2BMKB

Fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
223
Chain Sequence
EVKLQESGGGLVQPGHSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGLIRNKANGYTKEYSASVKGRFTISRDNSQSILYLQMNALRAEDSATYYCVRDKGSYGNYEAWFAYWGQGTTVTVSSAKTTPPSVYPLAPGSQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT OF CATALYTIC ANTIBODY 15A9, LIGHT CHAIN
publication title Structural basis for D-amino acid transamination by the pyridoxal 5'-phosphate-dependent catalytic antibody 15A9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 223
sequence length 225
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bmkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bmkB01
2XKSA 5GGQH 4G6FB 1TQBC 2Z8VC 1S3KH 3ARWA 3LOWA 5KVGH 3ALPA 1FO0B 2EDJA 4LSVH 1U91B 3UBXB 2IH1A 1KCVH 3UTSA 4A6YA 1KLGA 1MRFH 5DA0B 5EOQL 1J8HD 1A1NB 2AKRA 4ZUUA 2Y1VA 4F2MA 1UXSB 1X5GA 1J8HB 3GMQA 1TJHL 3KJ4B 1RJLA 3P4MA 4NN7C 5J12C 4FQQB 1ZLWK 1GVIA 4GKSB 4ZTPL 3ZKXB 1WBYA 3JSSA 5T3ZH 5F44A 4R97C 2BCKB 4ONHB 5AZEH 1SVCP 4R7DA 3BX7C 1MCLA 1OM3L 4KXZH 3D85A 1M05A 1KJVA 3IFNH 4RRPA 2ZG1A 4AEIL 4JDZA 4DEPC 2G2RB 5GHWH 4HPOH 1G6RB 4XPFH 1PY4A 2N56A 3FHAA 4W6XB 5EOTA 4DFHA 4JM2B 4AIOA 3ZTJH 3QYCA 5FFLA 4MJ5A 4UMGA 3EYFA 1RK1A 3MRQA 2OX5A 4QTHA 1JPSH 3QUYC 3KWWA 4I3RL 3FFCD 3T3PF 3NTCH 2ADFH 3HCVA 5SX4H 3JV6A 3L3KB 4XI5C 2IWGA 2C1PB 2P1YA 1CLOL 4HKZB 4YX2H 1T2QH 1WBXB 1EO8H 4MGXA 4HC1H 4RNRA 5FO7A 5CUSH 3C09B 4OM1H 5C6TL 1GPOL 4JQXA 5F88B 2O26U 4L9LA 2DQHL 3I02B 5EBLB 3E8UL 5D1QA 4LVEA 3BZFA 4OFYA 2EDFA 1FZMB 4HWZA 5GGSB 3VXMB 4EUPH 3NZ8A 5HGDA 5D6DC 4WDIA 2ADGA 3U6RB 3FO0H 1P4BL 3RY6C 3UYOD 4S11A 1KPRA 3D39A 4OGAD 4TUOB 5L8LB 4PJEF 1MCJA 3FT3B 4M6NH 3FMGH 1X5FA 1W0VB 4YGAB 4DQOL 3DETC 4EDWH 4Y19E 4WW2C 4M93C 3B5HA 2PXYC 3DVFA 2FGWL 3NIGE 4HV8A 1BIIA 1MUJA 4U0RC 5CEXA 1INQA 4DKEH 1OAQL 4U1MB 4HULB 1KN2H 1HKFA 4X8XA 3TIDA 3KXFA 3QAZC 4D0DB 2WQRA 3LD8B 1XH3B 5F3BA 4BQ6A 5IBLD 2AI0H 1WFUA 4HJ0D 2ZUSA 1MAMH 1HH6A 5INCB 4X7CC 3STLA 1TCMA 8CGTA 1WZ1H 4QO1A 3P0VH 3ZSTA 3P30H 2YUVA 5CGYC 4XC1H 3MUZ1 3C2SA 5KN5B 2EDTA 1PVHA 1GGCH 4BK5A 1BQUA 3DMMA 3ARED 2R2BA 1W72L 2AV1A 1T0NA 4YK4C 1G0DA 2R4RH 5DI8B 3T65B 5DRNA 3AREB 2P8PB 1E6JH 3N50A 3IJSB 4WWKD 9CGTA 1DLFH 3LQZB 4WWKB 2X89D 1LD9A 1A7OH 4X5XB 2Y06L 4NYLB 1M7DB 1T66C 4R4ND 4LSUH 4LSPL 2VO5A 5GZNC 4MXWH 2OJZH 4S0TD 3EOTH 2ADIB 3BW9A 3FQNB 2CD0A 3ARQA 2X70A 5LQBL 1SMOA 3EKCA 1KELH 1KTDB 5DA4A 3VH8A 2R1XA 3MA7B 4O9HL 4Y19D 2ZOLA 1EMTL 4D9RE 4X7SL 2EYRB 4Y19B 3LMJL 1MPAH 2IH3B 3HI1B 3OGOE 5K9OA 1KB5L 2Z91B 3AVEA 4ZNEA 1K4CB 3HNSL 1GAFL 4QHUB 4ZODA 3C5SA 5FOBA 4J3XA 2DQEL 2IADA 5DD6A 3MJGX 5HHOD 3C6LB 3BEVA 5DJZA 1PGRB 3TNNB 5DC0A 2AGJH 2JB6B 2J8UE 4NZTL 3HB3D 4I18C 3MGOB 5DJ8A 4KH2A 4GT7A 2HVJB 1OP3H 2FO4B 3BD3A 4GSDH 2HAZA 2YA2A 4ZSOB 2YD3A 3F8UB 5D2NA 1FAIH 4NWTH 5DJYA 4MDIA 2IQ9H 3MRBB 1UC6A 2NXYB 1UA6H 3QDMA 2DBLL 2G75A 4QF1B 4F15C 4BH7B 2ADJB 5E6IB 4J4PD 4M7LL 4KROD 1SBSH 4CL7A 3HR5A 4ZS6D 1GOHA 3X11B 3HPLB 2DQDH 3V5KB 2YBRB 4OT1H 1XIWA 1KTLA 3BKYH 1CIDA 1KXQE 2ZKHH 4JKPL 1CD0A 5DHYB 4JQVC 5L2JB 3VXOA 3ZDYF 1NBYB 3MRFA 2F58L 1VACB 3R4DA 2R2CA 2VXTL 2I24N 2VABA 5JDSA 3V7MA 5M95B 1GH7A 2BJMH 4L4TA 3AAZA 4D9RD 3PHSA 3BSZH 3LRSB 5CIPB 4LRNL 5I75B 4H5SB 2BVOB 3PABA 2BFVL 3EDDA 2IJ0C 4AQ1B 1UACL 1PKQA 3V6OC 3QIUC 4PJEA 1L7IH 3QCTH 3PWPE 2YOCA 4Y7MA 5EZJA 3NFNB 1JMXA 3SCMD 3HUJE 5IMMB 3G6DH 3SCMB 1CLYL 3P9MA 1LE5B 2J8UB 3T1FB 1IGFL 2IPTL 4X80L 3ULSA 4ODUA 4POZD 5IHUH 1NMAL 1ZHBB 5AG9A 1D5IL 4Z7VA 4HF5H 4P4KA 3U0TA 3O4LA 2VLJE 4XPAH 3OX8B 1U8MB 1F3DJ 4XPBH 3BP5B 2ENSA 5ISZE 2VZTA 3MCLL 3ZHKA 4QRRE 2WUCH 2OI9C 4MJ2A 1P5UA 2VXSH 3IF1A 4LQ1A 4HBCH 3L3IB 4IBLT 5GRZA 3WIFB 5KSAB 2BDNH 3KPLA 4U6XA 4M43H 3WKMH 1FPTL 4LSRH 5DURD 4FQ1L 3RHWF 3TT3H 1MAJA 3RZCD 1U58A 2B4CH 5JXEC 3RZCB 1R3LA 1N3NA 3FKUS 5JQHC 4U6VL 3BDXA 3PUCA 5DRWB 4Z9KB 1A6WH 1HEZB 5HPOA 1G9MC 2F53A 2R2EA 2ZUUA 2XA8L 5I73B 3DX6A 2GSIA 1JNLL 3VXSE 3MRLA 1XF2A 2HLFC 5GIRB 2KH2B 3TZVB 5MENA 3MLWH 2DLFL 5T3ZE 3OR6B 4OTXH 5I30L 2MFNA 4GKZB 5F6HJ 3T4YA 2GK2A 2MSPA 5E9DE 5C08E 4JVPA 3TCLA 1QP1A 4FG6D 5I1HH 3B9DA 3PWPD 3EDKA 4PJAE 2E7LA 1P1ZB 4GS7C 4F7MB 1T83A 3PWPB 4QTIL 1CT8A 5FUCE 5JIHA 1N7ML 3HUJB 5FM5O 4V1DA 4GRWE 4M02A 3SO5A 1NGYB 2VERN 4X83A 2NTFA 3M1BB 4PRNA 1S78C 5CGMA 5K59F 1RZJL 3C5ZD 1IQWL 1LDPL 2VLJD 3ULUC 3O6FC 3QUZD 1BGXH 2DQIH 5ISZD 2VLJB 2Y07H 3QUZB 3GFUA 4QRRD 1QHPA 2EE2A 3WIHH 4QRRB 4JM2F 3FO1B 2VQ1B 4XCYB 4YHIB 5I66A 4XVTL 4MLSA 3TJEL 5E2WH 3RX8A 3I9GH 4D0CB 2JJVA 4RDQG 4P2RA 3EYUL 4FFWD 4PJGE 1HHKB 2D7NA 4NGHH 3SE3C 3TBYA 4P2CG 1H3PL 5F6IB 2X2YA 4K7PL 3IU4L 5DSCA 1MFAH 1YC7A 4EIGB 2MQCA 4HUUB 4XBGB 4GAJH 1KEGL 2OMBA 1IQDA 5JR1L 4IIQA 3VXSD 4AIZB 3U0PA 1MIMH 1U42A 3WXVH 3NN8B 3VXSB 3DRQA 1KEML 3MMEB 1CU4H 4XWGL 4PP1C 4KZDH 7FABH 4PJDA 5IVZB 4GKOA 4U1LA 4JFYA 2P49B 2VDQL 1J1PL 1U95B 3TT1H 1DBAH 3BYTA 5E9DD 5C08D 5J6HA 2B1HL 3DSNA 3L9RB 3ILQD 5IVOA 5C08B 3QXUA 3QO0A 2X10A 2BSTA 3LIZH 4S2SA 4PJAB 1TZHA 4P2YA 3VU2A 4M48L 1L0XA 4L1HA 3EDFA 3GJFH 2YD2A 5E8PA 4GRWB 5IJVB 4NO3A 2QSCH 3ES6B 4X6EA 1T5XB 5E7FA 1R3HB 2AQ3A 4YBQD 2X6MA 1KCUL 4AT6B 4NRXA 1T20B 1CXHA 3VE0B 5DT1H 1PG7L 2AXFA 5LGHH 5JOEA 4G8GA 4K9EH 5C07A 3RVVD 4KI5E 4X99A 3DRTA 2EKJA 1JN6A 1MRDL 3KPPA 2D4FA 4PJGB 4FQLH 4G6KH 4HHAA 4JPIA 3RWDA 4EUPB 2R56L 2W38A 2I07B 3ABZA 1IEAA 2HA1A 3D69B 1FDLL 5C0CB 3X14A 3MODH 3OKLA 3QNZA 4KQ4H 1LO3H 1S9VA 3QDJB 5I1AA 1AC6A 5MI0C 3D25B 2EEBA 1FRGL 1QRNE 5JW3L 1K8DB 1F6FB 4GLRH 4P59L 3RTQC 1YQVL 4PD4J 5KSBB 2QJDA 1BQHA 1G7IB 3TN0D 4P9ML 3BFOA 1QKZH 5LXGH 3LV3A 4ZFOB 4TTGA 4LP4A 4Z0BL 1BOGA 2ATKB 4NZDA 5C2UB 3OAUH 1I3GH 4R90L 1XCQA 5EPMA 1MCDA 1U91A 3MV8A 4FFYH 1MHCA 3KLAA 1HWHB 2DICA 4R26H 1B0GB 5IEHA 4K8RH 3DTXB 2C4XA 4MVBD 4NIKB 4RRPG 1UXSA 4N9OB 1NGXA 1A0QH 2NYYD 1F42A 3UX9B 3EZ8A 2KQMA 1ZT7B 3WLWC 2Z0BA 4NO2A 1OW0A 5BS0E 4FABL 1CQYA 1OTTC 1YJDH 4RQQB 1LO4L 5F6HI 3KJ6H 3E0GA 4AENB 4KI5D 4F57L 2K7PA 2J8OA 4XRCB 4OIAA 4IDJH 5BZDA 3PHOB 5I1EL 2XY2A 1YNTB 4I4WB 1EXUB 4CRPA 3T2PA 1FH5L 2XZCH 3MJ9A 3O9WD 1XMWA 1HQ4A 4G8EA 5GSRA 2DBJA 4OD1H 3O9WB 4JR9L 5FV1L 1OB1A 2EDWA 3UAJC 4HS3B 5ALCL 1FGNH 1YEDA 1YECL 2E7MA 4Q74A 5JLZB 1FL5A 3MUGB 2D31B 4M62L 2AJSH 5DVNA 3FQXA 2J6EA 5IB3B 3V0VB 1QRND 3GMRA 4HKZA 4YDIL 3PWLA 4GFTB 1QRNB 4MXQD 5AZ2L 2C7UA 5DJXA 1CR9H 4C4KO 1EV2E 1MCSA 3MRKB 4LKXA 3MLUH 3S3PA 5FYKL 4KRMB 2BHYA 4L3AA 3ARXA 3A6OA 3HI5L 3MRNB 1X5LA 5L6YL 2Z8WC 2YD7A 3S8WA 1D6EB 4YUEL 5I6XC 1U8KA 5FCUL 5GGSY 4TOYH 2DI7A 1UVQA 1X5HA 2NY5C 2YC1B 4MX7B 6FABL 1T2JA 2X44D 3TV3H 1P7QB 1ND0B 3NACL 1RZKL 2NY3D 4Y16D 2O5ZH 8FABB 4U1HB 2L7UA 4QWWC 3RWCA 2NY3B 4Y16B 5F9OH 1TFHA 2R15A 1IAIL 2J8UF 1VERA 4PR5B 2DDQH 4EEEA 1VADB 2IMNA 3RGVB 5BS0D 3SE8L 2YPVH 5BS0B 1NEZG 5C0NC 4LVHB 2QQKH 2XWBA 3GMNA 2H8PB 3JXAA 1G7QB 3D3VA 2QHRL 5CMAB 3CX2A 5I9QC 1P53A 1I8LA 1J5OL 3CMOH 1PEWA 5ETUB 4WHTB 2VL5A 3FQUB 1CS6A 5E56A 1JHLL 1AI1H 4BKLA 1SJHA 3DGGA 2VXUL 2GJ6A 1MELA 4O58L 1N0LA 3ZDXF 4P2QB 4PJFB 4W4NA 2BVEA 2DJSA 4KGLA 3UTZA 4RZCB 2N7BA 4OQTL 2VNCA 2UZYB 4FOMA 1MJUL 3LN4B 3GIVA 4F3FB 1QLFB 3S7GA 5DI8A 3CIQA 3IJSA 5F9AC 5I1GL 3VH8G 4UT9H 4G8IB 1N5AB 2D2OA 5J4MA 4FTVA 5TGBB 1CDIA 1KYOJ 2XNAA 4NYLA 2BOCB 1UWGL 1JUFB 3NH7L 4F37F 1GOFA 4P5MA 2BNQA 2O93L 1SM3H 2UUDK 4PG9B 4YHOL 1UJTA 5EOCH 2MOVA 1A4JA 2E9WA 3FAXA 2DQTL 3SDYL 1QLEH 3VD7A 3HUJF 1EFXD 5D8JL 4YHML 3MV9B 3TBSB 3S37X 1YNLL 2IH3A 3C6SB 3HI1A 5CSBA 1EFXB 1MCHA 1DE4A 2B1AH 1AP2A 3QXAA 1QR1A 1ZKAA 4DOHE 2V2TA 3KR3L 1GYAA 1DEEA 1RUKH 3FT2B 4I2XB 1JF1B 4O2EB 4OSUL 4Y4FD 4HJGB 5F7DA 5C0BE 4ALAL 4F9LA 5IGXH 1CXIA 4G3YH 5I71C 4ZUVB 4Y4FB 2YKLL 3C6LA 5FECB 3GHBL 1MCWM 5DZLA 1RZGB 4ZOEA 3U4AA 4HH9B 1KIPA 2JB6A 3VD5A 3HKFA 5J1AA 5CEZH 3AROA 3TM6A 4TSCL 3RWGB 3UP1A 1EEZA 1HK6A 5T1LD 1II4E 1BF2A 1KF9B 5JA9A 3SKUD 2RFXA 3VGAC 2UYLA 5T1LB 1JWMB 4LLYB 1WV7T 4ZSOA 1HHJB 2YEZA 2O61A 3OKDA 2EDNA 1QFWI 4WO4D 3EUUA 3QFDA 5C6WH 1DQMH 4KDVA 1NGWA 3HMXA 4BJLA 5GRWA 5IWLA 3W81A 5IV2A 1IC7L 4NSKA 5IW6B 5J89A 3ROLB 3E3QE 5JOFA 1PD6A 3UDWC 5HVGB 5C1MB 3KDMA 4M6ML 3QUXD 3GNML 5DD5H 1IC4H 3QUXB 2EZ0C 2BVUA 5GS0C 2OR7A 3SDDC 5D1ZC 1OPGH 4NQDA 4FXGB 3VXNA 2MQ3A 4PTUB 2EDLA 1C16B 5FYJU 2VZ1A 4P9HH 3EFDH 4I0PC 3AM8C 2OR8A 3VDAA 2VN4A 1NC4D 3W0WB 4P99A 5DTFA 5GISL 5DMYA 4M7KH 4PJAF 4HQQL 3WNLA 3TLRA 3BRDA 3GBML 3TBTB 5C7XL 1F4WH 2XTJE 2VQTA 4FQJH 5T5NF 4M1CC 1AR1C 3F7PC 4JRXA 4NWUH 2FBJH 3U9PL 3LRSA 1NKRA 4GRWF 1LO5B 1MNUL 4LPWA 2FIRT 1JK8A 4NNXB 4YLQT 1JNHB 2FL5A 4UU9A 3RDTB 3UXFA 4DOHB 1BOYA 1ES0B 1H0DB 5C0BD 3RUGE 1TPXC 4N0YL 3QUMH 1QLRB 5C0BB 2JCCA 1FZKB 3CUPA 3VFPB 5IKCB 1AHWB 2J2ZA 4CBPA 3KYAA 2Z31D 1T03H 5E5MA 4IRSD 3MCKB 3UO1L 3GKWH 5BOZG 3DUSA 4E9LA 2Z31B 1S7VB 4CN4A 5JXAH 3KYKH 5EZIL 2APFA 5EN2A 5I16B 4JQIH 5GZOD 3VWKA 4WUKH 4PJGF 3GJEB 4GW1B 5KG9B 2I5YH 1JVKA 4AYFA 4NQEB 5ICXB 2AJVH 2W07A 4D9LH 1Q9KB 5JW4M 5KSAA 1ZGLM 5GRJH 4LVNC 3C8KA 4KKBD 1F02I 3UTTE 5E2TL 5IG7B 3EOAB 1DCLA 2DQJH 5IFAL 4MXVE 5IROC 1MHPH 4HS8H 2AJ3A 1DBMH 3W39A 1B4RA 15C8L 3GJFB 5FB8A 5HVWA 5KSBF 1QQDB 1SEQH 5SX5K 1R0AH 1NCUA 2VDKH 4CVZB 4EVNB 3B2UD 1L7TL 3VGFA 5AEAA 4CMMA 3RKPA 1RUML 3GGWA 1JGLH 3O4OB 4JFXA 5GIRA 1IT9H 2VITA 1CICD 4KKAD 4I13B 3K4DA 4BFIA 3O45A 2XTJB 1CICB 5FKAA 2ESVB 3EYOB 3BT2H 1A7NH 3HFML 4XVSL 4MA1B 4U4BA 3IXTA 1LNUB 3QZWB 4F7EA 3RUGB 4OLWL 4H1LA 4F7MA 1EBPA 1C12A 2YMXL 4W4OA 3BGFC 5GGVL 3DUHA 4X7EC 3DHJA 2LVEA 2GW5A 3PJSA 4OCWH 1IAIM 3CSGA 4PJ5B 4NJ9L 4KI5F 4Y5YC 4XP9H 2F5BH 4DN3H 5HI4C 3MRPB 4YXKH 1EZVY 4WI7A 5DFVC 4JHZA 3MLTB 2AEQH 3ULVE 1GC1H 3DPBA 3SDCC 5F1IB 3TO4C 3WSQL 3CFDB 4YHIA 1H3WM 2R0ZL 1UKSA 2B39A 2IAMC 2QQNH 5BV7C 1UM4L 2LTQC 4P5KA 2B7DT 4LEXL 4BZ2H 4D0CA 5F7YC 3RNKB 2KPNA 3BD5A 3UTTD 4M9OA 2Y72A 1RSFA 3O11B 1EBAA 2IANE 3UTTB 1ITCA 5I17A 1SEBA 2EDOA 2V7HB 4OCLC 4LLUA 4MCYB 3EIFA 5ABDE 5MEOA 1NAKH 3D18B 5KTEL 5GGTL 2DM7A 3CC5A 3WL9B 2XWJB 4XNQB 3GMOB 3SE9L 3TJHD 4OFKA 4ODHL 4UB0L 1BX2B 3MMEA 4PV8A 5GGRB 1ZLSL 4NKQB 3LKQA 2W65A 3WBDA 1FYTE 4UV7H 4EN3A 5D93B 5ESQB 3BP6A 5BMFH 5KSUB 1TETH 3S35X 1I3RB 4LIQH 2HKFH 5D71L 3BUYA 4JAMA 4YHPB 4YR6B 1VFOA 3PV7A 3ARFB 3CCHB 4LP5A 4MD5B 1NGZB 3L3GA 1HHHB 3LEYL 1J10A 1PSKH 3GSUB 2R29H 2CJUH 1INDH 2W9EL 2XZZA 2FYYB 4LKCA 5IJVA 4XGZB 3ZKXC 5EA0L 1CIUA 3DNKA 1TCRB 2ERJB 5F9DC 4H20L 3WKNA 5ICZB 1KGCE 1MFDH 1PLGL 4Z8FH 4ELME 1LGVA 4XB8A 4QRTB 3GHEL 4MAYD 2CK0L 4YXLH 3MR9A 4X4YB 3ULVD 4ERSH 1KT2A 1NLBH 5CJXC 5F89A 4KXZI 3THML 1DQJA 4PUBH 1LK2A 4JM2C 4CKVX 2GI7A 4PJFF 1FL6B 1XGTB 1E27B 1E4JA 4POYA 3VFVB 3ZO0A 4DKAA 3VWJD 1Y0LA 12E8H 1JGVH 1DQDH 1HE7A 3VWJB 4TQEH 4EUPA 4KHTL 2IANB 2AV7A 3ZSSA 5IJKA 1BQHG 1KN4L 2J5LC 2IALB 3ZE1E 3BDYH 5SX4I 3C09C 4P0DA 5E8OB 2BXYA 2E8ZA 3W9EA 3HZMA 2OL3L 3MBXH 5KZCB 3WFBL 1OARL 4EI5A 1JPGB 4P2OA 3DV4B 1OHQA 4IOSD 4NC1E 4XBEH 1FYTD 3L1OH 4KDTC 2JE8A 3QG7H 3IFPA 4HMCA 4LPUA 4PREB 1FYTB 5T5FH 3V7AG 4I3GA 1BD2B 3IDXL 1WIPA 2VKXA 4L8SB 4N0UE 4NKDB 5DUML 1Q9WA 2GYSA 4JVWA 3MLXH 4OGAC 1KJ3H 3JWOC 5TQ2L 4ZXBB 3IDJB 4CADA 5IEKB 2QKIA 3RIAF 2X4UA 2WZPD 1PX4A 1YZZA 3FB6B 3W2DL 2JELH 5DEGB 1B0GA 3DTXA 4OCNC 4JN2A 3SBWC 1A8JH 1CZ8H 2DF3A 2VSDA 3PNWB 2X1XR 4HUWB 1KGCD 5ELIA 4H88L 2B8OT 4RFEA 1EEYB 1N6VA 5TE6L 3J8F7 3LD8C 1ZT7A 3QDGE 4QXTB 5FDYA 4J8RA 2CQVA 3QRFM 2VYRE 3KPNB 4RQQA 1WZMA 3V6ZB 4G9FE 3HLAA 4KKNA 2NXZD 3BJ91 5IBLC 5IHZA 5C0IB 2ZNWA 4IHOB 4XH2A 3VRJA 2IPUG 4HJ0C 1CBVH 3WJLC 4N5ED 4TPRH 3WDJA 2ICWJ 2DIJA 4OI7A 4U6YB 5A16A 3TBWB 4CN1A 2H9GB 1BQLH 3IS0X 1RZ7L 3AREC 4WFEE 1LEGA 1I9IH 1EJOL 3W5MA 4WWKC 3IGAB 1F58H 2PR4L 4BH8A 4OCRH 3UTOA 5GRYA 1F6LL 1EGJH 2ED8A 1DUZB 1R24B 4R4NC 5FAAA 4H25B 4YXHH 4LLWB 1JZ8A 4MHHI 1T89C 3RBSA 1B2WH 5KW9H 5D7SH 4LLQA 5JHDE 2H3NA 4O5LL 4N0UB 1FV1A 4HCRL 1AFVL 5FYJL 3G08B 2DM2A 3LN5A 2VRAA 4G5ZL 2NY2D 4E5XB 1NPUA 1D6EA 2FJHB 5F7EH 2NY2B 3QB7C 1IAKB 4NFBA 1A3RL 1U8NB 3TBVB 3P0YL 1P7QA 3CZJA 1I8KA 1CDGA 5HHXH 3VFOA 4N0FB 5AYUH 3N1GC 3DLQR 2VDNH 3WNOA 3A67L 4JDTL 1EHLH 3QH3B 5ANMA 3QDGD 4BSJA 5B38A 3MZGB 4JPWH 4R2GD 3QDGB 1NUNB 4BSVB 2OTWA 3HB3C 4YPGA 3N06B 1CGWA 2A9MH 4G9FD 4OGXL 3Q6GH 1CFSB 4I8DA 3ARGA 4AL8H 4GQ9H 5B8CB 5GJTH 1SY6L 4FS0A 4G9FB 4AEEA 4J1UA 4KUCD 4LMQI 3ETBF 1X3DA 1X5ZA 5CMAA 4PGBA 2NXYC 3KYOB 4HFWB 1ADQH 2VC2L 5ETUA 3KAAA 3BP7A 1YPZB 4R7NA 5D6CB 4NRZA 3L5WB 4X4ME 4PJFA 4KROC 4WFED 4S1DC 5HYFA 4K94H 4Q6YA 4ZS6C 4HPYL 3X12B 3MREB 4H26B 5CKAA 4F9PA 4LPVA 4DCQB 3O3UN 2OM5A 4N8CL 1G9ML 2I60L 3JV4B 4S1RH 1O7VA 1QLFA 1WCQA 5B39A 2IC2A 2EYSA 1IGYB 1ZWIA 4LBEB 3QCVL 4MQSB 3VFGH 3QUMB 3GI9L 4YO0A 4ZPTA 5JHDD 5TGBA 1QFWM 2CMRH 1RU9L 2BOCA 5DLML 3REVA 2Y7QA 4DUWA 3JTSA 2DMBA 5DQ9A 2DD8L 5D7JA 5GS3A 2JK5A 3CDGB 4KK9D 3KPRE 5I75C 1KPUB 3QI9D 5ESAA 3RUGF 1YEEL 3QI9B 5TDOB 5I1CH 2YRZA 4HUVB 3G6JE 1NAMA 1Q9LA 2X7LA 4PB9L 4HMEA 4KTDL 2VDPH 1XF3B 2OQJA 3MC0A 4PYHA 1TJIL 3HS0B 1CE1H 4M1DL 3SCMC 1J0ZA 4WENB 2DJUA 2HTKD 3EOYG 4POZC 5ACZB 4I3SH 3NA9L 1YEIH 1BHGA 2V2WB 1JRHL 3IETA 4QHKJ 5IMKB 2PO6D 1OL0A 2GCYA 3H9ZA 5JNYA 5TPWH 1MF2H 4M7ZC 2ICWA 5TE4L 2E7CA 1NUDA 1RZ8A 2X1OA 1KTKE 1RURH 1NGPH 2F19H 1JFQH 2DMCA 4P46D 4N9GB 5F1OB 4O2FA 4KK5C 4MXVF 1KC5H 4MZ2A 4ODWB 1JHKL 2VUOA 4P46B 4XBPB 1MCBA 2YRPA 3HC4L 1UWXK 3RZCC 3ALWA 1HYSC 2YZ1A 2MJWA 1K6QL 1OCWH 2FHBA 2IGFL 2J8HA 5IT2H 4Y1AA 4FZ8H 5I73C 4ZAKA 1B4JL 2GY5A 2MNUA 2YHGA 2R9HD 2AEPH 2PNDA 3L3DA 1YEKH 2ICWI 3TZVC 2WP3O 2HG5B 4C58B 3KPRD 3FB5B 4RMUA 5MEQB 3CZFB 3KPRB 5IM7B 5HTSA 5EH1A 2NNAB 4LLMB 4R0LB 1YA5A 4PRIA 5F21B 4WI5A 4LCUB 4JFPA 4G7YH 4FG6C 5EFIB 1XGRB 3G6JB 2WBJB 1QEWA 4QGTA 3OJDB 2QSTA 3SKJH 1E28B 3E6FB 3QEGH 3BKJH 3UJIH 1JNHA 1N0XH 3RDTA 4Y8DC 2YD4A 3NMEA 1G7HB 1H0DA 1T0MA 4JB9L 4NPYB 1QLRA 1B88A 3MLYH 3GRWH 5ADOL 1IKNC 4G6AD 5FHBL 3MJ7B 2C3XA 3C5ZC 3FRUB 3WUZA 4ONGH 3E1F1 1HKLL 3OZ9L 2ITDB 4OLZH 1L6XA 3QUZC 1OD7A 4HIJB 2FEEI 2D7TH 3ULVF 3B5TA 3BHBB 3RPIB 1QO3A 1FYHB 4YAQB 1ZHLB 4R9HA 4YIQA 1D6VH 2C1OA 3GJEA 5BQ7B 5LBSL 2A74A 4FFWC 1BFVH 5F6IC 1BLNB 5E08L 5EO1B 1I8IB 4NQEA 4LDEB 2X4OB 5K9QG 3CVIL 1LILA 1OAYL 4W6YB 2QR0A 3L3OB 3ZYJA 2A6DB 4RSVA 2MKLC 2W0FB 4X5WB 1L0YA 1CFBA 2EYTB 3EOAA 2BRRH 4PRAB 1ZA3A 5CLTA 3VD3A 3WS6C 1ODAA 3SGDI 1ETZA 4XAWL 3WLBA 1AO7A 3ARBD 1NCDH 4FNLL 3ARBB 4CVZA 2BNRB 1QNZL 4O51A 3PGFH 3GBNL 1NLDL 2VLKA 4H1LG 4BQCA 5ID1A 3ILQC 3NFPB 4Y2DA 2E6QA 4FFVD 4PJ9A 1XGPB 5E2VL 1FNEB 2ESVA 3RVWD 3PQYE 5ITFB 1SJVA 5FUCC 3OKEB 2JJSA 2CDGB 2ZUWA 5I76A 4X9HA 5DUBB 2VDLL 1ZS8A 2HT4C 5E8DL 1RMFH 4Y5XC 5F96H 4XNYL 4PRBB 5FA4A 1CDHA 3U46B 4DTGH 1A6AB 4YBQC 5EC1B 3C60B 1R5VA 4U1JA 2XOTA 1A21A 2GTZB 2WINA 2B0SL 4QHMA 3FO9A 2I9TB 1RUQH 2Q3AA 3O3EB 1CFNA 2FEDD 1F8TL 4UBDD 3MRPA 5FGBC 2HFEA 5DJDB 5GRUL 3RVVC 3N1PC 2D7OA 3O6ML 4GBXA 2NY1D 1RQ5A 3ARPA 1I7UB 3U1SH 1CYGA 4GXVH 2NY1B 4X6BB 3CFDA 3VXUB 3HI6L 4EDXB 1I8MB 5JMRA 3FN3A 5D96C 3TO2B 1PZ5B 3ZE1F 2VTFA 3MV7E 4KKLD 1KB9J 5JPMB 4TYUA 4OD3H 2H2SD 3A6CH 1DLHA 4PS4L 1FFNA 1DVFD 2WWKO 3P9WB 1TQCC 2EE6A 4UOJA 4QHKI 4Q9QH 4DGIL 3IAGC 2V17L 2DQCH 4IOIB 4X4XA 3GEWB 5EU3B 4CNIA 4EXKA 4JZJB 1KXVC 5ALBH 1HDMB 1Q1JH 3CXDH 3D18A 1QFPA 4Q9RH 4G6MH 4YEEA 2AJXH 1WBZA 1N59A 3LKOB 5GGRA 1QRKA 5F3HB 2ZG3A 3V8CA 5JPNB 3FQTB 2QBWA 5GGRY 3WJJA 3ZTJG 3PQYD 1JCKA 4QT5B 4D3CH 5EZLA 5KSUA 4MJ6A 5JQ6H 2BNUA 3RX7A 3F7YA 3TGXA 4MVBC 1JNJA 3HA0A 1X4YA 2HJLB 4QOKE 4D94A 1IC5H 3ARFA 3CCHA 1MJ7H 4U2ZA 1NFKA 1MJ8H 3S88H 1OGTB 2NYYC 3O6KL 4JJ5A 1LO2L 3CPLA 4XGZA 4YHNA 4FFZL 1VGKA 4X8JB 4YFDB 3EJZC 4BQ9A 4LCCB 1KJ2L 1TCRA 3MRRB 1D9KA 1ZEAH 5ICZA 3QULB 4MA8L 4XWOD 3H7BB 1UADC 2HJFA 2L4OA 2VZOA 4KI5C 3WFCL 2WM0A 1JZ2A 4EUPG 1VKXB 4XNUL 2XN9B 1E4KC 2WUBH 1ZMYA 3ARDB 5J6GB 3LH2L 3WUWA 5ID0B 2F54E 4L3EE 1YPZF 2D0FA 4M8QB 4JFQA 3O9WC 3MV7D 3CX5J 1FL6A 2MHAA 1E27A 1KTRL 4IMLA 1LE9A 3MV7B 3D2UB 1U3HA 4HLZG 4AJ0A 3HZKA 32C2B 1D5BB 4F8TA 1K2DA 4J3WA 4MB4A 4FQIH 3G5XB 4PTTA 3DURA 4XZUA 4Q97A 3DSFL 2YSSB 2ATPB 4HZAA 1X5YA 3CFCL 1TJHH 4MXQC 1BECA 2A1WL 1C5DA 2GJZB 2FHCA 4ZTPH 4CUCA 1AJ7H 4ZPVA 1MCPH 4F33A 3MGTA 4C56E 1OM3H 4U49A 1N5YH 4OD2A 3OV6A 3MRGB 1J1XL 1BD2A 3RNQA 2X4PB 1A7RL 4MB3A 4NKDA 3WFEH 3KPOB 4PJBA 3KLSA 4NQXA 4QOKD 4ZXBA 2E8YA 3BXNB 3VFMB 5IESL 1CG9B 1T04B 2NY3C 4PJ7A 4Y16C 1LMKA 3OPZL 1MCEA 5CSZA 1YNKL 4BFEA 4I3RH 3MZTA 3RGVC 3M8OH 2YWYA 3PWNB 2NY7L 1U8LB 1Q8MA 2FSEB 1EX0A 3PNWA 4MHHG 1MQKH 4LPTA 4V2CB 4LVHC 4X7FC 4ZDHB 4OZIE 1EEYA 1FNFA 1WC7B 3OL2A 2HLAB 1U8QA 3MNZB 4KV5E 1E4WL 1D5MA 1MWAA 2F54D 4L3ED 5J13B 3KPNA 2Z4QB 2OZ4L 5IK3B 4L3EB 1EA9C 1UYWH 3F6LA 1BVKB 1RHHA 2C3VB 5D9SB 4L4VA 3UC0L 1MH5B 3CU1A 5JMOC 5IMOA 1UJ3B 1DUYA 1QSZA 4L8BB 1W0WA 3T0EA 1P4BH 3UROR 1CDYA 3QJFB 4EQ3A 1G7MA 4M7LT 5GS0L 1KLFA 4KAQL 4G9DB 1PQZA 5HDLA 4XPTL 3L5JA 5D72L 4LF3B 1A22B 1GGYA 4WNQA 2FGWH 4HXAL 1N8ZB 4MWFA 1V7NL 3BP4B 1LO0L 4C56D 3Q5YA 1TMCB 3HC0B 5MHSD 3IJYB 5T1KA 3SKOB 4C56B 4LSTL 3U2SB 1A6UH 4YDLC 1SJEB 4HEPG 4G7VL 1CD9B 4OJFH 4QXUH 3KYNB 4WEBL 3F62A 4DW2H 3G6JF 1KBGL 5B38G 5E8NB 2CIIA 25C8H 5D7LB 4MLIA 4WUUB 1U8NA 2BC4A 4LLDA 5J7CC 4KHXL 4OF3A 3MNVB 1BFOB 3O0RL 3ZTNH 3DBXB 5E5UB 4HIEA 3T77A 4U1GB 4ZNCD 4Y4FC 1WFNA 3QIBB 3HE6D 4OZIB 1W72H 3EFFB 1NMBL 4BSWA 3S36L 3HE6B 5I8OH 1U3JA 4U1KA 5FUOH 4ONFL 3ISWA 2CDFB 5DJAA 2XI9A 5B8CA 3QPXH 3CLFL 1SQ2N 3D0LB 3K1DA 4NJAL 3TA3D 3C9NA 4JHBA 4RGOL 1DQLL 2VXQL 3EO9L 1F11B 3A6BL 3IDGB 2RCSH 3NA4A 2ZSVA 5JW4Q 2P42B 1EAPA 5HPMB 4DKFH 1OVZA 2QEJA 2MCPL 5I1KH 5LQBH 3BIBX 5D6CA 3BH9A 5HYJA 5I1LA 3QUXC 1EMTH 4NQCE 2EXYD 2VH5H 3T8XA 2VDRL 1KB5H 4Z7QE 1HSBA 2Q76B 4P23D 3EYVA 3P73A 4NO0D 3CAFA 2DQEH 4JJHA 4NO0B 1RIHH 2OP4H 2IFFH 4TUJB 1MLBB 4GQPH 1CFVH 5IB4B 5DS8B 1GHFL 1QFUH 3CK0L 5F7NC 3X13A 3TWCH 3RA7L 4PJ8A 2EKSA 4ZYKB 1JYXA 1LEIA 2IQAB 4QHNA 1YY8A 3QNXA 2A6JB 5EU6A 3UJTL 3Q3GB 4CMHB 4PJIA 4JFFE 3EW3B 2APBA 1HINH 1OGAA 4LHJB 1ULVA 1MCRA 4N8PA 2MCG1 4WEUD 1KPUA 2FR4A 4LU5L 3NFSL 3MUY1 1ZHNA 3P3YA 4MJ4A 1RZIB 1U3ZA 4NQSA 5GS2H 1M7IB 2C4FU 4OQ1A 2XIDA 4K23L 3RU8H 1A3LL 1UG9A 2EIEA 1A6ZA 3OHXB 1AHWC 4RX4A 2BVQB 1QFHA 4DZ8B 4A6YH 4QCIB 1IGIL 1YMHB 2Z31C 4IRSC 4OAWA 1Q94B 5KVEH 2ENYA 2V2WA 2HN7B 2WIIA 4UTBH 4NFDA 4HUMB 5GZOC 5E6YA 5INDB 5BV7L 2IBZX 4LSQH 4TVPE 3I6GB 4NNPL 4UDUB 1UZ6E 4UOW1 2F58H 3CJJA 5HHOA 2VXTH 3ZKSD 3E3QC 1OD9A 2GJJA 2VUYA 3IAQA 2H6PB 4NQCD 3WFHB 4XP1L 2LFGA 2YN3A 3VXTA 4PFEA 5FK9B 4NQCB 35C8L 4KKBC 2BFVH 5IOPA 4X9IA 5DJCA 1A7QH 2ORBH 4P5TD 4FQXD 4P5TB 4FQXB 2R23A 1F2XK 2P5EA 3OMZA 2YPLA 5HGHB 3B2UC 3U7WH 1N2RA 4J4PA 1QFOA 1CLYH 3DX7B 3O4OC 3HNTH 1NMAH 5CBEB 4OZHE 1D5IH 4JFFD 1KCSL 2XTJC 5ACLA 1CICC 4KKAC 5J11B 3V6FA 4JFFB 3SPVB 4RISH 5CP3A 3FB8B 3MRDA 1VDGA 3DETD 5C70A 1MQ8A 1U6AH 3GBLA 4MA1C 3LZFL 3NABH 2QQLL 2HRPL 5HYIA 2PYEE 5EO9A 1LHZA 1V7MH 4HS6A 2WBJA 1FFOB 3BEWB 3IKCB 3UCRA 4QRUB 5FYLH 2RB8A 1FPTH 3PXHA 5T33L 2Z93A 4KMQA 5KVDH 2VAAB 2GUOB 4FQ1H 3O3AB 1S7WA 1WIUA 4XNZB 5DVOA 5K9KA 4PGEA 3MJ8B 3V5DB 3MJ7A 4GG6A 1G6RL 1P5VA 4K7PX 1GSMA 4TVPD 1GZPB 4BZ1L 1U8IA 3F5WB 4U1NB 1EHXA 3SGJA 2RBLA 4JY6A 2UWEA 3D9AL 4AM0B 2LU3A 4JVUA 3P40A 1A4KA 1LVEA 2VR9A 2YK1H 4Q6IA 1ORSA 3QEQB 1S9XA 4NZRL 1AXTL 1UZ8B 4UTAH 1JPFA 2XWTB 3K8MA 1ZLUK 2DIBA 2ZUVA 4R3SA 1N7MH 1Z2KA 4DFIA 4F7CA 1MY7A 5GZND 4APQA 3R0NA 5A2FA 4BFGA 4OLYL 3IDNA 5I2IB 4CDHA 2G5BB 3TJHC 3OAYK 2R2HB 2O5YH 4OZHB 1IQWH 1RULL 4OZFH 1X5XA 1YJDC 2OTUA 4C83A 1NDMA 5D93C 3JWOL 4NNYB 1A7PH 4J6RL 1ZSDB 3DIFB 1NCBH 1CGUA 3O2VL 2PYED 2Q7NA 4CVXA 3AXLB 4HJJL 1Q9OA 4Y4HB 5FYJE 1PG7X 5IBTL 4LAQL 4XVTH 2OJEA 3GSNH 2A38A 3TJEH 3PIQA 5ITFA 5J1SC 4D0BA 2OS7A 3CSYB 5DEZA 3BPCB 1HOCA 3DYMA 4I77L 2ERJC 1IM3B 1H3PH 1XR8A 4HKBB 4ZO9A 1BWMA 5HYSB 5IIEA 3U46A 1T1YA 1VFBB 4QRQA 3WYRA 3C60A 4I48B 1NH6A 3LVEA 5JR1H 1BBJB 2X9XA 5AG8A 3ULVC 1QSFB 3ARRA 1OAKH 1LEKB 4L8DB 1XF5B 3O3EA 5DMJB 1C5CH 4TTDD 1NDGB 4OFVA 4FXKA 5DJDA 5GSVA 1QOKA 3MNWA 1U2CA 1MVUA 3VWJC 3B6SA 1J1PH 4OBRA 4X6BA 4ZOAA 3PXJA 4YC2B 3VXUA 1J1OL 3GSOB 2B1HH 3TO2A 5ERWA 5ISZA 5C0FA 5MP6L 5A40E 4JANB 4GAYB 4HAFA 1NEUA 2DKMA 1INEL 2P8MB 4TSBH 4X4ZA 3AY4C 3LQAH 3QO1B 1TIUA 1BM3H 1RY7B 3O8XA 4M48H 4WU5B 3JUZA 5J8OA 5TQ0H 3VXPA 1PG7W 1TXKA 4XTRD 5CJQL 4GW5A 1DBJL 2A9NH 1Y18B 3Q1SL 1X4ZA 4Z7UA 3CFEA 1KLUA 4JZOB 1K3ZA 5FO8B 2FJFA 1KCUH 4XMKH 5DC9B 4L8SC 1DP0A 1A9BA 3BGMB 1UQSB 4WJ5B 5AUMB 1PG7H 4GKNA 5EBWB 1T0PB 3L3JA 5FYJD 3FQTA 1R3IH 1NUFA 5I18L 5JW5A 1F4XL 2VLLA 5DJ2B 1TLKA 4ODXB 5CP7B 4N68A 1JZ4A 3HG1E 3FCTA 4P49A 1FN4B 1MRDH 1IAOA 2VXVL 2IG2L 4JO4L 3UEZA 1AQKH 5L0QB 4ZQKB 3I2CH 4OZIF 1FDLH 3DX9A 3PDOA 5E9DA 4DKDC 3BZEA 4UV4L 3EO1B 4YDJB 5CWSB 5HDQH 4E41E 4KVCH 1TJGL 3UPRA 3G9VA 2BOBA 4GG8B 4WHDA 2A6IA 2DQGH 4NQVB 1FQ9C 3BGAA 2HWZL 1NSNH 3GMLA 4LQFH 5JW3H 1EGJA 2OSLB 4FQCL 5J6GA 1YQVH 5LCVL 3T0AA 4N5EC 1QBLH 2DTML 4AEHL 4OZGB 4KMTL 2Q6WB 2FX8H 2O5XH 1NCTA 1FCCA 5I8CB 4N8VB 2X1PA 4WU7B 1D5BA 5DD0H 4H0IA 4HUNB 2J3SA 1N6QL 5CS7A 3NAAH 4L8CA 3UPAA 4TULL 5E70A 4Y8AA 3B9KD 4M5YH 1R6VA 1A2YB 1MLCB 3TYGL 1NFIB 1OSZA 1FLRL 1E6OL 3B9KB 3CXHJ 4XCEB 4NC1C 5IB1A 5C09E 1YEHH 5C0DB 4PP2B 3WN5A 4UILL 3BQUB 4ETQA 7CGTA 3UTSE 4XHJC 1Z0MA 3IDYB 1EK3A 2Y36H 1F3JA 4Y4KA 2W1NA 1BJMA 1DBKH 1OAZL 2NY2C 3T1WA 3HG1D 4UIKH 3HE7D 1B0WA 3CVHA 4XP4L 5IQ9B 2Y5TB 1AXSA 2AXJA 3HG1B 3KYMA 2FWOA 1AGBB 1FG9C 3KPOA 3TVMD 3M17B 2V7NA 2W60A 3Q6FB 3QG6B 4S1QH 3TVMB 1MCIA 2XXCB 1IMHC 1ADQA 1HSAA 2J1KA 4IRJD 3TN0A 3IFOB 2P47B 2XFXB 4JR9H 3B8SA 2AJUL 1HCFX 3ZMRA 5CAYB 4IRJB 3S34L 4X7DC 1MHHB 4E41D 3I50L 5ALCH 1YECH 3FT4A 3S9DB 4F7PA 5T1MA 4OZ4A 3HZVB 4TVSa 1WC7A 2PTUA 2WANA 3H42L 4I0CC 3OKKB 5AYQA 1U9KA 3OGCA 4FMKA 1K3IA 1T6VN 4P9HC 5CSGA 1RUPL 1TTGA 2EH7L 4F7TB 4LOUD 1OAUH 5DD3H 5HI5D 3LKSA 1BVKA 5FYKH 2WW8A 5D9SA 4OLXL 3K46A 3WO3B 2CRYA 1MH5A 5IBUG 3F58H 5L6YH 1UJ3A 5JOPE 3R8QA 3O2DL 4Z7QF 4OCSL 5FGCE 1P7KB 3STZA 2H1PH 4MA3A 3HPJB 1GIGH 5JORB 2X4QB 1HILA 1CK0H 4WI4A 5C09D 2EDYA 2P5WB 3T0XA 1IAIH 1RJZA 4OB5L 3UYRL 1KULA 1GZQA 1I3VA 3QJHA 4R8WL 5FYLE 4X6DB 2YD9A 3BP4A 5A43C 2IH1B 3UTSB 4A6YB 1KLGB 3U2SA 4PLJD 3D39E 3MRCA 1SJEA 4L5FL 3LN9A 4KK9C 2QQQA 3KYNA 4HIIA 4ZUUB 5I19L 1TZIB 1NCAH 3VJ6A 3QI9C 1HH9A 3WXWH 1NCWL 1RJLB 1AGCA 3P4MB 3DV6A 2KL6A 4OM0L 2DWEA 3T2QA 1E4XH 4F58L 4EZMA 4TNVF 1DBBL 2PTTA 4RCAA 1WBYB 2AJZA 3D85D 2V9TA 4R7DB 4OQTH 1EVTC 5SWSE 3BN3B 3D85B 1M05B 3KXFE 1KJVB 2HTKC 3OKMB 2WMPA 3OKNA 4JCLA 3RVXD 4NT6A 1RZJC 4HWEL 2XY1A 3LHPH 4JDZB 2OYPA 3GSWB 2P43B 3PGDA 4WW1A 1UZ6F 3VFUA 5LWYH 1G9NC 5D5MB 5L2KB 5GGQL 4LEOA 4MJ5B 5FHAH 1S3KL 1RK1B 3L3HA 1ED3B 3MRQB 4QTHB 3KWWB 1UWGH 1XEDA 5KVGL 3PP4H 5DC4B 1RUAH 3HCVB 4LSVL 2XKNA 1KCVL 3JV6B 1MY5A 4UQ3A 3VXRA 5JOPD 1MRFL 5E4IA 2PETA 4YHOH 3GI8H 4P46C 4RMWA 2VZSA 1I7RA 4D2NA 4RNRB 5FO7B 5FM8A 4M3JA 3OG4B 5D1QD 3CU7A 3PP3H 4L9LB 5DQJA 1QPXA 4NKOA 5D1QB 2IPKA 1F97A 2V2XA 4GUPA 4OZHF 5FYLD 5T3ZL 4HWZB 3TPUB 5AZEL 3NZ8B 2DYPA 3D48R 5HGDB 4ACPA 3D39D 4WDIB 2ADGB 2YKLH 3IFNL 5I74B 3GHBH 3TEUA 1KPRB 4R0LC 4Z77B 5DQDL 4ZFFA 2PF6A 4TSCH 1XF4A 3Q3GA 2Y9RT 1YEFL 2B2XH 4ZNEE 1JPSL 4HV8B 1BIIB 5D1XA 1IJ9A 1MUJB 3NTCL 4IMKA 2ADFL 3P4NA 4JO2H 5CEXB 5SWSD 1INQB 1RZFH 3KXFD 3MOBH 4KRLB 3KXFB 4G6AC 2KZ1B 1M1SA 4HC1L 3U7YH 3U79A 1OTTD 5F3BB 3RRQA 2BY3A 5FV2A 4YJZL 3K80A 3OJVC 4XP5L 5JUEH 2WAHA 2DQUH 1FZJA 2KDGA 1HH6B 1TVBA 5LGJA 1CF8H 3STLB 3QDME 4MQ7A 3FO0L 3DMMD 4UDUA 3ESVF 4HFUH 3UAJD 4M6NL 4NKMB 5BRZA 2R2BB 3FMGL 2AV1B 1T0NB 3T3ME 2R0KL 5DRNB 4EDWL 5H94A 1AD0A 3WFHA 2H6PA 1LD9B 5FK9A 3BMWA 4JGUA 4XPGH 1RD6A 1MNUH 1NMCB 4WO4A 4XCCH 4XXCA 3MJ9H 5GGUA 4ZFOL 3K8KA 1KN2L 3ARBC 2D7MA 2VE6A 3BW9B 5DJ0B 4Y89A 3VGGA 4P4RB 2X70B 4L4TE 5EIVA 3DECA 3NCYS 2R1XB 4KDWA 4BA8A 5JZ7D 3UO1H 1JYVA 1P9MC 5L88H 2R69L 1WVZA 5LGKA 1V05A 5EZIH 5K9OB 1MAML 3NZHH 4FFVC 2XYCA 3RVWC 1PKQE 3P0VL 4XC3L 3C5SB 4PJEE 3P30L 3H3KA 5FOBB 2CLZA 4QWWD 5GPRA 4XC1L 2IADB 5DD6B 2HFGL 3BEVB 5DJZB 1FFOA 1GGCL 3RHWK 1NC4A 2GHWB 1EH9A 2EIZA 2R4RL 1EAJA 5DJ8B 2ICEA 4JKWA 2DN7A 5E2TH 5HXMA 2WP3T 2VAAA 1A7OL 2GUOA 3O4LE 4HK0B 4JEGB 4LSUL 5D2NB 3QDMD 3KHOA 5J9PA 2FEDC 2GTWA 1UEMA 4MDIB 4XMPH 15C8H 5DJYB 4UBDC 3MQIA 2G75B 3F5WA 4OZGF 2NY1C 5F7FA 1T22A 3FQWA 4WCYH 4RMRA 5FA3A 4DUXA 1KELL 3HR5B 5K9JL 4CAGA 1XIWD 4KKLC 1HWGB 5J06A 1CL7L 4QY8A 1KTLB 1CTOA 2GK0A 3HFMH 3P2TA 1DVFC 3INUL 4JKMA 4XVSH 1PEZA 3F7RA 4JZJC 3DXAA 2F53E 3VXOB 1I1FB 1C1EL 5TFSH 3IVKA 3H7LA 1FBIL 2AGJL 3E6HA 4L4TD 2VABB 4OBSA 3GUTB 1PKOA 3AAZB 5MENE 5I2IA 1H5BA 2R2HA 1QTYT 4FQPA 3B3IA 4G80B 2OLDA 5BXFA 1FAIL 3PABB 4NWTL 1CN4A 1GL4B 2IQ9L 1ZSDA 1PKQB 5C2BH 1UA6L 1WFTA 2GQHA 2NW3A 4M6OH 5EZJB 5CJBA 3TH4T 3AXLA 3WSQH 4V1DE 3MFFB 1H8OA 1SBSL 3PDDA 3P9MB 1AQDB 1WFOA 3CSYA 3QISA 4GW4A 2CKBA 3ULSB 4ODUB 1YYMH 1FSKC 3ZKQD 3GSQA 4P4KD 1FCGA 4OT1L 3O4LD 4Z7VB 4K71B 4LCCC 3U0TB 2H32A 2ZKHL 3O4LB 3O2WH 1BMGA 4P57A 4XWOC 1QFWH 1FL3A 4OLVH 1BP3B 3ARDC 1DJSA 4LHUA 3K4ZA 3WS3A 1HZHL 3V95A 3EYSH 3IF1B 5GGTH 5TF1L 1XF5A 1HXYA 3SE9H 4UB0H 3KPLB 3MFGB 4P2RE 4U6XB 2CXGA 2HMIC 4GJTB 3BSZL 1EDQA 3VMOA 1I75A 5J1TC 1U58B 2ZUXA 3AMKA 3Q5OA 2MMXA 2JB5H 4JHWH 1R3LB 1N3NB 1W0YT 2F53D 1L7IL 2VZ3A 3JUYA 4GAYA 1R5WB 2F53B 2R2EB 1JTOA 1ZGLB 5D1ZD 3DX6B 1NQBA 3QO1A 3MRLB 1MCKA 4WU5A 1RAMA 1XF2B 4ZUWB 4X6DF 5MEND 4PJDE 4N5UA 3CH1A 3PL6B 5MENB 1YEJH 4HF5L 4LVOB 1BBDH 4H20H 4XPAL 3ZDYE 4XPBL 5GRXG 4YHYB 3TCLB 1I3UA 2AXGA 2WUCL 2CK0H 2F15A 1AKJA 1NBZA 3GDBA 2VXSL 5HHQA 2P24A 5F7LB 3OJMB 1CT8B 4HBCL 4V1DD 3THMH 4OUOA 5CZXD 4MMXC 4V1DB 2BDNL 5CP7A 2WWKT 3QSKB 4M43L 3L5IA 3WKML 4LSRL 2NTFB 4PRNB 3P11H 3TT3L 3DHMA 5DHXB 5EUKA 3G9AB 4EOWH 5L8JB 1A6WL 2RAMA 1H3UA 3N85H 1QBAA 4PG2C 5D5MF 2NR6D 3KNBA 4G8GE 5J13C 5I66B 1QBMH 3QHFH 5C07E 1YUHA 4OLUH 4FQHA 4P2RD 2QLVB 1L9MA 4M9PA 4YHLL 1OARH 1QACA 4P2RB 3MLWL 4NN5B 4HAGA 1IL1A 3TBYB 3NPSB 3LPWA 2NX5A 3U7AA 4IM8A 3NBNA 5DSCB 5IVXA 5CD5C 3MBEA 3TFKD 5B3JF 1X6LA 5I1HL 1HIMH 2YWZA 4UT7H 4MAYA 5EU7E 3NCBB 2V5MA 5TQ2H 5I8CA 4N8VA 4KVNH 1IQDB 4IIQB 3U0PB 3T0DA 4WU7A 2ZUYA 5CINH 3IS1X 3DRQB 4LARH 4U0QB 3V0WL 4PJDB 2FEEL 4Y88A 2CUHA 5EU5A 2X9YA 1NFIA 4U1LB 3RGHA 4JFYB 4H88H 5EIQA 1BGXL 5JIPA 2DQIL 1JIBA 2AABH 2Y07L 5J6HB 5TE6H 1KCRH 3WIHL 3BQUA 2FX9L 3MXVH 3QO0B 5DRZA 1S5IL 1W72A 2BSTB 4S2SB 1M4KA 3JWDH 2NY6D 1TZHB 3FAWA 4YHZH 5E2WL 5FKPA 3RWEA 4ZG1A 2NY6B 3B5GA 2FDBP 3I9GL 4PY8J 5HDBE 5E8PB 5I8KL 3L95A 1DDHA 4X6EB 3V7AE 2K9UA 4U1GC 1MFAL 5C0GB 1JGDA 4H8WC 4MAUL 4NRXB 4GAJL 3HE6C 4UQ2A 1MHHA 2P8LB 4G8GD 2AXFB 5I8EA 2ARJA 1MIML 1ORQA 3CLEH 3I75A 5C07D 4U1IA 2F8OA 2D4DA 4WHCA 5C07B 3QXDB 4PB0H 3DRTB 4KZDL 1CDUA 7FABL 1JN6B 3KPPB 1KB5A 3Q5TA 1T7ZA 3TA3C 4XCFH 3TT1L 4HHAB 2IAMD 4JPIB 3RWDB 5I0ZA 2A6KA 3A0OA 1IEAB 3P9LA 3Q48A 3X14B 1DFBL 4M7JH 5HJ3A 3LIZL 4O4YH 3QNZB 1S9VB 2EXYC 2QSCL 4JFZH 4U3HA 1X44A 5E00A 4X7TB 4U2YA 2AS5M 2C9AA 3DUUA 1QA9A 2G9HA 1BQHB 2WNGA 3QWRA 3LV3B 2D03H 1CWVA 2GKIA 3QEUA 1BOGB 1LWRA 4MA7H 3VXME 5LGHL 1XCQB 4X6DA 4OGXH 5DVMA 3ARYA 2PW2A 5EPMB 4CMHC 3MV8B 1MHCB 3KLAB 1SY6H 1EPFA 4YZFE 5IEHB 1NANH 1ACYL 3KPSA 4KK8D 4OKVA 4U6TA 4FP8H 4DAGH 1JHTA 2B20A 5IR1A 1TZIA 4G6KL 4FZEH 5CJ8A 3SGEH 3SGKA 1NGXB 1P69B 4PRHA 3ME0A 2JJTA 1KYOK 3OKOA 1LK3H 3SE4A 3MODL 4YNYA 2E9BA 4NO2B 1W2KT 3GMPA 1GGBH 1LO3L 4NFCA 1A1OA 3D3VE 3OKMA 3KHQA 4JDVA 5BZDB 3FB7A 1G9MH 1ZVHA 1EEUA 3TH3T 2HKHH 5EULV 3GSWA 4F37K 5MERA 4JM2D 4P3DB 3JV5A 3QCVH 1HQ4B 5LXGL 4G8EB 1CQKA 5GSRB 5D5MA 3T3MF 5L2KA 2GJ6E 2R0WH 1ED3A 1OB1B 3GSXA 5GS1B 1I3GL 1YEDB 1HYRC 2PTVA 4QRPB 1IILE 1FL5B 4FFYL 4LCWA 3FQXB 4R26L 1I9EA 1AE6H 4K8RL 3GMRB 2ZUTA 1JWUB 4JO1H 3PWLB 3T09A 2C7UB 4LGRB 1I85C 1YEEH 3SKNA 5ITBH 1MEXH 5DJXB 3FOMA 3MUHL 2WBKA 1A0QL 3VFSA 4P5TC 4FQXC 1UM6H 2V9RA 4FTVE 3QNYA 4LKXB 3ZKNC 4LRIC 4KTDH 3ZT6A 1TJIH 4M1DH 3H0TA 1M6OA 3VXMD 2BNQE 3ULUH 1YJDL 4ZS7H 3TPUA 1P7HL 4WTWA 5H37H 5JW4N 1XZ0B 1U8KB 2DB8A 3NA9H 3WCYA 1UVQB 3WEXA 4IDJL 4KK6D 1BREA 4Z77A 5KS9A 5BVPH 2X42A 4LLVA 5LAXA 2XZCL 2FGZA 2VN7A 4XXDA 4HLZH 3RWCB 2IBZY 5TE4H 2XZQH 3QRGL 1TQBB 1H9VA 4TUKH 4Y0GA 1U8JA 1FGNL 3GO1H 1QSEA 1E0OB 4Z7VF 4WV1A 3DVNA 2AJSL 1MRCH 3H9HA 4MNGA 1JHKH 3D3VD 4XNZC 2XWBB 1S5HA 4DGVH 3GMNB 3QDHA 2OTPA 1DEDA 3D3VB 5SV3A 3ULVL 3QIWA 1CR9L 5D70L 3MLUL 2VL5B 4ZSOE 2GJ6D 1B4JH 4PY8I 3CFIC 5J12B 4BKLB 1SJHB 3DGGB 5KANI 1MAKA 2GJ6B 2IMMA 5JO5B 4UNVA 3UTZB 3FL7A 4TOYL 3SDAA 2QL1A 3JVGC 3C5JA 3I6KA 4OZFA 5ILTH 4NKIL 4NKMA 4NOBA 4M3KB 3GIVB 3BYYA 5DWUL 1I9JH 3I3DA 5FOJA 2O5ZL 2PO6A 1WEJH 3HTLX 4MCZA 3L6FA 4FTVB 4HWBL 4NQDE 2DDQL 2IF7A 4K3JH 5IHLB 2XNAB 3QUYB 2BNQD 2FH6A 3GSNA 4NUGH 3SKMA 3V79C 3UPCA 2YPVL 4M61B 1T7YA 1ZLUH 4JB9H 2BNQB 4P5MB 5FUZH 1I4FB 3BPNC 1WAAA 3VW3H 2QQKL 5FHBH 1G1CA 5DJ0A 2H2PD 1KV3A 1A4JB 3QHZH 1WJ3A 1HKLH 3OZ9H 4P4RA 4RMSA 1I7TA 3TPKA 3CMOL 3UMTA 1ZT1B 2J7LA 4ZFGH 1JYWA 1AI1L 4LDOB 2JJUA 4LHQB 1DE4B 1AP2B 3QXAB 1QR1B 2V2TB 1YYLL 1DEEB 5DFTA 1F2QA 3C08L 5DYOA 5F7DB 3C6LD 2JCCE 1EHAA 3VFWB 2HH0H 2HP4A 43C9A 1OT1A 2HVKA 4EKXA 4RWYH 1KIPB 2KKQA 5J1AB 1A7BA 1EEZB 2VAJA 3VA2C 3R0MA 4UT9L 4MQXD 4OI8A 2RFXB 2UYLB 4HK0A 1U8OA 2YEZB 2O61B 3OKDB 1H3VA 1VB9A 3QFDB 2NXYD 1HI6A 4XAWH 1NGWB 4TTDC 2ZG2A 2XQYG 1DQTA 4FNLH 1SM3L 3BJLA 5IV2B 5E6ID 5DK0A 5EOCL 4NSKB 5JOFB 1I1YA 4Z7WA 4S1DD 3PG2A 3KDMB 3RQ3A 1QLEL 2YPKA 5ICYA 3ZDXE 4X6FB 2B1AL 3PWUA 4PJDF 4NQDB 1RUKL 3VXNB 3O41A 2HT2D 4JY5H 5I1DA 4G3YL 5F9JB 1PZUB 3OAZH 1PYWA 2CLVB 3WDIA 3RPKA 5FGRA 4XTRC 2W9DL 1I1FA 4QEGA 5FDWA 2CIKA 5DTFB 1FVDA 5CEZL 3GUTA 1ZK9A 2Z8SA 3DOSA 3IDIA 4GRLA 4MD0B 2VMFA 4NP4H 4FQ2H 4JRXB 3SQOL 4NHUB 2Z8RA 3F65A 3QR2A 2Q86B 5DDHA 4G80A 5JA8B 1JK8B 1F8TH 3AB0B 2FL5B 2MKWA 4UU9B 3RWJA 2OR9L 3WHXA 4JFDA 5HYSG 1TZGH 1JE6A 3U30B 5L0QC 2JCCB 1KNOA 3T4AA 3CUPB 4LHUG 1Z6JT 3MFFA 4G6JL 1TDQA 1AQDA 5DD5L 1IC4L 3PF2A 5E5MB 5EORL 3DUSB 1NGQH 1ITBB 2ZCHL 3EYQD 3NCJL 2VWEE 5D2LA 1CFTB 1OPGL 5EN2B 3ROOB 5H8DA 4IRZH 3P0GB 3VWKB 3RX5A 1FVEA 3TESA 3MA9L 5AAMA 1NAMH 4P9HL 5HHVH 1U8PA 3DVIA 1YN6A 4NM4H 1J0HA 5KSAD 4M7KL 2NCMA 1F4WL 3F12A 2R0LH 4FQJL 3C8KB 4KK5D 2NY5H 5F97E 4NWUL 2FBJL 4QRSA 1Y6NR 5FM5M 1FNSH 1HYSD 2AJ3B 3W39B 3LAFA 3LPFA 2Z35A 5FB8B 3QUML 3B9KC 3EAKA 4XB7A 2DI8A 1LQSR 5BVJA 4TRPH 1R5WA 2WBWB 4ODVL 1JI2A 1ZGLA 1A64A 4CMMB 3K74B 3GGWB 3TZVD 1ACZA 4ZUWA 4JFXB 1EEQA 2VITB 1KPVA 1T03L 1T1WA 3GKWL 4BFIB 3O45B 3R06A 3PL6A 3WMSA 3KYKL 5FKAB 1JYNA 4Q0XH 4JQIL 4XVUD 5HDBF 4MA8H 4GO6B 2AK4A 4RIRA 4XNUH 3HE7C 3IXTB 4ESKA 2I5YL 3ZHLA 1T4KA 4F7EB 1UB5A 4H1LB 2AJVL 3TVMC 1C12B 4D9LL 4IRJC 3W9DA 3PJSB 5HHMB 5IB5A 3SJVB 2DQJL 1MHPL 3S6CA 1DBML 4MJIA 2V5SA 4KJPD 3I85A 4OGYL 3QIUB 4J3OC 1D5XA 1G9NL 2VDKL 3CFCH 1BEYH 1DZBA 5GXBB 4XT1C 4JFHE 5HVHC 1KIRA 3LS4H 3WIIL 3D0VA 4N8VG 4S0SD 2XXMB 4P5KB 5EUOA 1IT9L 2CH8A 1PJ9A 4LOUC 5HI5C 4DVRL 3QQ3A 3QPQD 2DLGA 5FM4A 4YBHA 1DTUA 1A7NL 3DO7A 3RIAK 2DWDA 4BQ8A 5I17B 1SEBB 5C0CE 2OK0H 1J1XH 4WRLA 4OUUA 3N9GH 4LLUB 2VISA 5AWNL 3SGDH 4G43A 5MEOB 4CJ1A 4Y5VA 2FJGA 1WTGT 3QDJE 1WT5C 1FJ1A 3U4BH 1KCLA 3CC5B 4PRDA 5DGRA 1MCQA 1IGTA 4PV8B 1N64H 3RVUD 4OCWL 5T3ZD 2NY7H 3LKQB 2W65B 5KSBE 4EN3D 1I1AA 4YZFF 4XP9L 1IAII 2EC8A 4EN3B 3BP6B 4OQTA 4PLJC 1OAXH 3DROA 2PCPA 3BUYB 3DX8A 2DL9A 4KJYA 1GC1L 4JAMB 3S36X 2E7BA 3Q2CA 1WSST 2QQNL 2Q87A 2OZ4H 1HNGA 3L3GB 4IEFB 5TH2A 1AIFA 1SVZA 4L29A 3MRHA 1A9EA 1Y6KR 2HT4D 4LKCB 3BWAA 4YBLC 4GAGH 3QWOA 4FXLA 3FFDA 3BE1L 2BZDA 2H41A 4ZTOH 5CZVH 5C0GA 1E4XI 3PV6A 3RVXC 5BW7A 2GFBA 3MR9B 5GS0H 1NAKL 2P8LA 1KT2B 4JFHD 4QOKA 5E4EB 5F89B 2FECL 2C5DC 5JTWA 1DQJB 1LK2B 5D72H 2AEIT 2GAZA 2XICA 3QXDA 1BJ8A 2EIBA 2IBBA 1Y0LB 2ZCLH 1LO0H 4EBQH 5IUSA 3LSOB 3O6FB 1F6AA 5C0CD 5CD3A 1KXTB 2AV7B 1FIGL 2HKFL 4UAOC 5E03A 1HHIB 1BZ7A 2YZ8A 1KBGH 5A2IH 1SYSA 4JQXC 3QDJD 4L9LC 3KVQA 1IGCH 4DVBB 5D1QC 4EI5D 3W9EB 3HZMB 2R29L 1PSKL 2ED7A 2CJUL 1INDL 4KQ4L 4P2OD 1OSPL 4EI5B 2VJXA 4P2OB 4X7TA 3O0RH 2DLEA 3VGHA 4J12A 3IFPB 4Z8FL 5I0DA 5I74C 2EECA 1Q9WB 2DQFB 4CJ0A 4LMQE 5F7HA 3MRJA 5HHPA 4CADB 4XPHH 2QKIB 2X4UB 1GCFA 1VPOH 2GITA 2BMKA 4JN2B 1JGVL 1DQDL 3SEPA 2E6JA 2VXQH 4XX1G 1T7VA 5IFJA 4TQEL 4RFEB 5ANME 1JGEA 2MCPH 4YWGH 4XMLL 2BERA 3GJFK 4J8RB 1BZQK 2ID5A 4O02H 1JMZA 2P4AB 3ZKMD 4F80A 3EJZD 4AMKH 4B53A 5E95B 3HLAB 2D9QB 4N0CD 5EBMB 4K3DL 4KRPD 3MBXL 2FZ3A 2Q8AH 5IHZB 4XH2B 3AGVA 3O3DA 3VRJB 1RVFL 4KRPB 4YQXL 4XBEL 4JGMA 1CTNA 3VCLB 3GZKA 3L1OL 3QG7L 3NCFB 4P3DA 3UTQA 5T5FL 5A16B 1GHFH 3B2VH 3CK0H 1T7XA 3K8LA 2EIDA 3DMMC 2BX5A 4P2QE 4PJFE 3MLXL 1KJ3L 3FTGA 3LEVH 5GS1A 1CFQB 3AS3A 4QRPA 1LEGB 2HTLD 2UZIL 2JELL 4YFLI 4BH8B 1XFPA 2CLRA 3MUJA 1OOAA 1JGUH 1JWUA 1FGVH 1NMCC 3NFSH 4HWNA 4LU5H 4RFOH 4D8PA 1CZ8L 3WE6A 3BPOB 4RMQA 5KANG 4K23H 1A3LH 4LLQB 4LLAA 2H3NB 3VFNA 1GJIA 1FV1B 2NTSP 3LN5B 2CR6A 4LL9A 5ESVA 5JZ7C 1XZ0A 2Q20A 2BRQA 4WTZA 1P7QD 1IGMH 1H3TA 2PW1B 3P4OA 4PBWD 1I8KB 4P23A 2JCCF 4TPRL 3VFOB 3MV9E 1BWWA 5ANMB 1BQLL 1VGEL 3MLRH 5B38B 3RGVD 1XCTB 2AERT 1IBGH 4I2XE 3C8HA 2OTWB 1I9IL 4YPGB 3ARGD 4J7RA 1F58L 1Q38A 1X9QA 2HFFA 3ARGB 3B83A 35C8H 5EC2B 5CGTA 3V9FA 3WD5L 4KI1A 5D2NC 4J1UB 3ZT5A 3G6AA 3K81A 4OIBA 5ENWA 4PGBB 4KZEH 4OZFG 4HDIA 4YXHL 3KGRA 4LGSB 5KW9L 3BP7B 4P2QD 5KJRL 4NRYA 4R7NB 3V4UH 1FO0H 4NRZB 2EH8L 2V6HA 3L5XH 4JFEB 4NO5A 5DEFA 2FLRT 5JO5A 1KCSH 3BN9D 1S7SA 1XIWC 2I27N 4LASL 2ZPKH 4X98A 3RWIB 1G0XA 1ZANH 1P84K 5E6ZA 1MWAH 1KIUA 5B39B 4AIXA 2EICA 2A77L 3ET9F 4Y1AE 2EYSB 1ZWIB 1Q72H 2VDNL 4HBQA 3BIKA 4YO0B 2A0LC 1EHLL 4ZPTB 5DVKA 3VDBA 2A2QT 4JPWL 3QUYA 2N4IA 3REVB 1XGUB 5D7JD 2Y7QB 4M61A 3JTSB 3Q6GL 5C0EA 5T33H 3NGBB 5DQ9B 1BAFH 3FN0L 1I4FA 5D7JB 2JK5B 5GJTL 3G5YA 3CFKA 1J0JA 3W0WE 1DQQA 5TDPA 3U4EB 3TNMA 5ESAB 4ZUTB 2QADD 4PBVC 4BZ1H 4B5EA 3MV9D 1NAMB 3OF6A 1Q9LB 2UY6A 1ZT1A 2QADB 3NCEB 2X7LB 1WTLA 4V2BA 2WK2A 2OQJB 1QG3A 3ZYOA 3D9AH 1JF5A 5GGTA 5FIEA 3X3FH 4HGWA 5D6DA 1RV6X 4K71C 2CRMA 3RIFF 3RY6A 3VFWA 4P4KC 1UWEH 3N1MC 5DK2A 3U0WH 1ZVSB 3MLPA 3IETB 2EC9U 3J7HA 4S1RL 1DR9A 2GCYB 4WGVB 2MTPA 1CD8A 3B9EA 4KJQD 3VFGL 5JNYB 1ZV5A 4OF5A 3OXSB 2ICWB 4MD4A 4NN6B 4WW2A 2PXYA 4Q7DA 1RZ8B 4IS6A 1I1RA 2CMRL 4PJCA 4OLYH 4RMTA 3OQ3B 1RULH 4O2FB 4NQEE 1VHPA 1SYVA 1UCBH 5SWZA 4HKXA 4R4FH 3VG0H 5DD1H 1K8IA 4K3EH 5I1CL 4Y1AD 3O2VH 4ZAKD 3RZWA 4X6FA 2X4NB 2E27H 4Y1AB 2VDPL 4ZAKB 3IFLH 3MPCA 4DK3A 5IMLA 3T08A 1CE1L 2EDHA 4TNWF 5DUPH 3L3DB 1TVHA 1AO7E 4JFOA 4I3SL 5F9JA 3W0WD 4LVOC 2CLVA 1YEIL 2VLKE 4YHYC 4LSSH 4B0MM 1KB9K 4PJXA 4PRIB 3MRMA 4JFPB 3LS5H 2JJWA 2E7LC 3S37H 5TPWL 1T83C 4MD0A 2ESVE 3AMLA 4NHUA 1QEWB 3RDTD 1RURL 2Q86A 4BUGA 1UB6A 5I1IH 2F19L 5CZXC 1JFQL 1UFUA 2OL3A 1T0MB 1AGDA 4H8WL 1KC5L 5IW3A 4NZJA 3MYJA 2CUMA 1NFDA 3FQRA 5MP6H 4JRYA 5GJSL 1A6VL 2YXMA 1OCWL 5HYQB 4WHYH 5IT2L 2FX7L 4NQTA 4FZ8L 1QO3B 2PYEA 3QCUH 2WWMD 4PJ5E 2ILLA 4G42A 3ECBA 2NR6C 1T3FA 1CFTA 3HC3H 3ROOA 2AEPL 4YIQB 1VA9A 2C4FT 2ZP0T 5I1JH 2C1OB 3BVNA 3ULUF 4I9WE 4NN5C 4NQED 1DBJH 1TVDA 2A74B 5CILH 2DLHA 3Q1SH 3HRZA 4W81A 5MEPA 3X3GH 1JZ7A 4I18A 5KSVA 2QR0B 4G7YL 3OWEA 3TFKC 4ZUSB 4IIQC 4R96B 1F4XH 3RWFA 1R3KA 3SKJL 3QEGL 1ZA3B 5IB2A 4C55A 3UJIL 1N0XL 3VFTA 1AO7D 1Z9SA 1ETZB 4RFNB 3WLBB 4KY1H 2VXVH 1AO7B 4UIMA 4MMZC 3MLYL 3GRWL 3V52H 4LSDA 4O51B 4OLZL 2VLKB 2BVYA 3CX5K 2H45A 3H9YA 2FATH 1LP9A 2D7TL 4Y2DD 5ID1B 5HD8D 2E9IA 2XTJD 4PJ9D 3SDXB 2ESVD 4Y2DB 4CVUA 4JLRA 4PJ9B 4PLOB 3L7FA 2NY6C 3H3PL 1D6VL 5B4MC 3KPMB 2HWZH 5I76B 5IQ7H 3K3QA 4JQVA 1JTPA 1ZS8B 4I0PB 4FQCH 1BFVL 5LCVH 2XG5A 2CXKA 3MCG1 5FA4B 2DTMH 2OMNA 1Z9OA 5EU4A 4Q9CA 1R5VB 4U1JB 2WINB 1FIEA 4QHMB 4PJ5D 5L9DL 4HCRA 3FO9B 3PWVA 5CP3H 4QHLA 2BRRL 3SJVA 4L3CA 2XKUA 2ITCA 1CFNB 3KPQA 4GBXD 4P3WA 2HFEB 4I9WD 2X1WL 5AD0A 3V6OA 3IRPX 3TYGH 1WCBA 4GBXB 3QIUA 4RBPH 5F1NB 4F8QA 1DN0A 1IEBB 2FHFA 1EVUA 4OLEA 4M5ZH 2JLLA 4ODBD 3VI4E 3TF7C 3FOLA 3H3BC 5EU7C 1DLHB 1FFNB 3IDMA 4K8RD 4X4XB 1SY6A 1M71A 4CNIB 3BKML 3LKNB 1RMFL 4LCIL 3T2NH 5F96L 4WY7H 4M00A 1WBZB 1N59B 3S34H 1M7XA 2X5PA 5C9JB 1JZ6A 1WICA 2YRLA 4DN4H 1RUQL 2R8SH 1DN2A 5HY9A 2J4WL 5EZLB 1BD2E 5JXEA 1VESA 2MWCA 4MJ6B 5M7QA 2BNUB 2W92A 4QXGL 4PJBE 4KK8C 3F7YB 3ARFD 3MOAH 3U1SL 2H26A 4XP6L 3KJ4C 2E5EA 4ZOBA 4PLNC 1NANI 2EH7H 1Z0NA 4PYGA 1NL0L 4JJ5B 3CPLB 4C57C 4OD3L 1JPST 3SGEI 4UT6H 4YHNB 2X41A 1OW0C 4BZYA 1D9KD 1VGKB 3BISA 3ZYIA 4Q9QL 3BH8B 1D9KB 4OCXH 4GMTL 2DQCL 4H0GA 1ZLWH 3F7VA 4OCSH 4RAUA 2HJFB 4TVPL 1MJJA 5ALBL 3MV11 1Q1JL 2NMSA 3CXDL 3OR7A 3WUWB 4Q9RL 4G6ML 4ENED 2AJXL 4JPVH 4JFQB 3BGFB 1R3JA 4L4VE 3OG6B 2MHAB 1OP5K 4J3UA 1LE9B 4IMLB 2NY4B 3V5HA 1U3HB 3HZKB 4JHAL 2IAND 1XAUA 1K2DB 1KIQA 3T0EE 4D3CL 3LSOA 3O6FA 4PTTB 3DURB 4XZUB 2DAVA 4L5FH 3AC0A 5HDOA 5I19H 1HHIA 2E3VA 1IC5L 1MJ7L 5JIKA 1MJ8L 1NCWH 1C08A 5KZCD 2XG4A 4DVBA 3S88L 4X0KA 4OM0H 3TC9A 2E9JA 1C5DB 2ZCKH 4MNQB 1WLHA 4ZPVB 3SE3A 5DMIH 4F33B 3MGTB 2QHLA 4ODTH 5K33A 1MCFA 2NLJA 1ZEAL 3VRLE 1BD2D 3S35H 1H3GA 2CDEA 4OD2B 3RNQB 3LQMA 2WUBL 2DQFA 4ZXBD 1KCKA 3QFJB 1Q0YL 1G6VK 4NQXB 4ODSL 4KK6C 4LCYA 3MOQA 4PJBB 5E94A 1I1CA 4Y2OA 2Q8BH 5CEZE 5IFHH 2BY2A 4PJ7B 4Z0XB 4Z5RB 1RIVH 3S96A 5C09A 1JRHI 5EB9A 5CSZB 1NC2A 4Z76A 1K9TA 4HXBH 4FQIL 3T0VA 1RIUH 3JBG7 4WWID 5E99L 5B3NA 4Q2ZB 1U8QB 1I8LC 1D5MB 1MWAB 3ZL4L 5C0JA 3FJTA 4LAJH 5H35A 5EBMA 4L4VD 3MACH 1RHHB 3BKCH 2XZAH 2F5AH 2APXA 1AJ7L 4L4VB 3MLZL 1MCPL 4DGYH 5HVFB 3T0ED 5IMOB 1N6UA 3VCLA 1DUYB 1N5YL 1W0WB 3T0EB 3CD4A 4JKLA 3MRIA 1YPZE 5D7IA 2UV3A 5T1DH 3WFEL 1VFMA 1G7MB 1UKTA 5DQDH 5TE7H 5HYJE 1CFQA 1PQZB 3MLVH 4JG1H 1YEFH 4GRWH 2PN5A 5CKGA 4WNQB 3BESR 3T0BA 4XNXL 5BZWA 5IBUB 4N1CA 4WTZG 1MFBL 3M8OL 5T1KD 4MWFB 3FFCB 1FNGA 3RVTD 5T1KB 1MQKL 1A14H 4AH2A 2Q1EA 3G5ZA 4NDMA 1KJMA 3AU1A 1JWSA 2J5LB 3R8BB 1XGQA 1ZT4A 5CEZD 1OQXA 2H2PC 3G5VA 2KQNA 2DM4A 3BPLB 4XHJD 5EU6E 4PJIE 3C87A 2CIIB 3K2UH 1OGAE 1UYWL 4HLJA 4XP5H 1O5DT 4YGVA 2PW1A 2BC4B 4WIQA 4LLDB 4URTB 3RTQA 1HNFA 4M4RA 4F9LC 5EO0A 3D5OF 4HIEB 4RWHA 3T77B 3C6LC 4JPKH 2ZUQB 1MHEB 2SEBB 1R5IA 4BSWB 1FNHA 1XCTA 2EEDA 2R0KH 1GGIH 3SN6N 4HIXL 4U1KB 1A6PA 2I26N 2XPGA 4OIIH 4CW1A 3CVHH 5DJAB 4PY7A 1F45A 5DMKB 5EC2A 4MQXC 4RGMB 3VI3E 4ZFZA 3IKKA 4M1GH 3C9NB 3RFZC 1J0KA 5IWLC 1A6UL 4JY4A 1F4AA 1JNNH 3BMVA 2ZSVB 3QA3A 4PJHA 5HHOE 5SWSA 5IP4A 2M1KA 1EAPB 5E6IC 5F7KC 4OJFL 4QXUL 3LKPA 4DW2L 5HYJD 4HIHA 3IT8D 3BH9B 4POUB 4FMFA 1PY9A 2CGRH 4JFEA 5TDNA 4G8FB 3V4PL 5HYJB 5I1LB 3BO8A 25C8L 2R69H 2GSGA 5BO1L 4WVRA 3T8XB 5L7XH 3RWIA 4D9QE 1NEZA 1P2CA 1MCNA 1HSBB 2K3TA 4XC3H 3EYVB 3P73B 3ZTNL 2VLRA 5JHLL 1A5FH 5C8JA 2HT2C 2P5EE 2YN5A 2HFGH 1EO5A 2YPLE 3KS0H 4PJ8D 1L0QA 5DMGD 3X13B 4UINH 3BOVA 3SDXF 4PJ8B 4IDLA 5EU6D 5I8OL 5FUOL 2EKSB 1XGUA 2G5RA 1JP5A 2VL4A 4QHNB 1LEIB 1YY8B 3QNXB 5EU6B 3MSPA 1OGAD 3FO2A 4PJIB 3QPXL 1OGAB 4OCYL 3C2AL 3U4EA 3AB0C 2FR4B 3V4VH 4RA0C 2W0KA 1ZHNB 4ZUTA 3QWQB 4GAFB 2WIMA 1ZHKA 1FORH 2YD1A 1EFQA 4NQSB 2RCSL 3U30C 2ED9A 4NZUH 1QD0A 3RL1A 4DKFL 4Z7NF 1DL7H 4RX4D 3ZE2E 5I1KL 4X6CA 5C3TA 1A6ZB 3LCYA 1ONQA 1P4IH 4OF6A 5K9JH 2YUZA 1JL8A 4QNPE 1Z5LA 5FXCH 3S4SA 4I5BA 1CL7H 2X1QA 1MCOH 2VH5L 4OAWB 4GG6E 4MNHA 3ELAT 5DR5H 3EYQC 3INUH 2WIIB 1ZVSA 3VWKC 3PWJA 2QV2A 4N1EA 1I9RL 1RIHL 2OP4L 5HGBA 2IFFL 1IFHL 1CFVL 1C1EH 1QFUL 3OXSA 2UWEE 5HHOB 3TWCL 1FBIH 5DZNA 1NKOA 1CLZH 1WITA 4JM4L 4PRPA 5KSAC 1A6TA 2F74A 1XT5A 3FONA 1CI5A 2YUXA 3VXTB 5A3ID 1HINL 3JWDC 4D9QD 3RP1A 1KJ2A 5IOPB 1UXWB 1S9WA 5DJCB 4LIQE 2AK1H 2Q7YA 1YMMA 5C0AA 2P5ED 1Z3GH 4LNRA 2YPLD 4TSAH 2X4NA 2R23B 3RU8L 2P5EB 1FP5A 2YPLB 2UVFA 1N2RB 4KROB 4LPCA 1S8DA 1JPTH 1F90H 4A6YL 5C0RH 2QTEA 1IKFH 3R1GL 1WF5A 3MROA 3UJJH 3V6FB 2BNRE 5KVEL 4HEME 1UM5H 5FYKU 3MRDB 4P3CH 4UTBL 4XVUC 2M2DA 4YDKL 4LSQL 5EIIA 2WBJD 5EO9B 1S7QA 1HZHH 2ARJQ 3P4LA 1U41A 1IZJA 4HS6B 3RL2A 5TF1H 3O6LL 3B9AA 4W4OC 5F70A 3BZ4A 4UDTA 5DFWH 4XNMA 4KRNA 4BQBA 1GRWA 2UZXB 3QQ9D 2Z93B 1CDBA 1S7WB 5K9KB 4PGEB 2VWEC 3PGCA 4GG6B 4GRMB 3RI5F 1A7QL 2ORBL 4YDVA 4HGKC 4KJPC 5GQBA 3ZT7A 1U8IB 3VRIB 1OF2A 5HYQA 4Z7OF 5DRXA 4NHCH 4JY6B 3RAJL 1CE6A 3MXWH 2UWEB 3U7WL 3VI4F 2ZJSH 4MDJA 4KTEH 3HNTL 2ZSWA 1AY1H 5FCSH 4HW6A 2F8VA 2LABA 1A4KB 1VSCA 1DANT 2M26A 4Q6IB 5IF0A 1ORSB 4RISL 3VXUE 4I1NB 1MFCH 3QPQC 1S9XB 1U6AL 4K3GA 1J0IA 2Z92B 3NABL 1S9KC 5KVFH 1JPFB 2AQ2A 1V7ML 4M7ZB 3WNPA 1PBYA 4ZUSA 4R96A 4APQD 4R3SB 5FF6A 1FAKT 5SWQA 4F7CB 3MJ6A 2OZ4A 3GK8H 4APQB 5FYLL 1MREH 3IDNB 5DO2C 5KVDL 3WHE1 1IGJA 4Z7UE 1RPQA 2BNRD 5DK3A 5DURB 3RVUC 1I7ZA 1Q0XL 2OTUB 4C83B 3GMMA 4ELKA 1NDMB 3UDWA 4EN3C 3IXAB 4PJBF 1JZ5A 4LPXA 2W9LA 2GEEA 4DZBA 4OI9A 3SDXA 4PJ7F 3IDUA 3IJHB 4Z18A 4CVXB 2X4RA 5CEYA 1Q9OB 3SDDA 2OJEB 5D1ZA 3MO1A 3PIQB 4D0BB 5IW1A 3KPMA 4YHLH 3ZE0F 2AJYH 1KG0A 1MFEH 3CXHK 1HOCB 2YK1L 4I0PA 3AM8A 1BQSA 3SY0A 5CCKH 1XR8B 2OXHA 3HNVH 1YDPA 4KQ3L 1N4XH 4U1SA 3C60D 5IIEB 1T1YB 3QQ4A 5KOMC 5T3XH 4QRQB 43CAA 4K3HA 4UTAL 3TIEA 2EXWD 1MIEL 2COQA 3K7UA 5E4EC 1AGFA 4JZNA 5E0QA 3LPGA 5ADPL 5BCAA 2CO7B 2NZ9D 2VDML 3V0WH 5CJOH 2ZZUT 4FXKB 2XN9E 2W91A 1CGSH 4KPHL 4M4PA 4S1SL 5GSVB 1C5BH 1ZA6A 1H15A 3WO4B 2O5YL 4BFBD 4Z78A 3MNWB 1MVUB 1ZTXL 3VXUD 3O3BA 3B6SB 5F1NA 1S7XA 3C5ZB 3H9SA 2J12B 4L4JA 1PDKA 5KBNC 1IEBA 4WI6A 3RY4A 1A7PL 5IJKC 1S7RA 3HAEA 1NCBL 2JIXA 5DHVA 1T5WA 5ERWB 5ISZB 1RJCA 5C0FB 3H8NA 2FX9H 1ROWA 1S5IH 3CDYA 3O8XD 1OTUC 1L6ZA 3GSNL 3O8XB 2NQCA 4E42A 1RJYA 3DO3A 2D7QA 3VXPB 4EI5