2BN7A

Mn substituted e. coli aminopeptidase p in complex with product and zn
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 158
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bn7A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bn7A02
2NQ7A 2GG2A 2GZ5A 3IL0A 1QXZA 5CE6A 2EVCA 2BHAA 4FLIA 2GGBA 4U1BA 3IG4A 5E5BA 3PN9A 2Q95A 4PV4A 2GG5A 3L24A 4U6WA 4MATA 3I7MA 1C24A 2BWUA 3RORA 3OOOA 5FCHA 3FM3A 3OVKA 1YJ3A 2EA2A 1W7VA 2NQ6A 1R5GA 1C22A 3O5VA 4PNCA 2G6PA 2BWWA 1A16A 2GG3A 4FUKA 2BWVA 2GU7A 4R60A 4IKRA 4Z7MA 2BHBA 2ZSGA 2DFIA 2BWYA 3IU8A 3MX6A 1W2MA 1B6AA 2OAZA 4OOKA 1M35A 2P98A 5D6EA 2Q92A 3BIQA 1KQ9A 1R5HA 2GGCA 1B59A 2Q8KA 4KM3A 1XNZA 4U76A 3CB6A 3PEBA 2BWXA 1R58A 5CDVA 2Q94A 4ZWUA 3PKAA 4FLKA 1WN1A 2BHDA 4FKCA 1WL9A 4U71A 4QR8A 1CHMA 1Y1NA 2GA2A 4A6VA 5CNXA 4JUQA 2B3LA 4IKTA 4IU6A 5D6FA 1QXYA 5CLSA 2GG8A 3RVAA 1MATA 2ADUA 3MR1A 3PKBA 3Q6DA 2P9AA 2EA4A 5FCFA 1WLRA 2EVMA 3CTZA 2BHCA 1WKMA 3FMQA 4IDYA 5JI6A 2GU4A 2BWTA 1PV9A 2IW2A 2BB7A 2MATA 4RZZA 3D27A 3IU7A 2Q96A 1WL6A 1XGOA 1KQ0A 1WBQA 1O0XA 2GG7A 4IPAA 1YVMA 1QXWA 3PKCA 3TB5A 3IU9A 1C27A 1JAWA 4U6ZA 4S00A 2Q93A 4ZWOA 2GG0A 3CB5A 1YW8A 3FMRA 5CIKA 2BN7A 2V3ZA 1XGMA 3PKDA 4HXXA 4EGEA 5CDLA 5JFRA 2HOWA 5JHUA 2V6CA 2GU5A 4RGZ1 4FLJA 4U6JA 3BIPA 3S6BA 2GG9A 2BH3A 2BWSA 1BOAA 2B3HA 4ZNGA 3TAVA 4A6WA 2V3YA 2P99A 1QZYA 1XGNA 4S2TP 1XGSA 3L7GA 1BN5A 3BITA 4ZWPA 2EVOA 2GU6A 4IECA 1YW7A 4S2RP 4U6CA 2V3XA 2OKNA 2B3KA 1KP0A 4RZYA 4FO7A 1C23A 4IF7A 4U73A 4IKSA 1N51A 4U69A 3QOCA 4U70A 4FO8A 4U75A 3PKEA 5E2CA 3MATA 5CDEA 2GTXA 4FLLA 4S01A 1C21A 1WY2A 4U6EA 4IKUA 1YW9A 4B28A
chains in the Genus database with same CATH superfamily
2NQ7A 2GG2A 2GZ5A 3IL0A 1QXZA 5CE6A 2EVCA 2BHAA 4FLIA 2GGBA 4U1BA 3IG4A 5E5BA 3PN9A 2Q95A 4PV4A 2GG5A 3L24A 4U6WA 4MATA 3I7MA 1C24A 2BWUA 3RORA 3OOOA 5FCHA 3FM3A 3OVKA 1YJ3A 2EA2A 1W7VA 2NQ6A 1R5GA 1C22A 3O5VA 4PNCA 2G6PA 2BWWA 1A16A 2GG3A 4FUKA 2BWVA 2GU7A 4R60A 4IKRA 4Z7MA 2BHBA 2ZSGA 2DFIA 2BWYA 3IU8A 3MX6A 1W2MA 1B6AA 2OAZA 4OOKA 1M35A 2P98A 5D6EA 2Q92A 3BIQA 1KQ9A 1R5HA 2GGCA 1B59A 2Q8KA 4KM3A 1XNZA 4U76A 3CB6A 3PEBA 2BWXA 1R58A 5CDVA 2Q94A 4ZWUA 3PKAA 4FLKA 1WN1A 2BHDA 4FKCA 1WL9A 4U71A 4QR8A 1CHMA 1Y1NA 2GA2A 4A6VA 5CNXA 4JUQA 2B3LA 4IKTA 4IU6A 5D6FA 1QXYA 5CLSA 2GG8A 3RVAA 1MATA 2ADUA 3MR1A 3PKBA 3Q6DA 2P9AA 2EA4A 5FCFA 1WLRA 2EVMA 3CTZA 2BHCA 1WKMA 3FMQA 4IDYA 5JI6A 2GU4A 2BWTA 1PV9A 2IW2A 2BB7A 2MATA 4RZZA 3D27A 3IU7A 2Q96A 1WL6A 1XGOA 1KQ0A 1WBQA 1O0XA 2GG7A 4IPAA 1YVMA 1QXWA 3PKCA 3TB5A 3IU9A 1C27A 1JAWA 4U6ZA 4S00A 2Q93A 4ZWOA 2GG0A 3CB5A 1YW8A 3FMRA 5CIKA 2BN7A 2V3ZA 1XGMA 3PKDA 4HXXA 4EGEA 5CDLA 5JFRA 2HOWA 5JHUA 2V6CA 2GU5A 4RGZ1 4FLJA 4U6JA 3BIPA 3S6BA 2GG9A 2BH3A 2BWSA 1BOAA 2B3HA 4ZNGA 3TAVA 4A6WA 2V3YA 2P99A 1QZYA 1XGNA 4S2TP 1XGSA 3L7GA 1BN5A 3BITA 4ZWPA 2EVOA 2GU6A 4IECA 1YW7A 4S2RP 4U6CA 2V3XA 2OKNA 2B3KA 1KP0A 4RZYA 4FO7A 1C23A 4IF7A 4U73A 4IKSA 1N51A 4U69A 3QOCA 4U70A 4FO8A 4U75A 3PKEA 5E2CA 3MATA 5CDEA 2GTXA 4FLLA 4S01A 1C21A 1WY2A 4U6EA 4IKUA 1YW9A 4B28A
chains in the Genus database with same CATH topology
2NQ7A 2GG2A 2GZ5A 3IL0A 1QXZA 5CE6A 2EVCA 2BHAA 4FLIA 2GGBA 4U1BA 3IG4A 5E5BA 3PN9A 2Q95A 4PV4A 2GG5A 3L24A 4U6WA 4MATA 3I7MA 1C24A 2BWUA 3RORA 3OOOA 5FCHA 3FM3A 3OVKA 1YJ3A 2EA2A 1W7VA 2NQ6A 1R5GA 1C22A 3O5VA 4PNCA 2G6PA 2BWWA 1A16A 2GG3A 4FUKA 2BWVA 2GU7A 4R60A 4IKRA 4Z7MA 2BHBA 2ZSGA 2DFIA 2BWYA 3IU8A 3MX6A 1W2MA 1B6AA 2OAZA 4OOKA 1M35A 2P98A 5D6EA 2Q92A 3BIQA 1KQ9A 1R5HA 2GGCA 1B59A 2Q8KA 4KM3A 1XNZA 4U76A 3CB6A 3PEBA 2BWXA 1R58A 5CDVA 2Q94A 4ZWUA 3PKAA 4FLKA 1WN1A 2BHDA 4FKCA 1WL9A 4U71A 4QR8A 1CHMA 1Y1NA 2GA2A 4A6VA 5CNXA 4JUQA 2B3LA 4IKTA 4IU6A 5D6FA 1QXYA 5CLSA 2GG8A 3RVAA 1MATA 2ADUA 3MR1A 3PKBA 3Q6DA 2P9AA 2EA4A 5FCFA 1WLRA 2EVMA 3CTZA 2BHCA 1WKMA 3FMQA 4IDYA 5JI6A 2GU4A 2BWTA 1PV9A 2IW2A 2BB7A 2MATA 4RZZA 3D27A 3IU7A 2Q96A 1WL6A 1XGOA 1KQ0A 1WBQA 1O0XA 2GG7A 4IPAA 1YVMA 1QXWA 3PKCA 3TB5A 3IU9A 1C27A 1JAWA 4U6ZA 4S00A 2Q93A 4ZWOA 2GG0A 3CB5A 1YW8A 3FMRA 5CIKA 2BN7A 2V3ZA 1XGMA 3PKDA 4HXXA 4EGEA 5CDLA 5JFRA 2HOWA 5JHUA 2V6CA 2GU5A 4RGZ1 4FLJA 4U6JA 3BIPA 3S6BA 2GG9A 2BH3A 2BWSA 1BOAA 2B3HA 4ZNGA 3TAVA 4A6WA 2V3YA 2P99A 1QZYA 1XGNA 4S2TP 1XGSA 3L7GA 1BN5A 3BITA 4ZWPA 2EVOA 2GU6A 4IECA 1YW7A 4S2RP 4U6CA 2V3XA 2OKNA 2B3KA 1KP0A 4RZYA 4FO7A 1C23A 4IF7A 4U73A 4IKSA 1N51A 4U69A 3QOCA 4U70A 4FO8A 4U75A 3PKEA 5E2CA 3MATA 5CDEA 2GTXA 4FLLA 4S01A 1C21A 1WY2A 4U6EA 4IKUA 1YW9A 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ7 A;  2GG2 A;  2GZ5 A;  3IL0 A;  1QXZ A;  5CE6 A;  2EVC A;  2BHA A;  4FLI A;  2GGB A;  4U1B A;  3IG4 A;  5E5B A;  3PN9 A;  2Q95 A;  4PV4 A;  2GG5 A;  3L24 A;  4U6W A;  4MAT A;  3I7M A;  1C24 A;  2BWU A;  3ROR A;  3OOO A;  5FCH A;  3FM3 A;  3OVK A;  1YJ3 A;  2EA2 A;  1W7V A;  2NQ6 A;  1R5G A;  1C22 A;  3O5V A;  4PNC A;  2G6P A;  2BWW A;  1A16 A;  2GG3 A;  4FUK A;  2BWV A;  2GU7 A;  4R60 A;  4IKR A;  4Z7M A;  2BHB A;  2ZSG A;  2DFI A;  2BWY A;  3IU8 A;  3MX6 A;  1W2M A;  1B6A A;  2OAZ A;  4OOK A;  1M35 A;  2P98 A;  5D6E A;  2Q92 A;  3BIQ A;  1KQ9 A;  1R5H A;  2GGC A;  1B59 A;  2Q8K A;  4KM3 A;  1XNZ A;  4U76 A;  3CB6 A;  3PEB A;  2BWX A;  1R58 A;  5CDV A;  2Q94 A;  4ZWU A;  3PKA A;  4FLK A;  1WN1 A;  2BHD A;  4FKC A;  1WL9 A;  4U71 A;  4QR8 A;  1CHM A;  1Y1N A;  2GA2 A;  4A6V A;  5CNX A;  4JUQ A;  2B3L A;  4IKT A;  4IU6 A;  5D6F A;  1QXY A;  5CLS A;  2GG8 A;  3RVA A;  1MAT A;  2ADU A;  3MR1 A;  3PKB A;  3Q6D A;  2P9A A;  2EA4 A;  5FCF A;  1WLR A;  2EVM A;  3CTZ A;  2BHC A;  1WKM A;  3FMQ A;  4IDY A;  5JI6 A;  2GU4 A;  2BWT A;  1PV9 A;  2IW2 A;  2BB7 A;  2MAT A;  4RZZ A;  3D27 A;  3IU7 A;  2Q96 A;  1WL6 A;  1XGO A;  1KQ0 A;  1WBQ A;  1O0X A;  2GG7 A;  4IPA A;  1YVM A;  1QXW A;  3PKC A;  3TB5 A;  3IU9 A;  1C27 A;  1JAW A;  4U6Z A;  4S00 A;  2Q93 A;  4ZWO A;  2GG0 A;  3CB5 A;  1YW8 A;  3FMR A;  5CIK A;  2BN7 A;  2V3Z A;  1XGM A;  3PKD A;  4HXX A;  4EGE A;  5CDL A;  5JFR A;  2HOW A;  5JHU A;  2V6C A;  2GU5 A;  4RGZ 1;  4FLJ A;  4U6J A;  3BIP A;  3S6B A;  2GG9 A;  2BH3 A;  2BWS A;  1BOA A;  2B3H A;  4ZNG A;  3TAV A;  4A6W A;  2V3Y A;  2P99 A;  1QZY A;  1XGN A;  4S2T P;  1XGS A;  3L7G A;  1BN5 A;  3BIT A;  4ZWP A;  2EVO A;  2GU6 A;  4IEC A;  1YW7 A;  4S2R P;  4U6C A;  2V3X A;  2OKN A;  2B3K A;  1KP0 A;  4RZY A;  4FO7 A;  1C23 A;  4IF7 A;  4U73 A;  4IKS A;  1N51 A;  4U69 A;  3QOC A;  4U70 A;  4FO8 A;  4U75 A;  3PKE A;  5E2C A;  3MAT A;  5CDE A;  2GTX A;  4FLL A;  4S01 A;  1C21 A;  1WY2 A;  4U6E A;  4IKU A;  1YW9 A;  4B28 A; 
#chains in the Genus database with same CATH topology
 2NQ7 A;  2GG2 A;  2GZ5 A;  3IL0 A;  1QXZ A;  5CE6 A;  2EVC A;  2BHA A;  4FLI A;  2GGB A;  4U1B A;  3IG4 A;  5E5B A;  3PN9 A;  2Q95 A;  4PV4 A;  2GG5 A;  3L24 A;  4U6W A;  4MAT A;  3I7M A;  1C24 A;  2BWU A;  3ROR A;  3OOO A;  5FCH A;  3FM3 A;  3OVK A;  1YJ3 A;  2EA2 A;  1W7V A;  2NQ6 A;  1R5G A;  1C22 A;  3O5V A;  4PNC A;  2G6P A;  2BWW A;  1A16 A;  2GG3 A;  4FUK A;  2BWV A;  2GU7 A;  4R60 A;  4IKR A;  4Z7M A;  2BHB A;  2ZSG A;  2DFI A;  2BWY A;  3IU8 A;  3MX6 A;  1W2M A;  1B6A A;  2OAZ A;  4OOK A;  1M35 A;  2P98 A;  5D6E A;  2Q92 A;  3BIQ A;  1KQ9 A;  1R5H A;  2GGC A;  1B59 A;  2Q8K A;  4KM3 A;  1XNZ A;  4U76 A;  3CB6 A;  3PEB A;  2BWX A;  1R58 A;  5CDV A;  2Q94 A;  4ZWU A;  3PKA A;  4FLK A;  1WN1 A;  2BHD A;  4FKC A;  1WL9 A;  4U71 A;  4QR8 A;  1CHM A;  1Y1N A;  2GA2 A;  4A6V A;  5CNX A;  4JUQ A;  2B3L A;  4IKT A;  4IU6 A;  5D6F A;  1QXY A;  5CLS A;  2GG8 A;  3RVA A;  1MAT A;  2ADU A;  3MR1 A;  3PKB A;  3Q6D A;  2P9A A;  2EA4 A;  5FCF A;  1WLR A;  2EVM A;  3CTZ A;  2BHC A;  1WKM A;  3FMQ A;  4IDY A;  5JI6 A;  2GU4 A;  2BWT A;  1PV9 A;  2IW2 A;  2BB7 A;  2MAT A;  4RZZ A;  3D27 A;  3IU7 A;  2Q96 A;  1WL6 A;  1XGO A;  1KQ0 A;  1WBQ A;  1O0X A;  2GG7 A;  4IPA A;  1YVM A;  1QXW A;  3PKC A;  3TB5 A;  3IU9 A;  1C27 A;  1JAW A;  4U6Z A;  4S00 A;  2Q93 A;  4ZWO A;  2GG0 A;  3CB5 A;  1YW8 A;  3FMR A;  5CIK A;  2BN7 A;  2V3Z A;  1XGM A;  3PKD A;  4HXX A;  4EGE A;  5CDL A;  5JFR A;  2HOW A;  5JHU A;  2V6C A;  2GU5 A;  4RGZ 1;  4FLJ A;  4U6J A;  3BIP A;  3S6B A;  2GG9 A;  2BH3 A;  2BWS A;  1BOA A;  2B3H A;  4ZNG A;  3TAV A;  4A6W A;  2V3Y A;  2P99 A;  1QZY A;  1XGN A;  4S2T P;  1XGS A;  3L7G A;  1BN5 A;  3BIT A;  4ZWP A;  2EVO A;  2GU6 A;  4IEC A;  1YW7 A;  4S2R P;  4U6C A;  2V3X A;  2OKN A;  2B3K A;  1KP0 A;  4RZY A;  4FO7 A;  1C23 A;  4IF7 A;  4U73 A;  4IKS A;  1N51 A;  4U69 A;  3QOC A;  4U70 A;  4FO8 A;  4U75 A;  3PKE A;  5E2C A;  3MAT A;  5CDE A;  2GTX A;  4FLL A;  4S01 A;  1C21 A;  1WY2 A;  4U6E A;  4IKU A;  1YW9 A;  4B28 A; 
#chains in the Genus database with same CATH homology
 2NQ7 A;  2GG2 A;  2GZ5 A;  3IL0 A;  1QXZ A;  5CE6 A;  2EVC A;  2BHA A;  4FLI A;  2GGB A;  4U1B A;  3IG4 A;  5E5B A;  3PN9 A;  2Q95 A;  4PV4 A;  2GG5 A;  3L24 A;  4U6W A;  4MAT A;  3I7M A;  1C24 A;  2BWU A;  3ROR A;  3OOO A;  5FCH A;  3FM3 A;  3OVK A;  1YJ3 A;  2EA2 A;  1W7V A;  2NQ6 A;  1R5G A;  1C22 A;  3O5V A;  4PNC A;  2G6P A;  2BWW A;  1A16 A;  2GG3 A;  4FUK A;  2BWV A;  2GU7 A;  4R60 A;  4IKR A;  4Z7M A;  2BHB A;  2ZSG A;  2DFI A;  2BWY A;  3IU8 A;  3MX6 A;  1W2M A;  1B6A A;  2OAZ A;  4OOK A;  1M35 A;  2P98 A;  5D6E A;  2Q92 A;  3BIQ A;  1KQ9 A;  1R5H A;  2GGC A;  1B59 A;  2Q8K A;  4KM3 A;  1XNZ A;  4U76 A;  3CB6 A;  3PEB A;  2BWX A;  1R58 A;  5CDV A;  2Q94 A;  4ZWU A;  3PKA A;  4FLK A;  1WN1 A;  2BHD A;  4FKC A;  1WL9 A;  4U71 A;  4QR8 A;  1CHM A;  1Y1N A;  2GA2 A;  4A6V A;  5CNX A;  4JUQ A;  2B3L A;  4IKT A;  4IU6 A;  5D6F A;  1QXY A;  5CLS A;  2GG8 A;  3RVA A;  1MAT A;  2ADU A;  3MR1 A;  3PKB A;  3Q6D A;  2P9A A;  2EA4 A;  5FCF A;  1WLR A;  2EVM A;  3CTZ A;  2BHC A;  1WKM A;  3FMQ A;  4IDY A;  5JI6 A;  2GU4 A;  2BWT A;  1PV9 A;  2IW2 A;  2BB7 A;  2MAT A;  4RZZ A;  3D27 A;  3IU7 A;  2Q96 A;  1WL6 A;  1XGO A;  1KQ0 A;  1WBQ A;  1O0X A;  2GG7 A;  4IPA A;  1YVM A;  1QXW A;  3PKC A;  3TB5 A;  3IU9 A;  1C27 A;  1JAW A;  4U6Z A;  4S00 A;  2Q93 A;  4ZWO A;  2GG0 A;  3CB5 A;  1YW8 A;  3FMR A;  5CIK A;  2BN7 A;  2V3Z A;  1XGM A;  3PKD A;  4HXX A;  4EGE A;  5CDL A;  5JFR A;  2HOW A;  5JHU A;  2V6C A;  2GU5 A;  4RGZ 1;  4FLJ A;  4U6J A;  3BIP A;  3S6B A;  2GG9 A;  2BH3 A;  2BWS A;  1BOA A;  2B3H A;  4ZNG A;  3TAV A;  4A6W A;  2V3Y A;  2P99 A;  1QZY A;  1XGN A;  4S2T P;  1XGS A;  3L7G A;  1BN5 A;  3BIT A;  4ZWP A;  2EVO A;  2GU6 A;  4IEC A;  1YW7 A;  4S2R P;  4U6C A;  2V3X A;  2OKN A;  2B3K A;  1KP0 A;  4RZY A;  4FO7 A;  1C23 A;  4IF7 A;  4U73 A;  4IKS A;  1N51 A;  4U69 A;  3QOC A;  4U70 A;  4FO8 A;  4U75 A;  3PKE A;  5E2C A;  3MAT A;  5CDE A;  2GTX A;  4FLL A;  4S01 A;  1C21 A;  1WY2 A;  4U6E A;  4IKU A;  1YW9 A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...