2BN7A

Mn substituted e. coli aminopeptidase p in complex with product and zn
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 158
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bn7A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bn7A02
3FMRA 2BHBA 1Y1NA 2GG7A 2Q8KA 2GA2A 4IU6A 1WN1A 4A6WA 1N51A 3CTZA 3PKDA 4FLLA 4JUQA 1PV9A 1MATA 4ZWPA 4FO8A 4U69A 2Q94A 2BHAA 2GGBA 4U6JA 5CLSA 2ADUA 3CB6A 4IDYA 4IF7A 4U6CA 4U71A 2GG8A 2GU5A 2OKNA 1B6AA 1R5HA 2B3KA 5D6EA 3PN9A 1W2MA 2Q96A 3D27A 4RZYA 1QXZA 4U1BA 4IKRA 2GU4A 4FLIA 1YW7A 2EVOA 2BWSA 1JAWA 1KQ0A 2V3YA 5E5BA 2GGCA 4RZZA 2BWUA 1KQ9A 3MR1A 2EA4A 3FM3A 3BITA 1C22A 2ZSGA 5CNXA 2HOWA 3IL0A 5CDLA 1QZYA 5JHUA 1C21A 3RVAA 2V3XA 2GG9A 2P9AA 5CE6A 1WL9A 1YW8A 2OAZA 1QXYA 2GU6A 3FMQA 4HXXA 3TB5A 1B59A 1O0XA 3MATA 1XGSA 4KM3A 1XGMA 2IW2A 4A6VA 4IKUA 4FLKA 1C24A 4R60A 5CDEA 2EVCA 3PKBA 1R5GA 4RGZ1 5FCFA 4ZNGA 3IU9A 3BIQA 4S2RP 3PKAA 1WL6A 4S01A 4EGEA 1WY2A 2EVMA 4S2TP 1WKMA 1XGOA 1XGNA 2BWTA 2P98A 4B28A 2G6PA 3IU8A 4IECA 2BN7A 4IKSA 4U6WA 4PNCA 3OOOA 2B3HA 2GZ5A 2EA2A 2MATA 2V6CA 4IKTA 4U6ZA 2BB7A 3Q6DA 3L7GA 1CHMA 1R58A 5CIKA 3MX6A 4U75A 2BWWA 3RORA 3IU7A 2Q95A 3TAVA 3PEBA 4ZWOA 1C27A 4QR8A 2GTXA 4U73A 3S6BA 4Z7MA 1A16A 2BWYA 2GG3A 2GG0A 2BH3A 1C23A 5D6FA 2BHDA 3OVKA 3I7MA 3BIPA 1BOAA 5JFRA 1BN5A 1W7VA 4PV4A 4FLJA 1WLRA 4IPAA 3QOCA 4U70A 3L24A 1YJ3A 4U6EA 2B3LA 4ZWUA 2V3ZA 2BWVA 1WBQA 3CB5A 2BWXA 4S00A 5CDVA 2GU7A 2GG2A 2Q92A 2GG5A 3O5VA 2BHCA 1M35A 1QXWA 4U76A 3PKEA 4MATA 4FO7A 1KP0A 2Q93A 2DFIA 2NQ7A 2NQ6A 3PKCA 5JI6A 4FKCA 5FCHA 1XNZA 4OOKA 4FUKA 1YVMA 2P99A 1YW9A 5E2CA 3IG4A
chains in the Genus database with same CATH superfamily
3FMRA 2BHBA 1Y1NA 2GG7A 2Q8KA 2GA2A 4IU6A 1WN1A 4A6WA 1N51A 3CTZA 3PKDA 4FLLA 4JUQA 1PV9A 1MATA 4ZWPA 4FO8A 4U69A 2Q94A 2BHAA 2GGBA 4U6JA 5CLSA 2ADUA 3CB6A 4IDYA 4IF7A 4U6CA 4U71A 2GG8A 2GU5A 2OKNA 1B6AA 1R5HA 2B3KA 5D6EA 3PN9A 1W2MA 2Q96A 3D27A 4RZYA 1QXZA 4U1BA 4IKRA 2GU4A 4FLIA 1YW7A 2EVOA 2BWSA 1JAWA 1KQ0A 2V3YA 5E5BA 2GGCA 4RZZA 2BWUA 1KQ9A 3MR1A 2EA4A 3FM3A 3BITA 1C22A 2ZSGA 5CNXA 2HOWA 3IL0A 5CDLA 1QZYA 5JHUA 1C21A 3RVAA 2V3XA 2GG9A 2P9AA 5CE6A 1WL9A 1YW8A 2OAZA 1QXYA 2GU6A 3FMQA 4HXXA 3TB5A 1B59A 1O0XA 3MATA 1XGSA 4KM3A 1XGMA 2IW2A 4A6VA 4IKUA 4FLKA 1C24A 4R60A 5CDEA 2EVCA 3PKBA 1R5GA 4RGZ1 5FCFA 4ZNGA 3IU9A 3BIQA 4S2RP 3PKAA 1WL6A 4S01A 4EGEA 1WY2A 2EVMA 4S2TP 1WKMA 1XGOA 1XGNA 2BWTA 2P98A 4B28A 2G6PA 3IU8A 4IECA 2BN7A 4IKSA 4U6WA 4PNCA 3OOOA 2B3HA 2GZ5A 2EA2A 2MATA 2V6CA 4IKTA 4U6ZA 2BB7A 3Q6DA 3L7GA 1CHMA 1R58A 5CIKA 3MX6A 4U75A 2BWWA 3RORA 3IU7A 2Q95A 3TAVA 3PEBA 4ZWOA 1C27A 4QR8A 2GTXA 4U73A 3S6BA 4Z7MA 1A16A 2BWYA 2GG3A 2GG0A 2BH3A 1C23A 5D6FA 2BHDA 3OVKA 3I7MA 3BIPA 1BOAA 5JFRA 1BN5A 1W7VA 4PV4A 4FLJA 1WLRA 4IPAA 3QOCA 4U70A 3L24A 1YJ3A 4U6EA 2B3LA 4ZWUA 2V3ZA 2BWVA 1WBQA 3CB5A 2BWXA 4S00A 5CDVA 2GU7A 2GG2A 2Q92A 2GG5A 3O5VA 2BHCA 1M35A 1QXWA 4U76A 3PKEA 4MATA 4FO7A 1KP0A 2Q93A 2DFIA 2NQ7A 2NQ6A 3PKCA 5JI6A 4FKCA 5FCHA 1XNZA 4OOKA 4FUKA 1YVMA 2P99A 1YW9A 5E2CA 3IG4A
chains in the Genus database with same CATH topology
3FMRA 2BHBA 1Y1NA 2GG7A 2Q8KA 2GA2A 4IU6A 1WN1A 4A6WA 1N51A 3CTZA 3PKDA 4FLLA 4JUQA 1PV9A 1MATA 4ZWPA 4FO8A 4U69A 2Q94A 2BHAA 2GGBA 4U6JA 5CLSA 2ADUA 3CB6A 4IDYA 4IF7A 4U6CA 4U71A 2GG8A 2GU5A 2OKNA 1B6AA 1R5HA 2B3KA 5D6EA 3PN9A 1W2MA 2Q96A 3D27A 4RZYA 1QXZA 4U1BA 4IKRA 2GU4A 4FLIA 1YW7A 2EVOA 2BWSA 1JAWA 1KQ0A 2V3YA 5E5BA 2GGCA 4RZZA 2BWUA 1KQ9A 3MR1A 2EA4A 3FM3A 3BITA 1C22A 2ZSGA 5CNXA 2HOWA 3IL0A 5CDLA 1QZYA 5JHUA 1C21A 3RVAA 2V3XA 2GG9A 2P9AA 5CE6A 1WL9A 1YW8A 2OAZA 1QXYA 2GU6A 3FMQA 4HXXA 3TB5A 1B59A 1O0XA 3MATA 1XGSA 4KM3A 1XGMA 2IW2A 4A6VA 4IKUA 4FLKA 1C24A 4R60A 5CDEA 2EVCA 3PKBA 1R5GA 4RGZ1 5FCFA 4ZNGA 3IU9A 3BIQA 4S2RP 3PKAA 1WL6A 4S01A 4EGEA 1WY2A 2EVMA 4S2TP 1WKMA 1XGOA 1XGNA 2BWTA 2P98A 4B28A 2G6PA 3IU8A 4IECA 2BN7A 4IKSA 4U6WA 4PNCA 3OOOA 2B3HA 2GZ5A 2EA2A 2MATA 2V6CA 4IKTA 4U6ZA 2BB7A 3Q6DA 3L7GA 1CHMA 1R58A 5CIKA 3MX6A 4U75A 2BWWA 3RORA 3IU7A 2Q95A 3TAVA 3PEBA 4ZWOA 1C27A 4QR8A 2GTXA 4U73A 3S6BA 4Z7MA 1A16A 2BWYA 2GG3A 2GG0A 2BH3A 1C23A 5D6FA 2BHDA 3OVKA 3I7MA 3BIPA 1BOAA 5JFRA 1BN5A 1W7VA 4PV4A 4FLJA 1WLRA 4IPAA 3QOCA 4U70A 3L24A 1YJ3A 4U6EA 2B3LA 4ZWUA 2V3ZA 2BWVA 1WBQA 3CB5A 2BWXA 4S00A 5CDVA 2GU7A 2GG2A 2Q92A 2GG5A 3O5VA 2BHCA 1M35A 1QXWA 4U76A 3PKEA 4MATA 4FO7A 1KP0A 2Q93A 2DFIA 2NQ7A 2NQ6A 3PKCA 5JI6A 4FKCA 5FCHA 1XNZA 4OOKA 4FUKA 1YVMA 2P99A 1YW9A 5E2CA 3IG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMR A;  2BHB A;  1Y1N A;  2GG7 A;  2Q8K A;  2GA2 A;  4IU6 A;  1WN1 A;  4A6W A;  1N51 A;  3CTZ A;  3PKD A;  4FLL A;  4JUQ A;  1PV9 A;  1MAT A;  4ZWP A;  4FO8 A;  4U69 A;  2Q94 A;  2BHA A;  2GGB A;  4U6J A;  5CLS A;  2ADU A;  3CB6 A;  4IDY A;  4IF7 A;  4U6C A;  4U71 A;  2GG8 A;  2GU5 A;  2OKN A;  1B6A A;  1R5H A;  2B3K A;  5D6E A;  3PN9 A;  1W2M A;  2Q96 A;  3D27 A;  4RZY A;  1QXZ A;  4U1B A;  4IKR A;  2GU4 A;  4FLI A;  1YW7 A;  2EVO A;  2BWS A;  1JAW A;  1KQ0 A;  2V3Y A;  5E5B A;  2GGC A;  4RZZ A;  2BWU A;  1KQ9 A;  3MR1 A;  2EA4 A;  3FM3 A;  3BIT A;  1C22 A;  2ZSG A;  5CNX A;  2HOW A;  3IL0 A;  5CDL A;  1QZY A;  5JHU A;  1C21 A;  3RVA A;  2V3X A;  2GG9 A;  2P9A A;  5CE6 A;  1WL9 A;  1YW8 A;  2OAZ A;  1QXY A;  2GU6 A;  3FMQ A;  4HXX A;  3TB5 A;  1B59 A;  1O0X A;  3MAT A;  1XGS A;  4KM3 A;  1XGM A;  2IW2 A;  4A6V A;  4IKU A;  4FLK A;  1C24 A;  4R60 A;  5CDE A;  2EVC A;  3PKB A;  1R5G A;  4RGZ 1;  5FCF A;  4ZNG A;  3IU9 A;  3BIQ A;  4S2R P;  3PKA A;  1WL6 A;  4S01 A;  4EGE A;  1WY2 A;  2EVM A;  4S2T P;  1WKM A;  1XGO A;  1XGN A;  2BWT A;  2P98 A;  4B28 A;  2G6P A;  3IU8 A;  4IEC A;  2BN7 A;  4IKS A;  4U6W A;  4PNC A;  3OOO A;  2B3H A;  2GZ5 A;  2EA2 A;  2MAT A;  2V6C A;  4IKT A;  4U6Z A;  2BB7 A;  3Q6D A;  3L7G A;  1CHM A;  1R58 A;  5CIK A;  3MX6 A;  4U75 A;  2BWW A;  3ROR A;  3IU7 A;  2Q95 A;  3TAV A;  3PEB A;  4ZWO A;  1C27 A;  4QR8 A;  2GTX A;  4U73 A;  3S6B A;  4Z7M A;  1A16 A;  2BWY A;  2GG3 A;  2GG0 A;  2BH3 A;  1C23 A;  5D6F A;  2BHD A;  3OVK A;  3I7M A;  3BIP A;  1BOA A;  5JFR A;  1BN5 A;  1W7V A;  4PV4 A;  4FLJ A;  1WLR A;  4IPA A;  3QOC A;  4U70 A;  3L24 A;  1YJ3 A;  4U6E A;  2B3L A;  4ZWU A;  2V3Z A;  2BWV A;  1WBQ A;  3CB5 A;  2BWX A;  4S00 A;  5CDV A;  2GU7 A;  2GG2 A;  2Q92 A;  2GG5 A;  3O5V A;  2BHC A;  1M35 A;  1QXW A;  4U76 A;  3PKE A;  4MAT A;  4FO7 A;  1KP0 A;  2Q93 A;  2DFI A;  2NQ7 A;  2NQ6 A;  3PKC A;  5JI6 A;  4FKC A;  5FCH A;  1XNZ A;  4OOK A;  4FUK A;  1YVM A;  2P99 A;  1YW9 A;  5E2C A;  3IG4 A; 
#chains in the Genus database with same CATH topology
 3FMR A;  2BHB A;  1Y1N A;  2GG7 A;  2Q8K A;  2GA2 A;  4IU6 A;  1WN1 A;  4A6W A;  1N51 A;  3CTZ A;  3PKD A;  4FLL A;  4JUQ A;  1PV9 A;  1MAT A;  4ZWP A;  4FO8 A;  4U69 A;  2Q94 A;  2BHA A;  2GGB A;  4U6J A;  5CLS A;  2ADU A;  3CB6 A;  4IDY A;  4IF7 A;  4U6C A;  4U71 A;  2GG8 A;  2GU5 A;  2OKN A;  1B6A A;  1R5H A;  2B3K A;  5D6E A;  3PN9 A;  1W2M A;  2Q96 A;  3D27 A;  4RZY A;  1QXZ A;  4U1B A;  4IKR A;  2GU4 A;  4FLI A;  1YW7 A;  2EVO A;  2BWS A;  1JAW A;  1KQ0 A;  2V3Y A;  5E5B A;  2GGC A;  4RZZ A;  2BWU A;  1KQ9 A;  3MR1 A;  2EA4 A;  3FM3 A;  3BIT A;  1C22 A;  2ZSG A;  5CNX A;  2HOW A;  3IL0 A;  5CDL A;  1QZY A;  5JHU A;  1C21 A;  3RVA A;  2V3X A;  2GG9 A;  2P9A A;  5CE6 A;  1WL9 A;  1YW8 A;  2OAZ A;  1QXY A;  2GU6 A;  3FMQ A;  4HXX A;  3TB5 A;  1B59 A;  1O0X A;  3MAT A;  1XGS A;  4KM3 A;  1XGM A;  2IW2 A;  4A6V A;  4IKU A;  4FLK A;  1C24 A;  4R60 A;  5CDE A;  2EVC A;  3PKB A;  1R5G A;  4RGZ 1;  5FCF A;  4ZNG A;  3IU9 A;  3BIQ A;  4S2R P;  3PKA A;  1WL6 A;  4S01 A;  4EGE A;  1WY2 A;  2EVM A;  4S2T P;  1WKM A;  1XGO A;  1XGN A;  2BWT A;  2P98 A;  4B28 A;  2G6P A;  3IU8 A;  4IEC A;  2BN7 A;  4IKS A;  4U6W A;  4PNC A;  3OOO A;  2B3H A;  2GZ5 A;  2EA2 A;  2MAT A;  2V6C A;  4IKT A;  4U6Z A;  2BB7 A;  3Q6D A;  3L7G A;  1CHM A;  1R58 A;  5CIK A;  3MX6 A;  4U75 A;  2BWW A;  3ROR A;  3IU7 A;  2Q95 A;  3TAV A;  3PEB A;  4ZWO A;  1C27 A;  4QR8 A;  2GTX A;  4U73 A;  3S6B A;  4Z7M A;  1A16 A;  2BWY A;  2GG3 A;  2GG0 A;  2BH3 A;  1C23 A;  5D6F A;  2BHD A;  3OVK A;  3I7M A;  3BIP A;  1BOA A;  5JFR A;  1BN5 A;  1W7V A;  4PV4 A;  4FLJ A;  1WLR A;  4IPA A;  3QOC A;  4U70 A;  3L24 A;  1YJ3 A;  4U6E A;  2B3L A;  4ZWU A;  2V3Z A;  2BWV A;  1WBQ A;  3CB5 A;  2BWX A;  4S00 A;  5CDV A;  2GU7 A;  2GG2 A;  2Q92 A;  2GG5 A;  3O5V A;  2BHC A;  1M35 A;  1QXW A;  4U76 A;  3PKE A;  4MAT A;  4FO7 A;  1KP0 A;  2Q93 A;  2DFI A;  2NQ7 A;  2NQ6 A;  3PKC A;  5JI6 A;  4FKC A;  5FCH A;  1XNZ A;  4OOK A;  4FUK A;  1YVM A;  2P99 A;  1YW9 A;  5E2C A;  3IG4 A; 
#chains in the Genus database with same CATH homology
 3FMR A;  2BHB A;  1Y1N A;  2GG7 A;  2Q8K A;  2GA2 A;  4IU6 A;  1WN1 A;  4A6W A;  1N51 A;  3CTZ A;  3PKD A;  4FLL A;  4JUQ A;  1PV9 A;  1MAT A;  4ZWP A;  4FO8 A;  4U69 A;  2Q94 A;  2BHA A;  2GGB A;  4U6J A;  5CLS A;  2ADU A;  3CB6 A;  4IDY A;  4IF7 A;  4U6C A;  4U71 A;  2GG8 A;  2GU5 A;  2OKN A;  1B6A A;  1R5H A;  2B3K A;  5D6E A;  3PN9 A;  1W2M A;  2Q96 A;  3D27 A;  4RZY A;  1QXZ A;  4U1B A;  4IKR A;  2GU4 A;  4FLI A;  1YW7 A;  2EVO A;  2BWS A;  1JAW A;  1KQ0 A;  2V3Y A;  5E5B A;  2GGC A;  4RZZ A;  2BWU A;  1KQ9 A;  3MR1 A;  2EA4 A;  3FM3 A;  3BIT A;  1C22 A;  2ZSG A;  5CNX A;  2HOW A;  3IL0 A;  5CDL A;  1QZY A;  5JHU A;  1C21 A;  3RVA A;  2V3X A;  2GG9 A;  2P9A A;  5CE6 A;  1WL9 A;  1YW8 A;  2OAZ A;  1QXY A;  2GU6 A;  3FMQ A;  4HXX A;  3TB5 A;  1B59 A;  1O0X A;  3MAT A;  1XGS A;  4KM3 A;  1XGM A;  2IW2 A;  4A6V A;  4IKU A;  4FLK A;  1C24 A;  4R60 A;  5CDE A;  2EVC A;  3PKB A;  1R5G A;  4RGZ 1;  5FCF A;  4ZNG A;  3IU9 A;  3BIQ A;  4S2R P;  3PKA A;  1WL6 A;  4S01 A;  4EGE A;  1WY2 A;  2EVM A;  4S2T P;  1WKM A;  1XGO A;  1XGN A;  2BWT A;  2P98 A;  4B28 A;  2G6P A;  3IU8 A;  4IEC A;  2BN7 A;  4IKS A;  4U6W A;  4PNC A;  3OOO A;  2B3H A;  2GZ5 A;  2EA2 A;  2MAT A;  2V6C A;  4IKT A;  4U6Z A;  2BB7 A;  3Q6D A;  3L7G A;  1CHM A;  1R58 A;  5CIK A;  3MX6 A;  4U75 A;  2BWW A;  3ROR A;  3IU7 A;  2Q95 A;  3TAV A;  3PEB A;  4ZWO A;  1C27 A;  4QR8 A;  2GTX A;  4U73 A;  3S6B A;  4Z7M A;  1A16 A;  2BWY A;  2GG3 A;  2GG0 A;  2BH3 A;  1C23 A;  5D6F A;  2BHD A;  3OVK A;  3I7M A;  3BIP A;  1BOA A;  5JFR A;  1BN5 A;  1W7V A;  4PV4 A;  4FLJ A;  1WLR A;  4IPA A;  3QOC A;  4U70 A;  3L24 A;  1YJ3 A;  4U6E A;  2B3L A;  4ZWU A;  2V3Z A;  2BWV A;  1WBQ A;  3CB5 A;  2BWX A;  4S00 A;  5CDV A;  2GU7 A;  2GG2 A;  2Q92 A;  2GG5 A;  3O5V A;  2BHC A;  1M35 A;  1QXW A;  4U76 A;  3PKE A;  4MAT A;  4FO7 A;  1KP0 A;  2Q93 A;  2DFI A;  2NQ7 A;  2NQ6 A;  3PKC A;  5JI6 A;  4FKC A;  5FCH A;  1XNZ A;  4OOK A;  4FUK A;  1YVM A;  2P99 A;  1YW9 A;  5E2C A;  3IG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...