2BN7A

Mn substituted e. coli aminopeptidase p in complex with product and zn
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 158
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bn7A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bn7A02
4IU6A 1C27A 4U6EA 5JI6A 2NQ6A 5CLSA 1WBQA 2GG0A 4IF7A 4QR8A 4S00A 1QXZA 3PKBA 2BHDA 1XGOA 3MR1A 4RZYA 4FUKA 3I7MA 1N51A 3PN9A 4IKRA 4JUQA 2GG3A 5E2CA 2OAZA 1JAWA 1QXWA 2GG5A 3CB5A 1BOAA 2GG7A 2B3KA 2GG9A 1W2MA 2ZSGA 3BIPA 5CNXA 4IPAA 2GA2A 2GTXA 4U6JA 1WL6A 4RGZ1 4S01A 1R58A 3S6BA 1C23A 1B59A 3IU9A 1M35A 4HXXA 4KM3A 5D6FA 2BWUA 4PNCA 2BHAA 2B3LA 3MATA 4U69A 2P9AA 2BWWA 1WN1A 5E5BA 1WKMA 4U75A 1XGMA 2Q94A 2OKNA 1R5HA 2EVCA 4OOKA 2EVMA 4U70A 2EA2A 2HOWA 4U71A 4FO7A 1YW7A 3PKAA 1WY2A 3IG4A 5FCFA 2B3HA 4FLLA 2V6CA 1Y1NA 4R60A 3OVKA 4ZNGA 1KQ0A 4A6VA 4S2RP 4ZWUA 3FMRA 3TAVA 1MATA 2GG2A 4FKCA 3L24A 1QXYA 3IU7A 3QOCA 3Q6DA 1C21A 2DFIA 5D6EA 4EGEA 1B6AA 2EVOA 2GU4A 4FLKA 1O0XA 2BB7A 4IKSA 4U6ZA 1A16A 2V3ZA 5JFRA 1KQ9A 3RVAA 4FLIA 3TB5A 1PV9A 1WLRA 1BN5A 3RORA 1W7VA 2BHBA 4IKTA 3L7GA 3FMQA 1YW9A 1XNZA 2ADUA 2GU6A 4ZWPA 4FLJA 2GU5A 1XGSA 2EA4A 3FM3A 4A6WA 3BIQA 4U73A 1R5GA 2BWTA 3IL0A 2V3XA 3OOOA 4FO8A 4IDYA 2Q96A 4U76A 5JHUA 3O5VA 2BHCA 3PKEA 2NQ7A 1WL9A 4MATA 1XGNA 2BH3A 5CE6A 2BWXA 3MX6A 1C22A 3PKCA 2GU7A 3PKDA 3CB6A 2V3YA 1C24A 3CTZA 1CHMA 2BWSA 5CDEA 3D27A 2P99A 4PV4A 3IU8A 2GG8A 2BWVA 4RZZA 5CDVA 2IW2A 2P98A 4S2TP 2G6PA 1YVMA 2GGCA 4Z7MA 1YJ3A 4U6CA 4IECA 2Q93A 4U6WA 2Q92A 2Q8KA 3PEBA 5FCHA 1QZYA 3BITA 2BWYA 2GZ5A 2BN7A 4U1BA 1KP0A 5CDLA 4IKUA 5CIKA 2MATA 1YW8A 2GGBA 2Q95A 4ZWOA 4B28A
chains in the Genus database with same CATH superfamily
4IU6A 1C27A 4U6EA 5JI6A 2NQ6A 5CLSA 1WBQA 2GG0A 4IF7A 4QR8A 4S00A 1QXZA 3PKBA 2BHDA 1XGOA 3MR1A 4RZYA 4FUKA 3I7MA 1N51A 3PN9A 4IKRA 4JUQA 2GG3A 5E2CA 2OAZA 1JAWA 1QXWA 2GG5A 3CB5A 1BOAA 2GG7A 2B3KA 2GG9A 1W2MA 2ZSGA 3BIPA 5CNXA 4IPAA 2GA2A 2GTXA 4U6JA 1WL6A 4RGZ1 4S01A 1R58A 3S6BA 1C23A 1B59A 3IU9A 1M35A 4HXXA 4KM3A 5D6FA 2BWUA 4PNCA 2BHAA 2B3LA 3MATA 4U69A 2P9AA 2BWWA 1WN1A 5E5BA 1WKMA 4U75A 1XGMA 2Q94A 2OKNA 1R5HA 2EVCA 4OOKA 2EVMA 4U70A 2EA2A 2HOWA 4U71A 4FO7A 1YW7A 3PKAA 1WY2A 3IG4A 5FCFA 2B3HA 4FLLA 2V6CA 1Y1NA 4R60A 3OVKA 4ZNGA 1KQ0A 4A6VA 4S2RP 4ZWUA 3FMRA 3TAVA 1MATA 2GG2A 4FKCA 3L24A 1QXYA 3IU7A 3QOCA 3Q6DA 1C21A 2DFIA 5D6EA 4EGEA 1B6AA 2EVOA 2GU4A 4FLKA 1O0XA 2BB7A 4IKSA 4U6ZA 1A16A 2V3ZA 5JFRA 1KQ9A 3RVAA 4FLIA 3TB5A 1PV9A 1WLRA 1BN5A 3RORA 1W7VA 2BHBA 4IKTA 3L7GA 3FMQA 1YW9A 1XNZA 2ADUA 2GU6A 4ZWPA 4FLJA 2GU5A 1XGSA 2EA4A 3FM3A 4A6WA 3BIQA 4U73A 1R5GA 2BWTA 3IL0A 2V3XA 3OOOA 4FO8A 4IDYA 2Q96A 4U76A 5JHUA 3O5VA 2BHCA 3PKEA 2NQ7A 1WL9A 4MATA 1XGNA 2BH3A 5CE6A 2BWXA 3MX6A 1C22A 3PKCA 2GU7A 3PKDA 3CB6A 2V3YA 1C24A 3CTZA 1CHMA 2BWSA 5CDEA 3D27A 2P99A 4PV4A 3IU8A 2GG8A 2BWVA 4RZZA 5CDVA 2IW2A 2P98A 4S2TP 2G6PA 1YVMA 2GGCA 4Z7MA 1YJ3A 4U6CA 4IECA 2Q93A 4U6WA 2Q92A 2Q8KA 3PEBA 5FCHA 1QZYA 3BITA 2BWYA 2GZ5A 2BN7A 4U1BA 1KP0A 5CDLA 4IKUA 5CIKA 2MATA 1YW8A 2GGBA 2Q95A 4ZWOA 4B28A
chains in the Genus database with same CATH topology
4IU6A 1C27A 4U6EA 5JI6A 2NQ6A 5CLSA 1WBQA 2GG0A 4IF7A 4QR8A 4S00A 1QXZA 3PKBA 2BHDA 1XGOA 3MR1A 4RZYA 4FUKA 3I7MA 1N51A 3PN9A 4IKRA 4JUQA 2GG3A 5E2CA 2OAZA 1JAWA 1QXWA 2GG5A 3CB5A 1BOAA 2GG7A 2B3KA 2GG9A 1W2MA 2ZSGA 3BIPA 5CNXA 4IPAA 2GA2A 2GTXA 4U6JA 1WL6A 4RGZ1 4S01A 1R58A 3S6BA 1C23A 1B59A 3IU9A 1M35A 4HXXA 4KM3A 5D6FA 2BWUA 4PNCA 2BHAA 2B3LA 3MATA 4U69A 2P9AA 2BWWA 1WN1A 5E5BA 1WKMA 4U75A 1XGMA 2Q94A 2OKNA 1R5HA 2EVCA 4OOKA 2EVMA 4U70A 2EA2A 2HOWA 4U71A 4FO7A 1YW7A 3PKAA 1WY2A 3IG4A 5FCFA 2B3HA 4FLLA 2V6CA 1Y1NA 4R60A 3OVKA 4ZNGA 1KQ0A 4A6VA 4S2RP 4ZWUA 3FMRA 3TAVA 1MATA 2GG2A 4FKCA 3L24A 1QXYA 3IU7A 3QOCA 3Q6DA 1C21A 2DFIA 5D6EA 4EGEA 1B6AA 2EVOA 2GU4A 4FLKA 1O0XA 2BB7A 4IKSA 4U6ZA 1A16A 2V3ZA 5JFRA 1KQ9A 3RVAA 4FLIA 3TB5A 1PV9A 1WLRA 1BN5A 3RORA 1W7VA 2BHBA 4IKTA 3L7GA 3FMQA 1YW9A 1XNZA 2ADUA 2GU6A 4ZWPA 4FLJA 2GU5A 1XGSA 2EA4A 3FM3A 4A6WA 3BIQA 4U73A 1R5GA 2BWTA 3IL0A 2V3XA 3OOOA 4FO8A 4IDYA 2Q96A 4U76A 5JHUA 3O5VA 2BHCA 3PKEA 2NQ7A 1WL9A 4MATA 1XGNA 2BH3A 5CE6A 2BWXA 3MX6A 1C22A 3PKCA 2GU7A 3PKDA 3CB6A 2V3YA 1C24A 3CTZA 1CHMA 2BWSA 5CDEA 3D27A 2P99A 4PV4A 3IU8A 2GG8A 2BWVA 4RZZA 5CDVA 2IW2A 2P98A 4S2TP 2G6PA 1YVMA 2GGCA 4Z7MA 1YJ3A 4U6CA 4IECA 2Q93A 4U6WA 2Q92A 2Q8KA 3PEBA 5FCHA 1QZYA 3BITA 2BWYA 2GZ5A 2BN7A 4U1BA 1KP0A 5CDLA 4IKUA 5CIKA 2MATA 1YW8A 2GGBA 2Q95A 4ZWOA 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU6 A;  1C27 A;  4U6E A;  5JI6 A;  2NQ6 A;  5CLS A;  1WBQ A;  2GG0 A;  4IF7 A;  4QR8 A;  4S00 A;  1QXZ A;  3PKB A;  2BHD A;  1XGO A;  3MR1 A;  4RZY A;  4FUK A;  3I7M A;  1N51 A;  3PN9 A;  4IKR A;  4JUQ A;  2GG3 A;  5E2C A;  2OAZ A;  1JAW A;  1QXW A;  2GG5 A;  3CB5 A;  1BOA A;  2GG7 A;  2B3K A;  2GG9 A;  1W2M A;  2ZSG A;  3BIP A;  5CNX A;  4IPA A;  2GA2 A;  2GTX A;  4U6J A;  1WL6 A;  4RGZ 1;  4S01 A;  1R58 A;  3S6B A;  1C23 A;  1B59 A;  3IU9 A;  1M35 A;  4HXX A;  4KM3 A;  5D6F A;  2BWU A;  4PNC A;  2BHA A;  2B3L A;  3MAT A;  4U69 A;  2P9A A;  2BWW A;  1WN1 A;  5E5B A;  1WKM A;  4U75 A;  1XGM A;  2Q94 A;  2OKN A;  1R5H A;  2EVC A;  4OOK A;  2EVM A;  4U70 A;  2EA2 A;  2HOW A;  4U71 A;  4FO7 A;  1YW7 A;  3PKA A;  1WY2 A;  3IG4 A;  5FCF A;  2B3H A;  4FLL A;  2V6C A;  1Y1N A;  4R60 A;  3OVK A;  4ZNG A;  1KQ0 A;  4A6V A;  4S2R P;  4ZWU A;  3FMR A;  3TAV A;  1MAT A;  2GG2 A;  4FKC A;  3L24 A;  1QXY A;  3IU7 A;  3QOC A;  3Q6D A;  1C21 A;  2DFI A;  5D6E A;  4EGE A;  1B6A A;  2EVO A;  2GU4 A;  4FLK A;  1O0X A;  2BB7 A;  4IKS A;  4U6Z A;  1A16 A;  2V3Z A;  5JFR A;  1KQ9 A;  3RVA A;  4FLI A;  3TB5 A;  1PV9 A;  1WLR A;  1BN5 A;  3ROR A;  1W7V A;  2BHB A;  4IKT A;  3L7G A;  3FMQ A;  1YW9 A;  1XNZ A;  2ADU A;  2GU6 A;  4ZWP A;  4FLJ A;  2GU5 A;  1XGS A;  2EA4 A;  3FM3 A;  4A6W A;  3BIQ A;  4U73 A;  1R5G A;  2BWT A;  3IL0 A;  2V3X A;  3OOO A;  4FO8 A;  4IDY A;  2Q96 A;  4U76 A;  5JHU A;  3O5V A;  2BHC A;  3PKE A;  2NQ7 A;  1WL9 A;  4MAT A;  1XGN A;  2BH3 A;  5CE6 A;  2BWX A;  3MX6 A;  1C22 A;  3PKC A;  2GU7 A;  3PKD A;  3CB6 A;  2V3Y A;  1C24 A;  3CTZ A;  1CHM A;  2BWS A;  5CDE A;  3D27 A;  2P99 A;  4PV4 A;  3IU8 A;  2GG8 A;  2BWV A;  4RZZ A;  5CDV A;  2IW2 A;  2P98 A;  4S2T P;  2G6P A;  1YVM A;  2GGC A;  4Z7M A;  1YJ3 A;  4U6C A;  4IEC A;  2Q93 A;  4U6W A;  2Q92 A;  2Q8K A;  3PEB A;  5FCH A;  1QZY A;  3BIT A;  2BWY A;  2GZ5 A;  2BN7 A;  4U1B A;  1KP0 A;  5CDL A;  4IKU A;  5CIK A;  2MAT A;  1YW8 A;  2GGB A;  2Q95 A;  4ZWO A;  4B28 A; 
#chains in the Genus database with same CATH topology
 4IU6 A;  1C27 A;  4U6E A;  5JI6 A;  2NQ6 A;  5CLS A;  1WBQ A;  2GG0 A;  4IF7 A;  4QR8 A;  4S00 A;  1QXZ A;  3PKB A;  2BHD A;  1XGO A;  3MR1 A;  4RZY A;  4FUK A;  3I7M A;  1N51 A;  3PN9 A;  4IKR A;  4JUQ A;  2GG3 A;  5E2C A;  2OAZ A;  1JAW A;  1QXW A;  2GG5 A;  3CB5 A;  1BOA A;  2GG7 A;  2B3K A;  2GG9 A;  1W2M A;  2ZSG A;  3BIP A;  5CNX A;  4IPA A;  2GA2 A;  2GTX A;  4U6J A;  1WL6 A;  4RGZ 1;  4S01 A;  1R58 A;  3S6B A;  1C23 A;  1B59 A;  3IU9 A;  1M35 A;  4HXX A;  4KM3 A;  5D6F A;  2BWU A;  4PNC A;  2BHA A;  2B3L A;  3MAT A;  4U69 A;  2P9A A;  2BWW A;  1WN1 A;  5E5B A;  1WKM A;  4U75 A;  1XGM A;  2Q94 A;  2OKN A;  1R5H A;  2EVC A;  4OOK A;  2EVM A;  4U70 A;  2EA2 A;  2HOW A;  4U71 A;  4FO7 A;  1YW7 A;  3PKA A;  1WY2 A;  3IG4 A;  5FCF A;  2B3H A;  4FLL A;  2V6C A;  1Y1N A;  4R60 A;  3OVK A;  4ZNG A;  1KQ0 A;  4A6V A;  4S2R P;  4ZWU A;  3FMR A;  3TAV A;  1MAT A;  2GG2 A;  4FKC A;  3L24 A;  1QXY A;  3IU7 A;  3QOC A;  3Q6D A;  1C21 A;  2DFI A;  5D6E A;  4EGE A;  1B6A A;  2EVO A;  2GU4 A;  4FLK A;  1O0X A;  2BB7 A;  4IKS A;  4U6Z A;  1A16 A;  2V3Z A;  5JFR A;  1KQ9 A;  3RVA A;  4FLI A;  3TB5 A;  1PV9 A;  1WLR A;  1BN5 A;  3ROR A;  1W7V A;  2BHB A;  4IKT A;  3L7G A;  3FMQ A;  1YW9 A;  1XNZ A;  2ADU A;  2GU6 A;  4ZWP A;  4FLJ A;  2GU5 A;  1XGS A;  2EA4 A;  3FM3 A;  4A6W A;  3BIQ A;  4U73 A;  1R5G A;  2BWT A;  3IL0 A;  2V3X A;  3OOO A;  4FO8 A;  4IDY A;  2Q96 A;  4U76 A;  5JHU A;  3O5V A;  2BHC A;  3PKE A;  2NQ7 A;  1WL9 A;  4MAT A;  1XGN A;  2BH3 A;  5CE6 A;  2BWX A;  3MX6 A;  1C22 A;  3PKC A;  2GU7 A;  3PKD A;  3CB6 A;  2V3Y A;  1C24 A;  3CTZ A;  1CHM A;  2BWS A;  5CDE A;  3D27 A;  2P99 A;  4PV4 A;  3IU8 A;  2GG8 A;  2BWV A;  4RZZ A;  5CDV A;  2IW2 A;  2P98 A;  4S2T P;  2G6P A;  1YVM A;  2GGC A;  4Z7M A;  1YJ3 A;  4U6C A;  4IEC A;  2Q93 A;  4U6W A;  2Q92 A;  2Q8K A;  3PEB A;  5FCH A;  1QZY A;  3BIT A;  2BWY A;  2GZ5 A;  2BN7 A;  4U1B A;  1KP0 A;  5CDL A;  4IKU A;  5CIK A;  2MAT A;  1YW8 A;  2GGB A;  2Q95 A;  4ZWO A;  4B28 A; 
#chains in the Genus database with same CATH homology
 4IU6 A;  1C27 A;  4U6E A;  5JI6 A;  2NQ6 A;  5CLS A;  1WBQ A;  2GG0 A;  4IF7 A;  4QR8 A;  4S00 A;  1QXZ A;  3PKB A;  2BHD A;  1XGO A;  3MR1 A;  4RZY A;  4FUK A;  3I7M A;  1N51 A;  3PN9 A;  4IKR A;  4JUQ A;  2GG3 A;  5E2C A;  2OAZ A;  1JAW A;  1QXW A;  2GG5 A;  3CB5 A;  1BOA A;  2GG7 A;  2B3K A;  2GG9 A;  1W2M A;  2ZSG A;  3BIP A;  5CNX A;  4IPA A;  2GA2 A;  2GTX A;  4U6J A;  1WL6 A;  4RGZ 1;  4S01 A;  1R58 A;  3S6B A;  1C23 A;  1B59 A;  3IU9 A;  1M35 A;  4HXX A;  4KM3 A;  5D6F A;  2BWU A;  4PNC A;  2BHA A;  2B3L A;  3MAT A;  4U69 A;  2P9A A;  2BWW A;  1WN1 A;  5E5B A;  1WKM A;  4U75 A;  1XGM A;  2Q94 A;  2OKN A;  1R5H A;  2EVC A;  4OOK A;  2EVM A;  4U70 A;  2EA2 A;  2HOW A;  4U71 A;  4FO7 A;  1YW7 A;  3PKA A;  1WY2 A;  3IG4 A;  5FCF A;  2B3H A;  4FLL A;  2V6C A;  1Y1N A;  4R60 A;  3OVK A;  4ZNG A;  1KQ0 A;  4A6V A;  4S2R P;  4ZWU A;  3FMR A;  3TAV A;  1MAT A;  2GG2 A;  4FKC A;  3L24 A;  1QXY A;  3IU7 A;  3QOC A;  3Q6D A;  1C21 A;  2DFI A;  5D6E A;  4EGE A;  1B6A A;  2EVO A;  2GU4 A;  4FLK A;  1O0X A;  2BB7 A;  4IKS A;  4U6Z A;  1A16 A;  2V3Z A;  5JFR A;  1KQ9 A;  3RVA A;  4FLI A;  3TB5 A;  1PV9 A;  1WLR A;  1BN5 A;  3ROR A;  1W7V A;  2BHB A;  4IKT A;  3L7G A;  3FMQ A;  1YW9 A;  1XNZ A;  2ADU A;  2GU6 A;  4ZWP A;  4FLJ A;  2GU5 A;  1XGS A;  2EA4 A;  3FM3 A;  4A6W A;  3BIQ A;  4U73 A;  1R5G A;  2BWT A;  3IL0 A;  2V3X A;  3OOO A;  4FO8 A;  4IDY A;  2Q96 A;  4U76 A;  5JHU A;  3O5V A;  2BHC A;  3PKE A;  2NQ7 A;  1WL9 A;  4MAT A;  1XGN A;  2BH3 A;  5CE6 A;  2BWX A;  3MX6 A;  1C22 A;  3PKC A;  2GU7 A;  3PKD A;  3CB6 A;  2V3Y A;  1C24 A;  3CTZ A;  1CHM A;  2BWS A;  5CDE A;  3D27 A;  2P99 A;  4PV4 A;  3IU8 A;  2GG8 A;  2BWV A;  4RZZ A;  5CDV A;  2IW2 A;  2P98 A;  4S2T P;  2G6P A;  1YVM A;  2GGC A;  4Z7M A;  1YJ3 A;  4U6C A;  4IEC A;  2Q93 A;  4U6W A;  2Q92 A;  2Q8K A;  3PEB A;  5FCH A;  1QZY A;  3BIT A;  2BWY A;  2GZ5 A;  2BN7 A;  4U1B A;  1KP0 A;  5CDL A;  4IKU A;  5CIK A;  2MAT A;  1YW8 A;  2GGB A;  2Q95 A;  4ZWO A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...