2BOBB

Potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobB01
4WDIA 2DTMH 2AQ3A 3WUWB 3IETA 2YBRB 2YC1B 2B4CH 4WV1C 4WEBH 1GOFA 4L8SB 2CKNA 1JGVL 3CFJA 1KCRL 4Z7UB 4MS8D 4MYWB 3VRIB 2P48B 1DQQB 5CJOH 4YDJA 5JIKA 4K3JL 5L2KA 4RAVA 4EI5B 3TNMA 4XPTL 2OL3H 5KS9F 2D7OA 1QD0A 3NIFE 1FAIL 3H9SD 3TJEH 4JB9L 3MODH 2XOTA 1MFNA 3T2PA 2X4NB 1CK0L 3QXTA 4TRPH 1TVBB 1WT5A 4QHUA 5GSVB 3VXPB 6FABH 3R0NA 2V9RA 3A6CL 3E8UL 4G6AD 4NQDD 4RFEA 3V95A 3GHEH 3GIZL 5KSUA 4X99B 4IMKA 3STBA 3P9LB 5MERB 3F62A 3TJHD 2A6DA 2L7UA 5CEZH 4ZO8A 1OD9A 4JR9L 3WDIA 5LXGH 2E8YA 2V2WA 1PKQB 1CFVH 4R4ND 4KUCD 5F7FA 2NX5A 3SJVA 4L5FH 4LLUB 1RZIA 3FTGA 1MFEH 4K7PL 3OXSA 2OZ4L 3MJ9H 4KJQC 4U6TA 4NQSB 1XFPA 3QXVA 3FB6A 3MOBH 3QCTL 1CXIA 1FVEB 3MLTB 4LSQH 5D7IB 2WINA 1S7UA 5J13B 1EA9C 3DTXA 3WJJC 3MYJB 1HZHL 4YX2L 3S5LG 4PJEA 3VI3F 1G7LB 1Q9LB 4HUWA 3VFGL 1T1XA 4Z78B 5DD3L 1VFAB 4PV8B 1N5AA 4FP8H 4ZQKA 2EZ0D 1AO7D 3QXDB 3ILPB 2EH7H 3JWOC 3MX0A 4P2QD 4X83A 1S7TB 3P9WB 3QJHB 1PX3A 1ZVSB 3B9KB 3Q2CA 4RGOL 1FIGH 4GO6B 5HHMD 3ULVF 3QEQE 1LO0H 5HI3D 1W0WB 3CXDH 3C9NA 5D93B 3EYQC 1XF2A 3V5HA 3SCMB 2B1AH 2P24B 4HLJA 3ULUL 3BIKB 1NJ9A 3BQUC 4OCXH 4YR6B 1FH5H 5IB4A 5KSAA 2YA0A 3SDXA 3U79A 3O6KL 5GS3A 3CSYB 2L0DA 4Q97A 2BVYA 3VXMD 2VIRB 1DQJB 5SWQA 5I16A 5I1CL 5K33A 3B2UC 1I8KB 3MZTA 4WTZA 5GRVL 5J3HC 4Z7VA 3T3PE 4IRJB 5BVPH 3VFSB 3EOBB 2WIIB 5CJ8A 2BJML 3OR7B 4NM4H 4PRIE 5SX5H 1JPFB 3CX5K 3OKDA 2OTWA 5C09B 5IB1A 3MMEA 2DBLH 1JF1B 2BNQE 2GJJA 5EZLA 5DK3A 4ODXA 1P7KB 4KVNH 4QWWD 5EZOL 5I1IL 2BNRB 3GBLA 4EJ1C 5E56A 3KPNA 5HYSG 4NC1C 1A7QH 1RUQH 3T1FB 1KPVB 3F7VA 3BDBA 5BZWA 2A1WH 4QRQB 3MLPA 4IIQA 2PXYC 4X7TA 3EKCA 2H8PB 4FXGB 4ZG1A 5CMAA 3RFZC 4TUKL 4EBQL 1QLFB 3OBAA 1MWAL 1TNNA 2DQJL 1MJJA 3KPRB 1N59B 3M1BB 3UBXA 3P11H 1ZLWK 1OB1B 5HHXL 1EXUA 1EK3A 3H3PL 4LCUA 4PRNA 5BZDB 2EYSA 2AABL 1RK0B 1IQWL 4Y19E 3SGEH 4C57C 2YD7A 5C3LD 5GIRA 3QIBA 5AUMB 3BPCB 5EU5B 1H0DB 1J88A 1SY6H 4GRLA 3Q0HA 1R3KB 4OZFH 3F5WA 5TDNA 5DJDB 5B39B 3LEYL 5TF0A 1CCZA 2HRLA 4ALAL 4ZTPL 2NY1C 4CVZB 3DSFH 5C2BH 5T3ZE 1K5NB 2OBGA 4H26A 4CMHB 1CXLA 3BFOA 4R3SB 4LHUD 4OF7A 5C0BD 3DBXB 4Z7NF 4ELKB 5D1ZB 4J4PD 1M71B 1BD2E 3WMSA 5SWZD 4OD1L 5E08L 3HNTL 2ZCKH 1U8JA 5DRXB 4Q9CA 1D5MB 2CR3A 2VC2H 2E3VA 1G6RB 2EDBA 1T1WB 2FJGA 3D5OF 3EDFA 3UTQB 1RU9L 1BVLB 4IJ3B 3VGDA 5FGBA 3CFBA 3O41A 5GRUH 4YUEH 3V9FA 3DETC 5HHVL 1OAYH 5TE7H 3HB3C 5HVGB 2I9TB 3SDAC 4ZOCA 1NDGA 4ODTL 2ATKA 5I19L 1FORL 4UTAH 3T0EA 1PQZA 3HE7D 2GTWB 2C1PA 1SEQH 1T66C 4PJIE 4FA8A 4BH8A 3LKPA 1U8QB 5E8OB 3QEQB 4N0YL 2XICA 2HMID 4JFED 1DVFD 3WFDH 4Q2ZB 2PTTB 1E4KC 2BMKB 4KRMB 3GKWL 4DW2L 1Y0LB 5ALCL 5IEKB 3DARA 4ZS7L 1MLCB 1Q0YL 5HHOA 1SMAA 2Q20A 4TSCH 1CGVA 2VUOA 4KK9D 4KJPC 3GM8A 2MPAH 1ZS8A 4F2MA 1NFIB 1DQLL 4FQ2H 4AY0A 2IAMC 1MFDL 3OKKB 1MLBA 2X1XR 3FQNA 1I85C 5SV4A 1EUUA 2CK0H 3QIUA 1QLEL 3VXRE 3UBXG 1QO3A 4PRIB 4HKJA 2AK4A 5D72L 4WJ5A 4C83B 4M7ZC 1K4CB 1PKOA 2NW2B 2WBKA 2ZNWA 3BEWB 2BNQB 1HKLH 1JIBA 1RIVH 4P2CG 3DX6A 1A6UH 2GYSA 3VFNA 4G8FA 5ANME 3ZL4L 3FQRB 2BNUB 5IT2L 3VD9A 3QUZD 3VH8A 1A22B 5E7BA 3CX2A 2VL5A 5CIPA 1QKZH 3GEWB 4Z8FL 4WO4D 5H8DA 3FMGL 1U8NB 2X89A 4BKLA 3ESVF 4WGVB 2XPGA 1FFNB 3TN0A 5L0QC 4OLVL 2QJDA 1KJ2H 4KV5E 3DHMA 2HKHL 2BOBB 4JY5L 3CFEA 1OPGH 4CJ0A 3UTOA 4TVSa 2PO6A 4J3OC 5GGQL 4POYA 2APFA 4TN9A 5EOTB 4XNQA 5C08A 5AAWA 4GKSA 1V8HA 3WNKA 1IE5A 2W0LA 4LCWB 3PABB 3LN5B 3L7EB 1GXEA 1M7DB 4S2SA 3NTCL 1YA5A 4JDVA 4QXGL 4DGIL 3ULUD 4GUPA 1RZJH 1S7RA 1EH9A 4R4BA 3BH9B 4OT1H 3CZFA 2BSRB 4W6WB 1HEZA 4O51B 1FDLH 1JPTH 2VLRD 4J1UB 2XRAH 1TVHA 3M8OL 4YEFA 2IMMA 3QH3A 5FGRA 4LCCB 4XPAL 1LEIB 4L9LC 4P3CL 3BZFB 2P44B 1HQRA 1AHWA 1HINH 4HS8L 4TVPE 4FFWC 4UQ2B 3QDJE 1EHAA 4KPHL 1LE5A 4HUVA 4BQBA 2Z31B 4U0QB 3DJ9A 2A9NL 5F3BA 4X9IA 3BISA 5F3HB 1IGTB 3S7GA 4WFFE 4HFUH 3X14A 1BZ9B 1MNUH 4XWOC 3BN9C 3DLQR 3RUGB 5B21A 1BM3H 4DEPB 2ZZUT 1VPOH 4OQTH 3ZE1F 1GGCH 3ME0A 4EUPH 2D4FA 5D9SB 1YEEL 2R15A 4GT7A 4Z7OF 5EU4A 3QSKB 2UZIL 1U3YA 4OGXL 4PJIB 2HRPH 4MMXC 2A73B 1N0XL 4PB9L 4RQQB 5EZJB 4HUUB 4LKCA 4KKCD 4Y19D 2WBJA 3DI3B 1WFNA 4K8RL 4CBPA 3VH8G 4YPJA 3OZ9H 4M5ZH 5HI5C 3ARDB 3H7LA 4LLVB 3H6JA 3IKCA 1NCBH 4FXLA 1I8MB 3MOAL 4G7YH 5HYIA 2HN7B 3FFCB 2X4PB 5D7KD 5DRNB 3OMZA 4JQIL 5DMGD 1XGTB 2HVKB 3EJYC 3EGSB 4DTGH 2WUBL 4JG0L 1RIUL 3I6LE 4AYFA 1DQMH 4HWBH 4QHKI 4GRWF 1T80A 1KEGH 1EAPB 4WV1A 3ZE0F 4PRBB 2E6JA 5TQ2L 3BAEH 4P9ML 3BWAA 5IVZB 2DD8L 4MSWA 4O2EB 1LK3H 3TO4D 4F7CB 4HF5L 4U1SA 1XT5A 3FKUS 3WE6A 4F7PB 5CCKL 2EKJA 2BVQA 2JCCF 4U0RC 3OAZH 2GITB 4PBWD 1RQ5A 2HVJB 2CRZA 4N0UA 2AJVL 1I1YB 2EDXA 5FO7B 1BJ1H 4G8EA 4HC1H 5IUSA 5FDWA 3MUJA 4LF3A 1N64H 2IH3B 3P4OA 2CO7B 2MJWA 3RWFB 1KCSL 3FO2A 4G8IB 4H0IA 3CH1B 3W0WB 1H3TA 3JUYA 4HG4K 5F7EH 2ED8A 5JOFB 5DK0A 3GUTA 3QDGD 9CGTA 4MS8C 5D1QA 4HUXB 4HUNB 5AWNL 2BSSA 5EU6B 4O58H 4JLRB 1HHHA 1IQDB 1MFAH 1ODAA 1WFUA 5A16A 3LKRA 2EICA 4HZAA 1H3UA 2J7LA 1FSKC 1JPSH 2PTVA 4G3YL 4K23H 5D71L 5LWYL 3WXWL 1BEYH 1YPZF 5SX4I 4OSUH 4UDUA 1FYTB 5F7NC 5IBTH 1P69B 3O3EA 4HS3B 5GJSH 3RZCB 1GZPB 3BP7A 5DD5L 1RZKL 4R2GB 4OM0H 4G6AC 1T7XA 5INDB 4I8DA 4C56A 1QPXA 1SYSA 4M48H 5K9KB 3LAFA 1NL0L 5DI8A 1YMHB 2EDWA 3WJJA 1NAKL 5ESAA 1ULVA 2QSCL 3QDJB 2R0WL 2I26N 4AMKH 2ADGA 4F33A 2OK0L 3B5GA 5F89B 4R4NC 3RIAK 2DJUA 4JFDE 3IDIB 3VXUE 1G0YR 1PVHA 4XP5L 5HY9A 3REVB 1GRWA 5BO1L 1OW0A 4OIBA 3GBNH 4E41D 3PIQA 4K94H 2GT9B 5T1DL 5EZIH 1UWXH 1NDMB 4L9DA 5EU3A 1JI1A 1GJIA 1YYMH 2DQIL 3QWRA 1I1FA 1INQB 3P30H 1DBAL 1UM5L 3NH7H 1ETZB 4OD2A 2EZ0C 4X6CB 3FN3A 1OP5H 5ADPL 3VFPB 1CGUA 4M6OH 2ZOKA 5CEZE 5T5NG 2DQHL 3SGJC 3SE8L 5KW9L 4GBXD 1BVKA 1A14L 2Y25A 4ZD3H 3HC3H 4LLYA 2PW2B 3FRUB 5IESH 4NZRH 2X1QA 2JKXA 4J3SA 1EFXD 5TQ0H 1QSFE 3FO1A 1ZK9A 2IPKA 2IG2H 2PTUA 1T04A 2GK0A 3V8CA 3H9HB 3V7AG 1MI5B 5DUBB 3UAJC 1IAKB 1ZT1B 4WFHD 4NHUA 5GRJL 3OGCB 4TVPD 4P4RB 2IH1B 3ZHDA 3MLVH 4NKDA 2FB4H 3AS1A 3HMXH 1IKFL 5EC1A 4PJ8B 5BRZE 2BK8A 3DHJA 3JWDH 4MAUH 1G7QA 3RPIA 5I9QB 4DGYL 3TZVB 3IXAA 1JWMB 3L7FB 2X4OB 2R2EB 3SQOH 3ARFA 1KB5H 1HHGA 1IEAB 2GTZA 2MCPH 2I5YH 4HZLA 1JRHI 4M7LT 5T1LA 3OXRB 5JIIA 5F9JA 1VGEL 3UBXI 1JGEB 1NUNB 3GB7A 1Z0NA 5J11C 2Y07H 2VSCA 4QWWC 2DMKA 5HYSB 5LBSL 3VFMA 1JV5A 1KLUA 5I15H 2W9EH 1G9MC 2EDOA 3O11B 2KDGA 5CSZB 4YHNB 1LK2B 2V2WB 4KQ4H 1ZA6A 4S1QL 1QFHA 1HHIA 3HG1A 1A7NL 4JO2H 1CD8A 3CCHB 3LOWA 4Z0BL 4K8RD 5C07D 3MRFA 3LEVH 3SKMA 4WRLA 3SGKC 1A9EA 5EBWA 2WWKT 3LS5H 4X6DF 4CN6A 1TPXB 4UB0L 3DOSA 3OL2A 4Y16A 3MLYL 5TFSH 3ZDZF 3AS3A 3FQUB 4Z76A 4KZDH 1ZOXA 3HI1A 3IDYB 4TYUA 1S3KL 1U8HA 3DXAB 1QSEA 1N5AB 1FL3B 3IFLH 4YDLC 2A6KB 1OLLA 3A6BL 3MA7A 4JREC 4ZNEE 2B20A 1FBIL 3SKUD 4FQXC 3MLSH 3OKNB 5DJAB 4IOFD 4NQXB 3MRIA 4MA7L 1NC2B 5DMIH 7CGTA 4N8CH 2R69H 3HUJF 3WN5C 4YJZL 4HKXB 4ZFGL 1MRDH 1FNHA 1BFVH 1W72H 2XN9D 3NACH 1XF2B 4JFDB 3T2NL 4YBLC 5KZCB 3LY6A 1OVZA 1Z9OA 3G6JE 5C0RH 2OL3B 5IKCB 5KOMC 5D70L 3MZGB 4N0FA 4LLQA 4GKZA 2XA3A 4LSVL 3U7AA 2VRAA 1E28A 3TGXA 4J4PC 3K74B 4ETQA 1A9BB 3LRHA 2AKRA 3MRJA 4K7PY 1KV3A 1DR9A 4JPIB 3SY0B 1QUNA 4XP9H 1MY5A 5KVGH 1CFBA 1FHGA 4XRCB 5DJ0B 4OUUA 1UB5A 1XCQB 4FFVD 5TH2B 4B7LA 5FYLE 5L88H 2B1HH 1EO8L 3ZKQD 1IM9A 1L7TH 3SGEI 3AU1A 4XVTH 2VXUL 1P4IH 4R97B 4YNYA 1I85A 3HE7C 2W60B 3BD5A 2R1XB 3HNSL 3MRGA 4KUZL 2P5WD 5CP7A 1E6JL 1O0VA 1GL4B 2OX5A 5MHSD 4MNHB 1QSFB 1AQKL 1DVFC 1T1ZB 5IOPA 4JFXA 4KVCH 4LRIA 4QEGA 2E7BA 4OZHA 5F9WC 2A77L 3FRPA 4IIQB 3RNKB 4M7JL 1QLRA 3I6KA 1EMTH 3UJIL 5J56B 3VWJD 2GSIA 3EOAB 3MROA 4IDJH 4O2FB 4NWTL 5DTFA 4R0LC 4JFFA 3IFOA 1TQCB 5CINL 2XFXB 4APQD 3ESUF 5BRZB 4L8BB 1S78C 4KHXH 4P57A 3S36X 5F7HA 3VXUD 1MEXL 4DQOL 4I1NB 1HH6A 1HKFA 3QRGL 4V1DA 4XNXL 4HIHA 2EE6A 4WUUE 4PLKC 1LWRA 3L5JA 2FBOJ 2AW2A 2FD6L 3HS0A 1FO0L 4ORGB 4LQ1A 1XR9A 4LGPB 3QAZB 2IQ9H 5JO5A 3LQZB 2VH5L 1Y18B 4LARH 4Y5YC 4ESKA 3Q5OA 4HGWB 3OKLB 3BE1L 1SEBB 2AK1L 4MJ6A 4OM1L 1DN2A 2QADD 3MRBB 3KG5A 1GAFL 3FB7B 4NN7C 1NKOA 1CFTA 2VXQH 1GZQA 1AKJA 5EFIB 1EBPA 3Q3GB 4KQ3H 4BFBD 4LLDA 3OF6D 5JZ7D 1RV6X 2FBJH 4BFEA 5GS1B 3GSVA 5DJYB 3EOTH 4L9LA 5E2TH 1NCAL 1YQVH 2DQEL 4YDKL 2VSDA 4XXDB 1MCFA 2W07A 3K8LA 2NNAB 4XMPL 1I3UA 5I74B 5DK2A 3UDWC 4Y5XB 3HMWH 5DJCA 2GCYA 4JM2D 1OAKL 3KLAB 4LOUD 4PBVC 1IC5L 3NN8B 5GGSA 1J8HA 1H9VA 4RMTA 3V4UH 4ZDHB 4KRPB 5ICZA 5LJYH 2DYPD 1QFWM 1YEHL 2G75B 2YZ1A 4HFWA 1LD9A 4UT6L 5JW3L 1RD6A 4KTYA 5CJQL 3FRPG 1CDJA 3SO3C 4B0MM 4U1GC 5KVMC 1D3CA 5F8RC 1YYLH 4OZIF 2C4FU 4YIQA 3KHQA 5BMFL 2DDQH 5AZ2L 3QJFA 5JUEL 3RY5A 4H5SA 4OZGB 1GCFA 3QPXL 3BGFB 3G5VB 3O45A 4Q6IA 3FQWA 4E42B 3L3IB 2GEEA 3KPPB 2FH6A 4YFEA 3RIFK 3AFLA 5CZKA 1RZGB 3CLFH 1A4KA 43CAA 2CLRB 2P5EA 4OCLC 1I7TB 4OZFB 1HQ4B 1IMHC 4NQEA 1BQLL 1H8SA 5C6TL 4CU8A 4UOW1 1W8OA 1R3IH 3PWVB 1CZ8L 1AE6H 3S34H 3SHSA 3TBWB 1SYVB 3VFUB 3ZDXE 1J9CT 3JTTA 1IZKA 1HCFX 1S7QA 2ATPA 2JELL 4P2OD 2ZKHL 4FQ1L 1N7ML 4YHYC 3MLWL 1EUTA 4TUOB 1ED3B 4KKAD 5I1GH 3B5HA 4I0KA 4PJ7E 4NQCA 1U2HA 4UILH 5D7JB 1WAAE 2ZCHH 4EN3C 1ZLUK 4NC0B 4JO1L 5DMGC 2WANA 1X5GA 2OQJA 3QR2A 5CD3B 3P4NA 2H1PL 4NQTA 3U46B 5D7LD 1WZ1H 1O7SA 1NKRA 2D7TL 3STZA 5CKGA 2VLKE 2OXHA 4ZFOB 2DIJA 4UAOC 3RAJL 5F44A 1DBBH 4PJHF 3SPVA 4Z7UF 2YPVL 1ND0A 2XZZA 3O2DA 4KGJA 3CUPB 3RWJA 5J6GB 3DX8B 5FB8B 2JB6B 4F57L 3BKML 4HBCL 3EFFB 3D2UA 4YXLL 5GGUA 3TH2T 1NBZB 5D5ME 5CAYB 1XGQA 4P5MB 3WJLC 3TO4C 5DMKB 1LNUB 4N0CD 2BDNL 5DURB 4P4KC 1Q94B 3RGVD 1QG3A 4ZFZA 3VMNA 2QSVA 3TF7C 1A3QA 1AR2A 5EOCH 1HHKB 3IRPX 4MNGB 2F5BL 1OM3L 4JAMB 1RUAH 3QISA 4JPKL 3RVTD 3UTSE 2D0GA 4CKVX 5I71C 5IF0B 2VITA 3V6OC 4A6YH 5GGRY 1D5BA 5LGHH 4P49A 1FYHB 1LP9E 2R39A 1D6EB 4XNMB 2DLEA 5IQ7H 5BV7H 3WXVH 1J7VR 1B3JA 2HT2D 3HC0B 5EULV 4YBQD 2XWJB 5K59F 3AAZB 3NFSL 4XCCL 1UWXK 5B38A 3P9MA 4X6FB 3QI9D 2X4RA 4WU5B 5E5MB 2LTQC 1FIEA 5GGVY 2H32B 3WIHL 3SDYL 1A6VL 4WUUD 5FECB 3KJ6H 3G5ZB 5FHBH 1A7OH 1F4AA 4OUOA 1KJ2B 5J12C 3F12B 5KTEL 3QHZL 1NGYA 3QCVL 1OSPL 3DV6A 2NYYD 3LV3B 1H5BB 1UZ6F 3SDDC 3N9GH 2W1NA 4LHQB 1A1OB 3UTTD 1UT9A 4R7NB 2ESVA 2DQUL 3ROLA 3QWOA 2B5IB 1I7UA 3SGJA 2DBJA 3BHBB 3BMVA 1RHHA 5I76A 5IM7B 4ZAKB 1ADQH 2APWA 4UIMB 4RMSA 1CFQA 5BJTB 12E8L 4Y2DC 3X11B 4LPWA 2NTFB 4M9OA 4Y0GA 2V2XA 4MXQD 4U6HB 4P48A 1BFOA 5MI0B 3U7WL 4X0KB 5ERWB 2VERN 5I8OL 3OJVC 1EIBA 3WUZA 1MCIA 3W9EA 2W91A 3KDMB 4G6MH 3GGWB 3PNWA 1JWUA 35C8H 3F8UB 2KH2B 1GPOL 1JZ5A 4GBXC 1J18A 3VDAA 1I75A 5FIEA 2QQKL 2LVCA 4XVSH 4D9QE 4PJ7B 1ACZA 5CILL 3K4AA 2JJTC 4I0PB 1B2WL 3SKJL 1MJUH 2P7TA 2R1YA 3MLXL 3P4OB 3VXQA 2ZUXA 2AXFA 5E9DE 2XKSA 2QL1A 4EUPB 1VFOA 2YWYA 2F54E 3FO2B 4RNRB 1TXKA 3MV9E 5FHAL 3N50A 3HZYB 2VLKB 2VUYA 1XGYL 3QO1A 1TDQA 5BW7C 3T0BA 5JMRA 3KYKL 4IHOB 5CEYA 1F8TL 2VDQL 2VR5A 1CDCA 4G9DB 3OAYH 2XZAL 2ZUSA 3CH8A 4FHBD 5IMLB 5B38G 3GMQB 4PY7B 3V0VA 2CDEA 3RWHA 4U7SA 4RMRA 4PJGE 5FAAA 3I2CH 2WMPA 3NIFF 4LNRA 1NAMH 1I8IA 4OD3H 4X7DC 1D5IH 4X4YA 3VG0H 1JTPA 3KLHD 4QO1A 3AUVA 3PHOA 5JW4R 4GW5B 2ARJA 4NKIL 4Z7WB 4PG9B 3UTSB 1IT9H 4OLZL 4QOKE 4JRXE 3VXOB 2A9ML 2EIEA 2HFFB 3G6DH 4OLXL 2CDFB 1EJOH 3PGFL 3KPOB 1KJMB 3WKMH 1TCRA 4FQXA 4ZS6D 1Q0XH 3BEVA 2HT3D 3NBNA 1IARB 3CDFA 4JRYE 1HXYB 5E8PB 3QCUL 4Y4FA 1S5HB 5KS9A 3PDOB 5FDYA 3UZVB 2YPKA 1YY8A 4CMMA 2W9DH 4MMZC 2AJZB 3L3GA 1XF3B 4KI5D 1I3GH 3WD5L 1U8IB 4TTDD 4F7TA 4JFZH 1M05B 4J4PA 4XPGL 1A3LL 4FNLH 4GW1A 1QHPA 3LKQA 5SWZA 1JYXA 5JHDE 3EO1A 3O6FA 3NCYS 3UPAA 5K9JL 3VWKC 4FN0A 1B6DA 4IOFC 1NSNH 3V52H 1EJ6A 3O2VH 1LE9B 2GQHA 1KCVH 1HH9B 4Z95L 3OB0K 3QDMA 1WISA 1JGUH 1Q8MA 4TOYH 4FFYL 5IVXF 3TVMA 5JXED 2XTLA 3V4VL 4WHTB 3QNYA 4MD5B 4H1LA 3EDKA 1YEGL 1UA6L 1XGPB 5IIEB 1CLOL 1KTDA 2BVUA 3MNZA 4G5ZL 1HOCA 2HAZA 1UM6H 4NCC2 4WUKH 1VGKA 2ED9A 3B9KD 3GSNA 5FM4A 2DI7A 4FFVC 3ULUF 2PYFA 5J9PA 3IXAB 4R9HA 3RI5K 4MXWH 4QF1B 1UKQA 3T3PF 3VGAC 4QHNB 1H3XA 4R0LA 5IR1B 1PGRB 2DQFB 2VDMH 1KELL 4AT6B 4UI2A 3RA7L 1YMMB 3D85B 1S9YA 3MV8D 4LLWB 4PGEA 2E6PA 5KVEL 1RJYA 4P59L 1AD0A 3P0YL 2YN3A 1OF2B 3QO0A 2XA8L 3LRGA 2Q7YA 2H26B 4OFVA 3QIWD 1ZEAH 1H15A 3NAAL 5E8EA 4HWZA 3PUCA 5IFAH 4IRJD 3GK8H 2IANE 4L8DA 3RWDA 4PGBA 1RZKC 3BRDA 1EEYA 4O4YL 2ADJB 4HAGA 2J6EL 4UINH 3L5XL 3RWIB 4WIQA 5DYOA 1B0WA 4APQC 2ZG3A 4LKXB 1KIQB 1HSBB 1EEQA 1XIWB 1T5WA 4K3EH 1DUYA 5CUSH 5DQJB 1CD1B 2NY0D 5HPMB 2BNRD 3B3IB 3S97C 4WGWB 4JO3L 1AH1A 3VMPA 3ZO0A 1G7MA 4IRSD 3T65B 3CC5A 5IW1B 3B4NA 4HJJL 3WFEL 4FABL 4ZXBC 3MNWB 4TPRH 4AIOA 1NGXA 2BVTA 2MKLC 1OHQA 2VDPH 4ZODA 4WENB 3RWCA 4EOWH 1KT2B 3KYNB 5I6XC 4K3DL 5EH1A 4PJ9D 1CL7L 2NY5L 1FNGA 4JRXB 4QOKB 4EXPX 4NGHH 1YEIH 4XMLH 1F97A 1OAXL 2ADIA 3L5WB 3QFJB 3Q6GL 5DQ9A 3E3QC 1E4XI 2QADC 5DJZA 1KBGL 1DANU 3EYFA 5FOJA 1A47A 2VR4A 3UDWA 5B8CA 2AJ3B 2VLRA 3BDYH 4JRYB 2VQTA 3O6LH 4QTHA 3OJMB 1NBQA 2RJMA 1KB5B 4H1LG 4YHLL 2QSQA 2GFBB 5EIVA 4BUGA 1ACYH 1HHJB 5D2LB 4YHOH 2EDRA 3WFBL 5AD0A 5T1KD 5GGTH 5E0QA 2XZQL 3SKNA 3TPUB 1PG7H 4Q9RH 4Y1AE 2X4QA 4GAYA 4CNIB 1GGIL 3ARXA 5JHDB 2IADB 2WW8A 4PJFE 4PJAE 4JM2C 3QUMH 5IMKB 5LGJB 1JN6A 2X9YA 5DVNA 2Y7QA 1U58A 2EIDA 3CLEL 2RCSL 1IGFH 4WFEE 2LVEA 4M4PA 1JZ8A 3C60B 4ERSL 4PJIF 1T0NB 1VFBB 3ARBB 3QA3B 3WS6A 1FNEB 3ARVA 1VSCA 3T77B 4B41A 3EO9H 5HYJB 1OP9A 5GSRA 2G60H 1OAUH 4B7IA 4UZGA 1RZ8A 4CAGA 1MCWM 3S37H 4KRNA 5TPWL 4PRPE 4LMQI 2VXVH 2QQNL 2R56L 5IJKC 1M4KA 3WHE1 4XCFL 1CU4H 5CZXD 5JPNB 4PRDA 3VRJB 4AL8L 4P3DA 2HH0H 5EO9A 2DLFH 1UZ8A 4U1LA 4NP4H 4PR5A 3S35L 5L8KB 1MCPL 2R29H 4JPWL 4N1EA 1BX2A 1GH7A 5IB3A 5IHZA 4EN3A 3KXFE 4HXBL 4A2LA 3QUYB 1BIIA 1WTGT 1W72B 1RURH 4MWFA 3MRRA 1MHPL 4NIKB 1U36A 3E2HC 3ZKXC 3FAWA 1N3NB 1UWGL 5TDOA 5H35A 4P2OC 2FATH 4JO4H 2J88L 1MHEB 2IANB 1MVUB 1SJEA 2FL5A 1UCTA 3B83A 3TNNA 2KBGA 5AYUH 2APXA 3K8MA 3ET9F 4UUJA 3RL1A 3OG6B 4JN2B 3D9AH 3ARGB 4WW1A 1UEMA 5FA3B 3TO4A 5IG7A 1BAFH 4KV5F 4P4KA 1C7SA 4H8WL 3EYUH 4NO3B 4N5ED 5CGYD 1BGXL 1FQ9C 1OGAA 3TBVB 1WCBA 3V4PH 4TTGA 5BS0D 1JK8B 4MDIA 1ZA3A 3LH2H 5D6DC 3U82B 3V6OA 4FQHB 2XWBA 7FABH 1SM3L 1CD0A 3O8XC 2JJVA 4BSWB 4P46D 1F4YH 4XZUB 3W82A 5ILTL 5C0CE 2WZPD 4L3CB 2DAVA 3RGVC 4AEHL 4BZ1L 1P7QB 4AG4H 2V17L 3GMOA 3CFIC 8FABA 3U1SH 3WIIL 2VN7A 3KYOB 3NCJL 3PDDA 1WIUA 3UEZA 3MRPA 3JSSA 5D7SH 2CUMA 4J12A 5AAMA 1CFSB 1XAUA 4XX1G 3HRZA 4ZO7A 2NY4B 5DJ2A 2Z8WC 4LBEA 4XCEB 1NCDH 1HE7A 4LFHD 3PWLA 1AXTH 1NEZA 1TJIL 3LSOB 4OI9A 1RJCA 5F88B 3IF1A 3KJ4B 2EDLA 2HT2C 3EYSL 4YBQC 3GSUB 3SDDA 4GLRH 3VJ6B 4PS4L 5FGSA 1T7YA 2G5BB 3CK0L 3RU8H 3PV6A 3TO2A 2FNBA 3IFPA 1SHMA 4PJDF 4E9LA 3UPRA 3KPLB 1H3PH 2YK1L 4PJAB 2JB5H 5GHWL 4WI6A 5F6IB 3H2WA 4C55A 3WS3A 3TYFA 5EC2B 1FFPB 2P8PA 4RGMB 4GRWH 4P23B 2Y5TA 3GMMA 4OGYH 5EIIA 3DVNA 2ADFH 3VD5A 4XAKD 3MRNA 4Y2DA 5JORA 4NWUH 4PP2A 4GAFB 5L2KE 1J0KA 1U95B 2Z31D 1EDQA 4BK4A 4TNWF 2O5XH 4L3EE 5GGRA 2PKDA 4DUWA 2IFFL 4I4WA 2NYYC 3QNZA 4NPYB 4WW2C 1KIRA 4AIZB 1T7VA 3CU7A 1MJ8H 4PRPB 2HLFC 3LN4B 1X7QA 1AFVL 4HPOL 3GI9L 2D0FA 2UV3A 2JJSC 1AQDB 1U91A 4HKBA 1X6LA 4G6JH 2V5TA 2XG4A 1Z9MA 4ZUUB 3PHQA 1MFCL 5F1IA 5FV2A 5ICXB 3TYGL 3KWWB 3M17B 3LS4H 3I02A 1QBBA 2EDKA 1XF4B 2XZCL 3KXFB 4JE4B 4PRHB 4NSKA 4ZTOH 5JPMB 5ISZA 1X5KA 4N90E 1T22B 3A67L 5E03A 4KHTL 1KNOB 3MCLH 4JQXA 4YAQA 3OAYK 4O02L 1MIMH 1XF5A 5D96C 1AY1L 5H2BB 3FONA 2VXSL 4NZUH 4NNPH 4U1IA 4Y1AD 4YWGH 1V3MA 2NQCA 4MJIA 3MO1B 1AGFA 3RTQB 5CFHA 4XC3H 2BOCA 2X09A 2P49B 3X13A 4LVHC 5DT1L 4AENB 3HI5H 4S1RH 3G08B 4QRPE 4ONFL 1B0GB 3C5ZB 3UTZB 2VITB 3SDCA 1N5YH 3P77A 5E94A 2PW1B 2VDNL 3C6LA 3PWPD 4LVNC 1U42A 3GI8H 1NEZG 1Q1JH 1T7ZA 2OL3L 2QHRL 3RVUD 3DYOA 3TJEL 3QUXB 4TSBH 1DBKL 5DO2C 5EOQL 1F11A 2ICWB 1MFBL 5DUML 1LO5B 1X5ZA 3QP3A 4IRZL 2DQCH 4O9HL 4P5KB 5D1XB 5FK9A 4CVUA 4U6XA 4LSPH 6FABL 1FVCA 1I9RH 3ECBB 1LHZA 1T2QH 5IK3B 4ZUTA 4M62L 3UJJL 4F80A 4R26H 2JIXB 3ZT7A 2DKUA 3GHEL 2JCCA 3NFNA 3ES6B 5C0CB 3H42L 3O4OB 2VLMD 2XV6B 1T0PB 3OKOA 3BIAX 4C54A 1XH3A 1CF8L 3W0WD 3KLHC 1QBAA 4Y8AA 3T09A 1OAQH 3NIGE 4HWEL 3TBYA 5DHVA 5TDPB 2R2HA 1S9VB 5EU6D 5I1JH 3FOMB 4NDMA 5CGMA 1OWRM 2VDLH 4KAQH 2VDRH 4RFNB 3DX9B 2EIBA 1AC6A 2ZCLL 4POZC 1MFEL 2BSED 4I18B 4UIKL 3MGOA 4U3XA 2I07A 2EYTB 3MOBL 3L3HA 3MA9H 5C0ND 4CU6A 4OKVB 1H3WM 3L3KA 5GJTH 3VWKA 4HIJB 5ID1B 2HT3C 3FN0L 4JFOB 2DWEB 4CRPA 4QRRE 2Z92B 4PRAB 3SE4A 5I1EL 2EXYC 4HCRH 2QKIB 1YPZA 3VXSA 2NY7L 4K07A 1NMBL 1XGUA 1U8KA 3U36A 3QHFH 5MEND 4KI5C 2RR3A 2AJUH 3KS0J 1JRHL 2VLJD 4TTDC 3QDAA 3GSOA 4XCNA 4UQ3B 1EVTC 3UYPA 4A6YB 4L3EB 4LEOB 2VTFA 4KDWA 1UJ3C 3W2DL 3O6ML 5BV7B 4X98A 4GS7C 4LEXH 5D2NC 2D03L 3BOVA 4KK6C 5ICYB 4OCRH 4PJCF 4RX4D 3PWNB 5KVFH 4DZ8A 2VDOH 3MJ8A 4L4TD 3LRSB 5IROC 3ZYZA 1P2CB 1VACB 3HPLA 4LIQH 3AMLA 2XY1A 5J06A 2WWMD 2GK2A 2X4UA 1YJDH 3V8OA 4WI9A 3CVHA 5FYKH 4JHAL 4FQCL 5CEYB 5JHLH 1DQDH 4K3GA 3LPWA 3B9KC 3X12B 4ZUVA 2WBWB 4F58H 2F53E 2CR6A 2HT4D 3F58L 4TULH 4UV4H 1YEJH 4LSSH 4MAYB 3D3VD 1CWVA 3LB6D 3C87A 2VAAA 4KVNL 2N4IA 4XPFH 4FQIH 4BFIB 4DKEL 4R90L 5F7DB 4QT5A 3RDTB 1S7VB 2BERA 5FKPB 2H9GB 1C5DA 4QRPB 3WNOA 3QIWC 3DX7B 3MRQA 2F9BT 2XQBH 3IFNL 1OWWA 4ZXBA 2APVA 4IRJC 4LCYA 1A7PH 2AJXL 2YUXA 3TP4A 4M61B 3MFGB 5I2IA 1ZSDB 1I9JH 1IAIH 3K4ZA 3UMTA 1S5IL 1T4KB 1F90L 5E4EC 1GSMA 3GHBH 1G7HB 5C6PB 3MUY1 2YUVA 1NMCB 2C4FT 3RKDC 5HVHC 5HHOE 3GSWB 2A6JB 3CDGB 1K3ZA 4KFZC 4IRSC 4F7TB 1S7WA 1UXSB 3L5HA 1UQSA 5D6CB 1YNKH 4BELD 1JNJA 4XP6H 3TBSA 2E27H 2NX5D 4CADB 3SJVD 5E24E 3WKNA 1KLGB 5I17A 5DQDH 3AXLB 4PJ9C 4N9GB 1CGXA 3CJJA 2PR4L 4I2XA 4KMQA 4JFPA 2AK4E 1KJVB 3CFCH 3FOLA 3MGTA 5HGGS 3OKYA 4JFQA 1KPRB 3DIFB 1I7RB 1P4LB 3QUKA 4GG6E 1Q38A 4Q0XH 4HWUA 1RIHL 1INEL 1IAMA 4JG1H 4L4VE 4UTBL 3F6IA 2GI7A 3DXAD 4X6DA 3G6JF 4DKFL 4WWKA 4MD4B 4H1LB 2CSPA 2X4SB 3FO9A 4Z77A 1CT8A 1NAMB 2LE9A 3P4MB 4MNQE 4HAFA 3SE3C 5GRUL 3DUUA 1QRNA 1OAYL 2F74A 1IEBA 2YPLA 4TQEL 4NZTL 4C4KO 3K2UH 5FO8B 2FJFA 3HE6B 5I1LB 5I1AA 5C0AA 4JQVC 2D31B 3W11C 4ODSL 5LAXB 2X4TB 1X4XA 3EFDL 4CMHC 1FN4A 1TZHA 1CLCA 5C08E 4YC2B 5LCVH 1VERA 2YSSB 5KSAD 4G8GE 1DLFH 2VQUA 3LEXB 2ZJSL 4JDTL 1YUHA 4TSCL 3LIZH 1ORQB 1A6AA 1WBXB 2VXTH 2AV1A 1KPUA 4PJXF 5F1NB 4FQ2L 1YECH 2OJEB 1A6ZB 3FB8B 5IHUL 2VZTA 5DJ6B 4G9FE 3CSBA 4LRNH 1YNTB 1GYAA 3VFOB 3IDGA 1LO4L 1KB9J 5E2WL 1UYWH 3MNVA 5AEAA 5CZXC 2GJ6E 5L7XL 2ARWA 1ZT7A 2F53B 3O3BA 1LGVA 3Q5YA 1PYWB 4U1MB 5ACZA 3PWJA 3IDXH 1ZHNA 3RVVD 4M7LH 4QGTA 3F7YB 1AR1D 3S88L 3QEHA 2IBZY 1MRCH 3FB5A 4EDWH 1WBZA 2GUOB 3B8YA 4RAUB 5HGHB 4JJ5B 1IAIM 4JRWA 1Z5LA 4MQTB 4UT7H 4DFIA 5A2KH 4DZBA 5ENWA 3HNVL 4FTVE 3DVGB 1J1XH 1LO2H 4G6KL 2W9LA 4LDLB 4LL9A 3O8XA 3OKEB 1AGDB 1F4XH 4XP1L 5I8EB 4OCSL 1X5IA 5J1AB 5E7FA 2P42B 4Y7MA 1MHHB 4U33A 1CE6A 2JF1A 1I1AA 4YQXL 3VFTB 4OQ1A 1YEFH 2CKBH 1I7ZA 3QIBD 1NGPL 4AK1A 5C0JB 4MB5A 1U92B 4GRLD 1N8ZB 4LU5H 1PD6A 1GHFH 1XGRB 3PP4L 2FR4A 3PP3K 4ELMF 5FYJL 1MCNA 2BRRH 2QEJA 4I3RL 1PY9A 5IJVA 2PNDA 5AG8A 1I9IH 2XTJB 1R24A 1BZ7A 3BPNB 3V5KB 4B53A 5IW6B 1MCKA 1VKXA 2MCG1 2ZSWB 4ENEC 3V0AC 1QYGH 4GG6B 4XNUL 2DF3A 4PUBL 5GS0C 2PF6A 1FGVH 3MGAA 4L4VB 4D9RD 4TSAH 3WEXB 2IBZX 2X5PA 3IGAB 2J2ZA 4QHKJ 3NABH 4OV6F 3JV6A 1JMXA 1ZANH 3MREB 2E7LC 4MNQB 4HPYH 3VFWB 1KCKA 1MCLA 4OJFH 2HJLB 5DA0B 5SWSE 2HFGH 3CMOL 1DCLA 4HHAB 3LKOA 4G80B 1K85A 3C8KA 3T0ED 1E27B 4YXHH 5ESVB 3VXTA 1P6FA 3MRHA 5MP6H 4BQ8A 3OSKA 4WW2A 4KK8C 5BXFA 3C2AH 3DYPA 4LCCC 5C0IA 1FO0A 1L7IH 1ZT4A 4G43B 5IHZB 4KRPD 1Q9WA 2CIIB 1A64A 5T1MA 2IPUG 1IEHA 1MREL 1KN2H 4HDIA 5HHOD 4ODHH 1NGQL 1NLBL 4G8GB 1JVKA 3QXUA 3TCLA 4S11A 3R8BB 3TT3L 2V5SA 2EC9T 5I8CB 1RUML 2DQTL 1FG2B 2Z31C 1I3RA 1O7VA 4G7YL 2G2RA 3IRZA 3ZDXF 5HGBB 43C9B 5C86A 3BW9A 2FX8H 2OTUB 2YD5A 3JTSB 3LZFH 4J3TA 3GRWH 5L6YH 3H7BA 4OZIA 1JNHA 3MFFA 4DEPC 3MJ7A 4GG8A 3RWEA 2EEBA 4G9FB 4JANA 4XBPA 5BQ7A 2J8UE 1EHLH 1RJZA 4PJ7F 5ADOH 3ALXA 3BSZL 4Y4HB 1WAAF 3LCYA 4JHWL 2V2TA 4MVBD 1F6AB 4YE4H 1KGCD 2OXGA 2GJ6B 3DECA 3QQ4A 4XBGB 2NY5C 1A1MB 5E6IB 5KSBE 3OHXB 5DEGA 2LABA 4YDVB 1I1RA 1MH5A 4HWBL 2BCKA 2EE9A 4I77L 4OLUH 4GLRI 4UBDC 3QUMB 3DRTA 3JWOL 2H6PB 1INDL 5I1HL 4LP5A 2YD9A 3FO0H 2BSTB 1IM3B 4AM0B 1HDMB 1MUJB 4LASH 3BZEA 5GRXG 5C3TA 1A3RL 1TJGH 4X7CC 1BF2A 1LK3L 4RBPK 3GMRA 2V7HA 2GSGB 3Q6FB 4NT6A 4DN3H 2QQQA 5EUKB 4FTVB 3TN0D 1ROWA 4OAWB 4F9PA 4LSRL 1SJXA 1DEDA 4QHLA 5JXAH 3EJZD 1Q72H 4U1NB 3O3DA 4YGVB 1MCBA 4QRUB 5D5MF 3ARQA 2VMFA 2PO6D 1QFUL 1K6QL 2VQ1A 5E4IA 4EVNB 2ENYA 1G9NL 3PGCA 3RHWF 4M43L 5E8DL 4NO0B 1XZ0B 3DROB 4HJGB 4FQJH 3STLB 4ZUWB 1HIMH 1G9MH 2NY2B 2K1MA 3WUWA 5DVMA 1VESA 2YBRA 1DL7H 4R8WL 2YC1A 4L8SA 1FNFA 4O58L 1CR9H 3L5IA 1NEZB 1J05B 4Z7UA 1LP9F 3DMMB 3VRIA 2EO9A 3IF1B 1NCCH 3FQXB 1DQQA 4Z7QE 3SGDH 2D0HA 5I73B 5EWIL 1KG0B 4EI5A 1IGMH 4GAGH 1QNZH 3M07A 4GXUM 4MHHG 5C7XH 5EPMA 1G7JA 3CPLB 1OTSD 3NCYP 2X4NA 1A7RL 1TVBA 4JGUA 4DVRH 3I50H 2EEAA 5GSVA 3VXPA 3SN6N 1PZ5B 4NC1E 5L8LB 4WFGE 4PLNC 5IHBA 3C6SB 2X44D 2X6MA 1I8LA 3K7UA 5DRWB 2B0SL 3EDJA 4X99A 2Z91B 4YHML 2NW3B 3P9LA 5MERA 4MX7B 3S35X 5I66B 1CXFA 3IU3B 5LQBH 4KKBD 4OFDA 1ZLSL 1KACB 1PKQA 1ZGLM 5IBUB 5SWSB 4EDXB 4LSTH 5C0NC 5IVOA 5EIQA 4JZOB 4LLUA 1A5FL 4KMTH 4KY1H 4MZ2A 2FX9L 4NQSA 1FZMB 1YYML 4R2GC 1FVEA 1N4XH 3EW3B 3MLTA 4A2MA 3RGHA 2WBJD 4DKDC 3P30L 1T7WA 4IDLA 5ISZB 4XHJD 2Q8AL 4OV5B 5T5FL 4ZFFB 1G7LA 5FXCH 1Q9LA 4Z78A 3G5XB 3ROOB 3HG1E 4QXTB 2Y9RT 1VFAA 3T8XB 4PV8A 3JV0A 1U93B 1JZ2A 3HC3L 1SMOA 4WY7L 3QXDA 1IGCL 1JGVH 3ILPA 4R7DB 1S7TA 3QJHA 4XNYL 1ZVSA 3B9KA 2ZPKL 5FYJD 1I3VA 4K3JH 1UB6B 2YN5A 5I0DA 2AQ1A 3PL6A 2J8UB 4XPTH 5CBAB 1RZFL 2EECA 4DOHE 1W0WA 4JB9H 4X9BA 4P2RB 4EIGB 5K9OB 3SCMA 2NY3D 1CLZL 2EKSB 3OB8A 4X9GA 1Z9SA 3TWCL 2P24A 1CK0H 3H0TB 4FZ8L 3WUWG 5KSBB 3V5DB 1JP5A 32C2B 3BIKA 3EJJX 4YR6A 3U30B 2IPTL 3A6CH 3E8UH 3TV3L 3S36H 2WWMC 4GRWB 3GSRB 3CSYA 3GIZH 1D5XB 2VIRA 4NJ9L 3W81A 1MSPA 1NCUA 1DQJA 5E2UL 4EXKA 3EOYG 2AEPL 4W6YB 1NANI 1I8KA 5FK9B 4I9WE 4IRJA 4JEGB 2DTSA 4MLSA 4JR9H 3VFSA 3QT2A 2HT4C 3EOBA 2C1OB 2WIIA 1LEGB 3OR7A 3OPZL 2OJZL 4QXUL 5LGKA 3BKJL 3LB6C 2JCCB 4U3HA 1JPFA 4PJGF 5DRZB 2HG5B 5C09A 1DDHB 5DLML 4GAJL 3F7PC 1JF1A 3D39E 3MV7B 2OZ4H 4EIZC 4I5BB 4M7KL 4P9HL 3QCTH 1P7KA 3CU1A 5K93A 3BQUB 5D1QD 4JM4L 1AI1L 2ZG2A 2NXYD 4LIQE 3T1FA 1HZHH 4YX2H 1KPVA 3W5NA 2IPUK 3BGMB 3O0RL 3VFGH 1NPUA 4QRQA 5DD3H 2EH8L 3LEVL 1WV7T 2D2OA 4ZPVB 4NC2B 2H8PA 1CG9B 4Q7DA 5GQBA 3KAAA 3NFPB 4RGOH 1QLFA 4C56D 2O5YL 5JIPA 2CJUL 1CXEA 1JYNA 3KPRA 1N59A 3M1BA 4OZHE 3IFLL 4W4OC 1U8KB 3QULB 2ZUWA 4IMKC 1OB1A 2FLRT 2IALB 4OI8A 2GJZB 3PWUB 1CGSL 3GSOB 4XP4L 5C6WH 2MOVA 3HZVB 5BZDA 4XCNB 3ULUH 1RK0A 4DAGL 1U8PB 3HZMB 1WK0A 4IBLT 5AUMA 3BPCA 2ICES 3O6KH 4HK0B 5EU5A 1R5VB 1H0DA 1FRGL 4K9EL 2PXYB 1X5AA 1XR8B 4KGLA 3SE3A 1GC1C 5CEXB 2OM5A 2FIKB 3T0AA 5I1CH 5DJDA 3KPSB 4WHYG 5B39A 3OAUL 1TPXC 4JQVA 1KXTB 3GMNB 4CVZA 3TA3B 1K5NA 2BJMH 3QWRD 4DKAA 1N6QL 3IJHB 3M45A 4NJAH 4R3SA 3DBXA 4ELKA 5D1ZA 1W0VB 1M71A 2B1HL 4KWUA 5CBEB 5EZOH 5I1IH 5DRXA 2B4CC 1D5MA 4UNTA 1G6RA 3B2UD 1MPAL 1T1WA 2NCMA 1MAML 4MLIA 5GZOD 4U1JB 2HKFL 4NZJA 3UTQA 1BVLA 1S9WB 1T2XA 5DD6B 5L9DL 1OGTB 1UJTA 2I9TA 2QR0B 3BUYB 5T3XL 4HIIB 2NY1B 4M93C 3THML 2GTWA 4TUKH 2BZDA 4EBQH 1U8QA 5E8OA 4HQQL 3QEQA 1E4XL 4DOHB 1MWAH 4Q6YA 1AP2B 1U3HB 1EMTL 4Q2ZA 1IBGL 4WFGD 2PTTA 1A6WL 2BMKA 5HHXH 2JTDA 1Y0LA 4Y5VB 5IEKA 3H3PH 1MLCA 4XTRD 2IQAB 1C08B 2AABH 1IQWH 1D9KB 3ARFD 4M6AA 1QTYT 1NFIA 1J8HE 2AP2A 2YD6A 5JR1L 2DM2A 3OKKA 2ICEB 2Y4SA 5HGDB 1RVFL 5F9OL 4NM8L 5DUPL 2BC4B 1GOGA 1QPPA 3LEYH 4ALAH 4ZTPH 4PRIA 3RVVC 1JE6A 1AR1C 4Q58C 4C83A 1K4CA 2YA1A 2NW2A 3D39B 3BEWA 2BNQA 4IIQC 4NRZB 3D87B 15C8L 2Z8VC 3MC0A 4XPBH 3MBEB 4AEIL 3BP4B 3HG1D 3ZTNL 5F9AC 3FQRA 2BNUA 4OD1H 5E08H 3HNTH 3TIEB 1TQCC 5DFWH 1AIFB 3UP1A 4PJ5B 4S1SH 5HYEA 4U6VH 1NC4B 5A40E 3MLZL 1MCDA 1JGLL 4Y16D 5B39G 1OP3H 3VMOA 2IAMB 1NGZB 1JZ6A 4UOW0 1U0QA 1U8NA 5TE6L 5HHVH 1FFNA 1UM4L 1EEZB 4RIRB 1SVCP 4ODTH 5I19H 1QSED 2BOBA 1FORH 4ODVL 2LQRA 4M7ZB 3QAZC 4N0YH 2ZUYA 4JVPA 1QHOA 5EOTA 4BUHA 3NIDE 4GRLC 3CD4A 4LCWA 5C0DB 3PABA 4NFCA 3LN5A 3L7EA 4G6FB 3FT4A 1M7DA 5TF1L 3GKWH 3PQYE 1T20B 4L1DA 4DW2H 5ALCH 2OMBA 4ZS7H 1P5UA 1Q0YH 1CBVH 2DLIA 3BH9A 2BSRA 3HB3D 4DFHA 4L8CB 4O51A 2EC8A 4TNVK 1M7IB 4CVXA 3HUJB 2HFTA 3O2DL 4QHMB 4J1UA 1DQLH 2AJYL 4PJFF 4PJAF 1MFDH 1T66D 1KXQE 4MHHI 1R5IB 3BMWA 3IJSB 2XACC 4LCCA 1QLEH 5GS1C 2HFEB 5ITFB 1LEIA 2F5AL 3BZFA 1NBVL 2OR8A 3F7RA 3IB4A 3L3DB 5C0EB 3C5JB 5D72H 3DYMA 3PV7A 4D9LL 2R23B 1F58L 1IM9D 1FL5B 3MACL 4FZEL 4UQ2A 4LLAA 1BD2A 4OB5L 5I74C 1LEKB 1K3IA 2Z31A 3S3SA 5BCAA 5IT2H 3B5TA 5KG9B 1IAOB 4HV8B 5F3HA 1IGTA 3C8HA 3BYYA 4I3GA 1BZ9A 3RUGA 2I27N 4OF3A 1EBAA 1TVDA 4Z8FH 2C5DC 3FMGH 4KRPC 1V3JA 5D9SA 1URLA 5T33L 4OLVH 2O61B 4NQDE 3HZKA 3BVNB 2HKHH 4PJIA 4JY5H 1KEML 4X4MA 2A73A 3RX7A 4KXZI 5GGQH 2VR9A 3GO1L 4RQQA 2AXHA 4JFFD 5I1GL 5EZJA 4HUUA 4JHBA 1LDSA 3BGFC 2PYEB 4GQ9L 1J0HA 3ZTJG 3NTCH 3ARDA 4XAWL 4LLVA 4QXGH 3MOQA 1I8MA 4DGIH 5JQ6L 3G5YB 2HN7A 4V1DD 3FFCA 2X4PA 5HJ3B 4CDGC 1ZTXH 1P53A 3QQ3B 1XGTA 2HVKA 1WZMA 1I1AB 3M8OH 1QBML 1FGNL 1BBDL 1W2KT 3EGSA 4O2CB 4TVPH 4XPAH 3ZYOA 4PJHE 2MWCA 2P8LB 4P3CH 3UROR 4YFLF 1KCUL 1BJ1J 1ES0B 2CGRL 3NGBB 1AO7E 3MRDB 3TIDB 4HS8H 3D6GA 1CI5A 1EAPA 4P2QE 4XBEL 4PRBA 4PTUB 4D8PB 4KPHH 3V6FB 5IVZA 3C5SB 2YEZB 1AKJD 2DICA 2Y36L 4O2EA 2R0LL 5J8OA 4Y8DC 2A9NH 1KC5L 3EJZC 5HHME 4F7CA 1RSFA 5C0GB 4F7PA 2PO6C 2GITA 1DFBL 3CFDB 2HVJA 1I1YA 5H94B 5FO7A 1A02N 1F3RB 2X70B 1G1YA 2IH3A 1YEEH 5T3XD 4FFWD 4LQFH 2UZIH 3GMPB 4OGXH 2NR6C 1CE1L 3RWFA 1GGBH 3ARPA 2DMCA 4G8IA 4HGKC 3CH1A 3W0WA 5JOFA 1N0XH 3BZ4B 4JN1H 4PB9H 3MRHB 4HUXA 4K8RH 4Q9QL 3B43A 3PQYB 5EU6A 4XWOD 5A3ID 4JLRA 1JHLL 1J8HD 1IQDA 4JKPL 2BP3A 5HYFA 4P0DA 5JMOC 1EGJA 2VLLB 1WLHA 1A7OL 3MOAH 3QPQD 1FYTA 3ZDYE 5EBGA 3ARYA 4JQIH 4RCAA 1TETH 2V6HA 4HS3A 3RZCA 1FPTH 2Z0BA 4GXUN 1IC7L 4XVUD 1ORSB 2WUBH 1M6OB 5INDA 1G7PB 3OGOE 1J0YA 5DJXB 5K9KA 1RIUH 1YMHA 3BPLB 3DRQB 2CKBB 1MJ7L 5HI5D 3SE9L 2G9HB 1T0MB 2QHLA 3QDJA 2AJSL 1UFUA 4MB4A 3DO3A 3IDNB 2FYYB 2P45B 2P5ED 1BECA 3BDXA 1W8NA 4NNXB 1C5CL 4KKBC 4NQED 2O5ZL 5TQ2H 4P9MH 5F89A 4F3FB 3LN9A 4HLZH 2V2TB 2DD8H 3IDIA 4QLRA 2EO1A 5I1DB 5K9QG 3H9SB 3REVA 2BHUA 3EJYD 3SGDI 4HF5H 5HHQB 5CCKH 1X4YA 3GJFH 1J1PL 4F37F 2GT9A 2DLTA 1NDMA 2AJVH 3MRLB 2YKLL 4XHJC 3TBTB 2H2PD 1RJLB 4G6ML 3L3JB 4NQDB 1INQA 4JKMA 3KNBB 4NQCD 4M1GL 3TC9A 1KCSH 4NT6B 1KIPB 4UMGA 5GRYA 5DDHB 4X6CA 3VFPA 5CLTA 1FL6B 2ARJQ 2B5IC 1QQDB 2C3XA 1JYVA 4ZAKC 5AWNH 3D25B 1C12A 2PW2A 3FRUA 4G3YH 5D71H 5ITBL 1Z9LA 3L95B 3WXWH 4PJEF 5C0BE 2E9WA 5DD1H 4H88L 4LPXA 2NY3C 5MI0C 5SWZE 3H9HA 1MI5A 5DUBA 3IU4L 1NUFA 1IAKA 1ZT1A 4ONHB 4RZCB 5DD5H 1RZKH 3OGCA 2WWKO 4PJHB 4P4RA 2IH1A 1H8NA 1HWHB 3D2UD 3C09B 3IT8D 1X4ZA 4X7SL 1NL0H 2XQYG 1AO7B 3I2CL 4PJ8A 3RTQD 1NAKH 4P2QB 3TZVA 1NAML 1S7SB 2KUTA 1NCNA 2R0WH 1JWMA 3L7FA 2X4OA 2R2EA 2OK0H 5EPMB 1G7JB 4I0PC 2AEQH 1WVZA 1GIGL 5CJ5A 3GSNL 2CIKB 2WUCL 1AJ7L 1IEAA 2YHGA 3C5ZD 5HHMB 3RJQB 3HA0A 3OXRA 1JJUA 4XP5H 4JFEE 4L3AA 1JGEA 5BO1H 5GISL 4HIXH 2R9HC 2H41A 3U4AA 5T1DH 4W4OA 5BVJB 3NIGF 5D1QC 5HYSA 1T3FB 3ULVL 3ARZA 4HW6A 4Z7VF 1X9QA 2BVEA 2NXYC 2DQIH 3O11A 5CSZA 3D0VB 4YHNA 3VXMB 1BQHG 1TTUA 1LK2A 1TENA 1DBAH 1DJSA 1UM5H 1D6VL 2UZXB 3UTPD 3U9UB 3MJGX 2JIXD 5ADPH 1YN7B 3LVEA 3CCHA 4OCYL 2DQHH 5KW9H 3SE8H 1NH6A 4K7FB 1PAMA 1I3GL 1A14H 4XVJL 3FQUA 1DEEB 2P4AB 3O4LB 4H0GA 3ZYJA 4W70A 3DXAA 5JA8B 1FL3A 2A6KA 2ESVD 2E7HA 5ESQB 1NFDE 2KPNA 5GRJH 3P3YA 4OLEA 1R3HB 5IFHL 3OKNA 5F96L 4LVOB 5DJAA 4NQXA 2P8MB 3IDUA 1OW0C 4FFZH 1NC2A 3U0WL 3H3BC 1IKFH 1A0QL 1MHCB 3PL6B 2GIYA 4HKXA 4DGYH 3KR3L 3RKPA 5IVXE 5HDQL 4JFDA 1A4JB 5CWSB 1N2RB 4X5WB 4BFGA 3FHAA 1YDPA 2OL3A 5IKCA 3T2OA 3UAJD 5EN2B 3S98A 3DO7B 4OTXL 1A9BA 3DUHA 4QRSB 1G9NC 2OR9H 1UVQB 5H37H 4YDLB 3VCLB 2E5EA 4JPIA 3SY0A 2Q7NA 3ULUE 1NLDL 5LBSH 4XRCA 5DJ0A 2VWEC 1XCQA 5TH2A 5GZOC 5C92A 3K8KA 1FZKB 3HCVB 2VLRE 3WN5B 1HCVA 3EUUA 4JFYB 4PP1D 2FJHB 4GKNB 2Z35B 1A7NH 1HILB 1C1EL 4Z0BH 1U9KA 2W60A 3E6FB 2R1XA 4HLZG 2WQRA 3OKMB 4D0DB 4E5XB 4HULB 4LHUB 5C0BB 4MNHA 1QSFA 3MJ9A 1T1ZA 2C9AA 4CN4A 2VZUA 4YH6A 1G7IB 1S3KH 1AGCB 3EZ8A 3RNKA 4XTRC 3B2VL 5DMYA 3MRCB 3EOAA 3ARFC 3N1PC 1R0AL 4O2FA 1FBIH 2Q8BL 3B8SA 2XFXA 4MA7H 2R4RH 4L8BA 5BRZA 2KZWA 4FQQB 5B22A 5C2UB 4RGND 4W6XB 4ZFGH 2D9CA 3HE7B 4K55A 5HHPB 3UO1L 3T2NH 4K94C 1JUFB 1LVEA 4JFEB 5D70H 1DVFB 5J6HB 3WO4B 3WHE0 4ORGA 4LSVH 5FYLH 4FQXD 3CFKB 1EV2E 3QBTB 3GDBA 3LQZA 1Y18A 4HGWA 2VO5A 3OKLA 4Y4FD 1PW3A 2C3HA 1SEBA 5D7KE 1K2DB 4NOFA 5EU7C 2ZG1A 3O6LL 3MRBA 4Y16C 4EI6B 5JDSB 1AXIB 5CJXA 3FB7A 4GG6F 4NNYB 4N68A 1R3LB 4ODBD 2VXUH 2V5MA 5EFIA 3Q3GA 3QZWG 2KQNA 5JNYB 2A74B 4KUZH 3HNSH 3OR6B 1RZ7L 5GS1A 5DJYA 1E6JH 2R0KL 3O6FD 1J0IA 4KJWC 1AQKH 1WICA 5FO9B 4LSUH 4XC1L 3BWUC 25C8L 1N6UA 4XXDA 3FJTA 2A77H 2X9XA 3QUZB 2NNAA 3QDMD 5L8JB 4M7JH 1NFDB 3UJIH 4CVWA 4Y5XA 3JWDC 3G04B 1QRKA 3E6HB 4NWTH 2FLBT 2R1WB 4WO4B 3TVMD 3KLAA 5CINH 2G60L 4AJ0A 4RWHA 2XQYK 1MEXH 3NN8A 1DBML 4DQOH 1KB9K 1AGBB 5IVXB 4OFYA 4ZDHA 3B6SB 1IGYB 3V6OE 3QRGH 3U9PL 2G75A 2X1WL 4XNXH 3CGTA 5D4QA 2MKWA 4R96B 3QHTC 4HJ0D 2WV3A 3KPMB 5B3JE 3X3GL 2FD6H 3QDGE 3KPTA 3PXHA 2HH0L 1K9TA 3WSQL 4P9HC 4OZGA 2ICWJ 2I25N 3G5VA 1BOGB 1GVIA 2VH5H 4U7KA 1S78D 1WBYB 1JHKL 3L3IA 4E42A 3ULVD 3KPPA 3F6LA 2AK1H 4OM1H 3BRFA 1V5JA 1RZGA 2X7LB 1WIPA 1SY6A 1ZWIB 1BLNB 3C60C 1GAFH 2CLRA 5K9QI 1I7TA 3ARBC 1HQ4A 4OZFA 4PLKD 1B4RA 1CGWA 4LRIC 5J1SC 3K0WA 3AS2A 4U6YB 4PJBE 3MJ6A 2VNCA 3PWVA 4JO4L 3S96B 3TBWA 1SYVA 3VFUA 3QG6B 1A7BA 4NQVB 1Q9KB 2VKWA 1NCAH 3T3ME 4GRMB 2B8OT 4ODUB 4TUOA 1ED3A 5H37G 5HD8C 1R5WB 3KLSA 3U0PB 4XMPH 5D7JA 5GGSY 1DE4B 4TNWK 3U0TB 2EE3A 4OF6A 1OARL 3QUYC 4E41E 8CGTA 5CD3A 4K9EC 4J8RB 1N26A 3U46A 1IC5H 2OSLB 1ZLVK 1UWEL 2OS7A 5DMJB 7FABL 3IJYB 1V7ML 3WNMA 4ZFOA 2PETA 4AH2B 3FT4B 1VEMA 1YEHH 4UT6H 5JW3H 5EOCJ 1MWAB 1C8PA 1QR1B 4Y19B 2ZP0T 3CUPA 5CJQH 5GGVL 2FHCA 5J6GA 1Z3GL 2QBWA 2CPCA 3DX8A 2D9QB 2UY7A 1TQBB 1CVRA 5FB8A 3B9VA 4N5UA 2HLAB 2JB6A 4OLYL 3EFFA 2GKIA 3NZ8B 1NGWB 4CVXB 2IGFL 5BMFH 5AZ2H 5JUEH 1NBZA 5LKNA 3QPXH 4XXCC 2Q3AA 4M02A 3ARGC 4P5MA 5DMKA 1LNUA 1PLGL 1Q94A 2XNAB 1A6TB 3UYRL 1BQLH 5E70A 1HHKA 3HAEH 3JUZA 4MNGA 5C6TH 4WFHE 1AXTL 4JAMA 5JDJA 1F4WL 3WIFB 5FGCE 4UAOB 5IF0A 1BD2B 1CZ8H 1JZ4A 5JOPE 1D6EA 3DV4B 1XCTB 4XNMA 1HSAB 3RU8L 5J0BA 4G42B 4DUXA 1P7HL 1ZAGA 1CTNA 3HC0A 2AS5M 2JELH 2ZKHH 2XWJA 2QQLL 3AAZA 4FQ1H 5DXWA 1N7MH 5A3IC 1G1CA 4PJDE 3MLWH 4YLQT 3IDJB 1VADB 4OZFG 4X6FA 3RL2B 3QPQC 4HX1B 3KVQA 4WU5A 5E5MA 2I24N 4JO1H 3HZKB 2H32A 4N8VG 5J7CC 5FECA 3G5ZA 2NTSP 3GMLB 2H1PH 2NY4C 5I71B 4XVUC 1KJ2A 2C4XA 1UG9A 1J8KA 2D7TH 3F12A 4BQCA 4Q6IC 3RAJH 2YMXL 4JDZB 4WI3A 3LV3A 1H5BA 4IS6B 2YPVH 1IFHL 3QDGB 1A1OA 1V3LA 1FC1A 5E6ZA 4EN3D 4R7NA 5C07E 3BKMH 2J8UF 5F6IC 3LS4L 2UVEA 4YXLH 3BHBA 3TPKA 3RP1A 2MFNA 4NBXB 5IM7A 4ZAKA 1F6LL 3CXHJ 2LTQB 4UIMA 3VXRB 3NZHL 2BDNH 1FNSL 5KSBF 5BJTA 4NUGL 2DRUA 4PD4K 3X11A 1U8LB 4YXKL 2NTFA 1AXSB 3WO3B 1XEDA 3C08L 1NCWL 4PJBB 4U6HA 5J12B 2H2PC 4NNPL 2F5BH 1OM3H 3QXAB 4JPKH 4X0KA 3MLRH 3P0VL 5ERWA 5B4MC 2WP3T 1KTRL 2HJFB 3GSQB 5ANMB 5A1AA 3KDMA 4Y4HD 3GGWA 5TGBB 3VFVB 1PDKA 1YN6B 5IB2B 3HI5L 2XN9E 4P4KD 3WL9B 3NFSH 4XCCH 2DLGA 4PJ7A 5IEHB 2VABB 1OGAD 2NZ9D 1WAAA 2VISB 1B90A 4I0PA 2CH8A 4K71C 3IAGC 5KVDL 3T0WA 3WNLA 1DUZB 4OQTA 2A6IA 3BIBX 3B9DA 3WIHH 4EUPA 3SDYH 5HGAB 4RNRA 1RFDL 3MUGB 4QKXB 3PDGA 4V2BA 3HZYA 2VLKA 2DQCL 4PREB 4DUVA 4IOIB 2W0PA 2AERT 1I9RL 4O5LH 5KTEH 3QHZH 4IHOA 5E99L 1OSPH 5E1AB 4G9DA 4WI5A 5ALBL 4Z7QF 3RTQC 2AI0L 3CVHL 5IMLA 1RUPL 1S7XB 3GMQA 4GBXB 4M6ML 4PY7A 3REWB 4FRWA 1BJ8A 4P5TA 2DQUH 2NY2D 1KENL 2P5WE 3C5ZC 1T03L 5INCB 1EFXB 5MHSE 3L1OL 4YHPB 4ZPTB 5EO1B 2VDLL 2WAHA 12E8H 1PBYA 4GW5A 3K81A 5IMOB 2R0ZL 4Z7WA 4PG9A 3O9WA 3UTSA 3QUXC 3SDDD 5FGCB 3VXOA 1OQXA 1Q9OB 3QNXA 2HFFA 5GJTL 3U7WH 3KLDA 1BQHB 2CUHA 2CDFA 5D1XC 5KJRH 5EA0L 3KPOA 4ODWB 2MQ3A 1KJMA 1LP9A 4HWBA 1CYGA 3TLRA 2ZUQC 2V5RA 1VA9A 3AS0A 4X80L 1HXYA 5E8PA 3O4OC 1GPOH 3OJDB 1S5HA 4PJDB 3PDOA 4PV9B 4Y2DD 4F9LC 2QQKH 2I60L 2AJUL 4E0RA 5CILH 4HEPG 2AJZA 3SKJH 3MLXH 1XF3A 5JW4Q 3BUTA 1EX0A 1U8IA 2GAZB 4HC1A 1M05A 3ZHLA 5EDXA 4I18C 4YPGB 5FHAH 5SX5K 1JFQL 2Z93B 1XGYH 1FFRA 3E3QE 4M1DL 4J6RL 3KYKH 5F1OB 2H3NB 2VDKL 1CDGA 1F8TH 2VDQH 1WFOA 4OCRL 1C12B 1LE9A 2F19L 2XZAH 3MSPA 4WNQB 5JOEA 1HH9A 4PJCE 5C07B 4X4XB 3VW3L 5ISZD 1BMGA 1YJDL 3FT3B 5FYKL 4EUPG 2AGJL 2UYLB 3L6FB 4JZJB 4WHTA 2J12B 5SV3A 4MD5A 1L6XA 4LPYA 4PTTB 1XGPA 4X6EB 5IIEA 3O3AA 4MJID 4LLMB 5DSCB 2FEEI 5JOPD 5FUCE 1YEJL 4NKIH 5KAQF 1KTLB 3V6ZB 4OLZH 1QBLH 2XKNB 2A9MH 5BV7C 4FQIL 1OL0A 5FYKU 4OLXH 3N85L 4NO5B 3PGFH 4QF1A 3ZSSA 2AEIT 3GSXB 3S4SG 3P0GB 1E0OB 5DJ8B 4P2RD 5HYQB 4GQPH 4QHNA 5IR1A 4PP1C 4GSDL 1QP1A 2DQFA 2VE6B 3SDCD 2XN9B 4M5YL 4W68A 1JPGB 4AT6A 1YMMA 3C6LD 3D85A 4LLWA 5CP3H 3QCUH 1QRNE 1FNLA 1OF2A 2YPLE 1CFNB 2JJWA 4HUMB 4OKDA 2H26A 2IJ0C 4PLOB 3GJFB 5E9DA 4WU7B 1K4DB 4UU9B 4OGZA 3ZKND 4XPGH 1A3LH 4LAQL 1X5JA 4URTB 5ID0B 2ADJA 3BJ91 3BO8B 3RWIA 5FUOH 5K9JH 2J5LB 4LKXA 1KIQA 1HSBA 1XIWA 3MV7D 1G9EA 3G6AB 1T83A 4XWGL 1LDPL 4NKOB 2NLJB 1CD1A 4RGNC 5DQJA 5HPMA 1E4WL 4Z95H 1PSKL 3B3IA 5BOZG 4Y89A 4OZHF 2P5WB 3T65A 2EIZB 5IW1A 2O93L 3BESR 4QYOA 3TFKC 3MNWA 4KJYB 3RBGA 3QDHA 1KT2A 3KYNA 5AG9A 4YK4C 1J0ZA 4D94A 1KFAL 1YEGH 3I3EA 1UA6H 4EQ2A 3VWKD 4G5ZH 1WWBX 4OZ4B 4QOKA 4JRXA 3VWJB 2XG5A 4FMKA 4Y4FC 3L5WA 3QFJA 3VXSD 1G0XA 4JG1L 5F6HJ 4X8JB 4APQB 3N1QC 3HMXA 4NYLB 3VXUB 2AJ3A 2UUDH 1YDPB 5D7LE 5DR5L 3KYMB 3QZWB 4JRYA 4NBYB 1KELH 2FECI 3HI6L 1F45A 3RA7H 4M8VA 1KB5A 1P5VA 3U7YL 3BX7C 2GFBA 4P59H 3I9GL 3BN3B 5L2JB 3P0YH 5CGTA 3C2SA 3O6FC 1IKNA 2XA8H 1HHJA 5D2LA 5I6XB 5A2FA 4D0CB 1QFWH 1UCBL 4XCYB 2C3VB 3NAAH 3TH4T 3TPUA 1P1ZB 3P73B 4YHZH 4HUKB 2BXZA 3BT2H 4CNIA 2VZVA 3TA3D 2RHEA 5JHDA 2IADA 4O4YH 2OYPA 2QADB 2J6EH 5IMKA 5LGJA 3TVMC 2UWEE 4PJCB 3C60A 2LFGA 1T0NA 1VFBA 1IGJB 3ARBA 3QA3A 1FNEA 5HYJA 4PJXE 3T77A 4M8QB 2Q1EA 5FUZL 4I3SL 3U6RB 3TM6A 1DBJL 4HJJH 4HJ0C 3WFEH 4FABH 4JCMA 3EYVB 4I48A 4U4BA 3ULSA 1T21B 3HE6C 2VYRE 2W92A 4KKLD 1X5FA 5TE4L 5MEOA 5FA4B 4K3DH 3FFDB 2ZSVB 4AIXA 4KC3B 2Y06L 1CL7H 1UKTA 2NY5H 5JPNA 2Q76B 1OCWL 4ZUSB 3ULVC 1OAXH 3CAFA 3VRJA 3Q6GH 2I9LB 4JM2B 4HT1L 2R8SH 3MCKB 4H25B 3QUYA 3IS0X 4ZXBD 2EDYA 1FZJB 1W72A 3DGCR 4DK6A 2V9QA 3GNMH 1C5BL 1ZXQA 2HWZL 4YHLH 4K7PX 1N3NA 1RY7B 1OT1A 4MJ5B 2BVPB 3UTTE 3WFBH 4L4JA 5C9JB 1MHEA 1DN0B 4DJMA 3VI4E 2IANA 1MVUA 2X42A 2N7AA 3QXWA 1L9NA 1B0RB 1GGIH 2CLVB 5I1KH 4JN2A 4QXWA 4XXCA 3CVIL 3ARGA 3IAPA 5FA3A 3CLEH 2RCSH 4NO3A 1WEJL 3MBED 4ERSH 3SKOA 4CDHA 3ILQD 4ELME 3H9ZA 3TBVA 2N7BA 3NIDF 4ZYKB 1JK8A 3E2HB 3ZKXB 3SOBL 1ZGLP 4FQHA 4MXVE 4AQOA 5TPWH 3WFCL 5B8CC 1JGDB 4BSWA 3BP6B 2QQNH 4JPVL 5D8JL 5ECJE 1X3DA 4XZUA 4XCFH 1BVZA 4WWKD 5DD0L 1JWSB 4AL8H 5IQ9B 1X6NA 4L3CA 4XPHL 1P7QA 2J3SA 4YFDB 3S35H 1MCPH 4JPWH 5HHNB 4YHKH 3G6JB 5EBMB 3KYOA 1QRND 4HXBH 2YPLD 3DI2B 5I18H 3GZKA 1CFSA 1VB9A 5C0AD 5MP6L 3TT1L 3RHWK 4XCEA 4QRTB 1MHPH 3ALPA 2DI9A 2XTJC 1B9ZA 2X40A 3C2AL 3H3KA 3BPNC 3LSOA 2O26U 1P4BL 1UWGH 5DA4A 2Z8RA 3BKYL 5F88A 3LHPL 2C3GA 3GSUA 3FN9A 2J88H 3VGBA 3VJ6A 2G5BA 4RFOL 3FZUD 1MQKH 3ZT5A 3WS6C 1QOKA 3HC4H 3KPLA 1KJ3L 3I6GB 3WNPA 1L0QA 4PJAA 5IHLB 1FE8L 1CICA 5EC2A 1FFPA 4N8VB 3JV4B 4FOMA 4WI7A 4HXAL 2UWEB 4P23A 1WQVT 4U1HB 2HA1A 4H8WH 3LZFL 4JFHE 3QQ9C 3J8F7 4PJXB 1U95A 3T08A 1SBSL 4OGAC 1BGXH 4OIAA 3OAZK 4NPYA 4AIZA 2CLZB 4PRPA 1SM3H 3LN4A 1S8DB 4KUCF 1WWAX 2YRPA 5E2VL 5C8JB 3AREA 4N9OB 3V79C 1AQDA 3OTTA 3BXNB 2X41A 3QI9B 2F8VA 5ILTH 4ZUUA 2CD0A 5ICXA 4KI5E 3KWWA 4R4FL 4AEHH 2JK5B 3M17A 4BZ1H 2AXGB 1XF4A 2V17H 2X10A 3KXFA 3PJSB 4WUUB 4DN4L 4PRHA 5JPMA 2PYED 3WIIH 1T22A 4MA1C 3NCJH 4DN3L 1KNOA 1ZHBB 3VFRB 5KN5B 4CW1B 4PFEA 3O8XD 2DWDB 5H2BA 3NA9H 1JNLL 4Y4HC 1TJIH 3VD7A 3MO1A 3UTTB 5D7IE 2CMRL 5D2NE 1I1AD 1NBYB 4RDQF 4ZSOE 4NHCL 2WSKA 3EYSH 4MQXC 3RTQA 4PB0L 4PS4H 4U1KB 3CK0H 1DL7L 2NZ9C 1BHGA 1HI6B 4AENA 4D0BB 3AM8C 2YK1H 3A6OA 3G08A 5GHWH 4NCDA 1B0GA 3C5ZA 3UTZA 1CIDA 3W39B 3MV01 1R6VA 3CIQA 2PW1A 3PGDB 4PPTA 1TIUA 4ELMB 1BQUA 5D96B 5C7XL 4HMEA 1P84J 3QUXA 4MJ2A 2IFFH 1RMFH 5AZEL 2ICWA 1LO5A 5I75B 4P5KA 4YHIB 3R1GL 5D1XA 3MR9B 2X05A 4UDTB 1YEKL 3ECBA 1AFVH 5DGRA 4HPOH 5IK3A 4XI5D 1C16B 3R4DA 3MV8E 2JIXA 3NMEA 4GMTL 3MBXL 3WFHB 2NY2C 4MDJB 4BA8A 3ES6A 1D7FA 3ZDYF 3QEUB 5C0CA 4LVHB 3LQMA 4WCYH 1MFCH 4F9LA 1HXMB 1OP5K 3MXWL 3TYGH 3O81A 3CDYA 4K3HA 2XZCH 3K3QA 5IB5B 5TDPA 5SX4H 1UXWB 5I73C 1FFOB 1S9VA 3FOMA 2HLFD 4O02H 2H2SD 5M95B 3DX9A 2ORBL 4NRYB 4OBRA 4KK5D 2UZYB 1K8DB 4I18A 1QSZA 1AY1H 3QQNA 1FG9C 1U8OB 2DJ4A 2EYTA 2VXSH 4OKVA 4HIJA 5ID1A 1BREA 1IC4H 4JFOA 2DWEA 2Z92A 2BNRE 4PRAA 2QKIA 5IGXL 1OOAA 2OP4H 2DN7A 2QTEA 4NKMB 1TZIA 4PLJC 2W0FA 5DT1H 1NMAL 4ONFH 2ITDB 1KCLA 3K80A 2DM7A 1A21A 3HAEB 4UQ3A 2ZWLT 2VDNH 3VXNB 4OFPA 1KN4L 3OX8B 4LCIL 4A6YA 4L3EA 2QHRH 1WZKA 4LEOA 1AC0A 3KPRE 4OLWL 1DBKH 5EOQH 4KH2A 1MFBH 5DUMH 4IRZH 4O9HH 4Y4KB 3UJJH 4M62H 5ICYA 4JQXC 3S36L 2A6IB 3PWNA 1MIEL 1MOEA 4MGXA 3H42H 3LRSA 1P2CA 1A2YB 1VACA 1CXKA 5KSVB 1CF8H 2Z8SA 4MA8L 4HWEH 5DO2D 5FF6B 3X12A 4Z0XB 3NA4A 1ZVHA 4JY4B 1SBBA 3S4SB 1UJ3B 2ZCLH 4MAYA 3S8WA 1G6RL 4UIKH 2APTA 4P5TB 5D5MB 2SEBB 4GS7B 2P43B 5D2NB 3SDCC 4ZSOB 4BFIA 3FN0H 1KTKE 5F7DA 3C6LC 5I1EH 3U30C 4M6NH 1S7VA 3RDTA 2NY7H 5FKPA 2H9GA 3RY4A 1RK1B 1ADQA 4QRPA 3MRMB 1NMBH 3O9WB 4JFHD 4FQLL 3SO5A 4LPUA 3DX7A 3QNXB 4EI5D 4POZD 1JRHH 4ZOBA 1LP9B 1IGIL 3ZKNC 1FZOA 5CZVL 4M61A 4D3CL 4XT1C 1ZSDA 2UUDK 5MEPB 1EEUA 4YEEA 2DIAA 1T4KA 2YUWA 3DUSB 4NZDA 2EXYD 1KIUA 3W2DH 1G7HA 3O6MH 1RULL 5DHYB 4E0RB 2OR7A 1OSZB 3WLBB 3MV8B 2D03H 3GSWA 1OAZL 3FHQA 2A6JA 3CDGA 1PY4A 5JW5B 3AMKA 4HKZA 1UXSA 4LPCA 1U8MB 2CDGB 5D6CA 3QIWB 4ZOEA 4CADA 1NFDF 1KLGA 2DL2A 3DSNA 4JHAH 3AXLA 4FQCH 3BH8B 4PG2A 4N9GA 3SE4C 3INUL 3N06B 1XF1A 4KTDL 3RNQA 1KJVA 4NJAL 5E4EB 3BYTA 3GIVB 1KPRA 3DIFA 1I7RA 1P4LA 3F58H 1NEUA 4KK6D 3V0WL 3O4LD 4XH2B 1WC7B 1JHTB 1NFKA 2NY0B 1FLRL 4QRRA 3VG9C 5EUOE 5HVHB 4MD4A 4WHDA 2X4SA 4DKEH 3ETBF 4R90H 4IRSB 5BS0E 3O3AB 2YUZA 2B2XL 1NAMA 3P4MA 3RVWD 1OT2A 4Q74A 1I4FB 3IFNH 5FO8A 3PL6D 3U4BH 3HE6A 4LDOB 4PJ9B 5GS0L 5I1LA 4POUB 4MA3B 2D31A 1V7NL 3T4AB 2AJXH 1RUKL 3TA3C 3SCMD 5CHNB 2MHAB 5LAXA 4RA0C 2X4TA 1ONQB 1S5IH 1F90H 2W65B 2YSSA 4LCWE 4PGDA 4GOSA 5DZOA 4GMSL 3LEXA 4BZ2H 2FCBA 4NN5B 1AGEB 4L29B 1ORQA 4FXKB 1T5XB 5E9DB 1WBXA 3LKSB 1FVDB 2C7UB 2F54B 4K2UH 3O2WL 5F1NA 3UC0L 2OJEA 3MV9B 1A6ZA 2ERJB 5T3ZL 3FB8A 5C71A 3CSPA 5DJ6A 4KKLC 5T1KB 4PIRF 1J1OL 1YNTA 4XMKL 3VFOA 4TUJA 4JKWA 1E6OL 5C09D 2PR4H 4X9FA 1QFWI 3GBMH 2F53A 4HH9B 4YO0B 1YNLL 3T0VA 1PYWA 2J4WL 3RKDD 4PJGB 4U1MA 4J3XA 3JVGA 1U3HC 5A2IH 3VU2A 4LK4A 1RIHH 5HXMA 2DL9A 1INEH 3F7YA 4XPBL 4QYOB 1T6WA 4XAKE 5CIPH 5ABDE 4KDTC 4UTBH 2GUOA 4Y5VC 4RAUA 1SJVA 5HGHA 1EPFA 4DKFH 4S1SL 3MRKB 4JJ5A 4U6VL 3J7HA 1D9KC 3DVFA 4WTZG 4MD0B 4BH7B 3RUGE 3RWGB 3DVGA 1FNAA 1F3DH 1BWWA 4X6BB 4TQEH 4NZTH 3KPRD 4BSVB 3OKEA 4HIEB 5GPRA 2HTKC 1AGDA 5I8EA 5J1AA 3GKZA 3JWNC 1TJHL 4ODSH 4X4ME 1MHHA 1HYSD 1TZGL 5F1SA 3EFDH 1CL7I 4BZYA 3B9AA 3VFTA 1RPQA 1JNNL 2DQGL 3MBEC 2ZJSH 1D5ZB 4JDTH 4QY8B 5C0JA 1U92A 1N8ZA 2Q3ZA 1CBVL 3ILQC 1XGRA 4F15B 4NO2B 4XGZB 4Z5RB 3FFCE 1UGNA 1YJDC 3L9RB 3BRGC 5FCUL 3W11D 5IHUH 4IEFB 3VE0B 3V5KA 4ONGL 5FKAB 3WNNA 5IW6A 1LO4H 3QG7H 1IL1B 4WWKC 5DS8B 5E2WH 3HPJB 5D1ZD 4IMLB 2ZSWA 1CLYL 2L7JA 2YD2A 5L7XH 5F71A 4GG6A 3ARWA 4KZEL 3FQTB 4UT9L 2DIBA 4LNVA 4L4VA 3QRFM 3S88H 4JJHA 3WEXA 3PWPE 3IGAA 5EUOB 3GJEB 3MXVH 4HS6B 4I48B 3ULSB 3MREA 1BF8A 5BS0B 3SQBA 4S1DD 5MEOB 1A6PA 5B3JF 5E2JA 5DVOA 4MNQA 3VFWA 4MCYB 3JV5A 4YDIH 2HJLA 1T1YB 4S0SD 2FO4B 4HHAA 5I8KL 2DQDL 4G80A 3HNVH 1E27A 2H32H 5ESVA 4P46B 3WHXB 4KTEL 5IMMB 3QEQD 4G6KH 3FZUC 3LD8C 4G43A 1MCOH 3IVKB 2FGZA 1U6AL 2VLME 4XP1H 4OCSH 2EYRB 1DSFL 2WNGA 1K8IB 2CIIA 2ITCB 3W0WE 2G5RA 1KOAA 5EORH 1ZHLB 1EGJL 3LQAH 4PJBF 3VGGA 4EKXA 4G8GA 4UV7L 4YQXH 3Q1SH 1NGPH 5EU6E 5I8CA 1FG2A 5EO0B 1CDIA 1KYOK 4M1CC 43C9A 5HGBA 3PP4H 3QFDB 5FYJH 3JTSA 2OTUA 5CJBA 1ZTXL 4X5XB 1FYTE 5DWUL 3U48A 5A43C 3T3MF 3MLUH 3FT2B 4I3RH 1UENA 4G9FA 4XB7A 1QVOB 4PRID 5GGTA 2FX7L 2FZ3B 2MTPA 3C8DA 4RRPA 4TVPL 4Y4HA 1F6AA 2FWOB 1LO3L 2BNQD 2GJ6A 4DGVL 4XBGA 2BRQA 1A1MA 5E6IA 3BKCH 3OHXA 4YDVA 4GFTB 4MB3A 5KBNC 3QUMA 4DVBB 1YY9C 1ZKAA 2H6PA 3SKOB 5MENE 4XNUH 4PUBH 4NUJB 2VLJE 5IW3A 5J57B 3AM8A 5I30L 1J5OL 2BSTA 1IM3A 4AM0A 1BZQK 1HDMA 1MUJA 4YFLI 3ARRA 4RWYL 4F37K 2GSGA 5E8NB 3CNKA 3Q6FA 4F7EB 5EUKA 2ICWI 4FTVA 4QCIB 4OAWA 1JYWA 3CMOH 4X9HA 4U1NA 3EIFA 1GGUA 4YGVA 4ENED 4QRUA 1B4JL 1DLHB 1I1AC 4Y88A 4EVNA 4LQFL 4GXVH 5GS0D 4NO0A 1M1SA 4LCWD 1GGBL 2WLZA 3EO0B 1XZ0A 3DROA 3HR5B 4HJGA 4L4TE 2E6QA 3STLA 3UX9B 1MF2L 3BP5B 4ZUWA 4QTIL