2BN7A

Mn substituted e. coli aminopeptidase p in complex with product and zn
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 158
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bn7A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bn7A02
1W2MA 1WN1A 1YJ3A 4FLLA 4FLJA 2Q8KA 2ADUA 1WBQA 2BWYA 2BWXA 1XGSA 2V3ZA 2P99A 1CHMA 4PV4A 4FO8A 2NQ6A 3OOOA 4U75A 4U6CA 4Z7MA 4S00A 1KQ0A 1XNZA 2MATA 4IU6A 2GG7A 4OOKA 1W7VA 1QXYA 3S6BA 3D27A 2V3XA 4U70A 5CE6A 5CDVA 2GZ5A 4FKCA 1A16A 4ZWOA 3BITA 4FUKA 2GU7A 2BWTA 5CDLA 4IPAA 1N51A 1R5GA 4U71A 2GG0A 2G6PA 3PKCA 5JI6A 3TB5A 3BIPA 4U1BA 2GA2A 3CB5A 2IW2A 3FMQA 2NQ7A 1BN5A 2GU4A 4IF7A 4S01A 5D6EA 4A6WA 1O0XA 5E5BA 1WKMA 5JHUA 4PNCA 2BN7A 1B6AA 1Y1NA 4EGEA 3RORA 2HOWA 4U73A 5JFRA 1R5HA 2Q95A 1YW7A 2EA2A 4MATA 1XGNA 3CTZA 1C27A 3IU7A 1JAWA 2V6CA 1QZYA 1C21A 1M35A 3PKBA 2GG8A 4IECA 4B28A 3TAVA 3FM3A 2BHDA 2B3LA 3PEBA 1YVMA 2GU5A 2BWUA 1C24A 1WLRA 4ZWUA 2BH3A 2OAZA 3PKAA 4U76A 2GG9A 3PKEA 4U69A 1MATA 3IG4A 1WL6A 3RVAA 1QXWA 2ZSGA 4IKRA 5CLSA 2P9AA 1XGMA 4A6VA 1WY2A 5CIKA 4RGZ1 5E2CA 2V3YA 1C22A 2Q93A 1BOAA 4IKUA 2BWVA 2GTXA 3PKDA 4KM3A 3Q6DA 3IU9A 3FMRA 4JUQA 4HXXA 4ZNGA 1C23A 4FLKA 2OKNA 2BB7A 4U6JA 1XGOA 2Q94A 3IU8A 4IKSA 1QXZA 2EVOA 5FCHA 3L24A 4S2RP 2Q96A 4IDYA 2BWSA 1KQ9A 1PV9A 4R60A 1YW8A 3OVKA 2EA4A 3MR1A 2GG5A 1WL9A 2B3KA 2GGCA 4ZWPA 2BHCA 4IKTA 3QOCA 4FLIA 2B3HA 4U6EA 4U6WA 1KP0A 2DFIA 3MX6A 2BWWA 2EVCA 2BHAA 3CB6A 2GU6A 2GGBA 4U6ZA 3MATA 1B59A 5D6FA 5FCFA 4RZZA 4RZYA 2Q92A 3BIQA 2BHBA 3I7MA 3IL0A 5CDEA 4S2TP 3L7GA 1YW9A 2GG3A 3O5VA 2P98A 1R58A 3PN9A 4QR8A 2EVMA 5CNXA 2GG2A 4FO7A
chains in the Genus database with same CATH superfamily
1W2MA 1WN1A 1YJ3A 4FLLA 4FLJA 2Q8KA 2ADUA 1WBQA 2BWYA 2BWXA 1XGSA 2V3ZA 2P99A 1CHMA 4PV4A 4FO8A 2NQ6A 3OOOA 4U75A 4U6CA 4Z7MA 4S00A 1KQ0A 1XNZA 2MATA 4IU6A 2GG7A 4OOKA 1W7VA 1QXYA 3S6BA 3D27A 2V3XA 4U70A 5CE6A 5CDVA 2GZ5A 4FKCA 1A16A 4ZWOA 3BITA 4FUKA 2GU7A 2BWTA 5CDLA 4IPAA 1N51A 1R5GA 4U71A 2GG0A 2G6PA 3PKCA 5JI6A 3TB5A 3BIPA 4U1BA 2GA2A 3CB5A 2IW2A 3FMQA 2NQ7A 1BN5A 2GU4A 4IF7A 4S01A 5D6EA 4A6WA 1O0XA 5E5BA 1WKMA 5JHUA 4PNCA 2BN7A 1B6AA 1Y1NA 4EGEA 3RORA 2HOWA 4U73A 5JFRA 1R5HA 2Q95A 1YW7A 2EA2A 4MATA 1XGNA 3CTZA 1C27A 3IU7A 1JAWA 2V6CA 1QZYA 1C21A 1M35A 3PKBA 2GG8A 4IECA 4B28A 3TAVA 3FM3A 2BHDA 2B3LA 3PEBA 1YVMA 2GU5A 2BWUA 1C24A 1WLRA 4ZWUA 2BH3A 2OAZA 3PKAA 4U76A 2GG9A 3PKEA 4U69A 1MATA 3IG4A 1WL6A 3RVAA 1QXWA 2ZSGA 4IKRA 5CLSA 2P9AA 1XGMA 4A6VA 1WY2A 5CIKA 4RGZ1 5E2CA 2V3YA 1C22A 2Q93A 1BOAA 4IKUA 2BWVA 2GTXA 3PKDA 4KM3A 3Q6DA 3IU9A 3FMRA 4JUQA 4HXXA 4ZNGA 1C23A 4FLKA 2OKNA 2BB7A 4U6JA 1XGOA 2Q94A 3IU8A 4IKSA 1QXZA 2EVOA 5FCHA 3L24A 4S2RP 2Q96A 4IDYA 2BWSA 1KQ9A 1PV9A 4R60A 1YW8A 3OVKA 2EA4A 3MR1A 2GG5A 1WL9A 2B3KA 2GGCA 4ZWPA 2BHCA 4IKTA 3QOCA 4FLIA 2B3HA 4U6EA 4U6WA 1KP0A 2DFIA 3MX6A 2BWWA 2EVCA 2BHAA 3CB6A 2GU6A 2GGBA 4U6ZA 3MATA 1B59A 5D6FA 5FCFA 4RZZA 4RZYA 2Q92A 3BIQA 2BHBA 3I7MA 3IL0A 5CDEA 4S2TP 3L7GA 1YW9A 2GG3A 3O5VA 2P98A 1R58A 3PN9A 4QR8A 2EVMA 5CNXA 2GG2A 4FO7A
chains in the Genus database with same CATH topology
1W2MA 1WN1A 1YJ3A 4FLLA 4FLJA 2Q8KA 2ADUA 1WBQA 2BWYA 2BWXA 1XGSA 2V3ZA 2P99A 1CHMA 4PV4A 4FO8A 2NQ6A 3OOOA 4U75A 4U6CA 4Z7MA 4S00A 1KQ0A 1XNZA 2MATA 4IU6A 2GG7A 4OOKA 1W7VA 1QXYA 3S6BA 3D27A 2V3XA 4U70A 5CE6A 5CDVA 2GZ5A 4FKCA 1A16A 4ZWOA 3BITA 4FUKA 2GU7A 2BWTA 5CDLA 4IPAA 1N51A 1R5GA 4U71A 2GG0A 2G6PA 3PKCA 5JI6A 3TB5A 3BIPA 4U1BA 2GA2A 3CB5A 2IW2A 3FMQA 2NQ7A 1BN5A 2GU4A 4IF7A 4S01A 5D6EA 4A6WA 1O0XA 5E5BA 1WKMA 5JHUA 4PNCA 2BN7A 1B6AA 1Y1NA 4EGEA 3RORA 2HOWA 4U73A 5JFRA 1R5HA 2Q95A 1YW7A 2EA2A 4MATA 1XGNA 3CTZA 1C27A 3IU7A 1JAWA 2V6CA 1QZYA 1C21A 1M35A 3PKBA 2GG8A 4IECA 4B28A 3TAVA 3FM3A 2BHDA 2B3LA 3PEBA 1YVMA 2GU5A 2BWUA 1C24A 1WLRA 4ZWUA 2BH3A 2OAZA 3PKAA 4U76A 2GG9A 3PKEA 4U69A 1MATA 3IG4A 1WL6A 3RVAA 1QXWA 2ZSGA 4IKRA 5CLSA 2P9AA 1XGMA 4A6VA 1WY2A 5CIKA 4RGZ1 5E2CA 2V3YA 1C22A 2Q93A 1BOAA 4IKUA 2BWVA 2GTXA 3PKDA 4KM3A 3Q6DA 3IU9A 3FMRA 4JUQA 4HXXA 4ZNGA 1C23A 4FLKA 2OKNA 2BB7A 4U6JA 1XGOA 2Q94A 3IU8A 4IKSA 1QXZA 2EVOA 5FCHA 3L24A 4S2RP 2Q96A 4IDYA 2BWSA 1KQ9A 1PV9A 4R60A 1YW8A 3OVKA 2EA4A 3MR1A 2GG5A 1WL9A 2B3KA 2GGCA 4ZWPA 2BHCA 4IKTA 3QOCA 4FLIA 2B3HA 4U6EA 4U6WA 1KP0A 2DFIA 3MX6A 2BWWA 2EVCA 2BHAA 3CB6A 2GU6A 2GGBA 4U6ZA 3MATA 1B59A 5D6FA 5FCFA 4RZZA 4RZYA 2Q92A 3BIQA 2BHBA 3I7MA 3IL0A 5CDEA 4S2TP 3L7GA 1YW9A 2GG3A 3O5VA 2P98A 1R58A 3PN9A 4QR8A 2EVMA 5CNXA 2GG2A 4FO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2M A;  1WN1 A;  1YJ3 A;  4FLL A;  4FLJ A;  2Q8K A;  2ADU A;  1WBQ A;  2BWY A;  2BWX A;  1XGS A;  2V3Z A;  2P99 A;  1CHM A;  4PV4 A;  4FO8 A;  2NQ6 A;  3OOO A;  4U75 A;  4U6C A;  4Z7M A;  4S00 A;  1KQ0 A;  1XNZ A;  2MAT A;  4IU6 A;  2GG7 A;  4OOK A;  1W7V A;  1QXY A;  3S6B A;  3D27 A;  2V3X A;  4U70 A;  5CE6 A;  5CDV A;  2GZ5 A;  4FKC A;  1A16 A;  4ZWO A;  3BIT A;  4FUK A;  2GU7 A;  2BWT A;  5CDL A;  4IPA A;  1N51 A;  1R5G A;  4U71 A;  2GG0 A;  2G6P A;  3PKC A;  5JI6 A;  3TB5 A;  3BIP A;  4U1B A;  2GA2 A;  3CB5 A;  2IW2 A;  3FMQ A;  2NQ7 A;  1BN5 A;  2GU4 A;  4IF7 A;  4S01 A;  5D6E A;  4A6W A;  1O0X A;  5E5B A;  1WKM A;  5JHU A;  4PNC A;  2BN7 A;  1B6A A;  1Y1N A;  4EGE A;  3ROR A;  2HOW A;  4U73 A;  5JFR A;  1R5H A;  2Q95 A;  1YW7 A;  2EA2 A;  4MAT A;  1XGN A;  3CTZ A;  1C27 A;  3IU7 A;  1JAW A;  2V6C A;  1QZY A;  1C21 A;  1M35 A;  3PKB A;  2GG8 A;  4IEC A;  4B28 A;  3TAV A;  3FM3 A;  2BHD A;  2B3L A;  3PEB A;  1YVM A;  2GU5 A;  2BWU A;  1C24 A;  1WLR A;  4ZWU A;  2BH3 A;  2OAZ A;  3PKA A;  4U76 A;  2GG9 A;  3PKE A;  4U69 A;  1MAT A;  3IG4 A;  1WL6 A;  3RVA A;  1QXW A;  2ZSG A;  4IKR A;  5CLS A;  2P9A A;  1XGM A;  4A6V A;  1WY2 A;  5CIK A;  4RGZ 1;  5E2C A;  2V3Y A;  1C22 A;  2Q93 A;  1BOA A;  4IKU A;  2BWV A;  2GTX A;  3PKD A;  4KM3 A;  3Q6D A;  3IU9 A;  3FMR A;  4JUQ A;  4HXX A;  4ZNG A;  1C23 A;  4FLK A;  2OKN A;  2BB7 A;  4U6J A;  1XGO A;  2Q94 A;  3IU8 A;  4IKS A;  1QXZ A;  2EVO A;  5FCH A;  3L24 A;  4S2R P;  2Q96 A;  4IDY A;  2BWS A;  1KQ9 A;  1PV9 A;  4R60 A;  1YW8 A;  3OVK A;  2EA4 A;  3MR1 A;  2GG5 A;  1WL9 A;  2B3K A;  2GGC A;  4ZWP A;  2BHC A;  4IKT A;  3QOC A;  4FLI A;  2B3H A;  4U6E A;  4U6W A;  1KP0 A;  2DFI A;  3MX6 A;  2BWW A;  2EVC A;  2BHA A;  3CB6 A;  2GU6 A;  2GGB A;  4U6Z A;  3MAT A;  1B59 A;  5D6F A;  5FCF A;  4RZZ A;  4RZY A;  2Q92 A;  3BIQ A;  2BHB A;  3I7M A;  3IL0 A;  5CDE A;  4S2T P;  3L7G A;  1YW9 A;  2GG3 A;  3O5V A;  2P98 A;  1R58 A;  3PN9 A;  4QR8 A;  2EVM A;  5CNX A;  2GG2 A;  4FO7 A; 
#chains in the Genus database with same CATH topology
 1W2M A;  1WN1 A;  1YJ3 A;  4FLL A;  4FLJ A;  2Q8K A;  2ADU A;  1WBQ A;  2BWY A;  2BWX A;  1XGS A;  2V3Z A;  2P99 A;  1CHM A;  4PV4 A;  4FO8 A;  2NQ6 A;  3OOO A;  4U75 A;  4U6C A;  4Z7M A;  4S00 A;  1KQ0 A;  1XNZ A;  2MAT A;  4IU6 A;  2GG7 A;  4OOK A;  1W7V A;  1QXY A;  3S6B A;  3D27 A;  2V3X A;  4U70 A;  5CE6 A;  5CDV A;  2GZ5 A;  4FKC A;  1A16 A;  4ZWO A;  3BIT A;  4FUK A;  2GU7 A;  2BWT A;  5CDL A;  4IPA A;  1N51 A;  1R5G A;  4U71 A;  2GG0 A;  2G6P A;  3PKC A;  5JI6 A;  3TB5 A;  3BIP A;  4U1B A;  2GA2 A;  3CB5 A;  2IW2 A;  3FMQ A;  2NQ7 A;  1BN5 A;  2GU4 A;  4IF7 A;  4S01 A;  5D6E A;  4A6W A;  1O0X A;  5E5B A;  1WKM A;  5JHU A;  4PNC A;  2BN7 A;  1B6A A;  1Y1N A;  4EGE A;  3ROR A;  2HOW A;  4U73 A;  5JFR A;  1R5H A;  2Q95 A;  1YW7 A;  2EA2 A;  4MAT A;  1XGN A;  3CTZ A;  1C27 A;  3IU7 A;  1JAW A;  2V6C A;  1QZY A;  1C21 A;  1M35 A;  3PKB A;  2GG8 A;  4IEC A;  4B28 A;  3TAV A;  3FM3 A;  2BHD A;  2B3L A;  3PEB A;  1YVM A;  2GU5 A;  2BWU A;  1C24 A;  1WLR A;  4ZWU A;  2BH3 A;  2OAZ A;  3PKA A;  4U76 A;  2GG9 A;  3PKE A;  4U69 A;  1MAT A;  3IG4 A;  1WL6 A;  3RVA A;  1QXW A;  2ZSG A;  4IKR A;  5CLS A;  2P9A A;  1XGM A;  4A6V A;  1WY2 A;  5CIK A;  4RGZ 1;  5E2C A;  2V3Y A;  1C22 A;  2Q93 A;  1BOA A;  4IKU A;  2BWV A;  2GTX A;  3PKD A;  4KM3 A;  3Q6D A;  3IU9 A;  3FMR A;  4JUQ A;  4HXX A;  4ZNG A;  1C23 A;  4FLK A;  2OKN A;  2BB7 A;  4U6J A;  1XGO A;  2Q94 A;  3IU8 A;  4IKS A;  1QXZ A;  2EVO A;  5FCH A;  3L24 A;  4S2R P;  2Q96 A;  4IDY A;  2BWS A;  1KQ9 A;  1PV9 A;  4R60 A;  1YW8 A;  3OVK A;  2EA4 A;  3MR1 A;  2GG5 A;  1WL9 A;  2B3K A;  2GGC A;  4ZWP A;  2BHC A;  4IKT A;  3QOC A;  4FLI A;  2B3H A;  4U6E A;  4U6W A;  1KP0 A;  2DFI A;  3MX6 A;  2BWW A;  2EVC A;  2BHA A;  3CB6 A;  2GU6 A;  2GGB A;  4U6Z A;  3MAT A;  1B59 A;  5D6F A;  5FCF A;  4RZZ A;  4RZY A;  2Q92 A;  3BIQ A;  2BHB A;  3I7M A;  3IL0 A;  5CDE A;  4S2T P;  3L7G A;  1YW9 A;  2GG3 A;  3O5V A;  2P98 A;  1R58 A;  3PN9 A;  4QR8 A;  2EVM A;  5CNX A;  2GG2 A;  4FO7 A; 
#chains in the Genus database with same CATH homology
 1W2M A;  1WN1 A;  1YJ3 A;  4FLL A;  4FLJ A;  2Q8K A;  2ADU A;  1WBQ A;  2BWY A;  2BWX A;  1XGS A;  2V3Z A;  2P99 A;  1CHM A;  4PV4 A;  4FO8 A;  2NQ6 A;  3OOO A;  4U75 A;  4U6C A;  4Z7M A;  4S00 A;  1KQ0 A;  1XNZ A;  2MAT A;  4IU6 A;  2GG7 A;  4OOK A;  1W7V A;  1QXY A;  3S6B A;  3D27 A;  2V3X A;  4U70 A;  5CE6 A;  5CDV A;  2GZ5 A;  4FKC A;  1A16 A;  4ZWO A;  3BIT A;  4FUK A;  2GU7 A;  2BWT A;  5CDL A;  4IPA A;  1N51 A;  1R5G A;  4U71 A;  2GG0 A;  2G6P A;  3PKC A;  5JI6 A;  3TB5 A;  3BIP A;  4U1B A;  2GA2 A;  3CB5 A;  2IW2 A;  3FMQ A;  2NQ7 A;  1BN5 A;  2GU4 A;  4IF7 A;  4S01 A;  5D6E A;  4A6W A;  1O0X A;  5E5B A;  1WKM A;  5JHU A;  4PNC A;  2BN7 A;  1B6A A;  1Y1N A;  4EGE A;  3ROR A;  2HOW A;  4U73 A;  5JFR A;  1R5H A;  2Q95 A;  1YW7 A;  2EA2 A;  4MAT A;  1XGN A;  3CTZ A;  1C27 A;  3IU7 A;  1JAW A;  2V6C A;  1QZY A;  1C21 A;  1M35 A;  3PKB A;  2GG8 A;  4IEC A;  4B28 A;  3TAV A;  3FM3 A;  2BHD A;  2B3L A;  3PEB A;  1YVM A;  2GU5 A;  2BWU A;  1C24 A;  1WLR A;  4ZWU A;  2BH3 A;  2OAZ A;  3PKA A;  4U76 A;  2GG9 A;  3PKE A;  4U69 A;  1MAT A;  3IG4 A;  1WL6 A;  3RVA A;  1QXW A;  2ZSG A;  4IKR A;  5CLS A;  2P9A A;  1XGM A;  4A6V A;  1WY2 A;  5CIK A;  4RGZ 1;  5E2C A;  2V3Y A;  1C22 A;  2Q93 A;  1BOA A;  4IKU A;  2BWV A;  2GTX A;  3PKD A;  4KM3 A;  3Q6D A;  3IU9 A;  3FMR A;  4JUQ A;  4HXX A;  4ZNG A;  1C23 A;  4FLK A;  2OKN A;  2BB7 A;  4U6J A;  1XGO A;  2Q94 A;  3IU8 A;  4IKS A;  1QXZ A;  2EVO A;  5FCH A;  3L24 A;  4S2R P;  2Q96 A;  4IDY A;  2BWS A;  1KQ9 A;  1PV9 A;  4R60 A;  1YW8 A;  3OVK A;  2EA4 A;  3MR1 A;  2GG5 A;  1WL9 A;  2B3K A;  2GGC A;  4ZWP A;  2BHC A;  4IKT A;  3QOC A;  4FLI A;  2B3H A;  4U6E A;  4U6W A;  1KP0 A;  2DFI A;  3MX6 A;  2BWW A;  2EVC A;  2BHA A;  3CB6 A;  2GU6 A;  2GGB A;  4U6Z A;  3MAT A;  1B59 A;  5D6F A;  5FCF A;  4RZZ A;  4RZY A;  2Q92 A;  3BIQ A;  2BHB A;  3I7M A;  3IL0 A;  5CDE A;  4S2T P;  3L7G A;  1YW9 A;  2GG3 A;  3O5V A;  2P98 A;  1R58 A;  3PN9 A;  4QR8 A;  2EVM A;  5CNX A;  2GG2 A;  4FO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...