93L 1MFEH 4KGLA 5FGCB 3CZFA 4FS0A 3DX9B 4TSAL 3UJJH 5AD0B 1L9NA 2DDQL 5T3ZD 5B38B 1UXSB 4MD4A 3SEPA 5JZ7D 3LRSB 4NO0D 4OSUH 4LCWD 2HT4C 4Z7NE 5IBUB 4V1DD 3O6LH 4W70A 1G7QB 3HZVA 2VN7A 1DLHB 5KBNC 5CWSB 1T0MB 5DYOA 3GK8H 2PTUA 1V8HA 3RTQB 1I9RH 2WWKO 4EI5D 5I17B 3IVKA 4AJ0A 1IT9H 2Q86A 2HTLD 4OLVH 2Y6SD 4YBQC 3J8F7 5FKPB 1N5YH 2H2SC 4X5WA 1HHGA 3LQZB 3UBXI 4Y5XB 5T33L 2ZUWA 1KEMH 1JPFA 4LCCC 2J6EL 1KJ2B 5J8OA 4KVNH 5E94A 4O51A 2CGRH 1YJDL 5C6PB 4NC2B 4W6XB 3L3OB 5B39B 1D6VH 1MH5B 3O3DB 5D6CA 4KDTA 1BOYA 5DK2B 3AM8A 2M26A 3L9RB 4U1HA 4HPOL 2F53B 2VLMD 2HFTA 3L3DA 4LQFH 2X2YA 3WN5A 4PTTB 3HS0B 2GK2A 1DEEA 1J0KA 2FZ3A 1H15A 2YD8A 1KTRL 1ZOXA 1FFOA 6CGTA 1JPGB 4Y8DC 3CUPA 4D9RE 5CD3A 2R0LL 3RVVC 5HHVL 3MBEA 5HHOB 1MI5E 4RQQA 1VGKB 3ARFB 4GRMB 2ZG1A 1ZT1B 3RX8A 2XXCB 3ZE1E 3E8UL 1DDHA 2ZOKA 3RWEB 4R97B 4JZNB 4LPTA 1A7OH 1I4FB 2H32H 4JPWH 3TWCH 1PKOA 7CGTA 3MV8E 1JGUH 2HJKB 3ISWA 1T2XA 1EEUA 5EUOE 1NGWA 4LARL 4XZUA 3TT1L 2J7LA 4LSQH 2PO6B 5DI8B 1TTGA 2DI8A 4NWUL 3MODH 4Q9CA 2PXYD 2RR3A 1SVCP 1PKQB 2Y06L 4NNYA 1DN0B 1IAOB 1BVZA 1FZOB 1SM3L 5HGAA 5FA3A 5I8EA 3NTCL 1VKXB 4AENA 4PBWD 5EWIH 1CXLA 2IPKA 2X70B 4X0KB 4Z0XB 2OTWA 2D3VA 4MB5A 4ETQA 4P3DB 5L2JB 1AR1C 5IESH 4PBVC 4EUPG 3JV6B 3QQ3B 2YUVA 3RU8H 5DA4A 3T0EB 4UUJB 1G7MA 5INCB 2Y07H 1NGQL 4ODVH 3RHWK 4AM0B 1F3DH 3IU4L 2HG5A 3QQ4B 5K93A 1Q1JL 1P5VA 4XNYL 4X9FA 3EZ8A 3FRUB 4NCDA 2OMBA 5BV7C 4UOJA 3OHXB 1A7QL 3D3VB 4O58L 3QHZH 1RK0A 5EU3A 2EDJA 1T4KA 4F9LA 3BEVA 4K94H 2V17H 3MFGB 2BY0A 2YUWA 1MJJA 3BI9X 3SE9H 1NSNH 5HJ3B 2VO5A 4Z7VA 2XACC 1OGAA 3CLEH 1L0YA 4X99A 4WI8A 3SGDI 1MEXH 3MNVB 3NZHL 4RFNC 1W72L 6FABL 4GKNB 1JHTB 5E8PB 4WTXA 3QDJD 5IV2B 4K2UL 3BAEH 3MBXH 4J23A 3MUGA 1T1WA 4JKLA 4YQXH 3TH3T 1OTUC 4U2YA 5IK3A 1J11A 1EHAA 4U1LA 1MCDA 3P0VH 5DURD 3K1DA 2AJUH 1UACL 1MNUL 3TVMB 1IFHH 4YDVB 5SV4A 5FDWA 5IB4A 5J9PB 3IDMB 3HRZA 4UIKL 4OFKA 2ERJB 4XCCL 3DNKA 4G6AD 2BSSB 2XQYG 5I66A 1YMHB 2XTJE 3FN3A 4B50A 4HEPG 4H8WL 5JPMA 3EYVA 4NM8H 1PFCA 4UILH 3WS6A 4OZFG 3OZ9H 2FWOA 3C5SA 2BC4A 3TO4D 3ZTNH 2ATKB 2OL3A 3IDGA 2AV1A 3VG9C 1ZANL 3HLAB 3SPVA 2PYEA 4F33B 2ATPB 3N1GC 2NY6B 3V4PH 5EZLB 2HA1A 3T2QA 3EYFA 2APVA 1YNTA 3AAZB 1GC1L 2APBA 4KUCF 3MNWA 1C5DB 4XB8A 3LEVL 2WBJC 4M03A 4GLRI 1D5MA 4M43L 4JDTL 2DWEB 3C08H 3HI1B 5ESQA 3ROLA 3NFPA 1RZJL 1NBYB 3HR5A 4KDTC 3AM8C 4HF5H 4LLWB 4X7TB 2GJZA 4NGHL 4OZHF 2BVQB 3GJFB 4LIQH 4LSSL 1BPVA 4ZAKB 2L4OA 2MQCA 4XH2B 1YECL 2G75A 3RX5A 3VDCA 1EBPA 3OKMB 4FXKA 1NKRA 1K2DB 1Z6JT 1GIGH 3O3BB 4PRHA 2GFBA 3T08A 1CICC 1AH1A 5I9QC 1YN7B 3BPCA 4OLXH 5I8CB 4Z76B 4X9IA 9CGTA 2MCG1 1N0XL 4DVBA 3EYOB 4Z7VE 3ZE0F 5C0JB 2X4SA 1OGAE 1JGVH 5LWYH 5JW4Q 2XRAH 1UKSA 2XI9A 5IEKA 1U8NB 1C08A 4JEGB 3EOAB 5C6TL 3SGEH 1I9IL 1Y18B 3DI3B 1I3UA 3RL1B 2YMXH 4BK4A 3TFKD 2NY5L 1TIUA 2W9LA 4JO4L 1SEQH 5DZOA 3VD3A 4AY0A 3GUTA 1A4JA 4TVSa 4PUBH 1W0YT 4ZPVB 3WFBH 1T22A 2O5YL 4QY8B 3WE6B 3EFFA 1HEZB 5D7LB 3FN0L 1OF2A 2KUTA 4M7KH 2KQNA 2BVUA 4GRWB 1A0QL 4L29A 1RI8A 4H25B 2F8OA 2A73B 5J11B 5GGSA 3EDDA 5H35A 2HH0L 5C0AA 2G5BB 2DQDH 4TSCH 4EIZC 1MQ8A 2LFGA 5LCVH 1JWSB 1KTDA 3L7EA 4J1UB 1JHKL 4Y4HD 5IMMA 2CDEA 1WBXB 3GHEH 1A7PH 5LXGH 4OIAA 5CBAB 4Z95H 2Y7QA 1KLUB 3MROB 1JPSH 4KK8D 1ND0B 3VXOA 3DHMA 2PYEE 3GIZH 4DFIA 4F57H 5IB1B 1QLRA 2EIBA 1ROWA 1QLEL 2QSVA 4P2YA 5T1KB 3PNWA 1YUHA 1P9MA 4F9LC 1DLFL 1JWMA 4YAQB 2WP3O 4WI6A 4ODXA 4YHLH 5K59E 3G6DL 3DARA 5FCUH 3FO0H 1OD7A 1FBIL 3ORJA 2R8SL 2WWMC 2BY2A 3VI4F 3UJTL 5DZNA 1FORL 2JCCF 4WI7A 2E6PA 5HI4D 5LGJB 5EO1B 1MAKA 5C09B 3TBVB 4N0UB 1FPTH 3BKCH 4PRHE 1W8OA 1QBBA 2OTUB 3P73A 2BRQA 2X1XR 3VH8G 2GJ6B 4ONOA 4EXKA 3UXFA 1A64A 2F54A 1MCPH 3STLA 5KN5A 1M7IA 3FB6A 4ZQKA 5HI3C 4Z8FH 1R3KB 2W65B 5D5MA 1WAAF 5EFIB 5DRZA 4JCLA 3V8CA 4Y16B 4ZD3L 3O3AB 4P46C 3RVUD 4IDLA 4LPWA 4NUGH 3LIZH 2AABL 5DMKA 2DLHA 4DCQB 3VFPA 1EH9A 1DBBL 3HC4H 2FX7L 1S8DA 5IKCA 5CINH 5HHQA 2E27H 3VFWB 2VXSH 4ZTPL 3U83A 2HRPL 3QCUH 1QR4A 1VFAB 2VKWA 2DQHL 4WWKA 1L7IL 4G6FD 5C0AE 3KPQB 4KI5C 3P4LA 32C2B 4XNQA 3TV3L 3QUMA 4KK6D 3HMWL 1XH3B 1IAMA 2G2RA 3OKYA 5HPMB 5CJQH 1DJSA 4WEBL 1MRCL 4H1LB 2Z8VC 3B9VA 4NZDA 1AGCA 1HXMB 2HFGL 3EYSH 4HUVA 1Z5LB 1Q9OA 3ETBF 3EOTL 5I8KL 3WLBB 4KH2A 2MJWA 1QBML 3WHXB 5EA0L 4F8QA 4AG4L 2BCKB 3FQRA 5KVGH 3RUGA 4OLWH 1IGMH 3NFSH 4HJGA 3MZTA 4KJQC 5IFHL 1BJ1H 4Y5VC 5D7KD 4FP8L 4JQIL 5IVXA 3MACH 2D7QA 5IHLB 3GRWH 3VXUB 1VA9A 1BHGA 4P4RB 3G08A 5C0BA 4ZOCA 2JJVA 4YXKL 4JGUA 1LQSR 1XGTA 3GI9H 4JN1L 1FVEB 3OWEA 3IYLW 1MFCH 4XI5C 2AGJL 5DMGC 4JFHD 1MY5A 4H0GA 5ALBH 3HE7D 3U0TB 2JJUA 4HMCA 1YJDC 4M93C 4MNGA 4MWFB 4PB0H 3MV7D 5C0NC 4J3OC 3MOBH 4L5FL 5IQ7H 5J3HC 1OSZA 2N4IA 2CLVB 2F54E 1J10A 4ZS7L 4FXGB 3B2VH 4XC1L 3O3EA 5D5ME 2FRGP 3U7YH 1CLOH 4NN7B 4XWGL 5DEGA 1RUKL 4JAMA 4YFDB 4N8VA 5E00A 3IJSB 3PIQB 5D93C 2DM4A 2P5EA 1KV3A 1FVDA 1AGDA 1JMXA 3H9HA 3ILQC 5DR5H 4PY7A 5EU6B 2YPVL 5E99L 3I85A 3QNYA 2YWYA 3DSFL 4JZOB 1PVHA 3S9DB 4NHUB 3VE0A 1UQSA 3BT2H 1X9QA 4BKLB 3QAZC 3SKOA 5FO7B 2FJFB 1KPRA 3FQXB 2VTFA 4DWHA 1NEUA 1QZ1A 1UH3A 4IS6B 3PQYB 2FBJL 3MMEB 2Q6WB 3GJEA 3HZMA 3NCYS 5TF1L 3MLTA 5I1DB 4N5ED 5DEFA 2VITB 3I6KB 5IJVB 2IMNA 1IQWL 1INDL 3RUGE 4G8GB 5D1XD 1NDGA 1N3NB 1CFBA 2OQJB 1VEOA 2EIZB 4Y19D 3S96A 4Q97A 5ITBL 3LB6C 5C07A 2AAVA 5IVXE 4XTRC 5IW6A 3QPQD 3K7UA 4P9HH 1AXSB 3PDGA 1IGJB 5C0BE 1WQVT 4QF1B 1OTSD 3VFSB 1T20A 1EO5A 1H3XA 1GPOH 4PJXA 4CL7A 5IWLA 2NY4B 1WZMA 4MLSA 3STZB 3DBXA 3VH8A 3HG1D 4CU6A 3UYRL 4HIJB 1MRDL 3HC3H 4RAUB 3T0VA 3H9SA 2R4RL 4U1GB 3TNNA 4FQ2H 4C56A 1OY3B 2Z31B 5GJTH 3GSWB 4MNGE 1ZAGA 4WW1B 3MLZH 1DQJB 4MAUL 4X6CF 1NL0H 1EMTL 3OAYH 4L8BB 1E4XH 1ZXQA 2VDMH 4WIQA 3RNKA 3PL6A 1KNOA 5EO9A 5C0IA 5FGBA 4UBDD 5DD3L 2F19L 1YEDA 3TA3A 4JFDB 3UBXB 3GB7B 5A16B 2CQVA 1CZ8H 5I76A 4WWKC 5INDA 2NW2B 4OCSH 5DJZB 4HH8A 4Y4FC 1LK3L 1HH9B 1C8PA 5CIPA 5I30L 2XNAB 3MJ8A 2X6MA 4PRPB 1EJ6A 2P5EE 4LF3B 5I18H 4DUXA 2Q7NA 3QUYC 3OTTA 2HWZH 4OF7A 1FZMB 3MRJB 4XBEL 3L95B 4QEGA 2KKQA 4FFYL 3N1FC 1FP5A 5SWQB 1MFAH 2Z92A 5DLML 4O2FB 4H8WC 5I1GL 1H8SA 5ISZA 4C83A 1WT5C 1HWHB 3IGAA 1YPZA 3GO1L 1HZHH 1MIML 1NMAL 1AO7B 2NXZD 5CD5C 4OF0A 3FFCD 4N5UA 3BVNB 1OAKH 3X14A 2MPAH 5K33A 1I3RB 5ICZA 4EVNA 4G9FA 1P6AB 3S37L 4Z77A 2BVTA 3QG6B 1PG7X 5GS0L 2R1XA 1GC1C 2VLRD 1RJCA 4HKXA 2IAMB 5EIQA 5C07E 4MNHA 4U6YB 1GOGA 3MCLL 3P4MB 4P99A 4MHHG 4R0LA 3CFJB 4PJXE 1TZGH 2OR7A 4MS8C 5I16B 3D25B 4GRLC 4DKEL 4P57A 1RUMH 5DJDB 1E28B 3O6FB 5C86A 1KLGA 4HC1H 3QI9D 3H9SE 1SYSB 4OCNC 3ALPA 4PGCA 1DQMH 4XNMB 4G7VH 4C56E 3I6GB 2XFXB 3SDDC 1U8OB 1PW3A 2NZ9C 2WANA 3C6SB 1FG2A 4FHBD 2NMSA 3IKCB 1DVFB 3KXFD 5ADPH 2X1WL 5IIEA 1A6ZB 5K9OB 3RWHA 5HHPA 4WRLA 5MENB 3VXSB 2VDKH 4HIHB 4LLVA 2NY5C 4NNPH 4MQXC 1A1NA 5LGKA 2A6KA 3TP4A 5CKGA 1NBZA 2Y1VA 3DRQB 5JMRA 4DN4H 4YDIL 4OLUL 4XPBL 1UM5H 4OSUL 1SJVA 5EU5A 5F7DB 5IMLA 1CD9B 3MR9B 3OKEA 1GZPA 2GTWA 5D7JA 3RTQD 4LBEB 5T3XH 4P5MB 5ID0B 1Q72H 3W82A 1CGSL 1NBQA 1I8LC 3CU7A 4F8TA 2E7CA 3T3ME 2Y5TB 3O0RL 1BBJB 3TIEA 5I1CL 1I9RL 4S10A 4Z5RB 4PD4K 4YHIA 1YYLL 1FSKC 1R5WA 1KCVL 1IARB 5ISZE 1ZSDA 4N68A 3QRGH 2DQUL 4AQ1B 4HJJH 5DSCB 4KK5D 1YPZE 2OJZL 3ZYZA 4M8QA 2VOTA 2FCBA 3VRJA 3RZCC 1G1CA 4KVNL 1T6WA 2WUCH 3GIVA 2F53D 4OGAD 1FZKB 3W5MA 1JL8A 1PG7W 5TE6L 4G9FE 3U0WH 3ARWA 1X5KA 4X5LA 1T83A 2R56H 2BSED 4CAGA 5CZKA 3BP6B 3TM6A 2IH1B 5JR1L 4GG6A 5HHOD 2Z8RA 3ARFD 3GMNB 1ZEAH 5DFWH 5TE4L 1Q9LB 4OGXL 1F2QA 4PV9B 1PQZB 2XA8L 2CKBL 4GMTH 5FGBC 4ZPTB 3MLUH 1RMFH 3GHBL 4L3EA 1PGRB 4WCYL 2X05A 2P24B 2MOVA 5ADOH 1WITA 2DQFB 4MJ2A 4L4TD 3MRCB 4OV5A 2UY7A 4UB0H 1T21B 1N8ZB 3DLQR 2V5SA 1T04B 2PO6D 1AGBA 2I24N 4X7EC 3NN8B 3RWFA 3FZUC 3UTSB 3CMOL 2HMIC 3P4OA 4HH9B 4J3TA 4JLRA 1IGCH 4HS6A 1D9KA 1BJ1J 1AIFA 1ZKAA 1NFIA 5H37H 1AGEA 1FHGA 3DROB 4M6AA 3QEUA 3RPIB 4AT6B 2VDOH 4PJFF 4DEPC 5I75B 2A74A 3KPOA 5EWIL 1DBKH 2E9BA 4RDQF 2A77H 4I3RL 3S7GA 4BSJA 3WNMA 3T0ED 2EZ0C 3BO8B 3AREA 3ZYIA 1UB6A 5JO5B 1L4IA 4K7PY 4U4BA 1CE1H 2WUBL 3FO1A 3SDXB 2WBKA 1U91B 5HGGS 4PJEF 1EGJH 3NIFE 3N9GH 4UV7H 3BP5A 1J05A 5DF0A 4MA7L 2JELL 5CJOH 3MOAL 4PRDB 4HZAA 1NCAH 1ORSB 1MF2L 3PHOB 4ZSOB 4X4ZA 3D3VD 3HNVL 3H3KA 3HI6L 1NDMB 4EJ1C 2HT2D 5JMOC 5DJCB 5FM5M 1WLHA 1XGQA 3QEQA 5F1OB 5E8EA 3T4YB 4R0LC 3QHTC 4HUUB 1YA5A 4K94L 2V17L 1H3PL 2ZP0T 4MYWB 5F89A 1NSNL 3IFOA 3IF1A 1IM9A 3GMQA 3PP3K 5CBEA 2AS5M 2D7OA 4PJCF 3QDJA 4U1KB 1JE6A 2P8LB 1N4XL 4KMTL 4P2OC 4F3FB 4ZNCD 5KSAA 4GG6E 4NQSA 1NMCC 2VZOA 1QHOA 1WFOA 1AY1H 5TF0A 1ZVSB 4DGIH 3G04A 4HXBH 3S34H 4FTVA 4QLRA 4KTYA 3MRNA 2WWKT 5FYJH 1KYOJ 3TVMD 3T65B 2AVGA 4H1LH 4O9HL 2P48B 4ZUTB 5I1IH 1IRAY 1NBVH 3L6FB 4IMLA 1GGTA 1LO3L 1SJEA 4OCXL 3T3PF 4L3EE 2AJUL 3VDAA 1UKQA 4XP4L 1IFHL 5E6ZA 4EDXB 4JB9H 3QUKB 4MCZA 3R8QA 4BJLA 3O9WB 3VW3H 3RGHA 2N7AA 4NPYA 2CIIB 1JYXA 4R4ND 4HUWB 1D5BA 3UDWA 2W60A 1IAII 5TQ0L 1XCQA 3LS5L 4PJHB 3P9MB 3MV11 5ILTH 1NQBA 2NY6D 1U93B 3JV5A 2C4FU 2OR9H 2BNRB 1A9BA 3OPZH 5ACZB 3HC0B 1ED3B 1J8HA 3RWCB 5TDNB 5E8DH 1HDMA 4MDJA 3T4AB 2LU4A 4ONGH 1CFTB 3QH3A 1P4BL 3L5XL 5I71C 3V7AE 2NY3B 2OS7A 3QXWA 3DVNB 3WNKA 1ORQB 1NCBH 5ANMB 1K4DB 1XF4A 4WV1B 3MRGA 1YEIH 4LKCB 3O45A 1S9WA 3IS0X 1LNUA 4CVXA 1CI5A 3EGSA 1J18A 4ZAKD 1QYGL 4XP1L 5JORA 1F11A 2E6JA 1UH2A 3WJLA 3IDYB 1JF6A 4K23L 3LEYL 3JBG7 1VGEH 2V7NA 4JQVC 1NEZB 5CEYA 3QEQE 4TUJB 3NPSC 5KJRH 4YLQT 5T3XD 3DUUB 1QVOA 1NC4A 1DFBH 4I18A 2VXTL 1P7KA 1WIOA 1KTLB 4OLXL 4TTGA 3BOVA 1J0YA 2R4SH 2GCYA 3FCTA 2CPCA 5CLTA 1P4LB 3VCLA 4X98B 1JWUA 1AJ7H 5KSBB 3MNZA 1PX4A 1VERA 2AQ2A 3C8HA 3RVTC 5D1ZA 3OB0H 4S11A 4AL8H 3T1WA 2VDNH 2ZCHL 1IE5A 5GSRA 3QDJE 3BKML 3CC5B 4OGYH 3BP4A 3ARVA 4QYOA 1TVHA 1A6WH 2VLJB 4FFZH 2FH8A 4S1DC 4BH8A 2XWTA 5C0GA 5D7LD 1F4YH 2CO7B 2FX9L 2W9DH 3KPLB 4PUBL 4FTVE 1QSEB 1H8OA 4GJTB 1D9KC 3KVQA 4XBPA 5K9KB 3RZWA 1X5YA 5BMFL 3RHWF 5F7NC 4ELMA 1KIRB 2ILLA 5EIIB 1M05B 2UZYB 4LPCA 1ZHLB 3WEXA 2W38A 4FQIL 4OTXL 2EC9U 3CVHH 1MWAB 2VUYA 1E4JA 2ZOLB 1FN4B 3AREC 4TSCL 3DYMA 3QFDB 4NZTH 5LCVL 4JRXB 2HRLA 1KN4L 3ROOB 1QPXA 4M7LH 3SY0B 4AEIL 4DK3A 1HHIB 4F7CA 5LXGL 4XPTH 1B4RA 2H32A 1RAMA 2QQLH 4PJGB 4DOHB 4IRJA 5L9DH 3LKSB 1J8HE 3SE4A 1YMMA 1LEIB 3GIZL 4OUOA 5FECA 4F57L 4HBCL 1J1PL 1TDQA 2VABB 4YWGL 2P42B 1MHCB 4NKQB 4QRTA 5ETUB 1H3VA 2DKMA 3U46A 4KJPC 1LK2B 5CS7A 4DQOH 1I75A 2LQRA 1HQ4A 1SBSH 3OKKA 5ALCL 1RJLB 4X6DA 3IDJB 2VQUA 4X6FB 1X6NA 2V5MA 4YUEH 2HLAA 3H9YA 3BSZH 5FCUL 3FO0L 3BW9B 5C09D 5IUSA 4LLUB 4YGVB 5EOTA 1CS6A 1I1AA 3RKDC 2GJ6D 1GCFA 2ICWJ 2B2XH 4TQEL 4EEEA 1KIQA 1VFBA 3LZFL 1FGVH 4O4YL 3BKCL 1E27A 3B5GA 4UT7H 3WS3A 4WENB 3V8OA 4I0KA 1A02N 4ESKA 3ULSB 5HHMB 2Z93B 5ITFA 5GS0C 4TTDC 5EORH 5IFJB 3MLSL 4NQUA 1NFDF 1WCQA 4OLZH 4Y16D 3RVXC 1MLBA 3S36X 1AD0A 3IFLL 3CFCL 4Y2DA 1S9VB 3VXMD 1MLCB 5IQ9A 4LCCB 4JFQA 5KW9H 3FQWB 2A6JA 1V7ML 4NYLB 3LH2H 1YY8B 3UDWC 1QEWB 1C5BH 3SDCB 5F7EH 4HULB 3KHOA 1Q0XH 1CGUA 5CINL 4ELME 2E27L 4AH2B 1X5HA 4PJBF 1KJVA 2FJHA 2V2WA 2D7TH 1F3JA 1SMOA 1YC7A 3KGRA 5E2TH 2R2HB 3BZDA 3VWJA 2RIKA 2DJ4A 1A47A 1GHFL 3GMRB 3SDAB 1N5AB 4CADA 1A1MA 3C2AH 4MB4A 4P4KA 3LD8B 4XRCA 5EG6C 1U58A 4YBLC 1T0PB 1KB5H 1OTTC 3KPPB 3SE8L 4V2BA 5SX4H 4KU1A 1YYMH 1LDPH 1YMME 4PJIA 4LCIL 2DM3A 2V2XA 3LN5A 1NC2A 3QEHB 4P23D 3SKMB 4WFGD 1U3HA 3VXUD 1G9ML 1KXQE 3GBML 2X4QB 1G9EA 1KEGH 3F65A 1EAPA 5GS3A 3MACL 1LE9A 4U1SB 4F37K 3WXWH 5C0DB 2AW2A 4X6DE 3SGKA 2A0LD 2RCSH 2AJVH 4WEUD 4XCNA 5GRUH 3VFRB 1GVIA 5IF0A 5D1ZC 3MLXL 4XVJH 2ZKHH 4PV8B 2B5IC 3F7YA 2LE9A 5F3BA 1EUUA 1SJXA 4G9DB 3KLHC 2IFGA 5BO1L 4YDLC 1XR9B 1DUYB 5F9JA 1HE7A 4OD3L 4QCIA 4RFOH 2DI9A 3SGDH 5H94B 2H8PA 5JNYB 1KN2H 2EIEA 2WINA 1CFVH 2A1WL 1S7SA 1VESA 2VLKD 4GBXB 3MYJA 3KLDA 4OKVB 2H3NB 2YR3A 1B88A 4DGYL 3ZDXF 2NY7L 2WM0A 1U8MB 1EIBA 3QNZA 5IBLD 2YPKB 25C8H 4XXCC 4U2ZA 4NZUL 4RNRA 1AP2A 4PJ7F 4APQD 5JDSB 2ZCKH 4IHOB 2XWJB 4KV5F 4XMPH 1RUAL 1K9TA 4NDMB 1EO8H 3BHBB 3DURB 4NQVB 2PKDA 2W0FA 4XMLH 5EU6D 2Z4QA 2ZUXA 2XPGB 3GMLB 2DL2A 1MI5B 1CD8A 4N9GA 3QPXL 1WC7B 1IC4H 5D2LF 1XF2B 2EH7H 5E8NB 5FK9A 5GRZA 2GTZB 3WV0A 2YRPA 2XN9A 1RK1A 1DL7L 1CGYA 1NGYA 2YA2A 1W0VA 4IRJC 3DIFA 3D5OF 2E7LA 3NIDE 4LLAA 2W0LA 4Q9QH 3HHRB 5FHAL 2BX5A 3TH4T 3PQYD 5EUOB 3RWJB 5JUEL 5MP6H 1T5WB 2ADJB 1QFWM 1KXTB 1B2WL 2V7HA 4FABL 3VWKC 1F58L 4J12A 3M17A 4G8GD 2ZUUA 4PJIE 1WK0A 4NT6A 1IGIL 5A2JH 2CUIA 2RHEA 2X1PA 3KPNA 1KACB 4GLRH 4KAQH 1JFQL 3MRHA 3U7WL 4OBRA 3HZVB 2NY4D 4JFEB 2D03H 1RZFH 4EDWH 3T0WA 4LSVH 4B0MM 3W9DA 2AJZA 4XVSH 5C0FA 3ZT6A 4GMSH 4L3CA 3AY4A 5FA4A 3IVKB 4FQQA 1JI2A 5GHWH 1BQLL 2Q86B 2A9NL 4M5ZL 5GZNC 1ZT7B 3HC3L 1HYRC 3IETA 2Z8SA 4GO6B 4FNLH 4LASH 4DTGH 1MCJA 4X5WB 1HHGB 1X4ZA 2B0SH 5FOJA 5FYLH 1JPFB 4P5TA 4ZXBD 5D4QA 3D85A 3BGMA 5E94B 2WBJB 4O51B 1U8PA 1LO2H 1NL0L 2JB6A 5T5FH 2XZQL 2FD6H 3QIBC 4JG0H 1S9XA 5EIVA 5D6CB 1IEAB 2BERA 4JFDD 4LIQE 4LLDA 2EECA 1SMAA 5CILL 3NCBB 4U1HB 4HZLA 4WVRA 3L3DB 1QLFA 2J3SA 4M7ZB 1YNLL 2OSLA 1DEEB 2FZ3B 1E4KC 1H15B 1FFOB 3VG0L 3VWJC 4YFLF 1F8TL 1CZ8L 1OLLA 4Y4KC 3GSVA 3CUPB 4KK9D 1CBVH 4PRPD 5I1EL 4OCSL 5CD3B 3BKYL 1CICB 1Z0MA 3MBEB 2LU3A 3HB3D 5DUBA 4HGKC 1KCRH 1QSFA 4RQQB 3NABH 1JNJA 4ORZC 1HSAB 1XGUA 2NTFA 1JF1A 1DDHB 4OF5A 5GQBA 2XN9E 2ZOKB 4M62H 4F9PA 5IW1A 1T03L 4BFEA 1FNAA 5DWUL 5HGHA 3PP4H 4WO4A 3RWDA 5LJYH 1EEYA 3S35X 2X9XA 5IVOA 3JUZA 5F44A 1NGWB 3KAAA 4XZUB 3ES6A 1AO7D 3NA9L 1U92A 4G6JL 3QQ9C 2FGZA 1HZHL 4S1SL 4NNYB 5HGAB 5FA3B 2HTKD 5I8EB 2MPAL 1KTKE 5J1AA 4OF6A 1K8IA 1BBDH 2IALA 2OTWB 1UM6L 4ETQB 4XPFL 3QG7L 2EDFA 4ONFL 5CHNA 1MCRA 3RPKA 1MSPA 4RZCA 4OT1L 5HVWA 1G7MB 2VMFA 1NCCH 2FO4A 3O6FD 3BPLB 1EEQA 1TZGL 5FKAB 2HG5B 2V9QA 2F5AL 4PJ9C 3MXWL 4UAOB 4LOUD 5E2WH 3ZSSA 3BWAA 4DAGH 2Q7YA 4EIGB 1ITCA 2EEAA 4J2XA 3ARBA 5GZOC 3MJGX 1RK0B 2D7NA 3GRWA 1E4WH 5EU3B 5LBSL 1DVFD 2JB5H 1T4KB 4IOFD 3BEVB 4JG1H 1TTFA 3GSNH 1F90H 4JHZA 4J3XA 1MJJB 5MEND 3VXSD 3BMVA 1QPPA 1DCLA 5CJXC 3DX9A 1WGOA 4Z7VB 1A3LL 1EAJA 5B38A 2DAVA 3ULVH 4NJAL 4Z7OE 3BN9D 4M4RA 5TFSH 2AJXL 4LSRL 3I9GH 1BGXH 4HGMA 2VUOA 3ARDA 3MUGB 1BMGA 1G7QA 5JXEC 3OXSA 3VGBA 3SQBA 2ZPKH 4NUJA 1WZKA 3PE9A 1MAML 2J8UB 1AQDA 1QSFE 4U1LB 4XAKE 3F6IA 5DD5L 3SKJH 2ADFL 1S78C 3QHFH 1OP5K 1UT9A 4OLEA 5HTSA 4XT1C 4KQ3L 1IBGL 1Q72L 4JHWH 5FDWB 5IB4B 1X7QA 4C58B 3HRZB 3ARGA 1BVLA 2R69L 2YK1H 4GQPH 1NCDH 4P46B 2YXFA 2B4CH 5FUOH 5I66B 4RMRA 2OK0L 5JPMB 3EYVB 2MFNA 1UM4L 3KYAA 4Z7UA 2XQBL 1GYAA 5GGQH 3L9RA 4Z6AT 1R3IH 3C5SB 2BC4B 5M95B 2OL3B 3E2HB 4PTTA 3CVIL 3HS0A 5C08A 1J1XH 3SPVB 2PYEB 3WHE1 1G7JA 1T1XA 2X09A 1BIIA 3WNPA 4ELKB 1QUNA 5GISL 2P45B 3EYFB 2FGWL 2R56L 4ODBD 1MWAH 2XKNB 3MNWB 4K8RD 4ZG1A 1VGKA 4A2LA 1D5MB 3O2VH 1OAYH 5ESQB 3ARYA 3ROLB 5DVLA 3NFPB 3B4NA 4FQXC 4MDIA 3ZTJH 5I0DA 1LEKA 5L6YL 4JPKL 3MLUL 4JPIB 2G75B 1CVSC 4U7SA 3KG5A 5DDHA 4Y5VB 1TMCB 3EYUH 3UTSD 5JW5A 4NC1E 4PRHB 3CH8A 2GFBB 3EYQD 5EOCJ 1JTTA 3BPCB 5DJ2A 2C3VA 1ZLVK 5JXAH 5C71A 4HPYL 4DVBB 2X4SB 1VKXA 5IEKB 1YEEH 4DZ8A 4MNQA 3PGCA 4NRYA 2H2PC 1KT2A 3FONA 4TVPH 1F6LL 3VGHA 5FYLD 1L0QA 3UTPD 1I8IA 4NKIL 4LVOC 4K7PH 4I9WE 4KQ4H 3QQ3A 3GUTB 4KTDH 5SWSA 3ZE2E 1A4JB 4HS8H 4HUKB 5DGQA 5HDQL 1T22B 3PV6B 5DUML 2JF1A 3EFFB 1I3VA 3M07A 1DBAH 1CE1L 2BRRH 3LPWA 2JJWA 1RUQL 4L29B 2QJDA 1EGJL 4Y5YA 3DV4A 4UV7L 3D39A 4I3SH 4RGMC 1I9JL 1AFVH 1G6VK 5GGSB 4XHJD 1OLZA 1J1OH 5H35B 1UZ8B 5ESVA 4MHHI 1BM3L 1UA6L 4PJDF 3R1GH 4LL9A 3VA6A 4XNXL 2BSRA 3GZKA 3B8SA 5D93B 4KKCD 4YDKL 4Z7UE 1QRNA 2FL5B 1KTDB 3IDNB 3TGXA 1M7DB 5IMMB 3P3YA 4EUPB 2DD8L 1ZHKB 3TF7C 1MPAH 3K8MA 4X4YB 2Y7QB 4PP1C 1ONQA 4OLYH 5C08E 5E8PA 5ERWA 2LTQC 2M8XA 1G9MC 1RZIA 1UWXK 3QAZB 1I7TA 5IV2A 1QLRB 4IIQA 2FR4A 3MUZ1 1I7UA 1P7QA 4UQ3A 3PNWB 3MQIA 1YUHB 1MJ8H 2VC2H 4I4WA 2VB5A 3RVWD 3WYRA 1A6VH 3CD4A 4P2CG 4DGIL 5TDPA 1JYNA 1U42A 2HLFC 4ODXB 4UQ2A 5GGVL 3H42L 1WJ3A 2X4RB 5J0BA 1F45A 3FFDA 5J9PA 1P84J 4C4KO 1XFPA 4YE4L 1KELL 1CQYA 5EH1A 5F9WC 3MXVH 3ZHDA 3DX8A 1MJ7H 3O9WD 1N6VA 5DZLA 3ARDC 1Z2KA 4L4VA 1JRHH 1UENA 3AMLA 3BH9A 5E56A 3SHSA 5CAYB 5GRJH 4U05A 1YNKH 1KCSH 3OG6B 3BPOC 5F7LB 1PX3A 2BNRD 2F54B 4HC1A 4U6VH 5KN5B 1XGRB 4MNQE 1M7IB 5ILTL 2NX5A 3OX8A 1E6OL 1TITA 3TZVA 5D5MB 5EZLA 2BVEA 4OCYH 2DQCL 2QHRH 5DRZB 5J1SC 2JK5A 2NY3D 2YD5A 5DRXA 5SWSE 1A4KA 4JFYA 3C60A 3LY6A 5F7HA 2VZVA 5DMKB 3IDIA 1ZGLP 1AI1L 4PLKD 4Z7QF 2QSQA 3TN0A 5CEZD 2EDYA 3OL2A 5EC1A 3KR3L 4N1HB 1D5XA 5IKCB 5HHQB 2ICWA 4OM0H 3E0GA 3KJ4B 4P3CL 1YEIL 3D6GA 5C70A 2A83B 3D39E 4ZAKA 4HT1L 3OAUH 1J86A 4NKMA 2VQ1B 4WWKB 3TCLB 4JO1H 1EVUA 2H26A 2KDGA 3VJ6A 5BV7H 4JFOA 2I27N 4MAYA 2BFVH 4HWBL 4XNQB 3QUMB 2VJXA 4PJAA 2G2RB 1QRNE 5EDXA 1T0NA 3QUYB 4LLMA 4AIZB 1AGCB 2ARJQ 1Q9OB 1YQVH 2R4SL 3RL1A 1CXIA 4TNVK 3FQRB 3RUGB 3X11A 4CGTA 1I7ZA 3OR6A 1CIDA 1H3TA 4MXQC 4HJGB 4D2NA 5IM7A 5C0EA 1JV5A 3SDYL 3D87B 4OFIA 4QY8A 2ED8A 5IVXB 1B6DA 1AQKH 3BP7A 3WE6A 1QSED 1QNZH 4R4FL 1A6WL 3EW3B 3G08B 3RBSA 5C0BB 3NZ8A 2W91A 4N0YH 3SCMC 3B43A 2DJSA 4F58H 5ICXB 4LRNH 4WY7L 3OKNB 3TYGH 3ZE0E 5AZ2L 1DQDH 3QUZA 2CR6A 2NY0C 3NH7H 5C0RH 1TNNA 4JDVA 5JOEA 2I9LA 5J12B 4KRPB 3KNBB 4CMHB 5F7YC 1QQDB 3KPRA 1N64H 4L4VE 1BQUA 1FC2D 1S9YA 1WIUA 3DOSA 4RA0C 1WBXA 4UT6H 4JRXD 3EJZD 1OSZB 3BDBA 4RMUA 3BRGC 1KLUA 5I74C 3HMXL 5D1QA 1WFUA 1FYHB 4QHKI 5JW3H 1T66D 3TPUA 2NX5E 3O3EB 3RGVA 4RCAA 4AEHH 1G7PA 4XPTL 2EDNA 1X5JA 3QO0A 3UC0H 4F7EA 3BYYA 3WNOA 4POZD 3N1MC 4TSBH 4LU5L 5T1KA 4XXDA 4K3JH 4JAMB 4K3EH 4UI2A 4GOSA 1FGNL 4N8VB 5E00B 2MHAA 4DFHA 3CDCA 2P5EB 3FB5A 1AGDB 3SBWA 1UKTA 3H9HB 4OD1H 4PY7B 4XNUL 4LGSB 1FRGL 1J5OL 4MMZC 3QNYB 5LQBH 4UV4H 2A6IA 2J88L 1QKZL 2HT4D 1UQSB 3QIWA 3TBVA 1Z9SA 3IDXL 5E2VH 1UEMA 4BZ1H 4IDJH 4UDTA 5BCAA 1II4E 1C7SA 1GAFH 5CSGA 1KPRB 3HTLX 4OFYA 1CQKA 4PJAE 5T3XE 1NMBH 4TOYL 5FIEA 1EGJA 3DMMA 4PB9H 1PEZA 4PREA 2X41A 1I85C 1UEYA 2DMCA 4L8SA 3GJEB 3IRPX 5E6IC 5F97E 2CDGA 1JZ2A 3MLTB 4WUKH 4CJ0A 4X4XA 5DEFB 4LVHC 3F7PC 4UMGA 1IKNA 2H2SD 3I50H 1NDGB 1FSKB 4QOKA 3KPMA 1JGDA 3KDMA 2NLJA 3BISA 3S96B 3V5DA 5C07B 2QL1A 4LP4A 5IW6B 1ZTXH 1TPXC 4OCRL 3B9KA 3BE1H 3KYKH 3SDCD 4KKBC 4NQXA 5KW9L 3MZGB 4PJXB 3O4LA 4NKDA 1I1YA 2HAZA 3DBXB 1QFPA 3VH8B 3VI3E 4BFBD 5CKAA 3NCCB 2O5ZH 1S3KL 4D0CA 4FQCL 3V5KA 2IGFH 3CSGA 3WFHA 3KPQA 4JFZL 4KROC 3D0LA 2FX8L 4C56B 5L2KA 4Z9KB 3VMPA 3RVVD 3SDAD 3KPRE 4HKZB 1CWVA 4PLJC 2JIXA 1DBML 1H3WM 4G5ZH 1PY9A 3BDXA 4HCRH 4U1JB 1G7LA 4BZ2L 4RGOH 4H1LA 3WKNA 4MXVE 3RNKB 3PL6B 1HXMA 2C7UA 1OARH 1KNOB 5C0IB 3MFFA 4G6MH 1YEDB 3H0TA 2DKUA 1MVUA 2XG4A 5DD1L 4BZYA 1YYML 5F1IB 5I76B 5INDB 5FM8A 3GFUA 5EOCL 3VMOA 1Z9LA 5LGHH 1CXKA 4QHUA 5MEOA 2ED9A 5CIPB 2WIMA 1IM3A 3MJ8B 1IC5L 3MRMA 5BVPH 1J88A 2WW8A 3LN4A 2A2QT 5DJ8A 4N0CC 2GSIA 5E4EC 4WHYH 1TQBB 2QQKH 3BQUC 4BUGA 1H3UA 1OCWH 2DBLL 3LDBB 4RGNC 4DEPB 2Z92B 4QRRB 4UT9L 4XVTL 4N8CH 1SVZA 5BW7A 5ISZB 4C83B 1RQ5A 1IQDA 1FNGA 4ZFZA 2B1AL 3EOBA 1OAQL 4F2MB 3IGAB 1YPZB 3C5ZC 2CLVA 4RAVA 4GBXD 3S4SG 1YEFH 3QBTB 2V2TA 3X14B 3WUWG 2FH6A 1CFVL 5KVDH 4EVNB 3QUZC 5F1KC 12E8H 4P9MH 4Z77B 2AEWA 3L5JA 4QOKE 2R1XB 4PPTA 3ZYOA 1JGLL 5HI5C 5FV2A 3SGEI 4HKXB 4D9RD 4KJWC 2ID5A 3QCTH 1WFTA 1S7QB 4MNHB 3O6KH 1MI5D 4RX4A 3MLVH 4XMPL 5E6YA 3BN3B 4R0LB 4OJFL 3QEGH 4KZEH 3O4LE 5FYJU 5FV1L 3V0WL 1KYOK 1IGYA 4UNUA 3ZDYF 2GUOB 4FG6C 4ZOBA 4NHUA 1DQTA 2EH7L 1KLGB 3VFVA 1X5IA 4BKLA 4PGCB 5L2KE 1KBGH 4OI9A 2WIIA 4C59B 2AI0L 3FQXA 1IAIH 1B0GB 1A9EA 3Q3GB 4B5EA 5FYJE 5CUSH 3U79A 1SYVA 5MP6L 4DN3L 2E7MA 1OB1A 4TSAH 3LQAL 3UO1L 1W8NA 4IJ3C 2ZZUT 5JZ7C 2VITA 3I6KA 1N0LA 4LLVB 2C3XA 3G9VA 4RDQG 1A1NB 2A6KB 3F8UB 3CVHA 3ARRA 1BQHG 1NBZB 5F8QC 1LEGA 1XAUA 1NH6A 3TJEL 2R23A 4ZUSA 5IB2A 2E9WA 5I1JH 4YEEA 5IMLB 1VADA 2DQTH 3OKEB 3DMMC 3U2SA 2GTWB 2HTLC 5AG8A 3FMGL 2Y6SC 1G7HA 4LSVL 2R15A 2M2DA 3Q1SH 3UZVB 4GMSL 2HYMA 3TIEB 4LPXA 3W5NA 4KHTL 5T33H 1G1YA 2Z31A 4JM2F 2BNQA 5IROC 3EFDH 2J6EH 1R5WB 4I2XB 1ZSDB 1YJDH 4U6XA 2WBJD 4AYFA 1XGYL 4FNLL 4LASL 2CLZA 4M8QB 2B0SL 3K4DA 4JKPL 4HMDA 4LRIA 4HPOH 1LO2L 5B21A 4JG0L 3UBXA 2ICES 3GB7A 1YZZA 2KH2B 1BZ7A 4NC0B 3A6BH 4M3JA 1NCNA 4X7FC 1KCKA 4C57C 2R0LH 5HHVH 4CVWA 1CICD 1QRKA 1HH9A 3MBED 4GG6B 2XNAA 1LO5A 1QP1A 4U0RB 2DTML 4LKXA 4F7PA 1FG9C 1TJGL 3VFUA 4FZEL 2X89D 3S36H 3L95A 4EUPH 4F37F 1S7RA 3NABL 4NRZA 5CJ8A 3FT3B 5L8KB 2EKSA 4G7YL 4L3EB 5LAXA 4PJHF 3KYNA 1L6ZA 5HY9A 4LARH 3TT1H 4OV5B 2L7JA 4ODWA 1MFBL 4U1IA 2XTJD 3OMZA 2PXYC 2D0GA 4M48L 5I1AA 3ARQA 3QXDA 1AGBB 1GZQA 1QSVA 5MHSE 4NQEB 2Y06H 3RWFB 3P4OB 4JLRB 1SM3H 3T0BA 4HFWA 4WUUA 1D9KB 3NTCH 1RIUL 1AIFB 4S0TD 3JV0A 1EXUA 1NFIB 3EDFA 1AGEB 3KYMA 3BZEA 3QEUB 4UINL 4KJYA 3DX7A 5HYQA 1CLCA 1EERB 4IBLT 5KS9F 5MEPA 2BHUA 3FT4A 2A38A 2IAMA 3QDGA 1S7TA 2XG5A 4LEXH 4LGRB 2FSEA 1NGQH 3P4MA 3AREB 1TJIL 3T1FA 3R0NA 1UB6B 3IU4H 4G8EB 4KUZH 1KB5A 2VDRH 3FO1B 1Q1JH 1NPUA 1UJ3C 5D7IA 3P2TA 3BP5B 1J05B 4LGPB 3K2MC 2QQQA 4XNMA 1A7QH 4O58H 5CJ5A 4CNIA 2GYSA 2APXA 2BNQE 4JN2A 4E5XA 4RMVA 1IKFL 3O8XA 1XGQB 3EO9L 3QEQB 4MSWA 5KSBF 2AK1L 4W4OA 3EDEA 1E4WL 5E8EB 1A6ZA 2OR8A 3V7MA 1RV6X 4Z78A 4JG1L 3GSNL 3NZHH 1OGAD 1W72H 3LEXA 4AQOA 6FABH 2HP4A 5BXFA 4P59L 2LV4A 5F89B 3IFOB 1H5BA 4K2UH 3DRQA 3TBYB 1CTOA 1YN6B 3IF1B 1RUPL 1IM9B 3GMQB 4OCWL 4OZFH 5CBEB 4L9LC 1GGUA 1XIWA 3I9GL 4QWWC 4ETYA 5KSAB 4NQSB 5HYJA 2BJML 4YHML 1UACH 3G04B 1LDSA 3TH2T 1MNUH 3WNNA 4FTVB 2XZCL 3MRNB 4JDZB 4PYGA 5KSVA 4QHLA 4IMLB 4UIKH 1SJEB 4XCCH 4XMKL 1PY4A 2GQHA 4AEEA 2X4OA 3QR2A 4PJFA 3PHSA 4H8WH 3V6FA 1UYWL 4NPYB 4MJ4A 3TO4C 1D5BB 5FUOL 4WUUE 1XCQB 3IU3B 3C09B 4KHXH 3U4AA 2PYED 5GGQL 1HN1A 3HAEG 3CU1A 3VGAC 1A9BB 5KG9A 5IT2L 3BIAX 4NKOA 4LSUL 3C8KB 1J8HB 4JM4H 1GC1H 3QDGE 4Q6IC 1HDMB 1TXKA 3LEVH 3O6ML 4MDJB 3QH3B 1YEKL 4JDTH 3UZQA 4D0DB 5IJKA 5T1LA 2XY2A 2VZSA 2EYRA 4JY4A 4PV9A 1XF4B 1PQZA 4P2QA 1ACYH 3MRGB 5D7IE 3O45B 3BPNB 1S9WB 4LSSH 4CVXB 4JY5L 1YECH 3B83A 3EGSB 5L8JB 4ODTL 3EO1B 5IR1A 1F11B 5DJ0A 3UAJD 1FLRL 4OFVA 3VU2A 2V7NB 2DLGA 5CEYB 4PRHD 4PJCA 3UTSA 3P9WB 1N0XH 5GXBB 1RY7B 1QVOB 3I2CH 1NC4B 3WJJA 4HWUA 4I18B 2AJ3A 4ISVA 4EI6B 1AGFA 5C6TH 3DROA 1I9IH 5IW3A 2GCYB 4I8DA 2NY5H 3VCLB 4JO4H 1JWUB 3MNZB 4JREC 1YEEL 5D1ZB 2R0WL 1JUFA 1MCOH 5GSRB 3W2DL 3WCYA 3KS0H 1WV7T 1A7BA 3BP4B 4QYOB 1TVHB 4X9GA 5J3HD 4BH8B 5HYJE 3FN0H 5JHDA 4TULL 2XWTB 2DWDB 4BFIA 2CDFA 4YDLB 1CG9A 2E8ZA 5C0GB 1CDJA 3LN9A 2VXUL 3MRBA 5E5MA 4JVUA 4IRSC 4XBPB 5GS2D 1ORSA 4FQPA 2HH0H 5HHXL 1VB9A 5C0AD 1KULA 1GOFA 3WEXB 4PJFE 3PWVA 1AFVL 4Y4HC 2UWEB 1JHKH 3HE6A 5IBUG 4KK8C 1TLKA 4CN4A 3AC0A 3U6RA 2XY1A 3K2UH 1MCFA 4F7CB 3CXDL 2EDXA 1HK6A 2H32B 2ZNWA 3PGFL 4JPVL 5GRWA 5IBTL 3I02A 4IRJB 4XBGB 2BVPB 1YMMB 1LILA 5FECB 1T2QL 1DLFH 3TJHD 4LPUA 3QZWA 3O8XC 3P77A 4QRTB 2DQEL 3G6DH 4W4OC 5DK3A 3VDBA 1FBIH 5D9SB 2R8SH 3QDAA 3T2NL 4P2QE 4GAGH 3UJTH 4G6KL 5HI4C 4B53A 1HQ4B 1KG0A 5B39G 1PG7L 4X6DB 1QFUL 5GGRY 5KZCD 5SV3A 1LE5A 1KGCE 5HVHB 2HLAB 4ZFOA 5IEHA 1T6VN 1FL5A 3Q5YA 3O11A 2BY3A 4LSPL 3MXVL 3MREA 3O9WA 5EOTB 4PJCE 3UTSE 1KIQB 1VFBB 3ULUF 1JRHL 1FVCA 4KMLB 2F54D 3P9MA 3LHPL 4IRZL 1KIPB 5ITFB 3GGWA 1KCUL 5L88L 4ODUA 3T3PE 5FUCE 3WDJA 3SJVB 2HFFA 1MLBB 1FLTX 1AD0B 2AABH 2ICWI 4ZUVA 4Y2DB 1WTLA 2QHRL 5FAAA 1DBBH 3GSNA 5IQ9B 5JHDE 4ZTPH 2A6JB 1K4DA 2X40A 3QJHA 4WFHE 2HRPH 5HYSA 3MA9L 3P30L 2B8OT 4LCYB 1MHPL 1RZKL 3GBNL 4WFFE 4JKMA 2DQHH 1BECA 1L7IH 3B9DA 1KJVB 2V2WB 4WW2F 4PD4J 5EULV 4WWKD 1F3JB 4M9PA 4QHNA 4QXGL 4OI8A 2NTSP 3HMWH 2OI9C 1A2YA 3VWJB 3CNKA 5E2JA 1IC1A 4WEBH 3LQAC 1EHXA 2DICA 5I8OL 1CYGA 2FNBA 4CADB 1ZVYA 1A1MB 4OV6F 2HFGH 3HZKA 5FB8A 1MIEH 3T2OA 2VR5A 3EOTH 5I8KH 2YD9A 2PYFB 1U58B 3A6CH 1QBMH 2FBOJ 5EA0H 4AG4H 1P4LA 4RRPA 2C26A 3IDUA 5HVFB 1HHJA 4PJIB 4FP8H 4JQIH 3LN5B 4PRNB 5CEXA 1NC2B 4H0HB 3V0AC 1WFNA 2VLJA 1U3HB 4YXKH 5C0BD 1HHHA 5CD5D 1EAPB 1INQB 2VDPH 2Z8WC 1LE9B 3IT8D 2VR4A 5IHZA 2AGJH 2X4NB 3UPAA 4S0SD 3HE7C 4J6RL 3K80A 4CKVX 4XCNB 4KRPD 5IF0B 3O2DL 1ZHLA 1DQDL 3LV3A 1RU9L 5E2UL 1MWAA 3LKRA 1JGEA 1CL7L 3F7YB 5F3BB 2ZOLA 2OXGA 4L5FH 1FN4A 2L0DA 2NQCA 3RQ3A 1F4WL 1N64L 1JK8A 1OGTB 5F9JB 4ZS7H 5HDBE 1F42A 2H8PB 4XC1H 3ROOA 3NVQA 2WINB 4UT6L 5LG1A 1HYSD 3FKUS 3OF6A 4M3KB 2B7DT 5JW3L 1LEIA 4XWGH 3QNZB 5GGTL 3ARXA 2CSPA 2VABA 4RNRB 1AP2B 4QXTB 4UNVA 1DP0A 5ETUA 3HE6C 2P5ED 2C1OB 4E9LA 3AB0C 2YPVH 3UP1A 5E99H 2Z4QB 4N9GB 2VN4A 1RJLA 5F9DC 4C4KT 4MJIA 3DSFH 3ULVE 3ESUF 3H6JA 2C3HA 1CGVA 3P11L 4OD1L 5FK9B 4KY1H 1UJTA 1GGBL 2XN9B 1RK1B 3QB7C 3RY5A 1NGYB 5LQBL 1W0VB 2VDLL 3DIFB 2PR4H 3MGOB 5EO0A 4WFED 5TF1H 4N5EC 1BFOB 4AIXA 4U7KA 1IQWH 1INDH 5D1XC 2V7HB 5DHXB 1WSST 3BGAA 3M17B 2N7BA 3RWGA 1FDLL 3DXAA 1FJ1A 1F5WA 3QPQC 3EKCA 5EU7C 4MA1C 5BRZA 5C07D 4XNZB 1MLCA 3KPNB 1OTSC 2VLJE 1H9VA 3S6CA 3VFMB 4LCCA 3FQWA 3MRHB 3P0GB 4YHPB 1REIA 2YD7A 4PG2A 3UYRH 3W9DB 2AJZB 3BE1L 5C0FB 2R4RH 2OCFD 3H9SD 2PCPA 2WQ8A 3PWUA 4C56D 2AKRA 2R2HA 3MYZA 1CU4L 3QWRA 3AVEA 4MAUH 3IETB 3H7LA 1EMTH 2JKXA 3LQMA 4HK3J 4M1C