2BMKA

Fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIELTQSPAIMAASPGEKVTITCSATSGVNYMHWFQQKPGTSPKLWIYSTSNLASAVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSTYPFTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT OF CATALYTIC ANTIBODY 15A9, LIGHT CHAIN
publication title Structural basis for D-amino acid transamination by the pyridoxal 5'-phosphate-dependent catalytic antibody 15A9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bmkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bmkA01
2MSPA 2X9XA 2Y6SC 4ZUWA 2K9UA 5F3BB 4JR9H 43C9A 2XZAH 1NCTA 3MODL 1JPGB 1WWCA 4ZPVA 1FE8H 4DUVA 4OZGB 1AKJA 5E94B 1V3LA 3RAJH 4X6BB 1IGYA 4P2QD 2HT3D 4DFHA 4H1LH 2VISB 3O41B 4LEOA 1HKLL 4YPGB 3KYMA 3UTTB 4F2MB 3C8KB 5I9QC 1U41A 4WO4B 4XMLL 2F74A 4G6ML 1WBZA 1Q8MA 3ARGA 2V17L 2BXYA 5SWSB 4ELMA 4FNLH 2VABA 4GRLB 1QRNA 5I1EL 2EDTA 3MBEA 1MI5A 4P4KB 3ROLB 3IF1A 4Q74A 4RCAA 4MXVE 5LKNA 1R3KB 1E4XH 3QXAA 2OK0L 2YKLL 3SO5A 2ZP0T 1HOCB 3S5LB 5KSBB 4RMVA 3RWGB 1L7TL 3LS5H 3PGCA 5C0AB 1A6UH 2BNQD 1H3WM 3ARRA 2JCCA 4H20L 5EPMB 5IR1B 5ICYB 5IVOA 3IFOB 2NY6C 2WAHA 4AEHH 5HVGB 2IALA 2X44D 3FHAA 4HC1H 1OM3L 3IKKA 2Q8BH 4PGEA 3VD9A 3MUZ1 4Y4HB 1RUKH 1UA6H 5KOVC 1IEBB 3NIGE 1HDMB 2H3NB 2HAZA 4LFHD 3ARYA 5CEYA 2VZSA 3GI8H 2NY2B 3HPJB 4PLJC 1SJHB 3W39A 1XGYH 4GXUN 2VXQH 1OAKH 2BNUA 5ICXB 2R0ZH 1LK2B 2D7QA 4WWKC 1J1OH 2EIEA 2QLVB 2VDNH 2DL2A 4NZTL 4HUVA 1CYGA 5D70L 1WTGT 1JI1A 3SO3C 1O7SA 4YZFE 3CDCA 1G1YA 3PABB 3TCXA 3OB0H 3X3GL 5DUPL 3GHBL 2EEBA 1MF2L 3QEQE 5CILL 4GLRH 1TQBC 1X7QB 2IBZY 3D18B 1ZVYA 4XPBL 3T2OA 3MCLL 4K8RL 5FFLA 1UJ3A 5IP4A 3MUHL 3WSQL 4WO4C 4QRUA 4TVPD 4FMKA 4BFBD 4E5XB 4ODTH 4P2QA 5GZOD 4WEBL 4I13B 4RDQF 1S7SA 1SEBA 1T1XA 3BD5A 3A6BH 4P2RE 2BDNH 3AXLB 4GRLC 1KJMA 5I73B 4JHAL 5D96B 4P4KC 2WNGA 2YD5A 1T3FB 1NANI 4X6CB 5E08L 5DGQA 1FVDA 4LSPL 5HXMA 2HTKC 5D7SH 3GBML 4ODUB 3ULVD 4G8EB 4C58B 5DQ9B 4JFDE 3GIZH 1DQTA 1LMKA 5GGVY 1P5UA 3ESVF 1GCFA 1G7HB 5HYSG 3VXRB 3QDME 1I1AA 4N5UA 3DVIA 3MNZB 1CFSB 3I75B 3PL6B 1QFUL 3QQ3A 5C09D 3CXHK 4JFPA 4DJMA 3BP5B 2IBZX 2X4OB 5EOQL 2ZOLB 3CFDB 2CRMA 2DQCL 2XXCB 4FQXD 5EDXA 3B6SB 3OSKA 1YJDL 1JFQL 4JJ5B 4BM7A 5JIPA 1DBJL 1QR1A 2P8MA 1R3HB 3LRSB 3QIWB 5CINL 3KPRA 4Y5VB 4ZYKA 3QUYD 1TCMA 3HFML 5IJKA 2NY2C 1A6TA 1E27B 4PRHD 4RSVA 1A7PL 3BRDA 2NR6C 5F88B 1ZOXA 3WJLC 3LKOA 1HN1A 1ADQL 2FX7L 4TVPH 3QG7L 4ZUUB 1NCCH 3QDJA 4HV8B 2A1WL 4MQXC 2H9GA 4ODWB 3OR7A 5I1KH 3W2DL 5JW4N 2FR4A 1MCOH 4FQ1H 3SDCC 1W0WA 3NZHL 1EXUB 1I3RA 1TETH 3RGVA 1NH6A 1J05A 3DRQA 5H2BB 3HN3A 1CIUA 1UB6A 1FNSH 1U8IA 2J7LA 4JGJA 2EXWD 2NTFB 3ZKND 1HEZB 3O9WA 3EAKA 3WHE0 3OB8A 3RY5A 3ULVH 4BH8B 3PV6B 3NGBC 3OWEA 3RWJA 5B3JF 1RJLB 1K4DA 4G43B 4LOUD 1YZZA 2VWEC 3HZMA 3PWLA 5KAQF 5GJTH 1NBZB 3L3HA 2N4IA 1KC5H 3S35L 4ODBD 1BPVA 5HHPA 5F96L 3MOQA 1B0RB 1U6AL 2YRLA 5FK9A 4PD4K 3CFKA 3L7FB 5KG9A 4KQ3H 5ACZB 4ETQA 5EZJA 5IHUH 5A16B 1M6OA 2DQEL 3BPNC 5CSBA 5HYEA 2H8PB 2IFGA 5JIIA 3L3KB 5D1ZD 1ED3A 5BOZG 3IFNL 4YE4L 2JK5B 3CFJA 2AQ1A 3P9LA 4I9WD 3WYRA 4Y16D 2G60H 5I8EB 2ZSVA 4G8IB 3RY6C 1NFDB 1ZXQA 2VZ3A 1URLA 3LKRB 3TIDA 3QO0B 3MV11 3ZDZF 1T1ZA 2PTTB 5DD3H 3PL6C 4BQBA 4TTDD 5GGUA 4QHKI 2ATKA 2EC9T 4LSTL 4PB9L 3C6SA 4OQTH 5FAAA 3DV4A 1NUNB 4NO5B 4ZS7H 3TYFA 4LKXA 4BUGA 3QIWC 3BAEH 5C2BL 5C09A 3TA3D 1ULVA 4GG6F 1MHHA 1NMBH 4LVOB 4PLKC 2PYEA 3ARZA 4FQXA 4TRPH 4OT1H 2XY2A 4HWZB 4Z7UB 2EDDA 5J6GA 4H1LG 2VLJB 4MJ2A 2UZIL 1GGTA 4DGYL 5FOBB 1KBGH 4OLWL 4PRHA 3VXQB 3MTRA 5C07A 1HXMA 2FD6L 2ZCHH 4HHAB 1CFBA 1GC1C 2Y5EA 2ZCLL 3S4SG 3IDMA 5F7MC 2AXFB 1G84A 1P7QD 1ITCA 1YEHH 1HSAA 2DWDB 3B83A 3EJJX 1TZGH 3F5WB 4OLYH 5E9DA 2EYRB 5DS8A 4AY0A 5D2LF 5LGHL 2I60H 5SWZE 1DE4A 1F2XK 2P5EB 3V6ZA 3IDGA 4NGHL 3WLWC 2VLKB 4YUEH 4OFKA 2AJVH 4K8RC 1S9YA 4GQPH 1HSBA 1HHGB 4O9HH 4AENA 5DD5H 3IDIA 4IRSB 5D7IE 3OJDA 3DMMA 1AGEB 5SV4A 4L1DA 3OKLB 1EEUA 4HK3N 1IC5H 4HH9A 4EDWL 4LHUB 1S5HB 1KXVC 4FHBD 2N1KA 1AD0B 1AJ7L 3WFEH 1J87A 5FGRA 4LDOB 4OZFH 5TH2A 2EIBA 3LEYH 5E8EA 3OMZA 1BLNB 3MJ8A 4OBSA 4WI8A 3RZWA 4QYOB 3HZYB 1FLRL 2X10A 4YDVA 4JFFD 1T1WB 3FN0H 3EJZC 3GSQA 3N1PC 4XNQB 5JXED 2W0FB 1MCFA 3IT8D 3QNZB 4FZEH 1FL3B 1NCAH 2UWEB 4OUUB 5D1ZA 3UTPE 3FO0H 3BEVB 4UV4L 5IHZA 1Q9OB 2C4XA 4NP4H 4I2XE 2EZ0D 5TF0A 1BQLL 4PRDA 4PTUA 1J8HB 2HT2C 3FN9A 1YJDC 4NNXB 3P4NA 2YMXH 1ZGLB 5AD0B 3RWHB 2XZQH 3HR5A 2G9HB 3V6OA 1JE6A 4LVOC 1KJVB 4WVRA 5C0NC 4J3OC 1UCBL 3WIIH 2Y36L 5DJYA 5JXAL 1MFAL 3TYGL 2GK0B 3U0TB 3G6AB 3DUSA 1W0VA 4Z7WE 4FFVC 3TA3A 3V0WL 1FAKT 4PJXE 4OZFA 5KJRH 1G6VK 5HHVH 5INDB 1P4IL 1RK0A 2EE3A 3V0VB 4UOJA 4R8WL 3PJSB 4TOYH 4X5XB 3P9MB 5HY9B 4F58L 5C8JB 2ZUTA 4PY8I 5DQJB 1KPRA 5HHOD 3WFHB 4HBQA 1QFWI 3H9SB 1IBGL 5DRXB 1EZVY 4MJ4A 1QLFB 2DKSA 1NBYB 2FATL 3BFOA 5DJCB 1P7QA 4LLMB 2EEDA 5FO8A 1NGPH 3NIDF 1FL5A 1IAKA 3ZMRA 1PLGL 4HK3J 4HWBL 1JUFB 2CXKA 3KPLB 2A38A 1YQVL 4NO2B 3F7PC 4MD4B 4JDTL 4ORGA 4IRZH 1CK0H 4HXAL 5D7LB 2ZCKL 4XP4L 5F9JB 3EGSA 1FYTE 4WJ5A 4O2EB 4ONGH 5BZWB 1JWMA 4C83A 4WCYL 4NWUH 2XYCA 1XCTA 2BSRA 5E2UL 5CCKH 5FA4A 4KKLC 3UYRL 5JW4R 4MAUH 5CBAB 3PNWB 1IGML 3IDNA 3R1GL 4P23B 4LCUA 4ZTOH 1BVLA 2ESVD 3TBVB 4WW1A 3SQOL 1CDHA 4O02H 3MFFA 3NCEB 1MFDL 1C5BH 3DURB 1EZVX 1I8LC 3QJHA 4LAQL 1I7RA 4GXUM 4WV1B 4UQ3B 1YNTB 3AS1A 4EOWL 3OGOE 1E6JL 2YRPA 1BVZA 12E8L 4JO2H 1EO5A 7CGTA 2AJYL 1ZS8A 5T3ZL 1A47A 2O5YL 2XIDA 4R7DB 4LRNL 1C16B 5DC4B 3DX8B 4HG4J 2ADGA 5GZNC 1JNNL 1P53A 4JRYE 1D5XB 1F90L 2VUYA 4YQXL 3I02A 3IDJA 3W5MA 4ODXA 5ALCH 2XA3A 2AW2A 2DM2A 2DBLH 4M43L 5IHBA 2W60B 2R0WL 2FIRT 5C0GA 1V8HA 3W0WD 4X5WB 3BGMA 3PGDA 2ED9A 4JPWH 2ZUUA 5IJVA 1QKZH 3DO3A 3VWKD 3VWJC 1BVKB 1RVFL 2R4SL 2Q76B 1OGTB 2VL5A 5TFSH 5B22A 5J0BA 1MCIA 2XFXA 4HX1A 1MHCB 3L5XL 5HYJE 4OLEA 2MCPH 1X5FA 5BV7H 5JNYB 3HB3C 5HHOA 3RA7H 3LQZB 3O0RH 1F97A 1WCBA 5AYUL 2A74B 4POUB 1VKXA 1CZ8L 5DT1L 3HI5L 3EO9L 5HHXH 3IDYB 4NKQB 1Q0XH 4RGOL 3P4MA 4GW5A 3STLA 1OTUD 2WUBL 3GRWL 3WKML 4HIJA 3VFSB 3U2SA 5BRZB 2MPAH 4H5SB 4WTWA 2HKHL 5GGRB 3CVHA 5EBMB 2HFFB 4IMLB 5GGVL 4XWGL 2W9EL 2XWBB 4WI6A 3SKMA 2ID5A 5JMRA 5ESQB 1LNUA 3SCMD 4P23C 4GT7A 3VXNB 3LS4H 3N9GH 4L8DB 4QOKD 4Y2OA 4Y2DC 3MNVA 1T22A 5DUBA 1LP9E 1BBDL 2DLGA 1MREL 3D3VA 4R97B 5ALBH 3IXAA 5DMIH 3SGEI 4WV1C 1FH5H 2AQ3A 1N7ML 2R23A 4PG2C 1MCJA 4OLUH 2I9TA 2P47B 4F7EB 1MLBA 1RUPL 4JCMA 2ESVA 3VGEA 1NCDL 5FO9A 3BKYL 4ZOEA 1J0KA 2PXYD 4J6RH 1T2QL 4Z0XA 1MIEH 3HUJA 1UWXH 3X11B 2Z0BA 3TO4A 5J6HA 1CL7H 3UJIL 1KIRB 4P2OB 3P30L 2R39A 1YEIH 3EDFA 3GMNB 1EERB 1JF1A 5DRWA 5FGSA 2J8UB 5HGHB 4M9OA 1G6RA 3QISA 5F7NC 2DI8A 3OKOA 5CJ5A 4X4YA 5I1CL 4G3YH 2NX5E 1YMMD 5I8CA 1MVFA 1K85A 1PKOA 1QD0A 4JN1H 4S1SL 1S9XA 4KROC 2RCSL 5HYIA 1A9EA 2EXYD 3VGAB 4PB0L 4U1JA 1UQSA 4WI9A 2G5RA 3PWVA 5I19H 1QSEB 4I5BB 4M5YH 2ZKHL 4QHMB 3SJVD 4HS6A 2R0LL 1J88A 1AC6A 5IF0A 2Z8SA 3MXWH 1NKRA 3VWKA 1G9ML 3OKDA 1P4LB 1UENA 5CKGA 1Q9WB 4ZNCD 1CGSH 2DTML 4KTEL 1DANT 4JB9H 3TCLA 3MREB 3WE6B 2W65A 4P0DA 3IDYC 3UXFA 1JWUB 3G04B 1OTTC 3GJFH 4XCCH 4OI9A 1KLFA 4RMRA 3VG0H 2D7NA 1QHOA 1OSPH 2JJVA 3RRQA 1F11A 5EO1A 1N6VA 4YAQB 3IS1X 1EIBA 1YEFH 1PY4A 3PP3K 4AIXA 1NBVH 2MQ0A 3HNTL 2VDMH 5GSVB 4HIHA 5HGAB 4LNRB 4MMZC 3T0WA 1A6VH 3F7QA 5DJDB 3IFLH 3F6IA 5I15L 3HMWL 4PP1D 4R97C 2ED7A 5HHME 3FB6A 4QTIL 3GB7A 2YR3A 2YUXA 1DUYA 3BO8A 3MLTA 1DEEB 2AV1A 4HQQL 1U92A 3RVWC 4IHOB 3SCMA 1CU4L 2IPTH 3QDAA 4K3DL 2VXUH 4QOKA 1F4YL 2HFTA 2R1XB 3GSWA 3VJ6B 3PP4L 4ZD3L 1KIQB 2JB6A 3FONA 1W72L 4XHJC 2GKIA 3OZ9L 3QXDB 3DXAA 4RGND 1T7VA 1EHAA 1JIBA 1A6WH 1AXIB 4M7LH 3QUZD 4Q9RL 1BX2B 4J1UB 1M05B 3OKYA 4P2OC 3WMSA 4MNQB 5ANMA 1ZHNB 2PXYA 3QUMA 4HGWB 3O8XD 3WNPA 4JANA 1U3YA 3T2NL 5D4QA 3TZVD 3ARFB 4HG4K 1TITA 1XR9B 3KJ4B 4HKZB 4JFYA 4X7TA 3VGAC 3PXJA 3JV6A 1KGCE 3D39A 4JVUA 2W9DH 3QZWB 4KTDH 1H8SA 2FJFA 2CDGA 1YMMA 5T1LA 3MRLA 5I8KH 1F3DJ 4FQPA 4JLRB 4XBPB 5E2JA 4JRXE 2AJZB 3HI1B 5TDOB 4FFYH 5CJOH 2ZUQB 4MHHI 4U1IB 4PJCE 1OAQL 3LCYA 1EGJH 5TQ2H 1UM6H 4X9GA 4UDUA 2LQRA 3CPLA 4G8GE 3OPZL 1OB1B 4RMTA 3NA4A 1R5IA 4QNPF 5DRZA 3U6RB 4NZRH 3L1OL 1WZKA 1U3ZA 3MJ9A 3F7YB 3U9UB 5IT2L 3KLHC 1I9RH 4HS3B 3BWUC 3DROA 4YHMH 3PDOA 5FGBC 5BVPH 2DJUA 5FO7A 5EUOA 4N0CC 4KMQA 5F1SA 3LSOB 3RUGE 4BZYA 1X5HA 1I7UA 3G08B 2LFGA 1N26A 3BE1H 5FV1L 3VRLE 4DKFL 1A3QA 2A73B 3M1BA 4N0UE 1M7IB 1P4BH 2XPGB 1FO0L 1JRHH 3UTZB 2VH5H 4TULH 1VFAA 3NCBB 4NZUL 3CSYB 2Q1EA 2ZJSH 4M1CC 3CH8A 2ENSA 4R2GD 1J1XL 3D69B 4XGZA 4ONFL 5H94B 1RHHA 2K1MA 2ADJB 1W72B 1S9WA 1SY6L 4AEIH 4URTB 5HSFA 4C54A 3B8YA 4GBXA 4LDEB 3SJVE 3ARQA 4J2XA 1EGJA 3HAEB 2UUDK 4ZFOB 1KCUH 1ZV5A 4C56B 3H0TB 4DKDC 1T20B 3GMOA 1OCWL 2GTZB 3V5DB 2C3VB 4XXCC 4ZO8A 3MMEB 1XMWA 3BMWA 4Z7VE 5DC9B 2VE6B 4MDJB 4GQ9L 4GAYB 5B38B 2UZXB 2QHLA 3QUZA 3HZKB 5EZOH 2YPKB 4G42A 4YH6A 3ARFC 4X4XB 2L7JA 4F37F 3G6DL 3O45B 4RBPH 5I1JL 3O8XA 1OAXH 2I26N 4NM8L 1LQSR 3SDYL 1FDLL 5D6CB 1S7RB 2EIZA 5HI5C 5I1GL 3ARSA 2VC2L 3T8XB 1CICA 4CU7A 4FZ8L 4X99A 4YDLB 2QSVA 1XCQB 4Z95L 3CFCH 1HILA 3JTTB 4EN3D 3ECBB 1K5NB 3O3EA 3WUWG 3MGTA 5C3LD 4E41B 1YC8A 2BSTA 3MRPB 2GUOA 3BZEB 1CF8L 4NQDB 4RGNE 2DBJA 3BN9C 1CVSC 5E8OA 1C7SA 2IANA 4XPAL 1SBSL 2JJWA 5EOTB 3EYFA 2FCBA 3KHOA 4OB5H 3MLUL 2DQJH 2H1PH 4NWTH 1BFOB 1T7WA 4LKCA 1JNHA 3W9EA 5IGXH 3KNBB 2FWOA 3IJHA 1F3JA 5FUZL 1SEQH 4OI8A 4PJFA 3ZKSD 3ZE0E 3MV7D 3A6CH 2V2TA 1Z5LB 4PJ7A 4OCXL 1N0XH 2NY4B 1KJ3L 1FG2B 3I9GH 3TT3H 1R5WA 1HHJA 4RFEB 5F1IA 4K9EH 4S1QL 3BVNA 4QGYA 3L5WA 4QXTA 4LSVH 4YEFA 2OI9B 1TDQA 4PJ9B 4UMGA 2NYYC 3OKNA 2YWYA 1BBJB 4ZO6A 4YDJA 3BPLB 4KAQH 1UGNA 3EOYG 1UM4L 1VEPA 3FZUD 1OP5K 3TV3H 4W68A 5F9OH 3CSGA 1DN0A 5K59F 4PJHA 4PJIA 2CLZA 4N5EC 2DKUA 2IJ0C 2ILLA 2GSGA 2H26B 5DVOA 5SWQA 3VH8G 3RI5K 5CJXA 1NUGA 1VFUA 4GMTL 1NCWL 2JELL 1NDGB 4UIMA 4XWOD 2WWMC 2NZ9D 4YO0A 5DR5L 1B4JL 4MJIB 1TVHB 5DD1L 3RIAK 4WU7B 2HA1A 3G5VB 2HJLA 5FKPA 4AH2B 3IJSA 3D0VB 5IBLC 1S5IL 1MPAL 4R0LA 4PJBA 4LLVA 5AZ2L 4MX7B 3MJ7B 4ZFFB 1IGJA 3S34L 2APTA 4ZS6C 1T0NA 3O3BB 1I8IB 1CLOH 1YDPA 3LQAL 4XNZB 4GKNB 4FTVB 5EZLA 4YDLC 4YGAB 4OD3H 5GJSL 2KZ1B 1ZHBB 4PJEB 3VCLB 4OCYH 1FNGB 4LCYB 3BDBA 1FG9C 2J6EL 4P3WA 1KENH 4KWUA 5DYOB 4PS4L 4U7SA 5TQ0H 1V05A 1B88A 4LDLB 3OX8A 3BISA 2HG5B 4OZIE 3RDTB 3LN4A 5ECJE 3SE9H 5JUEL 3TFKD 4MJ6B 1A6ZB 1UWEL 3SQBA 2CRIA 3TO2A 3KYNB 1BREA 4QRSB 3U7WH 4Y1AB 1Z0NA 3TN0D 1EDQA 5GISH 4GW1B 4D9LL 3H3PH 5CGYC 1YPZE 4F15B 4WHYG 2NY4C 4JKMA 2R8SH 1YNLH 4JQXC 3TH3T 5LAXB 1IGCH 4KK5C 3BQUA 3Q6FA 5JQ6L 5FDYA 5CZXD 3FFCB 1K8IA 3SEPA 3NIFE 5DTFB 3UPCA 4TNWK 4GRWB 2V2XB 4UINH 2D9QB 4PJ9C 2D4FA 4LCWE 4JVPA 4QXUL 1MNUH 5I1IH 1CGUA 3BPLC 1EFQA 4MJ5A 3CH1B 5EULV 4HWUA 3BT2H 2IBGA 3MV9D 4S10A 5IMLA 2C5DC 4XPFL 2DDQH 4E0RA 1IFHH 1OSZA 2D03H 4NKMB 5IB4A 5L2JA 4CVZB 4P46B 3HRZA 2VUOA 4XCYA 2HFEB 3ARBD 3MFGB 1CXFA 5HHNB 4NNYB 1UG9A 5BXFB 2A6JB 5BJTB 1Z0MA 3QSKB 2EDHA 4H0IA 5LBSL 3WXWH 4Z7NE 4ZXBD 2ZG2A 4PV8B 3EYUH 1I1YA 5C0FA 4L1HA 3GMMB 1T89A 3QHZL 3MV7E 3SGJA 4RAUA 1LE9B 4HIXH 4XZUA 4XNZC 5MEPB 4XVTH 5ADOH 5HHQB 4KH2A 1I9IL 2B4CC 2KPNA 1WFOA 3SE4C 4R4BA 1CFNB 1PSKH 3FB5B 5TE4L 5GRYA 1GHFL 4D9QD 1OAZH 3IU3A 5I6XB 1D6EB 1KF9B 3LHPH 3GKWH 4KKBC 3BP6A 1AGDA 3CJJA 1YMHB 3DRTB 5TE7L 1AGFB 2O61A 4BK4A 3BZFB 3RDTC 1AXTH 4RMSA 1NC4A 3GSRA 3GSUB 3MRNB 4GO6B 3ZKMD 1NJ9B 1Y0LB 3N1FC 1G7MA 2Z93A 1I3VA 1IGFH 3HZVA 4NQCD 1Q72L 5EOCJ 1JHKL 3X13A 2HJFA 5IMMA 1ZT4A 3HE6B 3GMPB 4F15C 2WQRA 4FQHA 4U3XA 5C0RL 3FT2B 1MCPH 1DJSA 5I1DB 3SKNB 1OY3B 4Y4HD 1N6UA 1CGYA 4NSKA 3RHWF 4NBYB 5E4IA 4N1HB 5CLTA 1RIHL 4GSDL 3TN0A 3SOBH 5JW5B 5L2KA 3O11B 2XNAB 4QRQB 1CD1A 4R4NC 43CAB 1HXYA 3ZT7A 4QRRA 4PUBH 3ARPA 3RFZC 4CJ1A 1JPFB 2D2OA 1KB5A 5CJQL 2H2PD 3INUH 1LO4L 4L8SB 4M8VA 5GRVK 3EOBB 3CLFH 4ZAKD 2J3SA 3C87A 3KXFA 1MVUB 3JTSA 1CGTA 4ELME 2QADB 4PJGF 3T0EB 1A1NA 3QPQC 2DF3A 5HGDB 4KHTH 3O6FD 1WBXA 4N8VB 2HP4A 5TGBB 4FQLL 4G6AD 3VDAA 4WI3A 5F72S 1HIML 1U91B 1R5VA 3DX9A 4WWKA 3QFJE 2XKNA 4ZUVA 3T0DA 3IGAB 1AE6H 3MRRB 5F3BA 5FYKL 2FIKB 5D1QD 5I1AB 3QXUA 4OZGA 3UPAA 2XWJB 3FO2B 4PRPB 4X6BA 1RHFA 1INEH 4NKOA 1M7XA 2PO6B 4P9ML 1XR8B 2VISA 3O41A 4X6DE 4YPGA 2MFNA 3SKJH 3C8KA 4F2MA 3BJ91 3B2VL 5I6XC 5HJ3B 4WO4A 1J18A 1RU9H 2AJUH 4U4BA 2DMCA 4BH7B 5CD5D 2H2SD 3C60B 4L29B 5DSCB 2DD8L 5SWSA 2FECI 4JZNB 1X5LA 1OD9A 4L3EB 5CIPH 5MHSD 2CDFB 4EBQL 3U1SL 3MV9E 4Q9CA 3VD4A 5C0BB 1E4WH 3ZL4L 3ROLA 4L5FL 1R3KA 1PZUB 4D2NA 3RU8H 5IQ7H 1J11A 2VLRB 3HE6C 3AFLA 5EA0H 5KS9E 1J1PL 1GGBH 3OKEA 1HOCA 5KSBA 4UILH 1EHLH 5C0AA 3I2CH 1DFBH 1MAKA 2VQTA 5IR1A 4KU1A 2EKSB 2OJZH 4M6MH 5ICYA 2XACC 2YD2A 4LSRH 4K3EH 1J86A 4NQED 4Y4HA 1HDMA 1T04B 2ZPKH 4L8SC 3TVMB 3O2DL 4F57H 4YJZL 5LWYL 3QYCA 5D8JL 5DQDH 3HPJA 4TPRH 1MCNA 2QADC 1LK3L 2YD9A 4Z5RB 3ORJA 3WJLA 1ZTXL 4EDXA 3T0EC 3DV6B 3ARED 1WGOA 1IC1A 5CBEA 2MKLC 1J9CT 1SQ2N 1A14L 3GM0A 1LK2A 3D25A 1HZHH 1G0XA 4I18B 2EDXA 2RAMA 1UWGH 4PJCF 3BPOB 4NQCE 3QI9B 3V2AR 1TJHH 5GRJL 2WP3T 3QIUC 1RURL 2OJEA 1MEXL 4YWGH 3PABA 5I71B 3ET9F 4HIIB 2YPLB 5BO1H 5EU7C 3FRPA 5CEZL 4DW2L 3GHEL 2CK0H 3NAAL 1X7QA 4MQ7B 1QRKA 1XIWC 1WT5C 1XH3B 4JO4H 1PW3A 1KEML 4NBXB 5DD0L 5DFVC 5CZVL 5IM7B 4JQIL 4E5XA 4QEGA 2DQGH 3KPRE 3C60C 2LABA 2E27H 1Q94B 3QRFM 3HHRB 2XG4A 4DQOL 3AXLA 4XAWH 3FQUB 5GHWL 3LD8B 4MD5B 3QDJE 4XMKL 4CU8A 3U0PB 4CMHB 3QWQB 1T3FA 1RUQH 1WC7B 1A5FH 2EE9A 1MRFH 4AYFA 5E8NB 2PKDA 2XA8L 2M2DA 2C4FU 3MLVH 3RX7A 4ODUA 4G8EA 1EEYB 3QDGB 1E4JA 5DQ9A 5KVDL 3PWNB 3L3DB 5DK0B 1I85A 2ADFH 5IW6B 1G7HA 3VXRA 5K9OB 1UM5L 3PQYD 1MFNA 3MNZA 3RNKB 4OM0H 3AC0A 4WW2F 3I75A 3PL6A 3CK0H 4BQ8A 1F4WH 3I3DA 4NNPH 3MLRL 4XNMB 2VITA 3U7AA 3EOTL 2X4OA 5KSVB 2ZOLA 4CNIB 3CFDA 2B7DT 4JJ5A 4XP5H 4X6FB 3CAFA 1R3HA 3LRSA 3QIWA 5TF1H 5JQHC 3TVMC 5ID0B 8CGTA 2Q3ZA 4Y5VA 5T33H 2CUMA 4RFOL 2OL3B 4EUPG 3TNNB 3O2VL 1E27A 4MA3B 5IG7B 4NQEA 2Y1VA 2UY7A 5F88A 5IFHH 4ZUUA 1H3XA 4WW2C 4N8PA 1F2QA 1WV7T 2OR8A 4UB0H 4K3JH 1U8LB 3PWUA 4O2FA 5FYLL 3RGHA 1IAIM 3NABH 4I18C 3B9KC 1EXUA 2P5ED 3BPOC 3QI9C 2ZSWA 2GJ6D 1IM9D 5H2BA 4OTXH 5M94B 4M4PA 4PYHA 2NTFA 4XPTL 2AV7B 3S88L 4G9FB 4ZTPH 1HEZA 2A77H 4K7FB 3RTQB 5H37G 5I71C 3L3IB 1WCQA 4BZ1H 1RFDL 3CFIC 4JCLA 4BH8A 3PV6A 3WO4B 5I1LB 1RJLA 5BVJA 4F80A 4G43A 5C0JB 3ZYZA 4LHUD 1KFAL 1DQQB 3UZEA 4Z78A 1BECA 1GAFL 1NQBA 3L3GA 3MOBL 1DQLH 1NBZA 2VDKH 5EWIL 3O3AB 1KG0B 3QH3B 5E2WL 2MMXA 1B0RA 2P43B 2QQLH 3LD8C 4NUGH 3L7FA 1FZJA 3CDYA 4QRPB 4CDGC 1QSVA 3REVA 5A16A 4CMHC 3L95B 2X40A 3IFPA 4AL8H 2H8PA 5J56B 3L3KA 3VFOB 1BQHG 1YEDB 3VFNB 3MA9H 1CXKA 2F54B 3DX6A 3HG1E 2OR9H 1QYGL 2ZG3A 2HRPL 1OLLA 3DSFH 5DURD 2WLZA 3GSNL 4YPJA 1NFDA 1EPFA 5E9DE 1AGCA 2P8PB 4XTRD 1A1MB 4KY1L 1OAYH 3VXSB 4OF5A 5E2VL 4R9HA 1WWBX 3RVUC 1JZ7A 2P7TA 1J5OL 2CMRL 1VFOA 1A7RH 2FGWL 3MROB 3WN5C 2PR4H 2G5BA 4JKPH 1OQXA 1KIPA 2ZWLT 1JPSL 5BMFH 4S1RH 2JTDA 2DQTH 1KB9K 4HWZA 4Z7UA 5EIVA 2VLJA 2VNCA 5F44A 2EYTB 3SDDD 1ZLWK 3FQRB 5FOBA 5IFAL 3VXQA 1D5BB 1D9KB 4HHAA 4HWEL 3N1MC 2BHUA 3QRGH 3CMOL 3U4AA 2DWDA 4BSVB 3F5WA 5JZ7C 3BN3B 4LRIC 4J4PD 2AI0L 2VTFA 2K7PA 4G7YH 3MV8B 2P5EA 5F70A 4DKAA 2GJ6A 2Q20A 1IM9A 2VLKA 3CD4A 2GITB 2XZAL 1JNLL 1IAOB 2CIKB 3PQYE 1U93B 1FE8L 3UP1A 4IRSA 2YEZB 1A7NL 3RBGA 2J4WH 5MENB 4MXWH 1PKQE 3OKLA 5EU6D 1YPZF 4U31A 4LHUA 1S5HA 1JGVH 1Q9LA 2NMSA 1AD0A 5IB1A 1HYRC 3VXOB 3K46A 3NCFB 4CU6A 1BLNA 3NIFF 4AK1A 3HZYA 5J1SC 3N0PB 5FGCE 1RD6A 1X4YA 4RAHA 3OGCB 1CBVH 4XNQA 2W0FA 5DGRA 4BQ6A 4HT1L 2VDRL 1FL3A 4K2UL 2UWEA 2OYPA 1E4XL 3DVNB 2GFBB 3BEVA 3EHBC 3O3DA 1Q9OA 1QPPA 4MS8C 3I3EA 5BS0E 2KL6A 3RWIB 4WTXA 5JLZB 1HHIB 2BY3A 3MOAH 5AAWA 1AKJB 3LS5L 4CRPA 4Y5YB 2AS5M 1PGRB 3ARDB 2IQAA 5JR1L 3T2PA 2C3GA 3GIVB 4LCCC 1B6UA 2G9HA 2Q8BL 1CI5A 1KJVA 3KYMB 3VGDA 5F7FA 5LGJB 1UA6L 4KJPD 3KLDA 4UTBH 5J06A 1WBZB 2GK0A 3U0TA 3ZO0A 3V52H 3UAJD 2VABB 1KCRH 4YEEA 1QRNB 3RPKA 1NLBL 5INDA 4JGUA 3V0VA 2Y06H 1XGYL 4NKIL 5AZEH 3ZTNH 4ENEC 1MI5B 4X5XA 1TFHA 1U0QA 1WWWX 3Q6GL 3NA9H 1OAKL 5C8JA 1FFPB 2R0ZL 1NCBH 2YA1A 5DQJA 5AG9A 3ROOB 3WFHA 5GRUH 4Y19D 5D1XD 1J1OL 2P42B 3H9SA 5DRXA 4EXPX 2C1OB 1QLFA 2VDNL 5BCAA 1S7UB 2ARJA 1NBYA 5DJCA 4LLMA 4HJGB 4O00A 5JO5B 1CGWA 5DJ0B 3QJFA 4J4PA 4H1LB 5BRZD 4YFDB 4YFLI 4MD4A 4O5LH 1GYAA 1N5YH 4PPTA 4OF8A 3S4SB 1MWAH 5F9JA 5CEYB 5I75B 2LTQB 3R8BB 3ULUD 3BYTA 3T77A 1HHKB 4AG4H 1WQVT 3HRPA 5BZWA 4C4KO 2ICCA 4K07A 2BDNL 1T21B 2VLME 4P2RB 1OAUL 1OQOA 3Q2CA 3GDBA 3UO1H 1F4XL 5CBAA 1ACYH 4GMSH 2BNUB 4OD1L 5FHBL 4P23A 3VXPB 1S7VA 3MRKA 2JJSC 1GOGA 3V5KA 4DZ8B 3NN8B 3DURA 4WV1A 4UQ3A 1YNTA 2AJSH 5T5FH 4PG2A 4ELMF 4ONHB 3AVEA 3WD5L 5A3IC 1JF6A 2DM7A 2D0GA 5KSAB 1ZK9A 4TN9A 4R7DA 5KTEL 1C16A 3DX8A 2X09A 4PRAB 4CMMB 1D5XA 4OLVH 2X9YA 3ARGC 4XI5D 1QVOA 1I8KB 4I48B 1T1XB 5T5NG 2BSSA 4PG9B 2JCCF 3NACH 2R56L 2W60A 4LLYB 3MBEC 4U6YB 4XVJH 1KJMB 4TVPL 4X5WA 4M62H 4F8QA 1NCCL 1ERNA 1SM3L 3ULUH 4DN4H 1MY5A 2IFFH 5DLMH 5I1KL 4OBRA 2VXVH 3MCKB 1BVKA 1TETL 3RWFA 3D3VE 3OAYH 4P9HH 1OGTA 2X89D 5ADPH 4LPWA 1BD2D 5B39A 1FNAA 1FNSL 2KDGA 2HJKB 1AFVL 4QY8B 3WFCH 5JNYA 4Y19A 1ZHKB 3QQ3B 4JFPB 1A1OA 2A83B 3ULVL 2Z8WC 2VR4A 3LQZA 5DWUL 1DCLA 3VXME 2BNRD 4KUZL 4LHJB 2A74A 1UKSA 2BNQB 5AYQA 4KVNH 1H9VA 2P8MB 3THMH 3TBWB 2R15A 1JYVA 2QQNL 5I75C 2LTQC 4ZYKB 4EI5D 3NCYP 5GJTL 4DKEH 3VFSA 4R4FH 5BRZA 4H5SA 1A6TB 4KGJA 5GGRA 1A4KB 3P4LA 5EBMA 4IMLA 3RY4A 4XNXH 2XRAH 1XGRA 5ESQA 4LLQA 1RIVL 3FT3B 4JY6B 3GMLA 1JPTL 4L8DA 1I3RB 4KI1A 3NPZB 4PR5B 3QEHB 3MLXH 1J05B 4Q2ZA 1U8IB 2G60L 3DI3B 4UV7H 4M7KL 4PRIE 1QSFE 1CR9L 4MNQD 3FQNA 2WINA 4QGTA 3RWJB 3OB0K 4JKLA 3AU1A 1K4DB 1MCBA 2NW3B 2Y7QB 3UYOD 4ZS7L 2HT3C 1XZ0A 4P2OA 2EEAA 3BAEL 3VW3H 3GMNA 1AR2A 4UOW0 4UTAH 3VFUB 3ZDXF 2J8UA 4LCIH 3IU4L 5HHPB 5HPMB 5FK9B 3CFKB 4OFVA 1A9BB 1HKFA 4OT1L 5I1HL 2UVFA 4YHKH 3DLQR 5C08D 1QLEH 4FQJH 4L3CB 3V4VL 4ONOA 3PG2A 1EO8H 1WAAE 3O6LL 4WY7H 1QSEA 2XQBH 4DUWA 2B0SH 3G6JE 4QHMA 4XNYL 1TZGL 4OLYL 4Y4FB 1GOHA 4XT1C 3CFEB 1TIUA 3MRJB 2MKWA 2I60L 5JHDD 1MCLA 4DGVH 1TJIL 2ATKB 4FXLA 4KGLA 3VFTA 2X89A 1P4LA 3DXAE 4YUEL 2AJVL 4ZO7A 2DJSA 4GRMA 1IKFH 3MREA 5DD5L 4LKXB 1RZJH 1ORSB 1JWUA 2R2EB 3G04A 3GRWA 1JMZA 4R90L 5D7IB 5C09B 3ZZ1A 5DDHB 1LEIA 4XP1H 1CFVL 3EDEA 5FGBA 3KPMB 2EE2A 2X4RB 4YAQA 4I77H 3WXVH 2RFXB 3KYKH 5F6IB 4LSUL 5SX4I 4EI5A 1OL0A 3O4LE 3QUYB 5GSVA 5HGAA 4LNRA 1V7ML 1WBYB 3WFEL 3D85D 4KI5E 3HLAB 1AO7D 4PRHB 4I0PB 5JOFB 1U8NB 1YEKH 4MCYA 3IDMB 1MUJB 3GO1L 2AP2A 4TTGA 3STZA 5D2NE 5BOPA 4GOSA 3FN0L 2E6JA 1DEEA 4LPXA 3GSOB 2GYSA 1N8ZB 4IHOA 3OR6B 4YHLH 5CWSA 3GNMH 5J1TC 5IBTH 1NCAL 1I9EA 2R1XA 3FO0L 5ISZD 1LO0L 3IDGB 1BD2E 2BX5A 2NY0B 4NP4L 2X4SA 1IQWL 4O58L 2QQKH 1KCVL 2F19H 3IDIB 2IEPA 2YMXL 1BX2A 1B6DA 1M05A 3KPSD 4MNQA 2VLLB 3MRHB 3NFSH 3NCJH 4HGWA 1MQ8A 2AXJA 2YRZA 3QIBD 2F58L 2LAGB 4HH9B 3BHBA 1ZA3B 3QDHA 5JPNB 1BIHA 3ARFA 4O51A 3HR6A 3V4PH 2HLFD 5GZOC 1CFTB 3J8F7 1WVZA 5TH2B 3P4OB 3BH8B 1FBIL 3MJ8B 4PJXB 1BGXH 5F9DC 5HHVL 2BHZA 4NZJA 3QZWA 4YDVB 4M4RA 2F8VA 3GSQB 4KPHL 4TOYL 5C08A 2ENYA 1C1EL 4PJDE 4JLRA 3U83A 4XBPA 4K55A 5D1ZB 4JPIB 4QXGL 2AJZA 3HI1A 3ULVC 1ODAA 3QCTH 1BFVH 4U1IA 5JDSA 4Y16B 1YNKH 5FF6B 5EU5B 3P4NB 1OB1A 2NXYB 1GGIL 1TJGH 1IKNC 1MELA 3LMJH 3G5YA 3U6RA 1ZMYA 5JHDA 2HH0H 3U9UA 3F7YA 4HS3A 3SDAD 1V7NL 4IRZL 5DJYB 1CK0L 3OF6A 4FQXC 4RISH 3LSOA 4TSBL 2F5BL 1W0VB 3G08A 1XF1A 3TA3B 4BZ2H 3IB4A 3FOLB 3QUYC 4OZFB 1WK0A 4ONGL 1CWVA 1M7IA 2XPGA 4JO3H 1D5IH 2YC1A 4GXVH 1QFPA 4YFEA 4KZEH 2P44B 1JHLH 2A9NL 1HCFX 4M48H 4QO1A 5CJBA 1EMTL 4S0TD 2ADJA 4O02L 1W72A 3HC0B 4JHWH 5F6HJ 25C8L 1C5BL 1MFBL 4KUCF 2BFVL 4L8BB 5FO8B 1KCSH 2EXWC 3HAEA 3KLSA 4ZFOA 3ZKNC 4C56A 3L9RB 1T20A 1RZGA 2GTZA 4JO2L 2C3VA 3V8CA 3MMEA 5ISZA 1D5MA 1FP5A 4QHUB 2VE6A 3MLSL 2D9CA 2PNDA 4MDJA 2XZCL 2AK4E 2D7MA 1KUMA 2DQIL 4GAYA 4LOUC 3WLBB 5B38A 4ODSH 3HZKA 1N4XL 5T5NF 4CW1B 1FSKC 5C0CD 4CKVX 1G9EA 3H9ZA 4X4XA 4F9PA 4OF0A 1AR1D 3O45A 5C7XL 3CVHL 5T1DL 4U1LB 1T0MA 2BSRB 2DBLL 4L4VE 3QPXH 5F3HB 4M8QA 3E3QE 5EBLB 2F53D 4PJ7E 5EFIA 5D6CA 1S7RA 2A0LD 1AO7E 4NJAH 4LCUB 1NMCB 4HCRH 3T8XA 1IZJA 4JPWL 5L9DH 5D1ZC 2X4PA 1YQ2A 2ZUVA 4HMCA 2IPUK 4LF3B 3VI3E 1VFMA 1ZAGA 4LPYA 5TFSL 4JFFB 4Y16C 3JTTA 3ECBA 2VXTH 1K5NA 3BRFA 1BZQK 4LMQI 3MRPA 2MCPL 1DUZB 2HRLA 2V6HA 3QCVH 5JA8B 5CHNB 1NKOA 3ZDYF 3BZEA 4NQDA 1ZS8B 4LSDA 4TTDC 3V6OC 5EOTA 4WUUE 3FQWB 1BEYH 4U7MA 5HHXL 4ALAL 1EH9A 1Q0XL 3IDJB 2ITCB 3KNBA 3TA3C 3TNMA 4A6YH 1UKQA 1G6RL 1OT2A 2BJMH 3BPCB 3FFCD 3NH7H 4Z6AT 4HW6A 1H8OA 1P6AB 1FG2A 1G9NH 2FECL 4LIQL 1QHPA 1DLFL 1KEGL 2XTJE 4RFEA 1DZBA 3BKJL 1LP9B 5DMIL 2XFXB 4XVSL 3C8HA 4KKCD 3WNOA 4PJ9A 5GS0D 1FH5L 4JM2F 1AHWB 1BBJA 1SYSA 1PG7H 4P46D 2FBJH 5HHOB 3DI2B 3W82A 1T80A 1IC4H 4NCDA 2KUTA 4B7LA 1WCBB 4L9DA 4WI7A 2H26A 4O4YH 3TJEL 3DIFA 4HAGA 4X8XA 4GUPA 4JZJA 1NDGA 3I50H 4GW5B 3B9DA 1IILE 2R2BB 2JB5H 3U2SB 3HMXA 1TVHA 2B1HH 1RIUL 3G5VA 5E03A 4MGXA 3D0VA 1EUTA 1VADA 3EDJA 3QQ9D 1LNUB 4MX7A 3MJ7A 5BW7C 3O3BA 1I8IA 4TYUA 3TM6A 3FMGL 3MNVB 4PTTB 2PW2B 5JPMB 5CD3B 4NOBA 5F7YC 4GRWH 3QXWA 4S11A 1OWWA 2F53A 2IGFH 2KQMA 3SE4A 1VSCA 4WFHD 1ZHBA 4PJEA 1KLGA 5FUCE 3VCLA 3VFVB 4J7RA 5I19L 4KKNA 4M5YL 5JXEC 4LCYA 1GZQB 5BV7B 4F8TA 1YN7B 3JUZA 3BESR 4KRPB 3MXWL 5DYOA 2ITDB 3UJTL 3WV0A 4K7PY 3ARWA 1YEEH 2EZ0C 3KYAA 3N1GC 1CVRA 5GS0H 5HI3D 3RDTA 1CGSL 1JGLH 3GKZA 5ACMA 1TMCB 4MJ6A 1T1YB 1IQDA 2CR6A 4XCCL 4LBEA 5DRWB 1M4KA 3VXUD 3KYNA 3VG0L 3B8SA 2Z91B 2BC4B 1NUDA 3DOSA 1OSPL 4UAOC 4Y1AA 4UBDD 3LAFA 4GW1A 1FPTH 1YEFL 4K23H 3UC0H 2P5WE 2QSCL 1DBAH 3OG4B 2K3TA 5LAXA 2BY1A 3WUWB 3QUXD 1XF5A 1A7QH 3FKUS 3AMLA 1I8MA 1ZVHA 1A6VL 2OTWA 3FFCA 1F58L 3W0WB 5DTFA 3UROR 5SX5H 3LZFL 3PWVB 1FNFA 2V2XA 5D5ME 5HHMB 4JG0H 1W8OA 4KDWA 5IF0B 4WFEE 4JFEE 2VXUL 4LASL 3OKDB 1QBLH 5DVMA 1ETZB 1IT9H 1RMFH 2JLLA 1JGUL 1A6WL 1QNZH 1XAUA 3DBXB 4HLJA 4MQXD 4OFPA 4U33A 4M7LL 4MCZA 4NKMA 4CVZA 4P46A 2FX8H 3B9EA 1TZIB 1MCCA 2HFEA 4W6XB 2MQCA 5HHNA 2IH1B 4NNYA 1II4E 1FORL 5DJ6B 5BJTA 5EO1B 3J7HA 4EQ3A 2NPLX 4P99A 4PV8A 2PO6D 3GMMA 1PY9A 3AB0B 3C5ZD 4YNYB 3HUJF 1IJ9A 2IAMB 2LU4A 3MV01 3JWOH 3RIFK 1A3RH 1QEWA 2M1KA 5HHQA 5D7JD 5MEPA 5L2KE 2W9DL 3FB6B 4YR6B 4M5ZH 4KTDL 5JIHA 1DBML 2VN7A 5I8OH 1N3NB 3LN5A 3S36X 3FB5A 3MLYH 4QRRE 5E8PB 3CU7A 5I8KL 3D2UD 1D6EA 4QOKB 3MUGA 3BD3A 3WS6C 4NC2B 4JRXB 1YMHA 3ARVA 1QG3A 3DRTA 1AGFA 1EGJL 1UM6L 3BZFA 2VLRD 5J7CC 4MXQD 2BMKB 2DQUH 3KXFE 3MRNA 3TPKA 1OGAD 1UWXK 1NJ9A 3GJFB 5E8DH 5ANMB 2CDEA 5IHLB 3MYJB 2WM0A 4V1DD 1I9RL 1GPOH 3JZ7A 3IS0X 5BVPL 2EECA 4D0DA 3GMPA 1ZA6B 4FFWD 3RUGB 3BE1L 3ZYJA 3FT2A 3T4AB 3MA7B 1PX4A 1F8TH 2X1WL 4RWYH 3VXUA 3KWWB 4WHTB 3SKNA 1EJOH 3EYOB 4JFYB 3ILQD 3JV6B 5J57B 1A7OH 1P4BL 5JW5A 2QSQA 4QRQA 1NDMA 1YN6A 2CDGB 1A6PA 1YMMB 5FYJE 43CAA 1DN2A 4BYHA 4C55A 3H7BA 4HF5H 4U2YA 1GH7A 1GIGL 5GGTA 3OJMB 3TGXA 2HT4D 3QB7C 3UTTE 4YIQA 3VWKC 4NYLB 4XMLH 4L8SA 4HXBH 3EOBA 1G7PA 1R24B 3CPLB 3SJVB 3L6FB 4HDIB 1Y18B 1KCUL 1MVUA 4W4OA 5SWSE 3S7GA 1WAAF 1AQDB 4JQVA 1G7QB 1CD8A 5ILTH 5DUMH 2FB4L 8FABB 3T0EA 4XXDA 4N8VA 5C2UB 5TGBA 2B1AH 3GJFK 3PDOB 4Z7VB 4KVCH 5EUOB 3VRJB 3UMTA 4G6JH 3GM8A 5EZOL 4WFFD 1L0QA 1FZOA 5L6YH 1OTUC 4YHNA 1IMHC 3IGAA 2CLRA 2YKLH 5KSBE 2FIKA 3AB0C 1EX0A 3M1BB 1JBJA 3K3QA 5I1AA 1CDIA 5C0AE 1YYMH 1G7LB 2XWJA 3FO2A 4PRPA 3U30B 2X05A 2YXFA 2KQNA 4H20H 2BVPB 2PO6A 3OV6A 4LU5H 1XR8A 2A9ML 3QULB 4OJFH 5IB2B 2F5AL 3SCMC 4B7IA 5B21A 1WT5A 3RQ3A 5JMOC 3PGFH 1L7IL 4BH7A 3CFCL 4MA7H 1B4RA 3C60A 4KI5F 4L29A 5DSCA 4WIQA 1IAIH 5L8LB 4L3EA 3MNWB 3UTSD 4GW4B 5C0BA 4JPKH 2PXYC 4RGNB 3ES6A 1PJ9A 1U8PA 3P40A 4D0BB 2VLRA 2DQJL 2H1PL 4G42B 4X7EC 4XP9L 4U6HB 4XP6L 5IGXL 3CX5J 4IOFD 4F33B 3O8XB 5D70H 1SEQL 3DSNA 4QCIB 2EKSA 3A6CL 3BD4A 3TZVB 1UACL 5IVZB 2UYLA 2EIZB 1JP5A 1WFUA 1UJTA 3X3GH 3L5IA 5DUPH 3GHBH 3I9GL 1MF2H 5AWNL 5CILH 1GGCH 4GJTB 4WDIB 3NZ8B 5EUOF 3TT3L 4AIOA 2PTVA 2EXYC 3SHSA 2E7LA 1T04A 2VWEE 2ZUYA 1HILB 4LSVL 1CE6B 3RVXD 2V5TA 2BSTB 4WEBH 3C5SB 4Z5RA 2X4QB 3DV6A 4ZNEA 4XNUH 3TV3L 4YHYB 2NY7H 5F9OL 4HEPG 3EW3B 4NN5C 1JPST 4G9DB 1KTLB 3OJVC 3BI9X 4X6CE 5LG1A 3A0OA 5E08H 1JNHB 3W9EB 2M8XA 3QI9A 2FWOB 3GBMH 1GRWA 3MRIB 2NY1B 4I4WB 5E6YA 4YXHH 5I16B 3U30C 4HIIA 2YPLA 3D0LB 4WU5B 2GAZA 3I6KB 5T3XD 2NW2B 1QFUH 3W9DA 2SEBB 4MQ7A 4QHNA 4J3UA 1RZ7H 4K71B 5E5MB 5EUKA 5B8CB 1XH3A 1PVHA 4PP1C 3WFZA 3L5WB 3JV4A 3ALXA 2XG5A 1YJDH 1JFQH 5IM7A 4OD3L 1ZHLA 5TDNB 4OCYL 4NT6B 3FQUA 1A7PH 4JFZH 4YBLB 4PJHB 1QLRB 1T2JA 5TQ0L 4RGNC 3QG7H 3U0PA 3T2QA 1YC7A 1WC7A 2ED8A 2A1WH 2NY5H 3MXVL 4OZIB 3QUZC 5E8NA 1G0DA 4M00A 2NQCA 4HLZH 4UIMB 3TBTA 3UTSA 1A6AB 1XFPA 1EEYA 3QDGA 4YO0B 5KN5B 3I84A 3PWNA 1SBBA 4ZFGH 4GG6E 3U7WL 2GI7A 3L3DA 3O8XC 5DK0A 3HTLX 4NBZB 5IW6A 5LGKA 1KJ2H 5K9OA 4PJBB 4WFFE 3W81A 4M1GL 4OM1H 4LLVB 1BM3L 3TZVC 2XXMB 1ZLSH 3WFBH 4L4TD 4NOFA 1U42A 2R1WB 1YNLL 3MX0A 4XNMA 4Q6YA 3EO1B 5HVWA 5DJXB 7FABL 4CNIA 4TNVK 4YDIL 3LKPB 5KOMC 2VB5A 5ID0A 4TUJB 2OL3A 2YZ8A 2KZWA 4PJFF 3TNNA 5IG7A 4MA3A 3OBAA 5E2TL 1CG9A 3S5LG 3ZHDA 4RDQG 5D2LE 2NXZD 5F96H 4PJ7F 4OIIL 4TQEL 1XGTA 4EN3B 2DJ4A 2DDQL 1U8LA 2WBWB 5IVXB 3KG5A 3ZKXC 3VI3F 3TO2B 1FAIL 3MPCA 4X7SH 5H35A 3VWJD 3IFNH 2J8OA 1F6LL 2AV7A 4KMTH 5AG8A 2FO1A 4KZDH 1NFDE 5CJ8A 4K7FA 3RTQA 4GG8A 4X7FC 3L3IA 3QWOA 4KDVA 4UQ2B 1UVQA 4C59B 2E9JA 4PJIF 3BWAB 1MCRA 3ZHKA 2RGSA 2FJHB 1PYWA 3GEWB 5I1LA 4X9FA 4LVNB 4K7PL 5K9QI 4HFWA 4K71C 5C0JA 3MV7B 2NLJB 1EEZB 4HIXL 4NFDA 1MQKH 5DRNB 3LV3B 4JFHE 4R2GC 3F65A 3ZTJG 4MJ5B 1IGIH 3VRIA 1L6XA 1KB5L 3VU2A 4PJBF 2FYYB 1SYVA 1WZLA 4YBLC 5JHLH 2D31B 3OXSA 4QRPA 5EU3B 1O5DT 3L95A 5KVMC 1RJCA 3FRPG 4LMQE 2UZIH 4BFIB 3VG9B 2G2RB 4XCYB 4J3WA 5DJ8A 5E6IB 2FD6H 3WNNA 2FEEI 1P7KB 1QFWM 2PF6A 2ZCLH 1IGFL 1FFQA 2RJMA 4R0LC 3EYQD 2I07B 2P8PA 1SJVA 4JO1L 3ARDD 4G6FD 3UJJL 15C8L 5A2LH 1A1MA 1TPXC 3BIBX 1MCPL 1MRDL 1CDYA 2N7AA 5DFWH 4NGHH 4KFZC 2CJUH 4OV6F 1T03L 3JXAA 2WBJD 4K9EC 3SOBL 3OAZH 4LK4A 1N5AB 1FYHB 4UT6H 4X4ME 1X5GA 3H8NA 4KDTA 1IEAB 5B3NA 5GQBA 5KAQG 4PYGA 4JKKA 4FMFA 5JOPE 1CQKA 2C4FT 5E56A 1LILA 1AGDB 3INUL 3CU1A 5E6ZA 4M6OH 3VA6A 4HWNA 2EYTA 3CLFL 1C5CL 3FQRA 3OJ2C 4L4JA 3C09C 5HYSA 1DVFD 3GSRB 3CZFB 3QP3A 1AJ7H 1D5BA 1D9KA 1RZFH 2Z93B 3NIDE 3HZVB 1FLRH 4WGVB 3EYSL 3QEGH 1X5IA 3QWRD 2MJWA 4BSVA 5IMMB 5DA4A 5D72H 3QFJB 1U2CA 3MV8A 4UV4H 1AE6L 1HCVA 3QEQD 1K4CA 2GITA 3MLWL 1J8HE 4HUXB 4JN2A 4LVNC 4Q9BA 3WNKA 1BQLH 1IAOA 2CIKA 1U93A 2AK1L 2VO5A 4UT9H 3T65B 2YEZA 4QWWD 1HXYB 1I1RA 1P69B 5LXGH 4P2RD 4X6DB 3GUTB 3SKJL 4F7MA 5C9JB 1UCBH 5EG6C 5LQBH 1RU9L 1VEOA 3X14B 1MFAH 3WDHA 3VXOA 2CO6B 2Q6WB 5KZCD 3U82B 3VG9C 3BKMH 5HDBE 3FZUC 3O81A 4Y7MA 5D5MF 1P4IH 3MV9B 1E4WL 2B2XL 4JFDD 3U9PL 2C26A 5A43C 4F58H 5KSAD 5DJ2B 3DVNA 3QDMD 2PCPB 2QV2A 1KLUB 4PJ8D 3H9SE 4XWOC 1T89C 1GGBL 3ARBB 3I85A 5KS9B 1H15B 3RWIA 5D93C 1IBGH 5JLZA 1HHIA 1AIFB 5E7BA 4UILL 3TT1H 3SGJC 2FATH 1DFBL 4R96A 4X8JB 4ZXBB 4EEEA 4NKOB 3GJEB 4Y5YA 2OJZL 3ARDA 3SE3A 2XI9A 4LSRL 4G8FB 1HQ4B 2XT1B 3GIVA 2OMBA 1PLGH 3EFFB 2EO1A 1GJIA 4GAGH 4PBWD 1PX3A 1YQVH 5LGJA 1MCWW 2DMKA 1BQHB 1Q0YL 2BHYA 5D7LE 3DWTA 4HXAH 4XP4H 4F57L 3PF2A 4BUHA 4ZOCA 1BJMA 4WUKL 2EC9U 4XVUC 3WNLA 2YOCA 2CRYA 3C2AH 2CR3A 4MAYD 5I17B 3F12B 2CLVB 3WJJA 4F3FB 1FFPA 1IGMH 1HZHL 3KPNB 3MSPA 1DVFA 3ROOA 2DOCA 5TPWH 1KXQE 3HE7D 5IWLA 1XF2A 2WANA 3OKEB 4WGWB 1UWGL 3S96B 4S0SD 2C1OA 5GGRY 2I5YH 1S7UA 4NQCB 2BRRL 3L3OB 4DN3L 4HJGA 3T3PE 5JO5A 3TN0C 5DJ0A 3V8OA 4HLZG 2DQHH 4YWGL 4GAFB 12E8H 2ZZUT 5JW3L 4H1LA 1S8DB 1KV3A 4LRNH 3BIKB 3EYVB 1JNNH 3S4SA 2NTSP 4P57A 4JO4L 4NRZA 5E1HB 2YA0A 4MB5A 1QBBA 1F90H 4YQXH 5CS7A 1HHKA 4E42B 3QEUB 2E27L 4OZGF 5CIPB 5IIEB 4EDXB 4P5MB 4P2RA 1T21A 1G7JB 2AXGB 4JFXB 4XAWL 5CBEB 4YBQD 1EEQA 2R0WH 2DQDH 3QNXA 2BOBB 4ZAKB 5FV2A 3D25B 3VXPA 1RUQL 1A5FL 4AJ0A 3VD5A 3U4BH 5I74C 4DZ8A 1CTNA 1GC1L 3MLVL 3KAAA 3NN8A 2R9HD 3FO1B 3KR3L 2R4SH 3O6FB 4JFDA 4ONHA 2OJEB 5A2FA 5C0DB 4JDVB 2ADFL 5DD6A 2AJ3B 2EDEA 5DZLA 5KSAA 4Z18A 3QDMA 2OTUB 4HC1A 3IKCB 3CK0L 2FHBA 5D1QB 1F4WL 1FN4B 5J89A 4J12A 4PRAA 5EC2B 5T1MA 4CMMA 4FQCH 5AYUH 4WENB 3C5JB 1E28B 3HI5H 3EO9H 5KSBF 1I8KA 2FO4B 4I48A 5T33L 1CIDA 5KANI 4PG9A 3WKMH 3GBLA 1Z2KA 2HKHH 2JE8A 4LLYA 4U6YA 5IFHL 2C7UB 5GGVH 2W9EH 1JTPA 1QFOA 4TUKL 4XC3H 5AUMB 3O3UN 3U7YL 4Y4FD 2IF7A 3RZCD 5FXCH 3HCVB 3NABL 4OD2B 3MCKA 3W5NA 3ZKMC 5F7WC 5IEHA 4KQ4L 5SWZD 1DBKH 1BBDH 1MREH 2VDQH 4POYA 1N7MH 2VDLH 3VGHA 2HJKA 4D0CB 1U3HD 4QY8A 5F97E 1HK6A 2A77L 1ZHKA 4BZ1L 3ZYOA 3D9AL 5T3ZE 1N59A 3HI6H 2A83A 4NQXB 2VITB 4Q7DA 4Y4HC 1T2QH 4FQIH 3K80A 3SGDI 2BNQA 2AEWA 2B5IB 4HZAA 3DUHA 1KPUB 3TBWA 2XTLA 1DDHB 1DQLL 2VDKL 2VIRB 4PJ5D 2Z4QA 4I0PD 4NQEB 1A4KA 1ZGLP 2H32H 2QQLL 5I30H 1D5ZB 2X70B 3ULSB 5I1CH 4ZAKC 1U95A 3FT3A 3PWUB 4O2FB 4JY6A 4AL8L 1UKTA 2OM5A 3MRFB 1FQ9C 3S37L 1WZ1L 4PR5A 2RCSH 4DAGL 2XOTA 2ZSWB 3AREB 3QEHA 3UTPD 2MHAB 2NY0D 4PB0H 1HNFA 3CDGB 2OR9L 1UXSB 3FQTB 4G6AC 4FP8L 3HG1B 3DSFL 2ZOKB 1PG7W 1UCTA 1I7ZB 2KKQA 5DMJB 1OLZA 2Y5TB 1OAYL 4PIRF 1G9MH 5BVJB 4J8RB 5D1QC 4X6CF 2NW3A 2Y7QA 3T08A 4UNTA 4Z78B 1OVZA 3LPFA 2B39A 5KVFH 4KTEH 3L3GB 2WSKA 1A7RL 3VFUA 2CKBH 4JKPL 5HPMA 1EBAA 4W70A 3LKQB 4S1RL 5ELIA 2H32A 1N6QL 1FZJB 2DQTL 1A9BA 3ISWA 5I73C 5D96C 1EFXD 5DK3A 1FGVH 2GCYB 5CD5C 2R2CA 1U8KB 2V9QA 3BUTA 3IFPB 3VI4E 4L3CA 4DVBB 1W8NA 4MNHB 2ATPB 5HYQA 1O0VA 3VFWA 4QNPE 1H3TA 3BSZL 3DX6B 4F7PB 4HFUH 3HMWH 5I15H 4HKJB 3ALPA 1S9VB 1I85C 4QTIH 4X83A 4Y4KD 4C4KT 1AGCB 2NXYD 4Y4FA 4H88L 3K81A 3P11L 3RZCA 1ZSDA 2HVKB 3CFEA 3MRJA 4K3DH 3ZE1F 4FABH 4ZD3H 3F58L 1JZ8A 3KJ6H 3TWCL 1X3DA 4HSQA 3QXTA 5FECB 2P7TB 5IESH 2B5IC 2A2QT 1CDGA 3CNKA 1IKNA 1ORSA 1PD6A 3LRGA 3PQYB 2R2EA 2J4WL 3DJ9A 3K7UA 4Y5VC 5D7IA 5DDHA 2G5BB 2VN4A 1FYTD 2CKBA 1KIPB 1NL0L 1IEHA 1ES0B 1P6FA 1T6WA 3NTCL 4UZGA 3VFPB 3KPMA 2X4RA 1FIGL 1UYWH 2RFXA 3T2NH 4OZHB 1KULA 3QUYA 2HVJA 1WBYA 2CK2A 3HLAA 5D6DA 4I0PA 5JOFA 1U8NA 3K8KA 1MUJA 3AREC 5JTWA 1U9KA 3DHJA 4LEXH 5FGCB 3GSOA 4Q6IA 1N8ZA 3OR6A 1ZANH 2GJ6B 2PTUA 1IM9B 4PGJA 4M7JL 4OQTA 3S6CA 1OAQH 4HUWB 3OPZH 4JRYD 2KBGA 4G6KH 4POZD 4U1HA 2VLLA 3MRHA 3P0YH 2CH8A 1YEGH 1NFDF 5IT2H 1J0ZA 1D7FA 3NCCB 1EHXA 1ZA3A 3P9WB 1Q9LB 5JPNA 1JVKA 4PJ5E 4MNGE 3FOMB 5IB1B 1CFTA 3CC5B 3SKUD 3V52L 3P4OA 4Z7WA 4PRBA 3BH8A 3NPSB 4H0GA 4DKFH 4PJXA 5C3TA 2RBLA 1FO0H 6FABL 3CLEH 3LIZL 3ZTNL 2W0KA 1FRGH 4N9GB 1QPXA 1EFXA 1UADC 4NZUH 4ACPA 2ERJB 4NPYB 5HYJD 3M45A 1J1XH 2IPKB 4JPIA 3O3DB 2Z31B 4ONFH 1J0YA 2AKRA 4Z7UF 4JKWA 4Y16A 3T4YA 5FF6A 3WNMA 4KKBD 1OF2A 1SY6H 5EU5A 1QR4A 2Z35A 5DURB 4P2CG 2VDPH 1PZ5A 3BXNA 4NM4H 4C56E 4MDIB 5MEOB 3Q1SH 1WJ3A 4HS8L 2IQAB 1D6VH 3RKDD 1XGQA 5EZIL 1I9JH 3BOVA 1OCWH 2WK2A 1AY1H 3DVFA 1R3LB 1A7BA 4ZSOE 2D0HA 2GSIB 2APWA 1NMAL 1Y6KR 3G5XA 1N5YL 5DJAB 2C1PB 4GQ9H 3FTGB 4H0HB 4IJ3B 1RAMA 4GS7B 3Q5OA 3FOLA 1IE5A 1FYTA 4AG4L 1P1ZB 2GJJA 4U1MB 3G6DH 3QBTB 2NY3D 5I1JH 1NCUA 1B2WL 3OL2A 5HTSA 1BAFH 1ZEAH 2Z92B 1DANU 2Q8AL 2BERA 5K59E 5F1NB 3UO1L 1ACYL 4GMSL 3SDDB 2DQFB 1BJ1J 2W1NA 5LJYH 2Y72A 2WLYA 4PV9A 4RMWA 5L7XH 1RJZB 2VC2H 3HC0A 1MJUH 4FZ8H 2ARJB 3BUYA 4L8BA 2AJSL 1I1FB 4LSQL 2WZPD 1VERA 3TLRA 2BVOA 1XF4B 3L9RA 5HGGS 5F7UA 4IRSC 4MD0B 3QJFB 4E41E 4QHUA 1CF8H 3H9HB 3BYYA 1LO3H 3WLBA 1SBSH 2UWEF 3MRBB 4OLXL 3MLUH 4CW1A 5DO2D 4OLVL 4JRYA 3T77B 2NX5D 2DICA 3QFDB 4M7LT 5EU6B 4U1LA 4X98B 3GGWA 4NC1C 5FUZH 5F3HA 5MERB 1T66D 4XVJL 4X9HA 5EBLA 3ARXA 3ULUL 5BW7A 2O5XL 4OCXH 1RZKH 2HWZH 4OGXH 1KJ3H 1Z9OA 1S7VB 2IFFL 3MRKB 2XKSA 5DLML 3V5KB 4KRPD 4LF3A 3WKNA 3EDDA 5E7FA 1NCNA 4S1QH 4P9HL 4JFFA 5FCSH 5FDWB 5IMKA 4HJ0D 2R4RL 5JXEA 1RI8A 1DUZA 5HDBF 5HYJA 5CHNA 4XTRC 3WFCL 1RJYB 4YDKL 1UM4H 3RWCB 3ZLQC 2JF1A 1DLHB 5J3HD 2MCG1 3QZWG 4HBCH 3FQWA 1MWAB 4LSSL 4QKXB 1AQKH 4OKVA 1QVOB 5CP3H 4GS7C 1B0GB 1NCWH 2ITCA 2JELH 1PG7X 2VOTA 1F5WA 1UC6A 2BSSB 3C6LD 4MJIE 4DKEL 2X1PA 1B4JH 5DD1H 3VGBA 3BPCA 1UFUA 1MPAH 3T0AA 3BRGC 4XNXL 1IC7L 2XRAL 5AZ2H 4OSUH 5HHMD 3SDDC 2X4NB 2IH3A 3S34H 1ACZA 3H42L 2GK2A 3LQAH 3JVGC 1MAMH 3RWFB 3D48R 1LP9A 4FTVE 3R06B 5B39B 2Z8VC 1AHWA 4UV7L 4Y19B 1EA9C 1HWHB 5D1XB 4J4PC 4XCEB 3QA3B 1A1OB 2J6EH 1VPOH 1NSNL 4L3AA 3BZDA 4LLUB 3N85H 2DAVA 4JAMB 4MQTB 2R2BA 5CP3A 5JUEH 3HKFA 3T3PF 2IAMD 4LCIL 1U58A 4ZDHB 4Y1AE 2YPVH 1VFBB 1LE5A 5ETUA 1KGCD 1XGRB 4LLQB 2H6PB 4B41A 2NX5A 1LWRA 3VFGH 3BDYL 4FQJL 3GMLB 4PTTA 1FIEA 2PW2A 5JPMA 5FUOH 2Q7YA 4JRXD 1WFNA 4Q2ZB 5CD3A 5B38G 3VFVA 5JIKA 4G80B 2FH6A 1GZQA 2P8LA 1QQDA 3G6JB 4G8GD 4QXUH 1NANH 1YN7A 1T2XA 2DLTA 3UYPA 3WS6A 3E8UL 2ITDA 3FQNB 4KXZI 2EDJA 2H45A 4DGVL 2WINB 3ZKQD 2YD4A 1SHMA 3AU1B 4YX2H 1S78D 2D3VA 5IBUG 3K4AA 1IKFL 1XZ0B 1RZJL 4CDHA 1T1YA 1TCRA 1BQUA 4OFIA 1LO2L 4XP1L 2Z91A 2BC4A 1P84J 4NO0B 1W0YT 2QKIB 5AEAA 4KJPC 2AJXH 2Q86B 5L0QB 2A6DB 3ETBF 4OF7A 4I77L 3WXVL 3KYKL 1H0DA 2X1QA 1HWGB 2HKFL 5F7EL 3WUWA 3X12B 3QHZH 3C6LA 4R26L 3UAJC 5DI8B 4XMPL 3RVTD 3WHE1 4PJGE 3W0WA 4XCFL 2D7OA 3IAGC 3OAYK 5D2NB 1I9IH 5SV3A 4DWHA 2VERN 5TE4H 1GHFH 5D1XC 3U36B 5IBTL 2DIAA 3VFTB 3ULUF 3SDXB 2CQVA 3MYZA 1BD2B 1ETZA 4R6UA 1INDH 5EBGA 4GRMB 4XBEH 3DBXA 3V4UH 2F19L 1E4XI 1X6NA 5C6TL 4FRWA 5M7QA 1TZIA 1E0OB 1LEIB 3HPLB 4LLDA 4UIKH 1OARL 1MCHA 1VHPA 2IH1A 2BNRB 3NFSL 5FYKD 1Q72H 4IDJL 5DJ6A 5E00B 2BRQA 4W6YB 1MY7A 2FNBA 4P4RB 4EI5B 3ULUC 4P49A 3V4PL 1OW0A 4YNYA 5IW3A 5C0RH 2IAMA 3OQ3B 4MCYB 1BF8A 1BGXL 3STZB 4P9HC 3P77B 4YR6A 3M8OL 1YUHA 2J8UF 1N3NA 5E8PA 4EZMA 5FM5M 5CWSB 3VH8A 1E6OL 4TSAL 4G7VL 4PJDB 3NFNB 1CD0A 1XEDA 5DK2B 4JRXA 2EDKA 4X6EA 1YA5A 2X4SB 3HA0A 2OZ4H 1YNKL 3HC3H 4I0KA 4OFYD 1S7TB 4Z0BL 4ZFOL 2BMKA 4U1SB 2YK1H 1TJGL 3GJFA 3LB6D 2APXA 3LMJL 3T0EE 1CT8A 4WHYH 1YYLH 1NAKL 3MYJA 5DHVH 4LL9A 4N0RA 4QT5B 1PDKA 1Z3GL 1CCZA 3BHBB 4FQLH 4QLRA 1HIMH 1ZA6A 4RISL 4O51B 3RUGA 4XI5C 3T4AA 2Z8RA 3MA7A 1H5BB 4GLRI 1A3LL 3KWWA 3LPGA 4WHTA 3BGFB 3EYOA 5KW9L 5FYKH 4JO3L 4TUOA 1A0QH 4IM8A 5EU7E 4KZEL 5C08B 5HYFA 4P9MH 3LEVL 2IQ9L 2WUCL 3OTTA 3LDBB 1SJEB 2YBRB 3RX8A 4JHWL 4NYLA 5JDSB 2FEEL 3VI4F 3GZKA 2OZ4A 1R24A 4KV5F 1KCSL 5CGTA 2YA2A 3SJVA 3L6FA 4HDIA 1Y18A 4YHZH 5GXBB 1FCCA 1AQDA 2DD8H 1U8OB 1GZPB 1G7QA 4L3EE 4N1EA 3G5YB 8FABA 3OHXB 3PWPE 1X5AA 3KDMB 5JHDB 4EBQH 5E95B 3U1SH 4QTHB 4Z7VA 3ZL4H 2NY1D 5CLWA 1V5JA 3VRJA 3UCRA 3RL2B 2A6IA 4ODSL 2AK4B 5CGMA 4EI5C 5CEZD 2GT9B 2YC1B 2MTPA 5A40E 1G7LA 5C1MB 1WUNT 4U1NB 5EN2B 3OKMA 5IOPB 3QPXL 2BVPA 2DM4A 3FL7A 3QULA 2E3VA 3UEZA 5IB2A 1M71A 4NJAL 3D85B 1AO7B 5LCVL 3T04D 3UTQA 5L9DL 3HC4H 1BP3B 2GTWB 1FC2D 1LGVA 3L7EB 2FSEB 4B0MM 1JGDB 1Z6JT 3E6FA 1OP9A 1MH5B 4RRPG 35C8L 2VAAB 3LY6A 2E6PA 1UZ6E 1RZGB 1RZJC 5D8JH 1A4JA 3MNWA 4OCLC 4GW4A 1LK3H 1E4KA 5ISZB 2JJTC 1D5MB 1ZTXH 1DL7H 2M26A 1MJ7L 3TC9A 5D7KE 2CGRH 4D0BA 1RULL 1BEYL 4WUUB 3RJQB 2F15A 4U6HA 2FX9L 3KPSB 1CE1H 3HMXL 3KJ4C 4P3DB 1H5BC 5FYKE 3EBAA 4A6YL 3F6LA 3SKOA 3ZT6A 2EDOA 4F33A 1T0MB 3QIBB 3I6LD 4M8QB 4QCIA 2BJML 2V5MA 1RURH 3NH7L 1MEXH 3TZVA 2YPLE 2QHRL 5EFIB 5IVZA 5CEZH 4DW2H 1CGVA 4U6XA 4WDIA 4LCWD 3NZ8A 3NAAH 2X4PB 5F8QC 2ZUQC 4KJWD 2B4CL 4LLAA 5DD0H 1S7XB 1CE6A 5IMOB 1GGUA 4OIAA 5CZVH 4JQIH 2Y4SA 2X7LB 5A2KH 3C5SA 2CPCA 4KK8D 2FBJL 4WI2A 3B5HA 2X4QA 3QHFL 1XT5A 1KELL 2APBA 2VDOH 3AGVA 2D4DA 4APQD 1QFWH 4M3KB 4DCQB 4RFNB 4XMKH 4G9DA 1KTLA 4O4YL 2DS4A 4LVHB 2FRGP 2XV6B 5IB5B 3TPUB 2FZ3B 3TNMB 3D1MC 2XA8H 2JB5L 5KVDH 3MRIA 4IS6B 3SDAB 1MCWM 1RQ5A 4I4WA 5I16A 3VDCA 3D0LA 4WU5A 1UM5H 3I6KA 2NW2A 1RZIB 3S9DB 4NJ9L 2SEBA 3TP4A 2UY6A 4W4NA 1EJ6A 1C5DB 5E5MA 1TTFA 3IDUA 3EOTH 3KPTA 5B8CA 5C6PB 5KVGH 5T1KB 4BKLB 2ICES 3O6MH 2WWKT 1SYSB 5TDNA 3V5HB 3A6OA 4HMEA 4RFOH 1O7VA 1RUAL 4NT6A 3O2VH 1K6QL 5E6ID 2RHEA 4YHOL 4PJAB 2AEQH 1QLRA 3K2UH 5HI4D 1DQDL 4U1KB 4PREB 5GRWA 1MHEB 3PHOB 5GS0L 4OZIA 3DIFB 1JGLL 4GUPB 4JZJB 1VGKA 5MP6H 1Q9KA 3BH9B 3B3IB 1A6AA 5KN5A 2BVYA 4A6YB 4F9PC 1QFHA 2OXHA 2W0LA 1H3PH 1KTDB 3QIBC 1VADB 4G9FE 4MA8H 4XPTH 2XN9E 1FPTL 1LO5B 5C0CB 5A2IH 5CEZE 3QXVA 3LH2H 2HLFC 1NGYB 1YPZA 2R1WA 3RI5F 2P45B 1RFDH 3EO1A 3Q5TA 5DJXA 3RNQB 1A7QL 4QXWA 3RIAF 3VFMB 3LKPA 4Q9QH 2F53B 1KFAH 4TUJA 1BIIB 1GAFH 1KLGB 5E24E 1LDPH 4N8CH 5EWIH 4YGVA 4LCWA 4LAJH 5GRVL 1MFCL 5E2WH 4JFEB 5I9QB 2QL1A 2HLAA 4FXKB 2LV4A 4S1DD 5IEKB 4QRPE 4EN3A 1IT9L 1F02I 2WP3O 5IVXA 1RMFL 1SMAA 1OPGL 5C0EB 2FX8L 3PHQB 3QFJD 1IQDB 4LBEB 2E5EA 3FN3A 2F54E 5DF0A 3G9VA 3SDAC 1NEZG 2HRPH 5E70A 2X4UA 1RUMH 2DYPD 3GSNH 1J10A 3CXHJ 2DMBA 1YEJH 4UQ2A 4DGIL 3BWAA 2FJHA 3VXSE 2VSCA 1U8QB 1XF5B 1I8MB 3I6LE 1T83C 2BVTA 2OTWB 3MV7A 2NLJA 1EEZA 4WHCA 4X0KA 4L8CB 1GSMA 1J5OH 2OI9C 2CMRH 5DRNA 3D6GA 3LV3A 5I8OL 3CXDL 5GGTL 3MLYL 4NUJA 3WFDL 1T4KB 2BSED 2WW8A 1JPSH 3FQXB 2XQYK 2FYYA 2CIIB 4X7CC 4H8WL 2D31A 3SGEH 5EU3A 1JWSA 2JJUA 1T5XB 4HPOL 5FYLE 4TNWF 4MCZB 4J3VA 1IM3B 9CGTA 4BFIA 4TSCL 2G2RA 3BW9A 1HI6B 4JZJC 5IFAH 5E8DL 5E6IA 1P7KA 4HWEH 3V6BR 2XKUA 4PJEF 5HDQH 1WEJH 3CMOH 1GPOL 2I07A 3UBXB 1CLCA 3CSPA 4NCC1 5ACLA 3TJHD 3MV8E 4XAKE 1JZ2A 1G9NC 1NGQH 4EUPH 1AR1C 5DJZB 4RWYL 5TDPB 1EJOL 4CVUA 1WWAX 3QQ4A 1QEWB 2W9LA 1A7OL 4OCMC 1JNLH 1FFRA 4FFZH 1I3GH 3SO3B 2LAAA 1N5AA 3KPOB 4HGMA 5MENE 2HTLD 3LN5B 4K94H 1T7YA 1A7NH 2A0LC 3DGGA 4ODHL 1IEAA 3WUZA 3GFUA 4HF5L 1UH3A 2OLDA 4PD4J 1TQBB 3MUGB 1RV6X 2IMNA 4MQSB 2VR5A 5FA3B 4AMKL 5J12B 4LGRB 1FCGA 2A6KA 2WV3A 4HXBL 3KHQA 4JFOB 3CZFA 5H37H 3HNVH 3AY4C 1JK8B 5ILTL 3U46A 1R6VA 5DUML 1CLZH 4GRWF 2CDEB 3IXTB 3KYOB 5ESAB 1X44A 2B1AL 5EBWB 3S36H 4KVCL 1WIPA 4Z76B 4D0DB 4G6JL 3B2UD 4HT1H 2VDRH 1I1AD 3QFJA 4K2UH 3LKSB 1S9KC 3UZQA 3VXUB 5L6YL 1JGEB 4EUPA 3MLZL 4HUXA 4X4ZA 4DOHB 5EH1A 3WDJA 3T65A 1YYML 3HS0A 3SY0B 3CDFA 2DYPA 1NDMB 1YN6B 1MHPH 3FFDA 3H7BB 4NC0B 3GI9L 1N2RB 4LU5L 5SX5K 3KPRD 4OJFL 5JR1H 3QUXB 4PBVC 4PRNB 4YIQB 4X6DA 3GUTA 2PYFB 5C9JA 4LPCA 1GOFA 4N0YL 3PGFL 5TE6L 3X14A 1G7PB 4KKCC 1ITBB 3QDJD 4MA7L 5GS1B 5GS0C 2Q6WA 1IAIL 4P46C 3DETD 2VZVA 1QRNE 1FHGA 5F9WB 3GSXB 2CD0A 1MOEA 2DLIA 2EH7H 5K9KB 1NLBH 4XXDB 4JPKL 3MV9A 3RGVD 1MI5E 4NKIH 3FHQA 1KN2H 1T7XA 1MLCA 4H25A 3Q6GH 5F7LB 1P5VA 3GK8L 1AI1L 3KVQA 5DJ2A 1ZLUH 5J9PB 2PCPA 1MCSA 1KLUA 1FZOB 3O9WD 3SDCB 4YHNB 3ARBA 2CLRB 5KS9A 1FVCB 1H15A 4NDMB 4IRJD 1AIFA 5F6HI 4DVRL 5FHAL 5EOCL 2JCCE 4X8JA 4ZXBA 3GJEA 4V2BA 4WI4A 1VCAA 3QQ9C 4G8FA 4LQ1A 4OLZL 1HQ4A 1F4HA 1MFEH 1U8JB 1UXWB 3EFFA 3C5ZB 4NIKB 1GGCL 5C92A 4ZQKB 4Y89A 5DVNA 3NGBB 1BQHA 5F7DB 2O93L 3DHMA 5KVEL 2CUIA 5D7JB 5F1OB 5J12C 4JZOA 2XY1A 3PXHA 2CXGA 2EDLA 3D2UB 3WCYA 1R0AL 3WS3B 3RJDA 3U0WH 1N64L 1NGXA 4XNUL 5I17A 3F12A 2NY7L 1OAUH 3ES6B 3FCTB 2CLVA 4IOIB 4RMQA 1U8PB 2ICEB 4F3FA 1F4XH 1LVEA 4OD1H 5HI3C 3KPNA 4PGDB 5FHBH 5HGBB 5IUSA 3BPNB 1FLTX 5FKAA 1OGAB 4PGCA 1DP0A 4M1DH 3S96A 2PW1B 4NRXB 4ZUSB 4NQCA 4V1DB 3L3OA 3CZJA 3JWOC 4OCRL 5JORB 4P3CH 4UBDC 4YXHL 1CL7I 3WD5H 1FL6B 4JDZA 2UYLB 4OGAD 4MLSA 4R3SB 3QUXC 1S8DA 2EYSB 4LP5A 2OMNA 1A02N 5KTEH 1RZ7L 3BIKA 3EYVA 2OCFD 2PYED 1BZ9B 4H8WC 4HPYH 4F7TB 4P2QE 3EO0B 4KRLB 4HIEB 4JG1L 5GS1C 3OKKA 4ORZC 2OL3L 4E42A 3QEUA 4W4OC 4MVBD 5GSRA 4JQVC 1P9MA 3DUUB 5CIPA 5IIEA 5DXWA 4P5MA 4P59H 1M7DB 1G7JA 2AXGA 4JFXA 5F9WC 3CCHA 5ITFB 4JFZL 2R56H 5C07D 4DUXA 4M02A 4JY5L 3DTXB 4ZAKA 2BOBA 3HG1D 1BFSA 1SM3H 3GBNL 2NY5L 4LPUA 5DMKA 5E9DD 4WTZG 3B5TA 4N68A 3O6FA 3FO1A 3MLPA 2PETA 3ZHLA 3ZDXE 4ZFGL 2MOVA 5C0DA 4JDVA 4GG6B 1KJ2L 2R29L 2AJ3A 4OM1L 1AFVH 2OTUA 2PO6C 2GAZB 1ZLSL 3IKCA 3RVVD 1MCEA 3WFBL 4XRCB 3DMMD 3W9DB 1KT2B 2Q7NA 4QHNB 5D1QA 3C5ZC 1FN4A 4IRJA 4JY4B 5DWUH 5EC2A 5EUKB 4KUZH 2BNQE 4OAWB 3JV4B 1WFTA 1BF2A 3C5JA 5D7JC 1E28A 1Q1JL 1ZHLB 2XZZA 2QQNH 2FO4A 5T3XL 2EIDA 5B4MD 3VDBA 4KUCD 2DLFL 3F7VA 5IKCA 5J13B 3ZE2F 2V9TA 3MACH 4NO3A 5D2LB 2C7UA 3G5ZB 5AUMA 4C57C 4P5TD 4MXQC 4YC2B 1RIVH 1VGEH 1YECL 5ERWB 3HCVA 1YY9D 4OD2A 3TBTB 3UTSB 1JPTH 1L4IA 3JWNC 4NZDA 4X7SL 2P24A 4BQCA 1UZ6F 3H3BC 4KMTL 4D0CA 2IBBA 4HEME 4KZDL 4M7KH 4OV5B 4EI6A 1TTGA 4FFWC 1CR9H 4KK6D 2W91A 1B0WA 4NQXA 3U4EB 3ILQC 2E7LC 1H3GA 1DQML 2AGJL 1KPUA 4XB8A 4D94A 1DDHA 1MQKL 4F7CA 4XPGH 2VIRA 1UB5A 2HT4C 1CG9B 4JFQB 6CGTA 3IU4H 1IGIL 2C3HA 2OSLB 4TVPE 1XGTB 1D5ZA 5JHLL 1PBYA 2X70A 3GMQA 3ULSA 4Q0XH 5L88L 5I1HH 1EUUA 4MYWB 1W2KT 5DMGD 3K8LA 2EDQA 2IWGA 3MRFA 3V4VH 5EORH 4I3SL 3AREA 4X9BA 2MHAA 1T5WB 5H35B 3BIAX 3O6LH 1HINH 2VR9A 4CN1A 5BS0D 3CDGA 3K1KC 1UXSA 3FQTA 5F7KC 3TBSB 1KJ2B 3HG1A 2ZOKA 4XNYH 4GG8B 3QWOB 1I7ZA 1UVQB 3ULVE 2Y5TA 1PYWB 1FV1B 2HN7A 5EIQA 4EJ1C 1TJIH 2E7HA 4J8RA 4HFWB 2APVA 5D9SB 5F71A 2CJUL 5DZNA 3CVIL 1SMOA 2FEDC 2R1YB 3QO1B 5C09E 4UT6L 4R90H 2AEPH 5C70A 3JWDH 1CFVH 3VRIB 2PYEE 5J13C 3LKQA 1JRHI 2EO9A 4HAFA 4JM2D 1SYVB 3WIFB 4GKZB 3OXSB 4X7DC 5DEFA 2GCYA 4M6OL 4N1CA 4XBGB 1U8KA 4WNQB 2Y23A 4LSUH 4DVBA 4MNHA 2ATPA 4YC2C 4PRHE 1V7MH 2H41A 2Z31D 5C07E 5DJ8B 2HMID 4E9LA 1RZFL 2DN7A 4F7PA 5CMAB 3QG6B 2OP4H 4HKJA 3GO1H 1S9VA 3QT2A 3QEGL 1T6VN 2EICA 3H6JA 4OKDA 5D72L 4P5TA 3BP7B 4XC1L 2HVKA 3P73B 1R3JB 2ZG1A 3TIEA 5IFJB 1LO0H 4IOFC 1TQCB 1IQWH 5FECA 1WICA 4O58H 4UT9L 1JHTB 4UT7L 1KCVH 3PQYA 4L4TB 3GMRB 1L6ZA 2PN5A 1R3IL 1G0YR 1PKQA 1OOAA 1ES0A 3VFPA 5LXGL 2VLMD 4LNVA 2F58H 5ITBL 5LQBL 2DKMA 4J3XA 4OZHA 2XWTA 2V7NA 4QRTB 3RVXC 2NY5C 5HYSB 2X1OA 1JF5A 3MBXH 4PLNC 2NXZB 4ZOBA 1FBIH 3WEXB