2BOBB

Potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobB01
4OZHB 2WQRA 1A7OH 3T04D 5A40E 3UX9B 4NN5B 5EU5A 3V5DB 2VL5B 1QKZL 3CFEB 2UZYB 1CFVH 3TIDA 3O6LL 3FO0L 1PKQA 2R39A 5GRUL 1FFNA 3JTTB 1VHPA 4XMLL 4HG4K 2V5TA 2H32H 2Y25A 5E2VL 1C8PA 4FQQA 2Z8SA 4UDTB 1RD6A 3S34L 3ZT5A 1IM3A 4DN3L 4Z7VA 1AH1A 5JW4M 4N0UB 3QCVH 1HYRC 5HI5D 4GXUN 1AXIB 4MQ7A 4N9GA 4TSCH 5T3XH 2NY2C 1ZLUH 4XC3L 3OWEA 5EUKB 4N0YH 2ICWB 1T2QH 2AEIT 4O4YL 1MF2L 1UEMA 1X4ZA 1E6OH 1YNTB 4JGMA 5MEPB 3CFCH 1WQVT 5MERB 4RDQF 5DFVC 4UILH 4Y2DA 4PRAB 1MHPH 4TQEH 4CMMB 2VC2L 4HT1L 4Z7WA 4X4ZA 3IJHA 1FL6B 4GG6B 4S0SD 5DWUL 4LF3A 3V79C 5F72S 1F8TL 5JDSB 4OGAC 5JO5B 3DUSA 5A3IC 4JHAH 2DIAA 3R1GL 1WT5C 4MJIA 5DJ8B 5TPWH 3EYFB 3EHBD 3ORJA 3RBSA 5CLWA 5AUMA 1CFSB 3UAJC 4OLXL 3QI9D 1D5XA 1CGTA 3H3KA 4C56B 4R9HA 3DWTA 3ZLQC 4MXQD 2EYSB 4R90L 3QUML 5KG9B 1TNMA 1G7PB 2VDPH 4OKVA 4PJDF 3RDTC 3U7YH 2E6PA 3H7LA 4J4PA 5DQDL 3VDBA 4PUBH 1SBSL 4Y89A 4MXWH 4KVNH 4JE4B 3QIBA 5DUMH 3B9KC 3RWCA 4XCFL 4U1GC 1UZ6E 4HXBL 2YHGA 4RZCA 2Z8WC 3CDCA 2ZUVA 4Y8DC 3W9DA 3OKEA 5DD5H 3SCMA 3KJ6L 2OX5A 1KJ2H 4PJEA 3SE9H 5KSBE 5DJ6A 4RCAA 4FHBD 2PXYA 3VFWB 3VFTA 1WZMA 1FSKB 3DBXB 3QI9B 3MODL 5A2IH 2P5EA 3WIIL 2W0FA 4X8JB 2DMKA 2YZ1A 5DYOB 1NDMB 3QUZA 1I7UA 1Q9KA 4JO1L 4P4KD 4ZUVA 2Y36L 4PJHF 3BP5B 3QIWC 2JCCF 4ODWA 4NIKB 3L3OB 3GMNA 2CGRL 1FORL 2VXVH 1YA5A 2X7LB 3C5ZC 5BJTB 3BIKB 4ZSOE 1FNAA 4X5WB 4KROB 4KK6D 3O3BA 2VZUA 2YD7A 1QZ1A 4N0FA 2VAAA 2WBJD 4L5FL 5EPMB 4RNRA 5JOEA 2WIMA 1I4FA 2X70B 3SGJA 4R0LB 1N8ZB 4S2SA 4QHKI 4LIQH 5IF0A 4Y4HA 4HBQA 1MOEA 5BZDA 2VLME 12E8L 4KH2A 4I18B 1TTGA 3D6GA 4JRYD 5EU4B 2PTVA 2Z4QA 3RPIB 4EIZC 4P46A 2O5XH 2BOBA 4KJPC 2YZ8A 3X12B 3D18A 3LY6A 4P4KB 1ITBB 2QADD 5IGXH 2AP2A 2FL5A 3WFZA 3TESA 1CICC 3MLSH 1FZMA 3WD5H 4AZ8A 4X6FA 4ZS6C 4YQXH 3FAWA 3QDGD 1CE6B 2C1PA 4OJFH 1HEZB 3IJYA 3RA7H 3ZSSA 2C26A 3L5HA 4MLIA 4AJ0A 2WBJB 3FB8B 3BQUA 3ARFC 1KJMB 5D7KE 3UTTA 1NBYA 4IRSA 6FABH 2Q3AA 3TIEB 3HFML 2GUOB 2VE6A 4Q2ZA 3O2VH 5ANMA 2ADFH 3AU1B 4UBDC 3F62A 4XH2A 5E5UB 1KUMA 1QSVA 3OXSB 4JRYB 3ZZ1A 2OR9H 5C0NC 4PJ5E 4EVNB 4OM0H 3O6FC 2DM7A 2QLVB 3O2DH 3OKNB 3DPBA 5ADOH 1WICA 4HC1L 4ONOA 4UQ3A 5JORB 5GISL 1B0WA 2FIKA 5F97E 5GJSH 3MUHL 1MCJA 5E8DL 1JYXA 1O7VA 1NEZB 3K0WA 2BJML 1IC7H 3E3QE 4U33A 3DX9B 1KCSL 3WSQL 4URTB 5B4MD 2YA0A 5ALBL 3MRNB 5EZJA 1GGCL 2WP3O 3QDGB 4Z77B 3GRWL 1T03L 4KZEH 2CIKA 1N6QH 2F15A 1DN2A 4X4YA 4HUVA 3O41A 2ITDA 3CCHA 3RWJB 3KPNA 4ZUTB 3K2UL 4R96A 4H1LG 1J1OL 3P3YA 2F58H 1NLDL 4CMHC 3MXVH 1XGRB 5E00B 5JW5B 3QPQC 1IL1B 2VSCA 4YWGL 4FFVC 1B4JL 2KZWA 4XNZB 4F8TA 5I6XB 1OTTC 3QAZC 1H5BC 1Q9LB 4O5LL 3ARXA 4FXLA 4F3FB 3ZDXF 4K3JL 1R3JA 5AZ2H 3JSSA 5CJ5A 1TJIL 1LO0H 2R4SH 3F7PC 3W5MA 4QOKE 3LQAC 3MNWA 4GXVL 3WHXA 4GMSL 5DJCA 4R6UA 1S8DA 2A77H 1CE1H 1XF4B 2WSKA 1X5JA 3K3QA 3IRZA 3TWCL 2JK5A 4PJ8A 1WK0A 3K4DA 4JN2B 3HG1D 1TVHA 1VFAB 1JV5B 5E5RB 2B2XH 2YD1A 4Y16C 2NTSP 5DD1L 5ENWA 3AREA 3F7YB 5DT1H 3MCKA 2VITA 5KSVA 5C3LD 5FOBB 5I1AB 5JA8B 2R56H 1A4JB 3QG6A 4NUGH 1JHTB 2R29H 3KWWB 1R24A 2R4RL 3RUGA 3V6FB 1N5AB 4C59B 3RU8L 1PEZA 4LVNC 2CDEB 4NWUL 1XGYH 5T1LD 2GTWB 3MA9H 2ZKHH 2EYRA 3EGSB 1LP9A 4YAQB 3DTXA 3WHE0 1KELL 4CN6A 3S3PA 2VDOH 3QUYD 2Y07L 4YDVA 1U92A 3RVUD 2EDLA 4ZD3H 1XCQA 4Y5YC 4M7ZC 5D1QA 2PO6C 4EOWL 5IQ7H 4XCEA 5EIIB 4NWTH 4TOYL 1LGVA 4FABL 4GKSB 3Q6GL 1ZGLA 4UU9A 4O9HL 3CK0H 1WCBB 2J7LA 4NGHL 3MLXH 4JHBA 1E27A 2ARJB 3HG1B 1OAUH 1ZEAL 1NFKA 4LSQL 3D9AL 4D8PB 5CMAA 1LE9B 3SGEI 1JGDA 1XF3A 1UXWB 3OKLB 1KJ2A 4LVOB 2D3VA 1ZLWH 3CH8A 3DECA 4G8GD 1TCRB 3VCLB 4N5EC 2LFGA 1WBXA 2YC1A 3NCJL 3RWDA 4IJ3C 1S7UB 3O3DA 2HRPL 1MFDL 4GUPA 4OB5H 3EDKA 5IHZB 3QUYB 3DI3B 4F15B 1G9MH 4LSPL 2IH3A 4PRIE 1UWEH 2IQAB 2ENSA 4L3EA 5IVZB 3SO5A 2IC2A 4A2LA 1RUKL 4D9LH 1P7HL 3GKZA 2I24N 4JM2D 1NLBH 1WEJL 4JG1H 5BMFH 4P2RA 2HT3C 4LFHD 4OZGB 4TTGA 3CFJA 3D3VA 4GW5B 4G6AD 3UTZA 1J18A 5A2FA 1K5NA 3PGCB 4GKNA 3STLB 5K59E 1MNUH 4XPBH 4ZUSA 4L8DB 1HOCB 3LMJH 5T3ZE 4YEFA 3G9VA 4G8GB 4H20H 1QFUH 3GK8H 3QIUA 3D0VB 3TO4D 1LDSA 3EDEA 4BELD 2A73A 3BOVA 3D69A 4JQIH 1KLGA 1F11A 3CNKA 1FG9C 1FFOB 3QWOB 1KFAH 1U36A 4FNLH 4X9GA 3PQYA 4LSVH 4H88L 5EUOE 4BA8A 4DKFL 4QHLA 2XFXA 4I0PC 3RY6C 3SKUD 5BS0E 4EJ1C 1QRNA 2BNUB 3O11A 1A6PA 1MCBA 4OFKA 1QBLL 2RHEA 1A6WH 3U7WH 4JM2B 4X7CC 5I1CL 4IHOA 3QULA 2IPKB 2QR0B 4LRNH 4LKCA 3GSQB 1NMAL 1U3HC 3FT3B 5KVDL 2KPNA 2FSEA 1GL4B 4H0GA 5L88H 5IKCA 3AAZB 4U31A 3RWHB 4WTZG 5IROC 2VZ1A 3E8UH 3FRUA 3SDDA 1MFCH 3BPLC 1FNGB 5DJAB 2IAMD 1U9KA 3WIFA 3MFFA 2BVTA 1UG9A 3G5YB 3T0EA 2XN9A 2YUZA 4M7LL 4PS4H 4XP5L 1YJDH 3S6CA 4GSDH 1A3LL 1OP3H 1KIRB 4GS7C 3FHQA 1MRDH 2XACC 5T1MB 3T0WA 2DL9A 3GGWB 5DO2D 4ZUUA 4OLYH 5MENA 1OOAA 3QHFH 2Y1VA 3M45A 4YIQB 3WNNA 3BGFB 4LDEB 4M6OL 4KDVA 1AQDB 4YBLC 4XWOD 3AUVA 5I17A 5CWSB 1RHHA 5DHVH 1OAYH 1NCBH 2ZOKA 1LO4H 3UTSE 5L2KA 1I1YB 1XF5B 2XWJB 3IDMA 4Q6IB 4JB9H 2IAMB 3EO9L 3ULUH 4D3CH 5FO7A 5I75C 1GCFA 5CZVL 4Z7QF 1OSZB 5DJXB 2DYPA 4PJHA 5IW6B 2E3VA 3ULUD 3OKDA 1RUPH 1RULH 4R2GC 4ZFGL 1EBAA 4IOIB 1RZGB 1R5WB 3GNML 5KW9L 4UAOB 2H2PD 4QCIA 3LKQA 4CU6A 2G9HA 1IFHL 1IGYA 4NCC2 5GS3A 5D8JL 4XBGB 4R8WH 1RI8A 1CI5A 2HH0L 3OGOE 5H94A 3WMSA 4JEGB 4ZTOL 1PG7X 5GSRB 1KT2A 3RI5F 2W60B 3O3EA 4ZPVA 3BHBB 3VI3E 3MOBH 4B5EA 4BK4A 1E4XI 4M00A 5DUBB 3QDHA 4YDKH 3KXFA 1NDGA 2BFVH 5HI4C 1BECA 2HLFD 3S36H 1UC6A 3QCUH 1C5DA 1OAQL 4DUVA 4XNMB 2V2TA 5JOFB 5I1DB 3PWNA 1MJUH 1QVOA 5DK0B 4FQXD 3H7BB 1BOGA 4YHKH 3RVWD 3GI8H 2BVOA 1BGXL 4WU5B 4Y7MA 4HKZB 1W0VB 3OAYK 5H37G 1OARH 5K9QG 1I3GL 1J1PH 3QJHA 3W2DH 2VLKA 4NRXB 5IB4B 4OF3A 1DQQA 4C57C 3MFGB 1GC1L 1U3ZA 5TE4H 2ED8A 4UINL 5FUZH 3QQ3A 2QHRL 1PX4A 3OKMB 4MAYC 5MP6L 2EDJA 1V05A 1OGAE 3MTRA 5CCKL 3W11C 3ZYJA 2XA8L 4S1SH 5GIRA 4HEME 3O6ML 4HWEL 4YE4H 3G6JE 4G3YL 4W6XB 3QA3B 1DEEB 4PFEA 3MRLA 4HK3N 4FN0A 3FMGL 2CRIA 3BVNA 1T20B 5DK3A 2APVA 5IB2A 4PD4J 3MRGA 2VLJD 1CZ8L 4N0CD 3D85D 1JL8A 4FQXB 5JIKA 2VDMH 1AI1H 2VDRH 5IM7B 4M4PA 3NFNA 2DLIA 3RVXC 1INEH 4XPGL 4P57B 4PRHD 4LHUG 4EN3A 2ZCKL 2HFEB 4Q9QL 4ZS7L 2YK1L 1A9BB 2BCKB 1A9EA 4U1LB 3QDMD 1CDJA 3N1FC 3PL6D 1QACA 3VDAA 1RK0B 4MMXC 5B8CC 3DI2B 5GS0H 1GPOL 3WN5A 4WEBH 1NSNL 2ZG3A 5B38G 3C60C 4WY7H 4XGZA 3L3DB 3PWJA 3LKPB 2QL1A 3TVMD 3NPZB 2GSIA 4N1EA 3LRSB 4PGCB 5HHNB 1L7TL 4YLQT 3T65A 4TTDD 2ZOLA 4LCYB 4RQQB 3D85B 1FGNH 1IGMH 3BPCB 5F3BB 2A6JA 5I1GL 3IJSB 1MJJA 3KNBA 1MCPL 3EZ8A 4PRHB 5DI8B 3KPSE 1IT9L 3GSNL 5F70A 1HHKA 1NMBL 4O58L 1H0DB 4KJYA 5ETUB 3N9GL 3QDMB 3VFRB 2K1MA 3HUJB 5K33A 1YEFL 3PL6B 2OP4L 4BZ2H 2FHBA 3NFPB 2AJYL 4PRIB 1BIIA 5E70A 3NN8B 3SDAD 4NSKB 4NKDA 2NY7H 2BNQD 4X4ME 3OGCB 3QEUB 4G42A 4P23A 4P3WA 4JLRA 4DAGH 2AV7B 3HI6L 1G0YR 4WWID 1I1FB 3OXRB 4NRYA 3TVMB 5I18L 2LQRA 1FGVL 3CZFB 4P2OD 3IAQA 5IBUB 4MWFA 4ERSL 2Z91A 5IW3A 1UVQB 5C2BL 4MS8D 1Q0XL 2E7LA 4FQIH 1A22B 1IQWH 4AYFA 2FJFA 1Q94B 5L8KB 3DVFA 1JF1B 2Z8VC 4KMTL 1I8LA 5ESQA 1ONQB 2AXHA 3RTQB 3BPNB 4LPVA 3DO7A 2P5WE 1S7VA 2BVQB 2DKUA 5E7BA 4WI2A 1DUYA 3HS0B 3MRCA 2DQTH 4NKMB 4K7FA 1I8IB 4QRRA 5EB9A 4HHAA 4OFPA 4S1DD 5EUOB 2OS7A 1V7MH 1AE6H 4KHXH 1QSZA 3DVNB 1KF9B 1NFDF 2QQNL 3SDAB 3BKCL 2BNQB 3SDYH 2MCPL 3S35H 1J8HD 3B2UC 2XPGA 4E5XB 5DJYB 2OTWB 3I75B 5JXED 3KPLB 4KVCH 5JXAL 2BERA 1YYLH 1C7SA 4P2OB 3KPRE 5GSVB 2X4TB 1J1XL 2J88L 1QOKA 2DTSA 4YHYC 1AXSB 3UTSD 1JFQH 2G5BA 4AMKH 5IR1B 1GGBH 4ZXBA 1G1YA 3QJFB 4PLJD 1GJIA 3SE3C 1LQSR 3S5LG 4YHNA 1ORSB 4BSWA 1P6AB 2OYPA 1D6VL 4R7NA 1N6VA 1ZT7A 2JJVA 1AC0A 3LEXA 3LPFA 1DANU 2O61B 1P9MC 5T3ZL 4WNQA 2J12B 4JY6A 1L0YA 2VXTL 4E9LA 4E0RA 2CIIA 3FQRA 4P5KA 3GMRB 3BJ91 1IEBB 4PPTA 1J8HB 3AS3A 2V9RA 3P30L 4ODHH 3PWPA 4YHOH 2EDWA 3MGOB 2HTLC 2M2DA 3V52L 3WDIA 4EI6B 3D48R 2MHAB 3AFLA 1PZ5B 3PGDA 3QRGL 1N64H 3UTSB 3HMXH 4GQ9L 1MCDA 2FH8A 4G80B 4Y4FD 4KQ3H 4MA8H 1M7DA 3MRKB 3VFMA 4KKCC 2LABA 4AENB 2XA3A 3MPCA 1BM3L 5FM8A 1R3KA 3BISA 4IRJD 4J3TA 4OBRA 1CQKA 5JW4N 3GMLB 1H15A 1V8HA 3RKDD 4U1KB 1KV3A 3W0WE 2Z92B 5J11C 1N3NA 4M7JH 5HHXH 1HI6A 1PAMA 4YFLF 3NCYP 4KI5C 3FQTB 3CSPA 1LEKA 4LLQA 5E56A 2P46B 1RZJC 3GHBH 5DEZA 1H3WM 4EKXA 3MRHB 3LKOB 1HXYB 1KGCE 5IVNA 5JHDA 1UQSB 4M8QB 4PGDB 1S5HB 5EWIL 3V2AR 3DURA 3VFGH 4DN4L 1GXEA 1AGDB 3JV0A 4HLJA 3V0WL 5AD0A 1VSCA 4Y4FB 5HI3C 2X4QA 3MBED 1D9KD 5ICYA 2D7OA 1BFSA 1TETH 1FAIH 3X13B 5DMKA 2MPAH 1T22B 4IRJB 4D9RD 3A6CH 3QH3B 3O45B 3G6DH 3NVQA 1T2XA 2D7TL 3I3DA 3IGAB 1AHWC 3STZA 3QUKB 2W65A 2C3VB 3LIZH 1BBJB 5D6CA 3QQ4A 3HNTH 4XNXL 3HPJB 1A0QL 1KIPA 1PBYA 4YXLH 2E9BA 4DFIA 3OTTA 3F12B 4KKBD 2AW2A 3PGFH 4YHLH 1A14L 3G6JB 5FCUH 2FEDC 4WI9A 1F4WL 3FQUB 4XPTH 4WHYH 3VMPA 1V3JA 1CTOA 1U8HA 4FFWC 4F7PA 5ERWA 2V2XA 3FN9A 4LBEA 1JPFA 1EHLH 4F58L 4MSWA 2FJHA 3MBEB 4Z6AT 1D9KB 5IHLB 1I1CA 4MXVE 4I2XA 3EBAA 3V6ZA 2I60L 1B88A 3LVEA 5C08E 2F19H 2PYED 1QSFA 1MREL 4RGOH 1YNLL 4P9HL 4WU7B 2IALA 2XZCL 4IS6B 3LN4A 1IC4H 4IRZH 3KPSD 1CGXA 4DGIL 1BQHG 3MRQB 5K9KB 1HHGA 3BIAX 1SYVB 5I1HH 2ICES 4Q9CA 2B1HH 2HJFA 4M5ZL 1DLFL 3I6KB 1FDLH 1MI5D 5B39A 3KPQB 4NT6B 5JHLH 4OCYL 1QKZH 2EIZA 3LN5A 1TQBC 5F1IB 4YFEA 5IEKB 3L5WA 4JCLA 3O6LH 4YHIB 2XKNA 3FO0H 3UJTL 1U8NB 2QKIB 3UYRL 2GFBB 3Q0HA 2OJEA 3S4SG 4K7PY 1GZPB 5F1OB 1WAAE 3IXAA 43C9A 5GPRA 4IOSD 1Q9OB 1CVRA 3U46A 5ESAA 2XOTA 3EYVA 5F6HI 1BF2A 3S34H 4DN3H 5TH2A 2V7NB 1INQA 3MRMB 1FO0H 3Q1SL 2PYEB 3NH7L 1RZ7L 2HFGL 2Y06H 1XF2B 2GK0A 4ZO8A 3KPSB 5EN2B 3QEHB 4O4YH 2P5WD 1NBZA 3L1OL 5B21A 2UZIL 1IAII 5C0FB 1KLFA 5M95B 5HYIA 1YQVL 1MI5B 5EOTB 4QTHA 4HQQH 3S96B 3DRTA 4DCQB 3R06B 4KXZH 5C0AE 3NFSL 4JFDA 1N4XL 2VC2H 4GT7A 4HT1H 3GSRB 2JTDA 1FNFA 1RHFA 4G9FD 5F7YC 3SY0B 5DXWA 1DN0A 1TJHH 5CHNA 3C9NB 1BWWA 3GJFK 5I16B 1F8TH 3AM8A 3PHOB 4ZYKA 1XMWA 2VTFA 3R1GH 1F3JB 3Q6FB 1ZT4A 3L7FA 1L6XA 4FQJL 5GRJH 4ELKB 5CP3A 2HLAB 1NC2D 3BKJL 3TN0B 2C4FU 1HHJB 1KJ3L 3P2TA 3BMWA 2ZPKL 5KBNC 5FKPA 4ZPTB 2YEZA 4QNPF 2P5WB 4JY4B 1FV1A 4YHPB 5K93A 1R5IB 2DIBA 2EDKA 1SJEA 3A6BH 3M17A 4LPCA 3CUPA 4QRQB 5C7XL 4OCXH 1EVUA 5EZLB 1I75A 1FYTA 3QUMH 3MV9D 1RIHH 2H6PA 5IMOA 1U3YA 2CO7B 4G9FB 5DQDH 1T7VA 1NAMA 4Y5VB 4PJAF 4HS8L 1FYHB 3SPVA 1NBVL 3NAAH 4HWUA 1JZ4A 5KVFL 3V4PH 3BX7C 3WL9B 4HBCL 4L8BB 4X9IA 5FYKH 5HHPA 2EXWC 1NC2B 3AY4A 5BV7C 3IFLL 1S7XA 3TPUA 2V9QA 3PV7A 4M4RA 5C9JA 3C8KB 3ARGD 3QDJE 5FYKD 25C8H 4OZIA 3MODH 1TNNA 4XMKH 5FGCE 3WIIH 2DI8A 2BSTA 4XHJD 4J3OC 4KHTH 5ID1A 3ULSB 3G5VA 1KEGL 4LKXA 1FRGH 1W72H 3MV9B 4L8CA 3U0WH 1FORH 1QLRB 3IDYC 2IADB 1PKOA 3SQOH 3MXWL 2GT9B 3QEQE 3PWVA 4K8RL 1UJ3B 3BKML 3IDGA 5JQ6L 1Q1JL 4KRNA 4ZFZA 4YDIH 5JPNB 1KGCD 4A6YB 4ZFFA 3ILQC 5GGUA 2NW3B 4RRPA 1XR8A 4PLNC 3HI1A 4L3CB 2KKQA 5T5FL 5IB1B 2G75B 3KR3H 5SX4I 1BX2A 5IB3B 3ARGB 4ZAKD 3ARTA 4TNWF 4XBEL 5E8EA 3TF7C 4ODXA 1PY9A 4KTYA 4U0QB 4ZMAT 5GHWH 2VDKH 1MY7A 4TSBH 2JIXD 3TBWA 2HKHH 2P24B 3FQWA 4PGBB 5J8OA 4DGVH 3V5KB 4D0DB 2XKSA 5FYLE 4AQ1B 4X4XA 5E08L 4KRPB 1XCTA 3WIHA 1QFWM 1IGFH 4XCYA 2GHWB 3DX8A 1KC5L 4ELME 3MRPA 3SKMB 3TA3C 2XYCA 3S35X 2YPKB 1URLA 4UIMA 4JPKL 4L1DA 5ISZA 3TBYA 1JMXA 1KIQA 4PJXE 2L7JA 5T5NG 1AGEB 3WEXB 4OD3L 3BZ4A 4RGMB 4LCWA 4ZDHB 3OPZL 4F7EA 4DZ8B 5DK2A 3IU3B 4U1SB 2CUHA 3BKYL 4LEOA 2FR4A 1A64A 3KPTA 4D9QE 2Z8RA 1YDPB 5CEZE 4Z7NE 2NY2D 4QEGA 4ZAKB 3QFJA 1JNHA 2OL3H 3QP3A 5ITFA 1P2CA 3NMEA 2VKXA 3MLWL 5GGVH 1OLLA 4HC1H 2JIXB 4NUJB 3FOLA 3MLTA 1LO5B 2H9GB 4PJCA 1KENH 4PV8A 3MLYL 5DFVD 1IAOA 4RX4A 2HWZH 4RFEA 2Y72A 4NHUA 1FVDB 4RSVA 4M6NL 1JIBA 3GSXB 1GGCH 4QHMA 4U6VH 5FAAA 3D87B 3P4LA 3GRWH 3T0XA 3WV0A 1YEHH 3HZMB 2WP3T 5ILTL 4YBQC 5C0RH 2J3SA 4OGAD 4CUCA 5A3ID 2D03L 1J1OH 1YYMH 5E9DA 3LEVL 4U2ZA 1HINL 4I3RH 2ZUYA 3JWDL 1NLDH 3MREB 1Q0YL 2CKBB 2EICA 4LLYB 4HGWB 3MV8E 2NY2B 3O9WA 5JW4R 1JYNA 4E41E 4YWGH 2OCFD 1B4JH 3UAJD 3B3IA 4JZNA 5M94B 2IQ9H 4PREA 1HQ4B 1CGUA 1JN6A 1EBPA 1RJLA 3HA0A 1JGLL 4K3JH 2EDYA 1FNEB 1TJIH 5FYKU 1P4LA 3IKKA 2FLBT 1R3LB 3BWAA 1DQDH 3RDTD 2ATPB 2J5LC 4XVJH 5I0DA 5C0AD 2X09A 3TWCH 5FA3B 1T1YB 2AJ3B 5DD1H 3KS0H 3V5DA 2VL5A 3TO2A 4OLUL 3B9KD 3T1WA 3IAPA 3FONB 4U1HB 3MMEB 1IKFL 3HZKB 3JTTA 1R3HA 2R4RH 2MKLC 5C07E 2A6DB 3RU8H 3RWIB 4NWUH 4Y5XC 1OWWA 5E99L 3LSOA 4PGEB 4N0UA 3UJJH 3MGAA 2R0LL 2Y07H 2R2BB 4ENEC 1JPSL 3UBXI 2DDQL 3QO0A 3QUMA 4NM4L 2CKBL 4OUUB 4PJIF 4QRPE 5EUKA 3MLZL 1TPXC 3QCTH 3BO8B 5J06A 4V1DD 1YNTA 2NXYC 3QIWD 4Q9BA 2AKRB 5MEPA 3RDTB 1K6QH 5MERA 4NGHH 2RCSH 3C5ZD 5C0AB 3MUGB 3TH2T 2YXFA 3I6GB 1ZEAH 4MNHB 1UZ6F 3D9AH 1GOGA 4CMMA 2CMRH 2Q86B 3B9KB 2FWOB 5F7LB 1L0QA 4YXHL 4U1GB 3WDJA 5KSBF 4OFYD 2BY3A 2FX7L 1FL6A 1MIMH 1YEIH 4QWWC 2ZUSA 2DD8L 3KYMA 5JO5A 4J8RB 3WFBH 4S1QL 4Q58C 2D31B 4J3WA 5DJ8A 1MRFH 1X9QA 3EYFA 4FQ1L 2P45B 3VXNB 3ULVC 4X99B 1LO2L 4I77L 3QXWA 1MUJB 4KJPD 5ADPH 4PJ7E 3BUYA 3QSKB 1AQKL 2VMFA 5DEFB 4MD0A 1RUKH 1CICD 4O51B 4V1DB 3QIWB 1NGXB 4C56A 5FO9A 4ZS6D 3U48A 2EE6A 2FIRT 4S10A 4O2EB 3C5ZB 1IBGL 3JXAA 4G6ML 1EFQA 4XAKD 5KG9A 2WK2A 2YKLL 3VXRD 2ZCHH 4F80A 3QWQB 3MOAL 4OF6A 3HPLA 1DVFC 2HVKA 4HXAL 1WIOA 3ARFD 4YBHA 2WM0A 4EDXB 4OCWH 2BHYA 4UBDD 1ES0B 3H0TB 1RZFL 5EA0H 5C0ND 2BY2A 3O2WH 3O6FD 3SDCC 2DWDB 4IMKA 5F9OL 4DKFH 4AT6B 5FGCB 4Y2DC 3VFWA 3DBXA 1RZKH 4PRPA 1QBLH 1U8PB 1CICB 4KDTA 5F71A 5LGJB 4X8JA 1LNUB 4TVPE 5I1CH 5ELIA 3FOMB 5DYOA 1NDMA 2EDTA 5I8OL 5AYQA 4PY8I 5ID0A 5AEAA 5EU3B 1NMAH 4Q9RL 1H3GA 1H8OA 4Y19D 2IAND 3CXHK 2MSPA 2FX8H 3MNZB 5EC1B 3VXRB 1JNNL 1KCVL 4NRZB 5IVXB 4WCYL 1TZHB 3QEQB 2X7LA 1V7NH 3BIKA 3ZE2E 3ARFB 1KPVB 1PSKL 4M7LH 4XP5H 3PXHA 1M6OB 3NCCB 3V8CA 4Y88A 5EPMA 3QPQD 4FP8L 5LBSH 4JKKA 3ALXA 1HN1A 3IDNB 3B8SA 5KSUB 4R0LA 1N8ZA 4FFVD 4ETQB 1OTTD 3CFDB 3O6FB 5CEZD 1NCNA 3VFVB 4WFFE 3ARQA 1UACL 5IFJB 1ADQA 4Y4KA 1HZHH 3AB0C 3CJJA 5EU4A 1Y6MR 2A9MH 1N59B 3RPIA 5TGBB 4M6OH 4HPOL 5DJ0B 4XNQB 1RU9H 3T8XB 1UWXH 5T1KD 4P4KA 4P5TA 1RUMH 4ELMB 4GAJH 4Y16D 1UENA 1QLFB 3EO9H 1GGYA 2KH2B 1CE6A 2X5PA 1DSFH 4LQFL 1HEZA 3SCMC 4PJXB 5SWZD 2K9UA 2Q7YB 2XZAL 3HC4L 1LK3L 1T1ZA 2Z9TA 2PXYC 4CMHB 4NOBA 2OXGA 5BW7C 1KXTB 5KW9H 4GKZB 4JFOB 5F7WC 3QAZB 1H5BB 2DJ4A 4E41D 2GUOA 4K7PX 1MRCL 3CX5K 2HH0H 2CR6A 4NN6C 3AU1A 3OXSA 4JRYA 4ZTOH 2DKMA 5GS1C 1LP9E 4EVNA 2PO6D 1KN4L 2XQBH 3OKNA 2F54E 1G6RH 5D72H 3U2SB 3HZVB 4QRUB 3TH3T 5JORA 3T4AA 5F8QC 5T1KB 1I8MA 2OXHA 3UZEA 3OJDB 2NX5E 3QNYB 5C0GB 1NEZA 4WWKB 1YEJL 4U1MA 3DX9A 1OAQH 5I1IL 1YMMD 3QXUA 3SGJC 1SJXA 3QDGA 4FQLL 1T6VN 4KI1A 4Y4HC 5FYLL 2PYFB 2MOVA 5GGRY 5E8OA 4OF0A 1UM5H 2ZNWA 4N5ED 1DZBA 3RWJA 5TE7L 1P4IH 4ZUTA 1PX3A 3DX6A 4LVNB 1AFVH 4J3XA 3D1MC 2AEPL 5C07D 3U36B 4E41B 1XGRA 5E00A 3ARDC 5JW5A 1GC1H 1IL1A 2QHRH 4Y5YB 2R2EA 5MP6H 4M7ZB 4R4BB 2PO6B 3JTSB 3U83A 4MA1C 4QRPD 2BNRE 4F3FA 4JQVA 4MDJB 4LNVA 5D7IB 2HT3D 1CU4H 4TRPH 4L3EE 4K3DL 2WANA 4YZFE 1G9NC 5E94B 3MC0A 1BVKA 2JJWA 1XF4A 2VR9A 4U7KA 2E8YA 2XTJC 1G7MB 4IRSC 1T66C 4JN2A 1VFAA 1JV5A 3UPRB 1NMCC 3VU2A 2ED9A 4LLWB 4WI5A 1MAMH 4IJ3B 1QYGL 4XPGH 1RMFL 2OQJB 2IPTH 3ZTNL 4TSAL 4KTDL 5FOBA 5C07B 5DZLA 4RDQG 4ZS7H 4PJFF 3KWWA 1OTUC 4IMLB 4PP1C 3V6FA 1N5AA 1FNLA 4DW2L 5KS9B 1CWVA 3EGSA 1AP2A 1JZ6A 1KEMH 5F3HB 1WZ1H 1MH5B 4M1GL 1GPOH 4QRPB 1IAMA 3ZYZA 3SDXE 4TUOA 4LSTL 1QLEL 4JFEE 1D7FA 4UT6L 4EBQH 4WW2C 2OZ4H 1U3HD 2UY6A 2ICWI 3A67L 2RR3A 4JDTH 5CSGA 3F65A 1KB5H 1CD1A 3HNSL 4G6KH 2ARJA 4Z5RA 4D8PA 1LE9A 3T2NH 2B20A 1UXWA 3UDWC 1A6ZB 1MCPH 3OKLA 2QTEA 3GSNH 3FTGA 3VCLA 2Q1EA 3N9GH 2Z35B 1EMTL 2N7BA 3PDGA 1S7UA 4I0PB 3DXAE 5K9OB 1DBBH 4MJ5B 4H1LB 4PJ7B 4KU1A 5IHZA 3QUYA 1A5FH 5HHQB 5ICZB 3THML 2DM2A 4NFBA 4XXCA 1U8IB 1CLOL 4FZEL 2IQAA 1U3HB 5IVZA 2PTTB 4NQSA 3HI6H 1A7QL 1CLZL 4JRXD 5I18H 5GZOC 2VDLH 4QHKJ 5LAXB 5CS7A 1R0AL 3BPLB 5CKGA 1IC1A 4R4FL 1FNSL 2J1KA 3HLAB 1ETZB 4DQOH 2D4DA 4GW5A 3U79A 3PGCA 5I66A 2X4UA 3AMLA 4KMTH 1U95B 2Z0BA 3STLA 4R2GD 4MD4B 4L8DA 4KKLC 1LD9B 4GS7B 1A8JH 4IIQC 5EFIA 3STBA 4OQTL 3SE8H 3X11B 4XCNA 3D0VA 3KLAA 3ZKXC 3UJIH 3GZKA 4WIQA 5KSBA 3IKCB 1FFOA 3QWOA 4KJWD 3ZKSD 5I1KL 3BKCH 2H1PL 5I1LA 4XMPL 5F89B 4N1HB 4YBLB 1XAUA 4OGYL 4JKMA 4JRXB 4FQ2L 1DBMH 5JXAH 4PG2A 5HI4D 4JM2A 3O3AB 2IPKA 4CVXB 2QR0A 3GSQA 1J1XH 2FCBA 4L4TD 3UTOA 4NO5A 1KTLB 4JFXB 3RWHA 2PNDA 4XVSL 4TUKH 5DJAA 4R2GB 3SGDH 4UV7L 1D6VH 3E1F1 4UNVA 3G5YA 3B2VL 5F7EH 1YNKL 2O5YH 5EORH 3HE6A 2IMNA 4K71C 2WUBL 1IAKA 3AXLB 1ZSDB 4IM8A 3UYPA 5JDJA 3QUXC 3D0LB 4MAYD 5T3ZH 4PJGF 2VXTH 1C5BH 1CT8B 3ZE0E 4NOFA 4ZO6A 3W11D 3R8BB 1JGVH 3GGWA 3I85A 1IGTB 1MFAH 3JUYA 2F54D 1ZA3B 5MEQB 1RAMA 1MLBB 4YIQA 3GB7A 2HP4A 5E8NB 1AQDA 3WE6B 2NX5D 1ZVHA 3TNMB 4L4TB 3QRGH 3RNKA 5CWSA 3I6LE 3QPXH 1DQLL 3ILPB 4TVPL 1RUQL 1SEQH 5CEYB 1I1YA 2XWJA 4Q6IA 2P8LA 2IAMA 2QADC 1E4XL 3RVXD 2F8VA 2R8SH 4KAQH 5EULV 5L7XH 3C2AH 3F7QA 1QP1A 1OSZA 5DJXA 5IW6A 1I1AC 4JQXA 5E4EC 4CN1A 1BBDH 3TLRA 1RQ5A 2DQGL 4PB0L 4MHHI 4IOIA 1R5WA 5DMIH 4MAYB 1BLNB 4OLWL 4XBGA 2DQCL 3MA7B 3C60D 4P2QD 2F54B 5GSRA 4LMQI 3UTQB 3K46A 3SDDC 2R69L 1DP0A 3BHBA 4GAFB 4ONHB 3ESUF 2NX5B 4YH6A 4H8WL 4XWGH 1K4CB 4XP9L 2LAAA 3U1SL 1A7RL 3EFDL 3O4LD 1EO8L 4PP2B 3V0WH 2IPUK 4GAGH 3IRPX 4XNMA 1F4XL 5JOFA 1AGCB 1CDIA 4QKXB 5I1DA 3IDJB 1E4KA 3VRLE 5DK0A 5B4MC 3H3PL 4HUWA 1TZGH 2EEDA 3DROB 4LVHC 3KPMA 3L5JA 1GGUA 4BSVB 1CDBA 4HKZA 1W0VA 4OF5A 4NO2A 5LWYH 1HCFX 4ZOCA 1W2KT 5LCVL 5B8CB 4NRXA 5IB4A 1LE5A 3ARBC 4XP4L 4G7VL 3WO4C 3C60B 1S7SB 4P2QB 2AGJL 5FYJH 5HYJE 3B6SB 4GKOA 1FNHA 4GRLD 2AJSL 1F4WH 1MFEH 3RY4A 3T2QA 4QOKA 1EEUA 2AJXH 1DEEA 3QA3A 4MA7L 2YXMA 3ROOB 4JHWH 1L7IL 1DBJL 5CJOH 1T20A 5DR5H 2IEPA 3N1MC 2UUDK 3GSNA 2W9EH 4FQXA 1MREH 2DQJH 1YNLH 4OCSL 5IM7A 2RJMA 3RX8A 5BOZG 4P57A 5IQ9B 3RIAF 4GAYB 3VXSE 3G08B 1IEHA 1HK6A 2HFEA 4HAFA 4M5ZH 2F53D 4LL9A 4KUZL 2AJZB 4U1LA 2NNAB 5F9JA 3T3ME 5C09D 3B2UD 4PYGA 5FECB 3SDXB 1RK0A 3TCXA 4BSJA 5I73B 4Z7UF 4WFGE 4NC1C 1NPUA 1S7QB 1GH7A 3NA9L 3C5JB 3N1QC 4JO4H 5KVGL 3L3DA 3WXVL 3LKPA 4GRWE 4BUHA 3LRSA 4HCRH 5HHNA 1DFBL 4X9HA 3DYMA 5DRXA 4LCYA 4RQQA 3D85A 5TDNB 3Q1SH 1LEIA 5TQ2H 4YPGB 3BPCA 3NH7H 5F3BA 1H3UA 3IJSA 5HYSG 2CLVA 4X7DC 3SKJH 5F7HA 4KZDL 3O81A 2OR8A 3MRDA 5DI8A 4GXUM 3EO0B 5C0JB 3MRRA 4HJ0C 1H0DA 3DXAB 3MACL 2FLRT 2CO6B 2IPUG 1Q9WA 2NY4C 4HWNA 5C09B 1KULA 1C1EH 4F7TB 3PL6A 4I13B 4OM1L 2HTLD 3NFPA 3CU7A 4PRIA 3L95B 3NN8A 3P0YL 1ZOXA 1YPZE 1MCRA 3QNXB 4LHUD 3OGCA 4HULB 2X1WL 4OD1L 2I27N 1SJHB 4LAQL 4YHYB 2AV7A 1LEGA 1ULVA 3OXRA 3E6FB 4MB3A 1ACYL 5CJBA 3CZFA 3AGVA 2RAMA 2CXGA 1TVBB 3BKJH 1G9MC 4KKCD 2GSGB 1KJ3H 1UVQA 5FGBA 1ZVYA 5D1XC 5ICXB 1JGUL 2B4CL 2EECA 2X1XR 4M9OA 1I7TB 5I30H 2XXMB 4IDLA 5GS2H 4JPVH 1HE7A 1ONQA 3RTQA 5DVNA 3UC0L 2FBOJ 2BVQA 5FDWB 3SBWC 3VD9A 2FD6L 2YN5A 4KI5D 1Q72L 2PW2B 5EUOA 1ZLSL 4C83B 3SDAA 4G6FD 1A7PH 2BNQA 4LHUB 4X80H 2KQNA 5BS0A 1E4WH 2JE8A 4MQXC 3OKYA 4HZLB 1MVUB 2F5BL 2Q7NA 4RMTA 4HS8H 2OTWA 3I75A 1FIGH 1C08A 3MRIB 5IEHA 4P2OA 5HI3D 3CVHB 1ED3A 5DZNA 2X4TA 2EKJA 3IFLH 1OD9A 3I6LD 1UKQA 1AXSA 1JHKH 2J6EH 1X7QB 5IR1A 5ITBH 5B38B 5FYJU 3QJFA 2DF3A 4XI5C 5F1NB 3SN6N 4JANB 5A1AA 2XICA 1CLYL 1WITA 2BC4B 4XPAH 5ACMA 5J11B 1FL3B 4ZUWB 3PWLB 2A0LC 1V3MA 3HR5B 2O61A 2XNAB 4B53A 5GRWA 4BFIB 3IT8D 5D2LF 5E2TL 1YY8B 1KG0B 4G6FB 4DGYL 5IJKA 3GMRA 3MXWH 1IEBA 2FEDD 4K8RH 2QQQA 3BKMH 2J4WL 43CAA 1Q1JH 2BSRB 3DGGB 4FFWD 4FXGA 1MCOH 4LSUL 1CXFA 1VKXA 4EI6A 4OFVA 4JKLA 2MHAA 3TFKC 3ET9F 5T5FH 5HGAA 4X7TB 1LWRA 5AAMA 3UTSA 2V17H 3VGAC 4HH9A 2AABH 4NKOB 2YA1A 2VXUH 4CNIB 5KANI 4MGXA 4G80A 3NIGE 4XBEH 3MRKA 1OP5H 2BOCA 1F45A 1JZ2A 4AENA 3CVHL 1AHWB 1OAXL 4QHNB 3U4EA 1QSFE 1EHNA 4HK0B 3W39B 3KGRA 4FA8A 3GMLA 4X6CB 3MV7E 4U1KA 4X9BA 2Z92A 2VH5H 3ALPA 1U8JB 3ZKMC 4I3SH 5IBLC 5CKAA 4X6DF 3HB3C 1ZTXH 1JRHH 4JPKH 4KUCD 5B39G 3C5SB 1YY9C 4OZFB 4JM4H 2BVPB 5BXFB 5KTEL 1ZA6B 3LKOA 1HXYA 1RZJL 2NY6C 3GDBA 1VGKA 1UQSA 5IBTL 3WUWG 4M8QA 4PGDA 1VPOL 1S5HA 4LPWA 1AGDA 4HUXB 4XPHL 3UXFA 1XR9B 2FZ3B 4OLVL 1CK0L 4NYLB 3KYKL 4RMQA 4X9FA 1MELA 1YUHA 3X13A 2KL6A 4OLZH 4L9LA 1T22A 4IRJA 3VFOA 3QH3A 3MLYH 3O45A 1I9EA 5DQJB 3S97C 3IFPB 4OI7A 2GJZB 3VXSD 2J8UB 3S5LB 1JF6A 1DBKH 3QUKA 2C3VA 1BBJA 1TQBB 3WNMA 1WAAF 2CJUL 2YPLD 3CZJA 3HPJA 1AY1H 2HT4C 4AEHH 3GHEL 4YPJA 2B0SL 1S5IL 1JZ8A 5SWQB 1XT5A 4QGYA 2ZNXA 4WFGD 5IT2L 5ILTH 1IGCH 3F12A 3HNVH 4DKDC 1CGWA 3NZHL 3G6JA 4PJ9C 1HINH 5DLML 3JWDH 1JHLL 3FQUA 5DA0B 4UMGA 1J86A 2LTQC 5C1MB 4RWYL 3WKML 4BKLA 3MBEA 5CILL 4FTVE 5JIPA 4UT9H 3WFCL 2NTFB 1JGLH 5C86A 3LPWA 4O2CA 4MDIB 1JPGB 3VXSB 5K9KA 1NFIB 3MRQA 1AD9A 1SYVA 3TBVA 5BRZE 3FO9A 5HHVH 1G84A 1R5VB 3ZDZE 5C70A 1WFUA 1FN4B 2YPLB 3I6KA 4QT5A 2CSPA 3CSBA 5C71A 3AROA 1FLRL 3HI5H 3KPQA 2YUWA 4HS6B 4K2UH 4NT6A 3V4UL 2JB6A 2VXSL 5DJ2B 1IAIL 1KBGH 4OLUH 3CGTA 5F1IA 2EE3A 3H2WA 5BV7H 4YDJA 3WJJA 4YHIA 1U8NA 2QKIA 3H9SE 4QF1B 1WV7T 5C0EB 4XP1L 4LGPB 3MR9B 1IKFH 1GZPA 4YR6A 1HILB 1NAKL 2EXWD 1SY6A 2G60H 1Q9OA 1F90H 3EDJA 3QBTB 2X05A 2OBGA 1TLKA 5E99H 3BSZL 2WBKA 4F37K 2GQHA 5GS0C 5IP4A 2V7NA 3VXQB 2J2ZA 3MRMA 3JWOL 3DIFB 2E7HA 5F7NC 1JPSH 2PYEA 4BFEA 3FQNB 1XF2A 3BD5A 4LK4A 5E2JA 3KPSA 5EN2A 3QEHA 5AYUL 5C0FA 1OAKH 3GMQB 5C2UB 1HNGA 4NBXB 3ALWA 3RVTC 1WBYA 1CG9B 4LEXL 1CDHA 1NGYA 5EOTA 3S96A 3VH8B 3MROA 4DCQA 1HWGB 3R06A 4HIIB 4D0CA 5DGQA 1K85A 4NJAL 2JB5L 3Q5YA 1YPZB 4HWBA 4X4MA 1UYWH 4KKAC 3ILQD 5DJDB 1Z3GL 1T2JA 3QXAA 4EDWH 1QG3A 2FNBA 2WUCL 1QR1A 3C9NA 1I9JL 4Z8FL 5I16A 1CDUA 3GBLA 5CFHA 3PHOA 1PEWA 1F3JA 4N8CL 4FQ1H 4LCUB 4RRPG 1QFWI 4KQ4L 3TN0A 2UWEE 5D71H 4NHCL 3HMWL 1HHJA 5H35A 1ACZA 2EEAA 5IMKB 3FJTA 4ZPTA 2Z31C 4HIXL 5IHUH 2BY1A 3NABH 2P5WA 4JY4A 4YHPA 3MJ6A 4F57L 2CK0L 2XWTA 4QRQA 3IDYB 5CGYC 1IBGH 1U3JA 1CFBA 5EZLA 2A6IB 1UEYA 2BVYA 3TA3D 5E1AA 2YKLH 1PG7W 4AM0A 1BQHB 3U6RB 2D0GA 1L9NA 1CIDA 3RL2B 1G1CA 4N90E 1HHIB 5J1TC 4Y5VA 1SHMA 2XTLA 2DJUA 7FABL 1CDGA 4D94A 4H25A 2PN5A 2VDNH 4KTEL 1BFOB 3KPRA 3REWB 3WL9A 1U8LB 1RZFH 4L8BA 2ORBL 3K80A 5F9OH 4X7SH 2A9NL 1NGWB 3O8XA 3S4SB 4ALAL 2YRLA 1UZ8B 1U41A 3BJLA 4OGXH 3N0PB 2PUQT 2NQCA 1KSRA 5DRWA 2A38A 1AD0B 2ADGB 3MV7D 1LVEA 4LAJH 5DJZB 3ULSA 5DQ9B 4CBPA 3QT2A 4XP6L 3TA3B 3MV9A 3UTPE 3CMGA 4K9EL 1JNNH 1XH3B 4W4OA 3VG9C 2Q87A 4WCYH 2X4RB 2DBLH 1GGIL 4YBQD 1D5IH 2IADA 1AKJD 5E2UL 1PSKH 2GT9A 4X98B 4TUJB 3TJEL 2W1NA 1EGJL 4Z7VF 2PTUA 5ECJE 4WI7A 4A6YA 4FP8H 2HYMA 4XX1G 2NW3A 2EDRA 4L3CA 5JNYB 3VRJB 5IB1A 2G75A 2ESVE 2XZQH 1PVHA 1X44A 5SX5K 5IB3A 3S3SA 4PB9H 4AEIL 3ARGA 4P3CL 1RK1B 2BSSB 3G5ZB 1FAKT 4JFFD 4OCRL 4HPOH 3QG7H 2ADJA 4UTAH 4PGBA 3MV7B 3DJ9A 4FRWA 3V5KA 3W0WA 4D0DA 4U6XB 1X5HA 1JWUB 1Z5LB 2E9IA 4LLDB 4G8IB 1PZUB 2EH7H 1J0IA 2YBRB 4HK3J 1AKJB 2JJTC 3ETBF 5CBEA 4FFYL 4OZHE 2DIJA 3IVKB 2YPKA 3HC4H 1K3IA 5EOCH 1QO3B 1LK3H 2YA2A 3KYOB 2O26U 4PJBE 2JJSC 1NH6A 3ZL4L 1AGEA 1VACB 4ZDHA 1EEYB 3TZVC 1N0XH 3HC3H 4DZ8A 3IU3A 3HAEB 4NKIH 2SEBB 1YN6A 4AH2B 1YDPA 1MRCH 4ENED 3RP1A 4FTVD 4ZAKA 15C8H 1P53A 3K81A 1KN4H 1B9ZA 4UOJA 4N0UE 3BN9C 3FO1B 4N8VA 2NXYD 2JIXA 4NUJA 4NO3B 5EU6D 1D5MA 1LO5A 4UDUB 4CL7A 2J5LB 2VABB 3RNQB 4U3HA 3P4NA 2LU4A 3FRPA 1YEJH 2OMBA 5KAQF 1FVDA 1OGTB 1EAPB 3D25B 5I1IH 1RVFH 2V9TA 2EZ0D 4ODVH 3GSXA 4FQLH 5E95B 2R9HC 1F3RB 3BGMB 1P7KB 4QWWD 4N0RA 3MJ9A 5TE7H 3H9SD 5CSZA 4UUJA 1KTRL 4Y5XB 3EW3B 5TQ0L 4PJEF 1UWGL 2VR5A 3BZEB 4GG6E 4XCCL 3MREA 3P11L 4QXTB 2CKBA 2YSSB 3ULVD 5FIEA 4TNVF 1UXSB 4FTVB 4HGWA 4LLYA 5LVEA 1CXHA 4Z0XB 2GAZB 2ZUWA 4XVUC 1N7MH 1TPXB 1HQ4A 2VXQH 5DEGA 5DRNA 4RMSA 3GI9L 2NXYB 4M62L 1IQDA 4OBSA 3U4BL 2ENYA 5EU6B 1G7JB 4LPUA 1DANT 4LLUB 4Z0BH 1FNEA 1W0YT 5BRZB 3TT3L 5T3XE 1F4YL 1SBBA 1WWWX 1R3LA 2CH8A 3MLUH 2ATPA 1KLUB 2DLEA 2AQ2A 4HJGB 5E4IA 1MFBH 3BDYL 3MJGX 1WISA 1DVFD 3BXNB 3GJFB 1I85C 5FA3A 5JA9A 1T1YA 2AJ3A 3P4MB 2N1KA 4M6ML 4OAWB 4WUKL 1AIFB 2HFFB 5HHMD 3H9SB 1MIEL 1RMFH 3NIDF 4P0DA 3ZTNH 1WAAA 3N50A 4KTDH 3FONA 3W81A 1NANH 1TTFA 3MMEA 4U1HA 3HZKA 3LQMA 3SDCD 3BIBX 3O3UN 4B7IA 2A6DA 3NIFE 2FBJL 3OX8A 4Y2DD 4L8SC 4NN7C 1P7QD 1N0LA 4TNWK 2DQDH 4KMLB 1FCGA 3WXWL 4H26B 2R2BA 4TULH 1MPAL 4P48A 4UT6H 1IRAY 4OUUA 5IK3B 4KPHL 4APQA 4LSSH 1FC1A 3ZDYE 5T1DL 3BO8A 2H3NB 2AKRA 5T33L 3BEWA 3RDTA 1IM3B 5D7LE 2HG5B 4UIKH 3QRFM 4ODTL 1B2WL 1PLGL 3HNSH 4NM8H 3MUGA 5C0AA 1TTUA 1DVFB 3I6GA 4MNHA 4P2CG 1MCFA 3B9KA 5EOQL 5HHMB 1QBML 4S0TD 2JELL 5D93B 3V9FA 4PD4K 3QHZL 1TENA 1ZHNA 3SDCB 5HGHB 1AXTL 4J8RA 4Y2DB 4WW1B 1P7QB 2IBZX 2D31A 2UWEB 1INDL 4KWUA 5DS8A 1AGFB 4PTTB 1NAML 1F3DJ 2LVEA 1BFVL 3GFUA 4Z7WB 1LDPL 3IJHB 5F7UA 5DF0A 3FAXA 2ZZUT 3TNNA 1I9RL 2VKWA 1A7QH 2LU3A 1JZ5A 1CDCA 1FZJB 4O51A 3QIWA 1NGXA 3LH2L 1R0AH 4HX1B 3ARPA 4D2NA 4NZRH 1Y0LB 4R4FH 1FNSH 3C5ZA 3C8HA 3SOBH 3SCMD 4OTXL 4OGZA 4Z7OE 4DVRL 2PXYD 1OAZL 4O00A 3IF1B 2UZXB 2I07A 4KXZI 4XXDB 5EO9A 4EDXA 5DD0L 2H26A 3FT2B 1U8MA 5F88B 3HZYB 4HF5H 1KCRH 3BT2L 3RY5A 3AB0B 3H0TA 4U6HA 2ESVD 5CINL 5F1SA 2VRAA 1A1MB 1CFNA 5EU7C 2DWDA 2H1PH 4YHZL 1KPUA 4AT6A 4LLMA 3L3GB 1NL0L 4PR5A 5FHBL 5KOMC 3JVGC 2PF6A 1S9VA 5MHSE 1NGPL 4LMQE 2VZ3A 4FQ2H 5CJQL 1U8PA 1CICA 5LGJA 1JWMB 1LNUA 1A47A 1AGBB 1K8IA 4Y4HD 3RGHA 3MNZA 3P40A 5EC1A 4R26L 4EUPA 4NRZA 1H8NA 1TZHA 3QEQA 3I84A 1EVTC 3ARFA 2W0FB 4LCCC 1WIPA 5L2JB 1KPVA 3RUGF 4P46D 1I7UB 4I3GA 3TT1H 1LP9F 3B5HA 3ARDD 1ROWA 2RIKA 3UO1H 2EDNA 4JDVB 4NN6B 4ZUVB 5IMMA 5KSUA 3IDNA 4I1NB 2ESVB 3KAAA 5GS1B 3K4AA 3O6FA 2R0WH 4OKDA 5I1EL 3EOTH 1KN2L 5FV1L 5E8PB 2XY2A 1G9NH 4LCIL 5EZOL 3VFVA 2DLGA 5IFJA 1K8DB 4XNUL 2FJGB 4XB8A 3O3BB 2YMXL 5IB5B 3VFNB 5D7JB 5DMGC 4O2FB 5I1JH 5DJ0A 2X4OA 4M7KL 4XNQA 3T8XA 4PJDE 4S2SB 1GAFH 2XTJD 3LV3B 4IRSD 5F7FA 1T66D 2H8PA 4Y4HB 4B50A 3KVQA 1U6AH 2P44B 1MWAB 4J7RA 3V0VA 3H8NA 3P9LA 2D7NA 4ELMA 4ZTPL 3TV3L 3UCRA 1QLFA 1E4XH 3INUL 3BW9A 4HIHB 3LHPL 4PJXA 2Z4QB 2R0ZL 3RL1B 2Q7YA 4PJBB 3MNVB 5JUEH 1JPTH 1MCEA 5TJWK 1UWXK 4PP1D 1OTUD 4FQHB 3ARDB 4PB0H 1VFMA 4UB0H 4KDTC 4MD5A 1FZMB 2C4FT 4GKZA 4JFOA 4NZJA 1U2HA 4UZGA 1TCMA 3S37H 4MA1B 5EC2B 4BYHA 4R7DA 3OB8A 4RGNC 3EJZC 3X3FL 3VWJA 2W0LA 1NCDH 1KYOK 2JCCE 4H8WH 4XP9H 2XTJB 4KROC 1NBYB 2ARWA 3OJDA 4IRSB 5T3XD 5C0GA 3SGKC 3LEYH 4WWKA 2Q8BL 1NMCB 5E6IA 2FEEI 5F7KC 4XBPB 4R0LC 3EDFA 5FUCC 4WI6A 3FFCE 1T04B 4XVTL 1R3IL 3HG1E 3QQ9C 4XAWH 2XG4A 1MWAL 1D5BB 4Y4KC 3T77B 4C58B 1U42A 2CPCA 2KBGA 3SDXF 1EJOH 1RFDH 4ZFOB 3MV8A 4NQXA 3U30C 2V5YA 2M1KA 2X42A 4E41A 4GLRI 5FCSH 2X40A 4KK5C 4G7VH 7CGTA 4OIIL 4WW2B 4P5TC 2H32B 4Y5YA 4PJ8D 4X4YB 4R4BA 1U93B 4HUVB 2ITDB 2PO6A 3JTSA 4MA3B 5ACLA 3FT4B 5DVKA 2D7PA 3CCHB 5GZOD 4BH7B 2AJSH 1KNOA 3DV6B 4MDJA 5D7IA 1T21B 5CP7A 1T83C 3M8OL 4NNXB 1L7IH 5E94A 1DBJH 2VZSA 5D7LD 1QBBA 3L5IA 2Y23A 1MHHA 1PJ9A 4J23A 1FZKB 1XGQB 4OZGE 4ODBD 4KKLD 2NPLX 2VDQH 3UPRA 1NBQA 4YDLC 4NP4L 1TITA 4LLWA 1FHGA 1SM3L 1Z0MA 2OQJA 3JWNC 4GW1B 1R6VA 3I02A 5C07A 1JNLL 2G5RA 4KUZH 4IDJL 2HA1A 4G8GE 4IMLA 1UH2A 3MRFB 1RJCA 1A7OL 1XEDA 4OI9A 32C2B 3UROR 2NZ9C 1MH5A 1S3KH 3BZFA 3MLRH 4QRPA 1TMCB 1M1SA 2WWKT 3MCLL 4ZFOL 1K9TA 4WTWA 2VWEE 4BK5A 1J12A 3P0VH 5CJ8A 4F7CB 3IYLW 1R24B 3SJVD 2F5AH 5D7LB 1TDQA 4PGJA 1B4RA 4OQTA 3QCVL 1I7RB 4TSCL 4IIQB 4O02L 3OV6A 4KGLA 6CGTA 4N0YL 1A6ZA 1VB9A 5I8EB 1T2QL 3ZKXB 4PY8J 3QUXD 1BD2E 1NCAL 3X14B 1EIBA 2CDFB 4Q0XL 5BO1L 1ZGLB 4JQVC 4P2RD 3CFCL 3MACH 2YD3A 2Z35A 3EYUH 4I0PA 4UILL 3RY6A 2BRQA 1MJ8L 5K9OA 5CIPA 3ZDXE 1MHPL 4EI5A 4UTBH 4TQEL 1JGDB 5DC9B 5I15L 3ZYIA 3P0YH 4MJ5A 4NQCE 4H1LA 4PJ7A 4RISH 5HHQA 5MHSD 4PY7B 1KJ2B 1U8IA 4HPYH 2OI9C 2ATKB 3SJVB 5IROA 5LAXA 1ACYH 3QWRA 2DLFL 5BOPA 3CFBB 4NKQB 4ODUB 1K3ZA 4JVUA 2QSTA 5TPWL 1REIA 5GGSA 1ETZA 1JZ7A 5C8JB 2CDGB 1JGUH 4K71B 1HDMA 2B4CH 1I1AD 1T4KA 1D6EA 3GIVB 2W38A 4MD4A 3ZE0F 3QUXB 3EO1B 2K7QA 4NQUA 3IDXL 4P2RB 3ZT7A 1BQSA 4FMKA 4B0MM 1Q72H 5HTSA 2B5IC 4JG0H 5INCB 3UTZB 4GMTL 3IKCA 3Q3GA 4UOW1 3BP4A 1K5NB 3SDDD 2VDPL 3C2SA 2PR4H 4BJLA 5GGRA 5F89A 5F93C 4F8QA 4JY5L 4KFZC 4PUBL 2XN9D 4HIJB 4JZOB 4MXWL 3WUZA 3DSFH 5DUML 1CFQB 4PV9B 3H42L 3RHWF 3O3AA 5EG6C 4ZNEE 2QADB 2E7MA 5D70H 4RFNC 1ADQL 3CLFH 1E28B 3SE9L 2VERN 1KTLA 4JFXA 1RZKC 1I1AB 2IBBA 5E4EB 3CXDL 3PABA 1KB9K 1OY3B 2XRAL 1CVSC 1EAJA 3O11B 1PG7L 2HJLB 3WO3B 3HRZA 3WKNA 5JW3H 3NCYS 1QPXA 3U9PH 3ULUE 3AXLA 2A6KA 1IKNC 1ZHKB 2L7UA 3ARBD 3HN3A 4QRSB 3SE4C 5LGKA 5IKCB 4W68A 2X9XA 3D0LA 5E2TH 3SDDB 1CT8A 2CLRB 3MLVL 3O0RL 4K23H 5CEXB 1IGTA 1JF5A 3MYJB 2J4WH 2CRYA 2XN9B 1ZA3A 5DRZB 5MEQA 2DYPD 4LSUH 1MLBA 4Z76B 5DC0A 3TYFB 2FYYB 4PJDB 3VRIA 1BPVA 1HQRB 4J6RL 2W9DL 1TQCC 3S9DB 1Z9SA 3X3GL 8FABB 3ILPA 2EDXA 4JFHD 3U0PB 1T89A 5CEYA 1RJZB 2P43B 4ZUUB 3FCTB 3FFCD 4LVHB 3BH8B 2UV3A 5BVJB 3GKWH 3RRQA 2ERJC 1T5XA 3KXFD 3ARBB 1RHHB 1P5VA 5IGXL 3WO4B 1EV2E 4RA3A 2ZOKB 3MLSL 4MAYA 5F9WC 3FB5A 3K4ZA 3WD5L 1FVCB 2DS4A 5J56B 1BLNA 2ZUQC 1BVZA 4OJFL 1ZHBA 1LHZA 2FB4H 2F54A 1OF2B 4PJHB 3UTQA 5CBAA 4CJ1A 2JCCB 5DHXB 5F44A 4HWZB 5LQBH 5IBTH 1ZK9A 4ONHA 5AZEH 2NX5A 1MCWM 1II4E 3HE6C 2HAZA 4QCIB 1U0QA 3LKQB 5IFHH 3OQ3B 1IGYB 4M48L 4PP2A 1GIGL 3CSYB 3O2VL 1HKLH 1TJGH 4I4WA 4OLVH 2I26N 3FFCB 4DJMA 1MHEA 5IOPA 1AGCA 1MCIA 1EA9C 2VLJE 4OM0L 2EO9A 3O2DL 3A0OA 3O3EB 1KOAA 2ICWJ 4HJ0D 5GJSL 3VWKC 4BSVA 2OJZL 4GW4B 2RFXB 2NY4D 4AIOA 3C8DA 4U3CA 4PRHE 3BGFC 1IC7L 5I71C 4HS3B 3WNOA 1JVKA 5B8CA 1GVIA 5T1LB 1EPFA 2C7UB 5HGDA 1BEYL 1FH5H 3GHEH 3CAFA 1FJ1A 2R0KH 3QDME 1N6QL 4GRWF 3C60A 1S7SA 3VJ6B 3HUJE 1FBIH 3F5WB 3DVIA 5IT2H 5SWSE 2BNRA 4Q6IC 2BVOB 2ZCLL 3NZHH 4DZBB 5C0DB 5TDOA 1BZ9A 2GTZB 5DLMH 5EIVA 1JHLH 2IH1B 1I3RB 1GC1C 2F58L 4P3DA 1ZVSB 3MXVL 3S8WA 3WKMH 3LAFA 5D1XD 3HKFA 3T09A 4Z7QE 4M43H 5BVPH 2NY5H 4HJJH 4PG9B 3DMMA 5HVHC 1BD2D 2NY4B 1LO0L 1B3JA 3KDMB 2R4SL 3MRLB 2LE9A 3G08A 3S37X 4M3JA 5L8JB 2AJZA 1JYWA 1NCWL 2NNAA 1WBZB 3E3QC 1JGEA 1I9IL 4MQXD 1RIUH 4NQCD 4RMVA 5FECA 2B2XL 3SDXA 3GSVA 4JFEA 1I7ZB 1Y18B 5DT1L 3VG0H 2BNQE 4XP1H 1S7QA 1A02N 4KV5E 4YXKL 5GQBA 4JREC 2OLDA 1UH3A 5D1XB 2DTMH 1CBVL 4XI5D 5E5MB 2ZKHL 3HRPA 1O7SA 2NXZC 5TDNA 5FB8B 1CDYA 4YPGA 4ZOAA 2EXYC 2WAHA 2A0LD 1JI1A 5HD8C 1BD2B 5AYUH 5IQ7L 3PV6B 1ZANH 5TFSL 2QSCL 3EZJB 3TO4B 4LEXH 3Q2CA 4JFYB 3DXAA 3CVIL 2A2QT 4F7TA 4RAVB 4NQCB 1OAUL 1QBAA 3PHSA 4CN4A 1H3PL 3KNBB 4NCC1 4WENB 3QNXA 1X5KA 3TFKD 1SJHA 1I1RA 1U8OA 4TPRH 5FF6B 1J8HE 1I9JH 4Z8FH 2BY0A 1HHKB 2ZG2A 3E6FA 3SE3A 2WZPD 1HHHA 5AWNH 3QQNA 1TVBA 5DGRA 2WLYA 1T1WB 2GSGA 4QRTA 4NHCH 3JZ7A 1BIIB 4OB5L 4ZQKB 3U9UB 4NKDB 2BMKA 5J6HB 4GRWH 5ICXA 1QQDB 1UWEL 2BXZA 3CXHJ 1OTSC 1I7TA 3AC0A 2X9YA 4F57H 2CK0H 4D9LL 3LKRB 5FDWA 2ICCA 3ZKMD 1NLBL 2NLJA 5IBLD 4JFPB 4MWFB 4LNRB 4ONGH 4JZJC 5TF1H 3HB3D 5D5ME 3K1KC 4N68A 2PW2A 4LARH 1WIUA 2XWBB 2X41A 1YY9D 4M61B 4C83A 1SVZA 2MTPA 2FJFB 4IOFD 4LHUA 5I2IB 1MNUL 4XPBL 3V6OE 2NY6D 2X10A 4HZLA 3LMJL 1B0GB 4KJWC 3DO7B 1A7BA 4KTEH 1KXVC 5D96C 1DUYB 3VGAB 3MRCB 1QFUL 3MRIA 1FVEB 3BESR 4LRIC 3FO2A 4JQIL 3CVHA 3T08A 2ORBH 5D9SB 1EERB 1WJ3A 4DTGL 4FNLL 1X7QA 3RIFF 1N2RB 4LSVL 2E9WA 5B38A 2W0KA 2EDOA 2V7HA 2Q8AL 5DHVB 4Y2OA 4ZUWA 5SX4H 3GSOB 3PWLA 3RIAK 1A6WL 3U7WL 1BZ7B 1VGEH 4LRNL 3HC0A 1RJYB 4ZOBA 2HT4D 4K94L 2XNAA 3DX7B 4K9EH 4M7LT 4BFIA 5HYSB 3N1GC 2MWCA 3E8UL 1KG0A 1MFCL 4YHNB 5A43C 2XY1A 4BSWB 2NY6B 4PJ9D 2EIBA 4R7NB 2IFFH 2UUDH 3CX5J 4PS4L 3WFEH 2BSRA 3DGGA 2FX9H 1YJDL 3EFFA 4GSDL 4OQ1A 1ZGLM 1A3RL 4X7TA 5K9JH 1MQKH 5DHYB 4E0RB 1MRDL 5GGQL 3FQRB 2M26A 4AEIH 2QQKH 4P5KB 4P3CH 4NKOA 4Z18A 4CNIA 4OLYL 4WI4A 4UI2A 3EOYG 1AHWA 5CZXC 4QHNA 2AERT 1VFOA 2AI0H 3GMMB 5JHDD 4D9RE 1OHQA 3SGDI 3W39A 5J12C 1NFDE 4U7MA 2EE9A 1XFPA 5F6IC 1MCCA 4B7LA 1OAYL 4QHUA 1NCBL 3BYYA 4HFWB 1LO4L 5CSBA 3BE1L 1U8JA 1AJ7H 1M7DB 4HUUB 4FFYH 4PTUB 1OP5K 4PJ9B 3ULUL 4OV5A 1UM4H 5SWSD 1F4AA 2AEQH 3GBMH 1R3KB 3JUZA 4OZFA 5IV2B 2P4AB 1RUAL 2LTQB 2YWZA 5BXFA 2BVPA 2BXYA 1RULL 1H15B 4XNYH 1M7IB 1N3NB 5GS0D 3N85L 1T1XA 4G5ZH 4HUXA 3EYOB 2KZ1B 3L3HA 5DVLA 1PW3A 4WDIA 2A74B 4R8WL 1A6UH 1ZS8B 2FZ3A 2VLJB 3BP6B 3OBAA 1LEKB 5LGHH 1LO3L 4TVSa 3ME0A 2O5ZH 2PYEE 3MOBL 3RVTD 3WJLC 1UB5A 3LRHA 3IFPA 4NQTA 5DQJA 1XGPA 2BFVL 2R1WA 1NEUA 4UV4L 3GSWA 3CFIC 3S36L 5AD0B 3QCUL 4ORZC 4LASH 4FQCH 4KKAD 1G7IB 5ESVB 1MI5E 1MJUL 2FECI 5SWSB 3MGTB 5HYJA 3QO1A 5DMKB 4LSDA 1U8KB 2ZUTA 1RIVL 1DUZB 3GI8L 1S9WB 1UWGH 3WHE1 3AS0A 3STZB 4OT1L 2W65B 1OARL 1J1PL 3QQ4B 4OZIF 2I9LB 3W2DL 4GRLC 1KIPB 1CFTB 1OSPL 3BI9X 5FUZL 2Z31D 5J7CC 2N7AA 1XIWA 4LPXA 3L3JB 2C3GA 4NQDE 3GI9H 4M62H 5D1ZC 4PLOB 3U4BH 1QNZH 3O6KH 3CC5A 3Q5OA 4S1SL 3ECBB 5CGYD 4YE4L 4MDIA 1JPGA 3A6OA 4I48B 3ZE1F 4WV1A 5L6YL 3VXSA 3RGVA 1NFIA 4LBEB 1TZIB 1R5VA 5JOPD 2EC9U 4X0KA 1FN4A 3BDYH 2GIYA 3V6ZB 1NCCH 4HS6A 2XT1B 4P9HC 5DJ2A 1UCBH 1BQLL 3S7GA 4BZ1H 4RMRA 1J0YA 2VDML 5DTFB 1AI1L 4D0BB 2OTPA 4U1NB 1ZWIB 3D5OF 4G9FE 4DKEL 4OV6F 3MR9A 4XTRC 5INDB 4L9LC 2C3WA 4KK9C 4A2MA 2Z31B 3G04B 4JFDD 1U91A 4FS0A 4HFUL 3LN5B 1N26A 1BVLB 5FXCH 3KJ4C 3WUWB 5GS0L 1MPAH 2DWEB 2W91A 4Z95L 4WEBL 2VIRA 3VGBA 3T3PF 4MAUL 3IXAB 5T1DH 1QFWL 5DMYA 5CP3H 1UB6B 3U46B 3ROLA 3GMQA 2FHCA 1QEWA 1A21A 1OPGH 1UH4A 1CG9A 4ODTH 1B2WH 4M5YL 1WVZA 4WUUD 3VH8A 5F7DB 1INQB 5EZIH 2VR4A 5J9PB 1FGNL 1S9YB 3MV9E 4HIIA 3VXTA 1YPZA 5EOQH 3GIZH 5HDQH 3I9GH 1DR9A 3NTCH 5DJDA 2JELH 2OK0L 5K9QI 5E1HB 4RBPK 4RWHA 3DSNA 3I50L 3MJ8A 4AG4L 1AXTH 5EU7E 4HZAA 5MEOA 4LCUA 4JFDB 1NAMH 1FCCA 4OIAA 3OKOA 4PJCF 3OAUH 4BZ2L 3C6LC 3KLDA 2GW5A 4F37F 5DSCA 2NY7L 5IMKA 3W9EA 1I9RH 3ZTJG 1BREA 5FYKE 3E2HC 5IFAH 2GEEA 1OL0A 3LS4H 4ZYKB 3WJJC 3SO3C 3VG9B 5D5MB 5GRVK 1HCVA 3L3IB 4WUUB 2A6IA 1EGJA 4LSRL 4DVRH 2F8XC 1JUFB 4ETYA 4JKPH 4FQIL 1IQWL 4JN1H 4FZ8H 5FKPB 3U6RA 1J5OL 3RL2A 3TZVD 1HHIA 1FV1B 5DD0H 3M17B 3CUPB 1P1ZB 3BT2H 2V2WB 3J7HA 3REWA 4CVZB 1U8LA 4BFGA 3P77A 5I0ZA 4FXKA 4G6JH 3GJEA 2H6PB 1V7ML 3BN9D 1NGWA 3TJHC 3S4SA 1IILE 1J88A 1L0XA 3VW3H 1NL0H 1BMGA 1UZ8A 2MKWA 3S35L 1KPRB 4BH8B 5CJQH 3CMOH 5HYFA 5EDXA 4OZHF 4KVCL 1DLHA 4N8VG 1C5CL 2ADGA 1MJ7H 1F58L 5DQ9A 2R9HD 2Y4SA 2Y6SC 3TA3A 4U6YB 3PIQA 1JFQL 3FRPG 1GGBL 5C9JB 1OM3L 1XH3A 4R26H 3WCYA 2X4RA 2ICEB 5M7QA 3QZWB 5DD3L 3TZVB 1ZLVH 2CQVA 3EYSH 3LDBC 4YGVA 2D2OA 3WIHH 5BQ7B 2A83A 5ID1B 3G5VB 3BEVA 2HN7B 1ORQB 2D9QB 3EYQC 1A6VL 4XVUD 5JNYA 5I1EH 5JZ7C 3VRJA 1MCNA 5CGTA 3DUUB 4RAUB 4K8RC 4LCIH 5EZOH 2NY3C 4NCDA 3OZ9H 1CGSH 4XNUH 1BQUA 4B41A 1RK1A 2BSSA 3IDGB 5FOJA 3G5ZA 4ODHL 4ZFZB 4YHOL 9CGTA 2K7PA 4M7KH 5HGBB 4DVBA 4ZFFB 2WIIA 1J10A 4JO3L 2I5YL 1XR8B 1NFDB 4HMCA 5L9DH 3MV7A 4HV8A 3WNKA 4Y5VC 1B6UA 4U6XA 1JWUA 2XKUA 1N64L 2Y5EA 5FUCE 1Z5LA 5J3HC 2VN4A 4H5SA 1B0RB 4G8IA 4PJAE 2YUVA 3QFJD 2YBRA 4GG6F 4KQ3L 4MA8L 3LHPH 4Q7DA 1HSAB 2NCMA 3O8XC 1QO3A 2YD5A 3KYOA 3GMOB 3VD7A 2HFTA 3TBWB 1GOHA 3VGFA 1EEYA 3RWGB 35C8L 5C0IB 4X4XB 2OSLA 5GRUH 4XMLH 1XCTB 1MAKA 5E2VH 3HAEA 4M7JL 2SEBA 3VXUE 3DX8B 3S36X 4AH2A 5HHXL 2HTKD 3BWUC 1CXIA 4NQDD 5DVMA 3X3FH 2XV6B 4CW1B 2FRGP 3UBXA 3GHBL 4XC3H 1EUTA 4NO3A 4OCLC 4F7EB 4UDUA 3U0TB 3RNQA 5EH1A 3LPGA 1JJUA 1MF2H 1VADB 3NPSC 3WLBB 2FR4B 2YOCA 1OGTA 3RZCA 3B8YA 4EQ2A 3M1BB 1EAPA 3D25A 3ES6A 1JNHB 4WO4C 1F2QA 5C0CE 4LP5A 2APTA 4JPIA 1OCWL 1TETL 1FAIL 3BGMA 1DQJB 3KHQA 1A4KA 3T0VA 1HXMB 3A6CL 5CD5C 1A7NL 4NJ9L 1IAOB 5JMRA 4Y5XA 2IGFL 1F6AB 5DWUH 4L8SB 1JRHI 4NN7B 3BZEA 3QNZB 3CIQA 2X4SB 3LIZL 1KCKA 2YSSA 4QHMB 1OQOA 4JO2L 3HNTL 4FTVA 1CCZA 3Q48A 4Z0XA 1VESA 2GAZA 4KRPC 3WS6A 4NQDB 4YXLL 3EIFA 5HBBA 1TIUA 1CLCA 2NY0C 3KHOA 1G7QB 1HH6B 1SY6L 3JWDC 4OLXH 3PGFL 4LLUA 1FO0B 2CR3A 1JE6A 3M8OH 4ONFL 2ZSWB 5BRZA 2C3HA 5HHOE 4XPTL 1NCUA 4RGMC 5KSAA 4V1DE 1A1NB 1KLUA 4R90H 4HJGA 2C1OB 1OP9A 5HJ3B 1NKRA 3GJFA 4GH7B 4PBWD 4KY1L 1JN6B 1RJLB 3P4MA 2F19L 5F21B 2ARJQ 4OAWA 4Q97A 2HFFA 4RGOL 3H9SA 1SM3H 1SBSH 1IC4L 4IRZL 1BAFL 4DWHA 1CL7I 1P4LB 1JNLH 1MLCA 4XCFH 5I1HL 2B1HL 4HXBH 4KRLB 1EHXA 5GGVY 4HWBL 5KVEL 4MCYB 1FDLL 1YC8A 1OW0C 1IMHC 4OFDA 4MNGB 3KJ6H 5JHLL 3OHXB 1ZE3C 3TO2B 5EBMA 3KYNB 4H26A 3MCLH 4F9PA 5BCAA 1G0DA 4Z7OF 5IK3A 4EXKA 3IFNL 2ZSVB 2LU7A 1R3HB 4LVEA 5D2NC 2H3NA 3BAEL 4JO1H 3BH9B 1I3UA 5TF0A 3LSOB 1UKSA 2ITCA 2HG5A 1AO7E 2FATL 2Y36H 1DVFA 4O02H 4XAKE 1FO0L 3VGHA 4F2MB 4PLKC 5IJVB 2CGRH 4RIRA 5DD6B 5SX5H 3QO0B 3QUMB 3VXRE 4BQ6A 1YMHB 2Y06L 5IVXE 2PCPB 4EUPG 2AXGB 5FO8A 1NCAH 5CJXC 3L7EA 1LMKA 1GRWA 4Q0XH 5BO1H 3SDCA 4C56D 1IARB 5HGHA 4L5FH 3FB7A 4MJ6B 1FPTL 2D0HA 3BFOA 5B3JE 4HQQL 3NACL 1MJ8H 4WW1A 5J1AB 1P7QA 2UWEA 3ARYA 5J57B 5I15H 1AGFA 4PTTA 5DMGD 1MHCA 2R2HB 2DKSA 12E8H 3C08L 4WHCA 4LLVA 1S7WB 1TJHL 5I8CB 3DRQB 1FZJA 3PJSA 4DFHA 4HUNB 3KYMB 1KJVB 2DLFH 4HX1A 3FKUS 4LGRB 1DBAL 1Y0LA 3K1DA 5GRJL 4Y19E 1YEDB 4LCCB 2IANE 1CS6A 4HKXB 3VGEA 3MBXL 3RX7A 1W72B 3BUYB 3WFHB 2HRLA 1RV6X 1ZHLB 3G5XB 3IF1A 4MD0B 4PRPD 4NQVB 1DQML 3D2UD 4XHQA 4XXDA 3A6BL 3FT2A 5FO9B 3IDXH 5F88A 3LRGA 3HZYA 3CSGA 4OCXL 4APQC 3WS3A 4TNVK 2VLLA 4RGND 4GMTH 3EJZD 1RIHL 4PJIE 3HFMH 1A1MA 1KCLA 4X7FC 3OSKA 4G8FB 2MQCA 1ITCA 3HPLB 5BZWB 3L3GA 2HVKB 4JY5H 4A6YL 1N6UA 4KROD 3MRBB 3NAAL 5C0BE 1JWMA 4IBLT 3H42H 5GISH 3V4PL 5E8DH 3L5XL 1AGBA 2BJMH 1ADQH 5FYKL 2HVJA 4TN9A 3LD8C 3RWEB 1K2DA 4L4VE 3WSQH 1KCSH 3V4VL 3S98A 5ALBH 3D39E 3QQ9D 1WSST 4K7PL 2GY5A 1T03H 3CXDH 4Y4KD 4FFZL 25C8L 2XRAH 8CGTA 3BN3B 5BW7A 4PRPB 4XMKL 1M7XA 3VDCA 1PG7H 5JIHA 3D2UB 5SWZE 5L2JA 5DDHB 5HDBE 3QHTC 5EBLA 5ID0B 3K2UH 4KHTL 1X6LA 1DEDA 4KK5D 4P9ML 1M05B 4JDVA 4NPYB 1NUGA 1FRGL 4RGNB 1W72L 4P5TD 3VXUD 5GS1A 2ESVA 3U0WL 3MLVH 5E8PA 3O0RH 1F6FB 2X89D 5KJRL 2R23A 5CUSL 1K8DA 3SQOL 5KZCD 2FJGA 4O5LH 3VFNA 5IB5A 5D7JA 4YDIL 4O2FA 2OL3B 4NO0D 5FM4A 4DEPC 4J6RH 1S7RB 2W9DH 5ACZB 1QFOA 5D7IE 1G0XA 2WLZA 3LV3A 3MO1B 4GXVH 3X3GH 4PJAB 1MWAA 1T0NA 4GMSH 1AR1C 3KR3L 4Y8AA 5C0CD 3HE7C 4OZHA 4Y4KB 1YMME 4HIHA 3BD4A 3RL1A 4PJBA 4AQOA 3MNVA 5KN5B 5GHWL 2VDKL 4TSBL 3CFEA 2NY1C 3U30B 2HKHL 5TDPB 1VDGA 2FEEL 4FQHA 2Q20A 3ARDA 5KAQG 4DGVL 3PHQB 4HD9A 4P5TB 4JDZB 3VXUB 4PRBB 1IGFL 1GZQB 3R8QA 2NZ9D 1QSEE 5EC2A 2Q76B 4UDTA 3RVVC 3MJ9L 5KS9E 4QY8B 5KZCB 1WFTA 1WF5A 1KELH 2CRMA 1T1ZB 3MJ7B 4NO0B 2FH6A 4OZGF 2WV3A 3PNWB 2ICWA 4EOWH 5HHOD 1VCAA 4TOYH 4FABH 1CD8A 4M48H 3Q6GH 1GIGH 4O9HH 5DVOA 2VQ1B 5C0CB 4YDLB 4XBPA 2OL3L 1QD0A 4PRAA 4JGUA 4LSQH 1T04A 4HGKC 3ZSTA 2EZ0C 5GGVL 2QQLL 5IESL 3T4AB 3OJ2C 1G7LB 1D5BA 3CFKB 5CLTA 2PW1B 1KENL 3T77A 4GBXC 1I8MB 2OJZH 4GG6A 2HWZL 2GKIA 2GJJA 4U1MB 4ZFOA 3NCJH 2APFA 5JDSA 3P4OB 3TCLB 1YEEL 2VNCA 4U6VL 2YPVL 1BEYH 3BGAA 3B9AA 2HRPH 1EFXD 3V7AG 4WW2A 2H32A 1MFDH 1U93A 1A6AB 5C6WH 4JJHA 4F7MB 4JM2F 4MA3A 5E8OB 3FT4A 1YEHL 4LSPH 2ZCLH 1CFSA 4BH7A 5C0RL 3DX6B 3EDDA 1FL5B 3DV6A 4LPYA 1YYML 4DUXA 5HHOB 1T21A 4LDLB 4I3RL 4MNQE 2MFNA 4NNXA 1G7HB 1WEJH 4EIGB 1MVFA 3FB6B 1AO7D 2EYSA 1FC2D 2R2EB 4HUMB 3UDWA 2P47B 2DQEL 4QXWA 1FZKA 1XGQA 3F7VB 2IQ9L 4I8DA 1G7PA 3F8UB 5A2JH 2P8PB 2EEBA 1JZ3A 1PYWB 4PRDB 3GM0A 2K3TA 4POZC 3VWJC 3FZUC 5E24E 3UZQA 4GW1A 3RKPA 1BVKB 1CGYA 1DQDL 2D4FA 1NCWH 4N5UA 4XVJL 1JBJA 1EFXB 1I9IH 3MRFA 4MJ4A 1C16B 3NCMA 4WWKC 2OI9B 3E6HB 4H88H 5E6IC 32C2A 1YECL 3W82A 3OJVC 1ZT1B 1XGUB 2E27L 4YXKH 5HYEA 1WFOA 3QI9A 1J05B 4WI3A 1T5WB 3ZHLA 4Q74A 1MEXL 2CKNA 4F7CA 4JRXE 1VFBB 5D7LA 1JPST 1CBVH 2DQUL 1AO7B 4Y1AE 5HGGS 3RZWA 4LPTA 4X6BB 1AP2B 5KVDH 3IDUA 3KLHC 3IDIB 3UJJL 1I7RA 3BP5A 4G7YL 5HPOA 4IIQA 4TUOB 3L3OA 2EDFA 5BJTA 5FUOL 2WQ8A 2MCG1 5I8EA 4X5WA 5LKNA 2B5IB 3QCTL 5TFSH 2QSCH 3X14A 1PD6A 4UNUA 2CDFA 5DC4B 1EXUB 1A3LH 4Y0GA 2QJDA 3BUTA 1NJ9B 3CVIH 1K6QL 1CD1B 2VZTA 2RCSL 2X70A 2A1WL 1SMOA 1NGZB 4PBXA 3VD3A 1NANI 1NUFA 3IETB 2FGWL 4Z5RB 3ZYOA 1H3PH 1NCTA 2CMRL 3UMTA 4F33B 2V5SA 1B6DA 4I18A 4PY7A 5LJYH 2ATKA 5C0BD 1MIML 4RFNB 3FTGB 1KCUL 1YEIL 2BHUA 3SJVA 4J4PC 4MB4A 4WHTB 3X12A 5I76B 3WFBL 4Y19B 4XB7A 5GGTL 3CFBA 3JV6B 3QIBC 4L4VD 2IANB 4ODUA 1MRFL 3ARVA 4L4TE 4NQEE 3D39D 4XRCB 4HLZH 5IG7B 3ULUF 2V6HA 5C8JA 2CDGA 3VFSB 2VL4A 5ADPL 4PJFE 2BSED 3RJDA 3GIVA 5CZVH 4NQSB 1WC7B 4C4KO 3QUXA 3EO1A 1KTDB 3RX5A 1BWMA 2WBJA 1PQZB 3FB8A 4ZFGH 5E7FA 3GNMH 1UT9A 4PJIB 1KJMA 3OMZA 5INCA 5TE6L 2ZWLT 4L3AA 3QUZC 3NGBC 1L6ZA 1IFHH 3TIEA 5D8JH 1S9KC 2ZCHL 5I66B 2X4UB 4CU8A 5HDLA 5EFIB 4HIJA 4JZOA 2RQ8A 3HE6D 1TQCB 5C0BB 4QYOB 1A6TB 1XF1A 4LU5L 3VMOA 1CFQA 4OCWL 4XCNB 4PV9A 3KLAB 4L4VB 2JF1A 5KSBB 5DFWH 5EA0L 1U8QB 2M8XA 4DTGH 5FM5M 2P7TB 3D39B 1E28A 3O2WL 5I1LB 4Y16B 3VFUB 2G2RB 2VLMD 3WNLA 3MRNA 4LLAA 1I1AA 2ERJB 2Q8AH 4Z77A 5SWZB 5AAWA 4MQSB 3VWKD 4EI5C 1RZKL 2YR3A 2V5RA 2HJLA 2MNUA 5F9WB 1EEZB 3UPAA 1BGXH 1T3FB 2ZUQB 5FGRA 1ZHKA 4QRSA 4K94H 4P46C 1I3GH 4NO5B 2FX8L 1QSED 3MZGB 3T1FB 2CLRA 4ZSOB 3FN0L 4UINH 3IFOB 2X4NB 5CEXA 1V7NL 1UFUA 2EIDA 3MYJA 3LS5L 1H3TA 5CCKH 3HE6B 1Q9LA 4P2QE 5DRZA 3HR6A 2XA8H 1IAKB 4Z76A 3TYFA 1CXKA 5CEZL 2FYYA 3O6MH 4PJDA 4HWEH 5D7KD 1HQRA 3QISA 4G3YH 4J12A 2BVEA 5LBSL 3O2DA 1A3RH 1MCKA 1G6RB 3K7UA 4QXGL 3IXTB 2ZUXA 4QXUL 5GGQH 3FMGH 3BQUC 4ZODA 8FABA 1YMMB 3O4LE 1CR9L 2OMNA 3U0PA 4PJ5D 1RJZA 3LQAL