2BOCC

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2bocC00
3RBZA 5KUKA 3K0DA 2H8PC 3AG3C 2WLLB 4QE7A 2WLMA 4JTAB 1OCRC 2Q67A 3PJSK 1J95A 1M56C 1XL6A 3IGAC 1KKDA 5EC1C 4MVOA 4PA7A 3RVZA 1QLEC 3T4DA 2EIJC 3STLC 4PDRA 4WFHA 4P2ZA 2EILC 3RW0A 3OR6C 3LDCA 5B1BC 5B3SC 3ABLC 1ZWIC 2DYSC 3ABMC 3LUTB 3FB7C 2X6BA 2ITDC 3SYQA 5EBLC 4EKWA 2JK5C 3VOUA 2WLKA 3ABKC 4MW8A 4PA3A 2WLJA 4J9YB 4F4LA 2QTOA 3STZC 3TCUA 4MSWC 5CBFA 4MVRA 2WLIA 1ORQC 4KFMA 4R8CA 1R3IC 2WLNA 3BEHA 3E8GA 2Q68A 4QNHB 4ZBMA 4H37A 3X2QC 5B1AC 2EIKC 1K4CC 4PDMA 2BOCC 4I9WA 2W0FC 4LBEC 3AG1C 3T4ZA 4G28B 5EK0A 2AHYA 2IH3C 2HJFC 3GB7C 1S5HC 4R7CA 3RVYA 5BZBA 3SPIA 5EBWC 3LDEA 3E8HA 2A0LA 2DWEC 2ZD9A 1V54C 2QKSA 4MVSA 5EBMC 1G4YB 2IH1C 2WLIB 3FB5C 3OR7C 4JTCB 1LNQA 3TETA 1BL8A 4HYOA 2AHZA 3HPLC 3SPGA 5CBGA 3K08A 3SYPA 4H33A 4OXSA 1XL4A 2DWDC 3K06A 4R6ZA 3F7YC 3JYCA 4P30A 4GX2A 5KUMA 2HG5C 3F5WC 4XDLA 4MW3A 3SYOA 1M57C 3SJQC 4PDVA 4P9PA 4GX0A 3SPJA 3EFFK 3FB8C 3IFXA 4UUJC 3SYCA 3UKMA 2ZXWC 4MVUA 3LNMB 4MS2A 3E83A 2WLLA 4PA4A 2ITCC 4GX5A 3SYAA 2K1EA 2NLJC 1R3LC 3AG4C 3LDDA 5CBHA 2X6AA 2A79B 3ASNC 3F7VC 3WG7C 2DYRC 2YEVA 4GX1A 4MTFA 4JTDB 3E89A 4X89A 4DXWA 4RUFA 4WFGA 4WFEA 2Q69A 1K4DC 4RAIA 5J9PC 1R3KC 3KG2A 2HVKC 4RUEA 4CBCA 4MVMA 1OCCC 2OCCC 2P7TC 1V55C 3K0GA 2KB1A 2EIMC 3OGCC 2X6CA 1JVMA 3ASOC 3K04A 4QE9A 3T2MA 3T1CA 2WLHA 3AG2C 3OUSA 2BOBC 3R65A 4G27B 4PDLA 4XDJA 5E1AC 4LP8A 4P9OA 1OCOC 4RO2A 4R50A 4X88A 3ZJZA 2R9RB 3E86A 4PA6A 3E8FA 4J9ZB 1P7BA 4MTGA 4TWKA 2A9HA 5IY5C 4X8AA 3UM7A 4LCUC 1OCZC 2Y69C 3OUFA 4PA9A 2HFEC 4MTOA 4WFFA 3E8BA 3SPHA 3K03A 2EINC 2Q6AA 1R3JC 3SPCA 4BW5A 4MVQA 5EC2C 2ATKC 4XDKA 3ZRSA 2HVJC 4MVZA 4HZ3A 3FB6C
chains in the Genus database with same CATH superfamily
1KKCA 1QR9A 2RN9A 3JD0A 3RT3C 1XL6A 4FM2A 5GW7A 4MVOA 4PA7A 1H2MA 1DF4A 1YDXA 1G1XB 4LWSA 4R8CA 2BE3A 1R3IC 1WLEA 3JASB 2ZKOA 3P30A 2OIGA 1NR1A 3AG1C 4R7CA 2Y0IA 1JJ2U 1SKVA 3E8HA 3AEIA 3ABTA 1QBZA 2YSUB 2LJ2A 3FFQA 3O9OA 1VQMV 1MNGA 1H2SB 5DEDA 3W7SA 1PL0A 3F5WC 1SESA 4DV3O 2Z3YA 5ITZA 5LMNO 4O2BB 3UKMA 2C2AA 3LNMB 2ZE8A 2E5LB 4CC5A 4H0LB 3W7UA 2QSAA 1I0HA 1MSWD 2IM9A 3E89A 4X89A 3WB2A 1H8HG 1MA1A 4DR5B 1W59A 2HHHB 3ETQA 4TV8A 1QLNA 1Z5WA 5GONB 1N36B 4FFBA 4QJFB 1NQTA 1JR9A 1NTKH 4FLYA 4X20B 4JV5B 1OCOC 3P3PA 1NS1A 3E8FA 1L1FA 2UUBB 4TSFG 5EYPA 5B5EZ 4GKKO 1PP9H 5H5NA 5KAFZ 2DYSB 4DUYO 4WBNA 3SPCA 3G67A 2ZE6A 2PGGA 4XDKA 1YITV 2QWRB 3BVOA 1NKDA 1MMMA 4DR6B 1FXVA 1VP7A 1IBMO 4JI1O 1R73A 1GH6A 1I08A 4GKJB 1SQXH 2IJHA 2EZOA 3EHBB 1NVPD 3RYCB 1AJNA 1QVFU 4JF3A 2XAHA 2AHYA 3GB7C 1S5HC 4JYBA 3L71H 4DR4O 2O57A 3BY6A 4K0KB 1WPBA 1GN2A 1XMOB 3RYHA 2E74B 2XAQA 2OTLV 4JI4O 5JJEB 1KQSU 5J2UB 4GX2A 1H2NA 3SYCA 1VQ8V 2QM4A 4I0XA 3A0RA 3SYAA 2ZNIA 4LF7O 5CBHA 4W4KA 3CEIA 1L0LH 4DRXA 1SS3A 3ZS8C 4O4JB 4DR2B 1UFIA 1IURA 1XILA 5E79Z 1OV9A 4UFZA 2ODMA 4CBCA 1OCCC 5CB4A 1V55C 4YJ2B 3T1YO 1PKXA 2BSKB 3J81N 2ILMA 3GVMA 2UXCO 4O4JA 3OMIB 5J2UA 1SQVH 3DGEA 2HKOA 2XT9A 4IIJA 4MTOA 1AP6A 4DK0A 1VMGA 2JS5A 3ABMB 3CE2A 1EZVH 1KU9A 3TXQA 2JIZG 4LH6A 1K92A 5IYZA 2UXDB 4LF9O 1M56C 4JAUA 4DV2O 3H1KH 5A2QN 2HR3A 3A0HZ 3JATB 1L8DA 1W0JG 3CCQV 3P32A 3KZIZ 4UB8Z 3BA9A 1G6UA 3AG7A 3HKCA 3APQA 3TXSA 3G4SV 2YIAA 1IBLB 3SDLA 3X2QC 2JDIG 2QWOB 4X62B 1OCCB 1YI2V 2XTAA 4DR3O 5LGUA 5KMGB 4LF8O 1M57B 1CEZA 2A7WA 4CH4A 3ZMUA 2IJKA 1N34O 1ZLZA 1GRJA 3TETA 4TV9A 4HYOA 4DR1O 2EULA 4FLZA 3C3SA 1AJPA 1WB7A 1WA8B 4RWUA 2FL4A 5KUMA 4DR4B 4B3MO 4XDLA 4ZOLB 5H2FZ 3CC7V 3QO7A 4B3MB 1EFRG 1P49A 2KQXA 2WLLA 1FXKC 4KL1A 5H6QA 3OGIB 4Z1MG 2YEVA 5KHJA 3BPZA 3K5NA 3ZHQA 1GO3F 3OMNB 4RUEA 3OTFA 4LNUA 3D3IA 2UU9O 2QWQB 3B8NA 4I0XB 4X62O 1QNMA 4L87A 4FK5C 4PDLA 5HFLA 1Q8IA 4DR6O 3I56V 2XNDG 4PA6A 1YCIA 4D6TH 1AB3A 4LCUC 1NTMH 3Q4HB 1K5SA 2EINC 1SF9A 3HKEA 4MTXA 1BT8A 3ZIAG 3ZRXA 4DV7B 1J5EO 3THOA 3OT7A 1Q43A 4DV2B 2QWNB 2V4DA 3RWRD 3KCXA 2CE4A 4DV1B 1J95A 1RM1C 2VQEO 1GAXA 1XOUA 2ADQB 3JARA 3QTCA 4LFCB 1MOFA 1Y66A 4B7KA 4JI7B 5LOVA 2ZQMA 1Y76B 4O2AB 2P90A 5LL6Y 3K5OA 5LP6B 2JGDB 2BSKA 5FLXN 3CWBH 1V9PA 2CUGA 2CTRA 3AK3A 2YC0A 1PPJH 4CS2A 4X1IA 3N2KB 2QE7G 3TK1A 1TUBB 2DN9A 5H6RA 1VQLV 1O9GA 2ZD9A 2PUSA 5JQGA 1XBLA 2P6JA 3CPWU 4PV1B 4LFAB 2CTQA 3WU2Z 3JAWA 1BS3A 4PDVA 4X64O 3FB8C 2HJDA 2W6JG 3HKDA 1DF5A 2CDYA 1D2DA 3UO2A 3RYCA 3AG4C 3EVKA 3AG2B 1URFA 2OCHA 4LH7A 5CN0A 4DXWA 4WFEA 3H9VA 3FKSG 3DXRB 3JALB 3CSXA 3KG2A 3OTOO 4TQDA 5LHGA 3AK1A 1AILA 2LFSA 1AJQA 5BR8B 3K04A 3JAKB 1SQPH 2VRZA 1W2BU 3ZJZA 1F4MA 3RYHB 3OEHG 2JS3A 1WN7A 1B04A 3U10A 2EILB 4K3AA 3UCSC 1B3QA 1GKFA 1Q90D 2F95B 4UCOA 1TA8A 4FM1A 2P4VA 1K5QA 3CMEV 3K59A 3MAQA 2D3OW 2AZ2A 2IW5A 3TJTA 1SQBH 2Q7EA 1OHHG 1XEQA 3ABLC 5C8YB 3RN4A 1FFXB 4DR7B 1YJWV 2UUAB 1GMGA 2QJ1A 4KFMA 1K97A 1RP3B 5KX5B 4G28B 4E2LA 2E3CA 5ITZB 4JAVA 3X2QB 5BZBA 2YI9A 2A0LA 1FFTB 4NXMO 3T1HB 2QWPB 3A0BZ 5IJ9B 5C93A 5CA0A 2IH1C 3HKEB 1KBHA 4X1KA 2LQTA 2AW9A 2AHZA 5K1XA 1RSOA 3BCCH 4DV1O 1QVGU 4DK1A 1IVSA 2WPDG 5LMNB 4MW3A 4WFBV 5BR8O 1BQZA 4FMTA 4JPRA 1NVPB 5KHGA 4MVUA 4X1YB 1CPYA 1Q6UA 2GDSA 4YIOA 4RQEA 1DGSA 4X65O 4OX9O 2RCVA 2QR4A 1TGOA 1HNWO 2IU3A 2Q8VA 2AXTZ 3CXHF 4NTYA 2HEPA 4DR3B 2UU9B 3ASOC 5LHIA 2Q4PA 5EIBD 3FAVA 3R65A 1HNWB 3N2GB 4X88A 3ZHSA 1IBLO 5B1OA 4NR1A 1VARA 3ABUA 4X8AA 2Y69C 3JSNA 4WBNB 2GV9A 5JJJB 5L3EA 3E22B 3QO5A 4B3TB 1W0KG 4HBNA 3ZRSA 3DC5A 1VQ6V 3ZBHA 3M7MX 1OCRC 1ZAUA 4D7TA 5EC1C 2UUCB 2EIKB 1HDJA 3ZHTA 2KKWA 4IHJB 4WFHA 4J7JA 3RW0A 1Q7YW 5B3SC 1ZWIC 5C8YA 4RQFA 1JX9A 4F6EA 3BA8A 3VOUA 4JYAO 1PD3A 1L0NH 2F23A 4UXNA 4J7KA 2VQEB 2E5LO 3FX7A 2LP7A 3JD1A 4LBEC 4JI8O 2B1GA 2ZE7A 4I9QA 1V55B 3JD3A 3ASOB 4MVSA 4X9QA 1YTFB 4XBFA 2BTQB 4JZ2A 4FLUA 2JGUA 3CX5F 3SPGA 1VF7A 1BSMA 5CBGA 4E4EA 4PI0A 1TUEB 2ZXWB 3JYCA 1YEWA 4I50A 4UUJC 3I55V 1BMFG 2A3QA 4JYYA 2EJ7A 3CRRA 1BZKA 2W0XA 2Y48A 4OPAA 5JH7B 1M56B 2NLJC 1KD1W 5BXZA 5LP6A 4FLXA 4ZHQA 2XASA 1AI6A 5B3SB 4JI6B 1RFYA 1OZ0A 2OCCC 1U97A 4W4LA 3JAWB 3ZMVA 2KB1A 2EIMC 4QE9A 3ETDA 3D8CA 5GTIZ 1XQ8A 3FAVB 1T5EA 2D2CB 3CCEV 2EZPA 4FPPA 2ZDIA 4J9ZB 5EYPB 2A9HA 4JZGA 3ZRWA 2R9IA 2Y4UA 4LR3A 4O4IA 1IXBA 2IU0A 4X64B 4ZIBA 4F4LA 4QPJA 3RBZA 5JJNB 3GWKC 2Q67A 2PY5A 1EBOA 4I4TB 1YIJV 1JPXA 1KYOF 1Q82W 4GYCB 1Q6IA 4LFAO 1JJOA 2L35A 2DYSC 3ETEA 4UVBA 4DV5O 4EKWA 3D3QA 3B09A 4J9YB 5IE9A 4MSWC 4O4LB 4EB6A 3OW2U 1ORQC 4DV6B 2QEXV 5D5PA 5KHKA 1I7FA 4PELA 4GZRB 4JI0O 1FJGO 2Q5ZA 3SPIA 4ZOLA 3W7TA 4LF6B 4YJ3A 2DWEC 1VF6A 4X1KB 3WB0A 4C7UA 1ROPA 1G4YB 5JQGB 3VBBA 4F6RB 4DV0B 5K1PA 1JFFB 2QTSA 3RGBA 5AG2A 5KA5A 2YEVB 3N2KA 1VF6C 3MHSC 4DYLA 3CD6V 4YJ2A 2R72A 1NH2D 2FYUH 3NR7A 1KECA 2UXBB 4DUYB 1VQNV 5B66Z 2DW4A 4EEQA 3ZX6A 5KHHA 1AVMA 3CS5A 1XMQB 1JQ0A 2H3OA 4MVMA 2P22C 1H2GA 1US6A 3VQYA 5KAIZ 4X20A 1FD9A 1IDSA 1TAEA 4GT1A 1S72V 1Y74B 2F93B 5LP6C 1OCZC 1I94B 4JI2B 2HFEC 3E35A 3JALA 3CCUV 4I50B 2HVJC 3DXRA 4BIOA 2L6LA 4PDRA 1KP2A 2KSDA 3ABMC 1BQ0A 2F1MA 1K8AW 1QR8A 3E22A 4MW8A 2WLJA 1M5IA 3AG4B 1P4RA 4TUYB 1WPXA 4DRXB 1YJ9V 4K35A 4HNAA 2DQ3A 1QHTA 1AR5A 1S76D 2YIBD 3B77A 3EXAA 5EK0A 1H2KA 3ZCCA 2IH3C 2QKAA 1SRYA 5LMUB 2ARHA 2N74A 3ZHRA 4HNAB 4JYCA 3K9SA 4BAYA 3JD2A 2F4VB 2PTMA 2JRIA 5DM6V 1MABG 2V1DA 3AG3B 2WAMA 2DE0X 1AR1B 4D7SA 3SJQC 3EFFK 3KKYA 3K9AA 2ZXWC 4MS2A 4PA4A 1XNRB 3LDDA 4DV6O 1SQGA 2YI8A 3J7AU 4B3RB 1Z2GA 2A79B 3JATA 2Q7HA 4DR7O 4X66O 2HVKC 1R6KA 5IJ9A 2P7TC 4YY3O 3E2EA 3K0GA 3OGCC 4BWAA 1UJWB 4BIZA 1XDCA 1B6QA 1ZSPA 4CH6A 4XDJA 2DYRB 2ZCEA 5CA1A 2YUAA 2YXYA 2K9PA 4B3RO 2EBOA 4CS3A 4LF7B 3CCSV 2DJVA 1S77D 3K03A 2Y4TA 4WCEV 3BHPA 4LF6O 3IC9A 4LF5B 2V7QG 3W7XA 3AG3C 3GWOA 4JTAB 4DUZB 2QGNA 5KLVH 1SZTA 2R70A 3PN1A 2P5OA 3S3XA 2RQ6A 1FFXA 2YDEA 3LDCA 3OFNG 4JI6O 2JK5C 4N23A 1RPRA 3ABKC 4TV9B 5LMUO 4I5SA 2CGOA 4UV8A 1VQ5V 3BFRA 3JSLA 2F43G 2WSSG 2XAJA 3CCVV 1VQPV 1YVWA 5CA1B 4YHHB 1GN6A 4QIWF 1TUBA 5J2TB 4FLWA 1XNQB 2P4KA 2RNBA 4TV8B 1XMQO 2LGWA 4B3SB 1Q86W 4FLTA 1SQFA 4X65B 4J80A 5JVDB 4Q20A 2ZM6B 1EM1A 1PNLA 3SJAC 2M7WA 4G2KA 3JARB 2YIBA 4O2BA 2XHBA 4UB6Z 5IYCO 4JI8B 3CHXA 4JI5B 5IYZB 4IGGA 2ITCC 4BR6A 4NTWA 3ZHUA 4K8XA 3L73H 1BHBA 1S0VA 4RAIA 4A5UB 1IBKO 4JYAB 4LWSB 3T1HO 1YTFD 1GM7A 1N4CA 2XAFA 4JGSA 1VQ9V 4NTXA 4NXNB 1AI4A 3T2MA 2Q73A 3AG2C 4G27B 5BY1A 4P9OA 3VQVA 4DR5O 2Q7GA 4MTGA 1TVKB 4PI2A 4PA9A 2UXBO 4BW5A 3B4SA 2ADPA 4MVZA 1HNXB 4UVCA 5KUKA 1OCOB 2H8PC 5KA6A 4JI3B 2DOSA 3JAMN 2N05A 2WLKA 4PA3A 5GTHZ 2QTOA 3CB2A 1KP3A 2FKXA 1FXHA 4CH3A 3R66A 4ZBMA 1NJIW 3CMAV 3CCLV 1NZ6A 1WNSA 1NT2B 3LDEA 1HNZO 4JASA 1V54C 1U96A 3K57A 3FB5C 2JEUA 1UPGA 2EIMB 3K5MA 1LUVA 1HWYA 5BMVA 5HFMA 4OXSA 2RMKB 1XL4A 4DUZO 1Q3EA 5IWAB 1KC8W 2BTOA 5H9CA 3JCUZ 4LNUB 4IL6Z 4GX0A 3IFXA 1MZEA 2ETNA 4J41A 2K1EA 4IYHA 2EINB 1BE3H 1PL4A 4GX1A 2YXHA 3G6BA 2FB5A 4IIJB 1VQOV 3CP1A 3SR2C 1R6NA 4I55A 5IYDO 4NB5A 1HR0B 4YJ3B 2OYQA 4DW0A 1F4NA 2BOBC 4LP8A 2R9RB 4TWKA 1N0JA 3C3TA 2PI4A 1N32B 3M99B 1Y76A 4O2AA 4WFFA 3E8BA 2Q6AA 5LXTA 2CAZC 3CC4V 4JI0B 1FJGB 2UXCB 3CC2V 2CH7B 4AQYO 1GK9A 4FFBB 1XUQA 4PJ0Z 2ZIOA 1PNMA 1CXZB 1ZL8B 4FVMA 4NYKA 2F4VO 4P2ZA 4B3TO 3TGUH 3LUTB 2QA4V 4GCZA 4DV5B 3FYIB 4FLVA 4UCVA 5CBFA 1WP7A 3IC7A 3BEHA 4QNHB 3UT5B 4H37A 1K73W 2EIKC 2QKCA 3IJ4A 1XREA 4PDMA 4QGPA 5JCOC 3T4ZA 1IZ3A 1V54B 4CS4A 1F7YA 3OAAG 2Z5UA 2IBZH 1QU7A 3JD4A 3JASA 4H44B 2XOKG 4N21A 1P7GA 1FXKB 1OJHA 3K08A 2DWDC 1JCHA 4GUNA 1PM9A 1K7DA 3SYOA 5EIBC 1GN4A 1M57C 2A06H 5IJ0A 2YIDA 2YXLA 3SJBC 2QM8A 1Y6XA 4UCRA 3H1HH 2CK3G 3HKBB 1ZUQA 3CCMV 4WF9V 1SERA 1R3LC 5FPOA 2LFRA 3H01A 4JTDB 2B9ZA 1VIBA 4K8ZA 1SA0B 4KHPB 3A2FA 3BRCA 1X59A 3G6EV 4LFCO 4LFBB 4Q6GA 2LO1A 1N33B 2HP8A 2JGDA 3T1CA 2WLHA 4TUYA 2YICA 3SGIA 1FXKA 4PD4F 1N0NA 3L74H 2Y0PA 1RM1B 1JA8A 4OX9B 5BMVB 1ZX3A 5F2VO 1BHAA 1FKAO 4KXRA 5A9GA 2BTQA 1R1BA 2ZIMA 3ZMTA 2QM7A 2NNUA 4KP4A 4UCSA 2WLMA 2EX3A 4U3FH 1KKDA 3RVZA 1SQQH 3OR6C 2OWOA 1HW7A 2ITDC 1G8MA 1LR1A 4KHPO 4JAAA 2UUCO 5TISZ 3K5LA 2WLNA 3E8GA 5FNVB 4JI5O 2BOCC 5LXTB 1VQ7V 2OIEA 3OTOB 5FPRA 1M1KW 3LSQA 2E75B 2WA4A 3CCJV 4AILC 2Q9LA 3LSUA 4DR2O 2KG7B 1EN6A 2GTSA 2XUMA 1QCEA 4IT5A 3WB1A 3K06A 4ICGA 3F7YC 2VWJA 4I55B 1D5NA 3APOA 1RPOA 4YHHO 5IWAO 1GTOA 4YIPA 3WFVA 3UT5A 1VQ4V 4O4HA 4WFAV 1BGYH 3ASNC 1YSCA 3F7VC 4JI4B 4ABMA 1YHQV 2OT5A 1SC5B 3OD4A 4TOIA 5B1AB 3B40A 2AZ0A 5LYJB 4B08A 4UCUA 1THZA 1HNZB 3ICXA 5KHIA 4HAMA 3ZRVA 1IXMA 4DV4B 5GONA 2UXXA 3CXCU 4FZ0A 1XI1A 3RFRA 4R50A 5KX5A 2JJ1G 2ZT9B 2B1IA 2M6YA 2JJ2G 3QG5A 2GHYA 3AK2A 5LYJA 4GLXA 2IJJA 2B5UA 3N27A 2YS8A 3I5DA 2PYLA 3UO3A 2ZR2A 4MVQA 5EC2C 4O4HB 4CC6A 3K0DA 1F51A 2WLLB 4IYIA 2CGNA 4Z2WA 3IGAC 1Q81W 3M8AA 4YY3B 1WA8A 2EILC 4CH5A 2AGAA 2GSMB 3CJHA 2GUZA 2ZR3A 3HKBA 4EFBA 1H8EG 1R6TA 2WLIA 4JV5O 1FPOA 2RDCA 1MZFA 1YXBA 3ABLB 2DQ0A 5IY5B 1N36O 4BIUA 3JAKA 2JEXA 2DMXA 3UQ8A 1DTOA 4TQFA 4AHCA 3ZN1A 5JH7A 1K3EA 1LNQA 4FJCC 1E1RG 1BL8A 1F23A 2VWKA 4J10A 3ZMZA 2IJIA 5FL7G 5LHHA 3RYFA 2WA3A 4ZKIA 3T1YB 1J5EB 4P9PA 1IX9A 3NXSA 1RSOB 2N04A 3AG1B 2W6IG 5CMUA 4ZI7A 4GKJO 1N34B 1E79G 1I5XA 1Q5OA 1GN3A 3CJHB 3WG7B 2QDOA 2ZINA 3ZN0A 3U11A 3LNNA 4BW9A 3MDSA 4QPKA 4LFBO 1WJZA 2MW2B 3A8TA 2WWWA 3ZHVA 2FTKA 1DLBA 3RYIA 2MK3A 1NBMG 4OPHA 2BCCH 5D5QA 5IY5C 4U7OA 5DECA 1YJNV 1SA0A 4UCTA 2OTJV 3K79A 5LOVB 1R3JC 3L75H 1Z5VA 1A32A 2ATKC 3W7WA 3CRAA 4LF9B 1NTZH 3N2GA 3PJSK 5B1BB 1VQKV 3LSSA 4LF5O 2LGQA 2Y69B 1QLEC 3T4DA 3STLC 4ZI7B 1FYJA 2LW1A 2X6BA 1EN4A 1PNKA 2EIJB 3B2EE 5KMGA 2P67A 1N32O 1JMKC 4LC1A 5LA6A 4JI1B 3TCUA 5DN6G 2X7RB 3QF7A 1QQCA 4I9WA 5B1NA 1N8RW 1Q6HA 4DV7O 2X0LA 5EBWC 4YXWG 3ABKB 5EBMC 5LGTA 1LUWA 5LBQA 5L3BA 3OR7C 4GKKB 1K34A 3L9DA 1K9MW 1CP9A 2F66C 3CRMA 3ZRWB 4I4TA 1ZTEA 3FYEB 1Y74A 3G71V 4P30A 1ZL8A 2HG5C 4AQYB 4UVAA 4Z1VA 1M4UA 3SJCC 1AROP 1Y4MA 4UV9A 3QNEA 1N33O 2HLDG 4GX5A 2GUZB 1IBKB 4J7ZA 3D36C 3WG7C 3ETGA 5LGNA 4WFGA 1XMOO 3CRQA 5J9PC 4ZHQB 2GTAA 2XAGA 3ASNB 4X1IB 1NR7A 3BAAA 2X6CA 4DV4O 5CA3A 1S5LZ 3OUSA 3VQXA 5FNVA 4DR1B 1H2LA 1KB9F 3DSQA 1COWG 2OCCB 1AI5A 1MG1A 3ZEDA 4LF8B 4DW1A 1ENVA 3MD0A 4F6RA 2CTWA 5JWPA 1XHZA 3QVNA 3KCYA 4HZ3A 5L3CA 4JI3O 1O9HA 1MSDA 1BCCH 2ZDIC 3S3WA 1HNXO 3VQWA 4NVPA 3Q4HA 2EIJC 4LF4O 4MT8A 3IAYA 2UXNA 4TT3G 1KMIZ 1H38A 3MHHC 2FMLA 2NR5A 3STZC 4L8JA 4MVRA 3FD9A 1YZBA 4J42A 5IT9N 4FFKA 3H1LH 1VF5B 1XNRO 5JCOA 2GBOA 3RYFB 2W0FC 1X4TA 4J11A 1M93A 2HJFC 5JVDA 2EJRA 5EZYB 2RJZA 1M9NA 2QKSA 4JI7O 2VQFO 5CB4B 1AP5A 4O4IB 5LA6B 1JFFA 3SYPA 1IBMB 2Q0AA 4H33A 1NI8A 4R6ZA 2Q0OC 4OGQB 4DV3B 4I7ZB 1HR0O 2ZNJA 3H1JH 5L3DA 4AI8A 1EZJA 1D5AA 2ZM6O 4H13B 5L3GA 2X6AA 4RUFA 1K4DC 4U3JB 1R3KC 1GM9A 2VQFB 1TVKA 3DC6A 5IJ0B 3ZMSA 3JCZA 5EZYA 4NXNO 4X1YA 1FS0G 3K58A 2HHHO 3HKCB 3CYOA 4KUMA 2Z0AA 4RO2A 1B06A 1WAZA 1SETA 3E86A 2G38A 4K0KO 4EFEA 3SPHA 3K3WA 2JVDA 4LF4B 3H1IH 4ASUG 1KUQA 3B8MA 4QE7A 1NU1H 3DTUB 5J2TA 3G80A 1OCZB 1EN5A 1WP8A 5B1BC 3J80N 4B3SO 3FB7C 3SYQA 1SZXA 5EBLC 3P3NA 1QLEB 2NN4A 2KG7A 4FIPC 3HR0A 1I5YA 1PV0A 3RYIB 2Q68A 3OEEG 3CRCA 5B1AC 1DK1A 1K4CC 3L70H 2P06A 4B7EA 2CTPA 3RVYA 1S3JA 2LW7A 2VS0A 1YF2A 2PI5A 3U0ZA 1P84F 2WLIB 1I94O 4JI2O 4JTCB 2H94A 2UUBO 3HPLC 4NKGB 2PYJA 5IYBO 1AR4A 4U7NA 1VEWA 2E76B 5L3FA 5IDJA 4NXMB 2UXDO 1FAFA 1S5JA 3OMAB 3SPJA 3E83A 3OE7G 1M90W 1K33A 4FZ1A 1E1QG 1HP8A 2DYRC 3F5TA 4MTFA 4O4LA 4EB6B 1XHXA 2UUAO 2Q69A 4CZZA 1GM8A 2ZE5A 2PZSA 3ML0A 2R9AA 4FM0A 1AI7A 2CH7A 1JVMA 3L72H 3C90A 3BABA 3OM3B 3D36A 5E1AC 3HB3B 4X66B 3O65A 1OCRB 1NH2B 1WB8A 1P7BA 3CCRV 4PHZA 4DV0O 4DO2A 3UM7A 3OUFA 4IHJA 4U3JA 3HKDB 1Y67A 2PF4E 1XNQO 3QO8A 5CA0B 1JOYA 3FB6C
chains in the Genus database with same CATH topology
2V7QG 3W7XA 1QR9A 3K0DA 1F51A 3AG3C 2D3OW 2WLLB 3GWOA 4JTAB 3JD0A 2IW5A 1SZTA 1XL6A 3IGAC 5GW7A 4MVOA 4PA7A 1Q81W 1DF4A 2EILC 1OHHG 3LDCA 3ABLC 3OFNG 2GSMB 2JK5C 4N23A 1RPRA 3ABKC 2ZR3A 1YJWV 1GMGA 1H8EG 4I5SA 2WLIA 4UV8A 4R8CA 4KFMA 1VQ5V 1R3IC 1WLEA 3P30A 1K97A 2F43G 2WSSG 2XAJA 3CCVV 1VQPV 1NR1A 3AG1C 4G28B 4QIWF 4E2LA 3ABLB 2DQ0A 4JAVA 4R7CA 3X2QB 5IY5B 5BZBA 4BIUA 1JJ2U 2JEXA 3E8HA 2A0LA 1FFTB 3AEIA 1DTOA 3ABTA 1QBZA 5C93A 2IH1C 3ZN1A 1K3EA 2YSUB 1LNQA 4FJCC 1Q86W 1E1RG 1BL8A 1F23A 2AHZA 3ZMZA 2IJIA 4Q20A 1VQMV 5FL7G 1PNLA 5LHHA 2M7WA 1QVGU 4G2KA 3W7SA 4ZKIA 1PL0A 2WPDG 3F5WC 4MW3A 1SESA 4WFBV 4P9PA 2Z3YA 4FMTA 4JPRA 1NVPB 5IYCO 3NXSA 3UKMA 2C2AA 4MVUA 3LNMB 2ITCC 1CPYA 3AG1B 4RQEA 3W7UA 2W6IG 1BHBA 1MSWD 3E89A 4X89A 5CMUA 1S0VA 1H8HG 4RAIA 1E79G 1I5XA 3WG7B 2IU3A 1YTFD 1GM7A 3ZN0A 2XAFA 4JGSA 1VQ9V 1QLNA 1AI4A 4QJFB 3ASOC 5LHIA 4QPKA 1NQTA 3T2MA 3AG2C 3R65A 4G27B 4P9OA 1OCOC 2WWWA 2FTKA 4X88A 3E8FA 1DLBA 5B1OA 2MK3A 1NBMG 1L1FA 4MTGA 4TSFG 4U7OA 5IY5C 3ABUA 4X8AA 2Y69C 4PA9A 1YJNV 5L3EA 2OTJV 2DYSB 3K79A 3QO5A 1R3JC 1W0KG 3SPCA 4BW5A 2ATKC 4XDKA 3ZRSA 1YITV 4MVZA 3W7WA 4UVCA 1VQ6V 5KUKA 1OCOB 1NKDA 2H8PC 5KA6A 1OCRC 3PJSK 1FXVA 5B1BB 1VQKV 3LSSA 5EC1C 2EIKB 2Y69B 1QLEC 3T4DA 3STLC 4WFHA 3RW0A 1R73A 1Q7YW 5B3SC 1ZWIC 4RQFA 2X6BA 1JX9A 1PNKA 2EIJB 3VOUA 2WLKA 2P67A 4PA3A 1PD3A 2IJHA 2QTOA 4LC1A 3TCUA 1KP3A 2EZOA 5DN6G 4UXNA 3EHBB 1FXHA 2X7RB 1NVPD 1NJIW 4ZBMA 3CMAV 1AJNA 1QVFU 2LP7A 4JF3A 3CCLV 4I9WA 3JD1A 4LBEC 5B1NA 2B1GA 2XAHA 1N8RW 2AHYA 3GB7C 1S5HC 4JYBA 1V55B 3JD3A 2X0LA 5EBWC 4YXWG 3ASOB 3LDEA 4JASA 3ABKB 1V54C 4MVSA 3BY6A 5EBMC 5LGTA 1YTFB 4XBFA 5LBQA 5L3BA 3OR7C 3FB5C 1K34A 2JEUA 2XAQA 2OTLV 1K9MW 1CP9A 3SPGA 2EIMB 5CBGA 1HWYA 5HFMA 3ZRWB 4OXSA 1XL4A 1KQSU 3FYEB 1KC8W 1TUEB 2ZXWB 3JYCA 3G71V 4P30A 4GX2A 2HG5C 5H9CA 4UVAA 4GX0A 1AROP 1Y4MA 3IFXA 4UUJC 4UV9A 1BMFG 3QNEA 3I55V 3SYCA 3CMEV 1VQ8V 3A0RA 2HLDG 2Y48A 4GX5A 3SYAA 1M56B 2K1EA 2NLJC 2EINB 5CBHA 1KD1W 3WG7C 4GX1A 3ETGA 5LGNA 4WFGA 2XASA 1AI6A 5B3SB 5J9PC 2XAGA 1VQOV 3ASNB 3CP1A 4CBCA 1OCCC 1OZ0A 1R6NA 2OCCC 5IYDO 1NR7A 3ZMVA 1V55C 2KB1A 2EIMC 4QE9A 2X6CA 1PKXA 3ETDA 5CA3A 1F4NA 3OUSA 2BOBC 4LP8A 3CCEV 2R9RB 2EZPA 4FPPA 3OMIB 2ZDIA 4J9ZB 4TWKA 2A9HA 2PI4A 3DGEA 3ZRWA 2R9IA 2HKOA 3M99B 4MTOA 1COWG 2OCCB 4WFFA 3E8BA 2Q6AA 1AI5A 1MG1A 3ABMB 1ENVA 3MD0A 3CC4V 2IU0A 3CC2V 2JIZG 4HZ3A 4F4LA 1GK9A 4QPJA 3RBZA 5L3CA 1K92A 2Q67A 1EBOA 1M56C 2ZDIC 4JAUA 1YIJV 1JPXA 1Q82W 1PNMA 2HR3A 2EIJC 4P2ZA 1W0JG 3LUTB 2DYSC 3P32A 4MT8A 3ETEA 2UXNA 4TT3G 4UVBA 3CCQV 2QA4V 1H38A 3MHHC 4EKWA 4GCZA 3FYIB 4J9YB 3STZC 4MSWC 5CBFA 4MVRA 3OW2U 1ORQC 3G4SV 3IC7A 3BEHA 4QNHB 3X2QC 4H37A 1K73W 2EIKC 2JDIG 2QEXV 4PDMA 2W0FC 3T4ZA 1V54B 4PELA 1OCCB 1YI2V 2HJFC 2EJRA 3SPIA 5LGUA 3OAAG 3W7TA 1M57B 2Z5UA 2DWEC 1CEZA 1M9NA 2QKSA 3JD4A 1ROPA 3ZMUA 2IJKA 1G4YB 3VBBA 2XOKG 4N21A 3TETA 4HYOA 1FXKB 3K08A 5KA5A 2YEVB 3SYPA 1AJPA 4H33A 2DWDC 1JCHA 3MHSC 4R6ZA 3CD6V 5KUMA 4XDLA 1K7DA 3SYOA 1NH2D 1M57C 3CC7V 3QO7A 1EFRG 1KECA 2QM8A 2CK3G 2WLLA 5L3DA 1EZJA 3CCMV 1VQNV 4WF9V 1SERA 1R3LC 1FXKC 5L3GA 5H6QA 2X6AA 2LFRA 3H01A 2DW4A 4Z1MG 2YEVA 4JTDB 4RUFA 1K4DC 1GO3F 3OMNB 1R3KC 1JQ0A 1GM9A 3G6EV 4RUEA 4MVMA 3ZMSA 3D3IA 1H2GA 3JCZA 3B8NA 1FS0G 4L87A 4FK5C 3T1CA 2WLHA 4PDLA 5HFLA 1FXKA 3CYOA 4KUMA 4RO2A 3I56V 2XNDG 1SETA 3E86A 4PA6A 1S72V 4GT1A 1RM1B 4LCUC 1OCZC 2HFEC 3E35A 1BHAA 3SPHA 1K5SA 2EINC 3CCUV 3K3WA 4MTXA 3ZMTA 3ZIAG 3ZRXA 2HVJC 4ASUG 3B8MA 2QM7A 2NNUA 4KP4A 4QE7A 2WLMA 3DTUB 1J95A 1RM1C 1KKDA 1OCZB 3RVZA 4PDRA 3OR6C 5B1BC 1KP2A 3ABMC 3FB7C 1MOFA 1Y66A 2ITDC 1G8MA 5EBLC 3SYQA 1QLEB 1K8AW 1QR8A 2ZQMA 4MW8A 2WLJA 3AG4B 2P90A 4FIPC 1P4RA 1WPXA 1I5YA 1YJ9V 2WLNA 2DQ3A 3E8GA 2Q68A 3OEEG 5B1AC 1K4CC 1S76D 2BOCC 3B77A 2QE7G 5EK0A 3ZCCA 3TK1A 2IH3C 3RVYA 1VQ7V 1SRYA 5H6RA 1VQLV 2ZD9A 1S3JA 1M1KW 2PI5A 3LSQA 4JYCA 4BAYA 2P6JA 2WLIB 3CPWU 3CCJV 3JD2A 4JTCB 2H94A 3HPLC 5DM6V 1MABG 2V1DA 1QCEA 3AG3B 5IYBO 2WAMA 4U7NA 5L3FA 3K06A 5IDJA 3F7YC 1AR1B 3OMAB 3SJQC 4PDVA 3SPJA 3EFFK 3FB8C 2W6JG 1DF5A 3K9AA 1RPOA 2ZXWC 4MS2A 3E83A 3OE7G 1GTOA 4PA4A 1M90W 1K33A 3WFVA 1VQ4V 3AG4C 3LDDA 3AG2B 4WFAV 1E1QG 3ASNC 2A79B 1YSCA 3F7VC 2DYRC 4MTFA 5CN0A 4DXWA 4WFEA 1YHQV 2Q69A 3FKSG 2OT5A 4CZZA 5B1AB 1GM8A 3KG2A 2HVKC 1R6KA 1THZA 5LHGA 3ML0A 4HAMA 2P7TC 3ZRVA 1AI7A 1IXMA 1AJQA 2LFSA 3K0GA 3E2EA 2UXXA 3OGCC 1JVMA 3K04A 3CXCU 1UJWB 4BIZA 1B6QA 3OM3B 3D36A 5E1AC 4XDJA 1W2BU 2DYRB 3HB3B 3ZJZA 4R50A 1F4MA 2JJ1G 1OCRB 3OEHG 1NH2B 2B1IA 1P7BA 3CCRV 2JJ2G 3UM7A 2GHYA 4DO2A 2EBOA 3OUFA 3CCSV 2IJJA 2EILB 1S77D 3K03A 2B5UA 4WCEV 2ZR2A 4MVQA 1GKFA 5EC2C 3QO8A 1JOYA 1K5QA 3FB6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBZ A;  5KUK A;  3K0D A;  2H8P C;  3AG3 C;  2WLL B;  4QE7 A;  2WLM A;  4JTA B;  1OCR C;  2Q67 A;  3PJS K;  1J95 A;  1M56 C;  1XL6 A;  3IGA C;  1KKD A;  5EC1 C;  4MVO A;  4PA7 A;  3RVZ A;  1QLE C;  3T4D A;  2EIJ C;  3STL C;  4PDR A;  4WFH A;  4P2Z A;  2EIL C;  3RW0 A;  3OR6 C;  3LDC A;  5B1B C;  5B3S C;  3ABL C;  1ZWI C;  2DYS C;  3ABM C;  3LUT B;  3FB7 C;  2X6B A;  2ITD C;  3SYQ A;  5EBL C;  4EKW A;  2JK5 C;  3VOU A;  2WLK A;  3ABK C;  4MW8 A;  4PA3 A;  2WLJ A;  4J9Y B;  4F4L A;  2QTO A;  3STZ C;  3TCU A;  4MSW C;  5CBF A;  4MVR A;  2WLI A;  1ORQ C;  4KFM A;  4R8C A;  1R3I C;  2WLN A;  3BEH A;  3E8G A;  2Q68 A;  4QNH B;  4ZBM A;  4H37 A;  3X2Q C;  5B1A C;  2EIK C;  1K4C C;  4PDM A;  2BOC C;  4I9W A;  2W0F C;  4LBE C;  3AG1 C;  3T4Z A;  4G28 B;  5EK0 A;  2AHY A;  2IH3 C;  2HJF C;  3GB7 C;  1S5H C;  4R7C A;  3RVY A;  5BZB A;  3SPI A;  5EBW C;  3LDE A;  3E8H A;  2A0L A;  2DWE C;  2ZD9 A;  1V54 C;  2QKS A;  4MVS A;  5EBM C;  1G4Y B;  2IH1 C;  2WLI B;  3FB5 C;  3OR7 C;  4JTC B;  1LNQ A;  3TET A;  1BL8 A;  4HYO A;  2AHZ A;  3HPL C;  3SPG A;  5CBG A;  3K08 A;  3SYP A;  4H33 A;  4OXS A;  1XL4 A;  2DWD C;  3K06 A;  4R6Z A;  3F7Y C;  3JYC A;  4P30 A;  4GX2 A;  5KUM A;  2HG5 C;  3F5W C;  4XDL A;  4MW3 A;  3SYO A;  1M57 C;  3SJQ C;  4PDV A;  4P9P A;  4GX0 A;  3SPJ A;  3EFF K;  3FB8 C;  3IFX A;  4UUJ C;  3SYC A;  3UKM A;  2ZXW C;  4MVU A;  3LNM B;  4MS2 A;  3E83 A;  2WLL A;  4PA4 A;  2ITC C;  4GX5 A;  3SYA A;  2K1E A;  2NLJ C;  1R3L C;  3AG4 C;  3LDD A;  5CBH A;  2X6A A;  2A79 B;  3ASN C;  3F7V C;  3WG7 C;  2DYR C;  2YEV A;  4GX1 A;  4MTF A;  4JTD B;  3E89 A;  4X89 A;  4DXW A;  4RUF A;  4WFG A;  4WFE A;  2Q69 A;  1K4D C;  4RAI A;  5J9P C;  1R3K C;  3KG2 A;  2HVK C;  4RUE A;  4CBC A;  4MVM A;  1OCC C;  2OCC C;  2P7T C;  1V55 C;  3K0G A;  2KB1 A;  2EIM C;  3OGC C;  2X6C A;  1JVM A;  3ASO C;  3K04 A;  4QE9 A;  3T2M A;  3T1C A;  2WLH A;  3AG2 C;  3OUS A;  2BOB C;  3R65 A;  4G27 B;  4PDL A;  4XDJ A;  5E1A C;  4LP8 A;  4P9O A;  1OCO C;  4RO2 A;  4R50 A;  4X88 A;  3ZJZ A;  2R9R B;  3E86 A;  4PA6 A;  3E8F A;  4J9Z B;  1P7B A;  4MTG A;  4TWK A;  2A9H A;  5IY5 C;  4X8A A;  3UM7 A;  4LCU C;  1OCZ C;  2Y69 C;  3OUF A;  4PA9 A;  2HFE C;  4MTO A;  4WFF A;  3E8B A;  3SPH A;  3K03 A;  2EIN C;  2Q6A A;  1R3J C;  3SPC A;  4BW5 A;  4MVQ A;  5EC2 C;  2ATK C;  4XDK A;  3ZRS A;  2HVJ C;  4MVZ A;  4HZ3 A;  3FB6 C; 
#chains in the Genus database with same CATH topology
 1KKC A;  1QR9 A;  2RN9 A;  3JD0 A;  3RT3 C;  1XL6 A;  4FM2 A;  5GW7 A;  4MVO A;  4PA7 A;  1H2M A;  1DF4 A;  1YDX A;  1G1X B;  4LWS A;  4R8C A;  2BE3 A;  1R3I C;  1WLE A;  3JAS B;  2ZKO A;  3P30 A;  2OIG A;  1NR1 A;  3AG1 C;  4R7C A;  2Y0I A;  1JJ2 U;  1SKV A;  3E8H A;  3AEI A;  3ABT A;  1QBZ A;  2YSU B;  2LJ2 A;  3FFQ A;  3O9O A;  1VQM V;  1MNG A;  1H2S B;  5DED A;  3W7S A;  1PL0 A;  3F5W C;  1SES A;  4DV3 O;  2Z3Y A;  5ITZ A;  5LMN O;  4O2B B;  3UKM A;  2C2A A;  3LNM B;  2ZE8 A;  2E5L B;  4CC5 A;  4H0L B;  3W7U A;  2QSA A;  1I0H A;  1MSW D;  2IM9 A;  3E89 A;  4X89 A;  3WB2 A;  1H8H G;  1MA1 A;  4DR5 B;  1W59 A;  2HHH B;  3ETQ A;  4TV8 A;  1QLN A;  1Z5W A;  5GON B;  1N36 B;  4FFB A;  4QJF B;  1NQT A;  1JR9 A;  1NTK H;  4FLY A;  4X20 B;  4JV5 B;  1OCO C;  3P3P A;  1NS1 A;  3E8F A;  1L1F A;  2UUB B;  4TSF G;  5EYP A;  5B5E Z;  4GKK O;  1PP9 H;  5H5N A;  5KAF Z;  2DYS B;  4DUY O;  4WBN A;  3SPC A;  3G67 A;  2ZE6 A;  2PGG A;  4XDK A;  1YIT V;  2QWR B;  3BVO A;  1NKD A;  1MMM A;  4DR6 B;  1FXV A;  1VP7 A;  1IBM O;  4JI1 O;  1R73 A;  1GH6 A;  1I08 A;  4GKJ B;  1SQX H;  2IJH A;  2EZO A;  3EHB B;  1NVP D;  3RYC B;  1AJN A;  1QVF U;  4JF3 A;  2XAH A;  2AHY A;  3GB7 C;  1S5H C;  4JYB A;  3L71 H;  4DR4 O;  2O57 A;  3BY6 A;  4K0K B;  1WPB A;  1GN2 A;  1XMO B;  3RYH A;  2E74 B;  2XAQ A;  2OTL V;  4JI4 O;  5JJE B;  1KQS U;  5J2U B;  4GX2 A;  1H2N A;  3SYC A;  1VQ8 V;  2QM4 A;  4I0X A;  3A0R A;  3SYA A;  2ZNI A;  4LF7 O;  5CBH A;  4W4K A;  3CEI A;  1L0L H;  4DRX A;  1SS3 A;  3ZS8 C;  4O4J B;  4DR2 B;  1UFI A;  1IUR A;  1XIL A;  5E79 Z;  1OV9 A;  4UFZ A;  2ODM A;  4CBC A;  1OCC C;  5CB4 A;  1V55 C;  4YJ2 B;  3T1Y O;  1PKX A;  2BSK B;  3J81 N;  2ILM A;  3GVM A;  2UXC O;  4O4J A;  3OMI B;  5J2U A;  1SQV H;  3DGE A;  2HKO A;  2XT9 A;  4IIJ A;  4MTO A;  1AP6 A;  4DK0 A;  1VMG A;  2JS5 A;  3ABM B;  3CE2 A;  1EZV H;  1KU9 A;  3TXQ A;  2JIZ G;  4LH6 A;  1K92 A;  5IYZ A;  2UXD B;  4LF9 O;  1M56 C;  4JAU A;  4DV2 O;  3H1K H;  5A2Q N;  2HR3 A;  3A0H Z;  3JAT B;  1L8D A;  1W0J G;  3CCQ V;  3P32 A;  3KZI Z;  4UB8 Z;  3BA9 A;  1G6U A;  3AG7 A;  3HKC A;  3APQ A;  3TXS A;  3G4S V;  2YIA A;  1IBL B;  3SDL A;  3X2Q C;  2JDI G;  2QWO B;  4X62 B;  1OCC B;  1YI2 V;  2XTA A;  4DR3 O;  5LGU A;  5KMG B;  4LF8 O;  1M57 B;  1CEZ A;  2A7W A;  4CH4 A;  3ZMU A;  2IJK A;  1N34 O;  1ZLZ A;  1GRJ A;  3TET A;  4TV9 A;  4HYO A;  4DR1 O;  2EUL A;  4FLZ A;  3C3S A;  1AJP A;  1WB7 A;  1WA8 B;  4RWU A;  2FL4 A;  5KUM A;  4DR4 B;  4B3M O;  4XDL A;  4ZOL B;  5H2F Z;  3CC7 V;  3QO7 A;  4B3M B;  1EFR G;  1P49 A;  2KQX A;  2WLL A;  1FXK C;  4KL1 A;  5H6Q A;  3OGI B;  4Z1M G;  2YEV A;  5KHJ A;  3BPZ A;  3K5N A;  3ZHQ A;  1GO3 F;  3OMN B;  4RUE A;  3OTF A;  4LNU A;  3D3I A;  2UU9 O;  2QWQ B;  3B8N A;  4I0X B;  4X62 O;  1QNM A;  4L87 A;  4FK5 C;  4PDL A;  5HFL A;  1Q8I A;  4DR6 O;  3I56 V;  2XND G;  4PA6 A;  1YCI A;  4D6T H;  1AB3 A;  4LCU C;  1NTM H;  3Q4H B;  1K5S A;  2EIN C;  1SF9 A;  3HKE A;  4MTX A;  1BT8 A;  3ZIA G;  3ZRX A;  4DV7 B;  1J5E O;  3THO A;  3OT7 A;  1Q43 A;  4DV2 B;  2QWN B;  2V4D A;  3RWR D;  3KCX A;  2CE4 A;  4DV1 B;  1J95 A;  1RM1 C;  2VQE O;  1GAX A;  1XOU A;  2ADQ B;  3JAR A;  3QTC A;  4LFC B;  1MOF A;  1Y66 A;  4B7K A;  4JI7 B;  5LOV A;  2ZQM A;  1Y76 B;  4O2A B;  2P90 A;  5LL6 Y;  3K5O A;  5LP6 B;  2JGD B;  2BSK A;  5FLX N;  3CWB H;  1V9P A;  2CUG A;  2CTR A;  3AK3 A;  2YC0 A;  1PPJ H;  4CS2 A;  4X1I A;  3N2K B;  2QE7 G;  3TK1 A;  1TUB B;  2DN9 A;  5H6R A;  1VQL V;  1O9G A;  2ZD9 A;  2PUS A;  5JQG A;  1XBL A;  2P6J A;  3CPW U;  4PV1 B;  4LFA B;  2CTQ A;  3WU2 Z;  3JAW A;  1BS3 A;  4PDV A;  4X64 O;  3FB8 C;  2HJD A;  2W6J G;  3HKD A;  1DF5 A;  2CDY A;  1D2D A;  3UO2 A;  3RYC A;  3AG4 C;  3EVK A;  3AG2 B;  1URF A;  2OCH A;  4LH7 A;  5CN0 A;  4DXW A;  4WFE A;  3H9V A;  3FKS G;  3DXR B;  3JAL B;  3CSX A;  3KG2 A;  3OTO O;  4TQD A;  5LHG A;  3AK1 A;  1AIL A;  2LFS A;  1AJQ A;  5BR8 B;  3K04 A;  3JAK B;  1SQP H;  2VRZ A;  1W2B U;  3ZJZ A;  1F4M A;  3RYH B;  3OEH G;  2JS3 A;  1WN7 A;  1B04 A;  3U10 A;  2EIL B;  4K3A A;  3UCS C;  1B3Q A;  1GKF A;  1Q90 D;  2F95 B;  4UCO A;  1TA8 A;  4FM1 A;  2P4V A;  1K5Q A;  3CME V;  3K59 A;  3MAQ A;  2D3O W;  2AZ2 A;  2IW5 A;  3TJT A;  1SQB H;  2Q7E A;  1OHH G;  1XEQ A;  3ABL C;  5C8Y B;  3RN4 A;  1FFX B;  4DR7 B;  1YJW V;  2UUA B;  1GMG A;  2QJ1 A;  4KFM A;  1K97 A;  1RP3 B;  5KX5 B;  4G28 B;  4E2L A;  2E3C A;  5ITZ B;  4JAV A;  3X2Q B;  5BZB A;  2YI9 A;  2A0L A;  1FFT B;  4NXM O;  3T1H B;  2QWP B;  3A0B Z;  5IJ9 B;  5C93 A;  5CA0 A;  2IH1 C;  3HKE B;  1KBH A;  4X1K A;  2LQT A;  2AW9 A;  2AHZ A;  5K1X A;  1RSO A;  3BCC H;  4DV1 O;  1QVG U;  4DK1 A;  1IVS A;  2WPD G;  5LMN B;  4MW3 A;  4WFB V;  5BR8 O;  1BQZ A;  4FMT A;  4JPR A;  1NVP B;  5KHG A;  4MVU A;  4X1Y B;  1CPY A;  1Q6U A;  2GDS A;  4YIO A;  4RQE A;  1DGS A;  4X65 O;  4OX9 O;  2RCV A;  2QR4 A;  1TGO A;  1HNW O;  2IU3 A;  2Q8V A;  2AXT Z;  3CXH F;  4NTY A;  2HEP A;  4DR3 B;  2UU9 B;  3ASO C;  5LHI A;  2Q4P A;  5EIB D;  3FAV A;  3R65 A;  1HNW B;  3N2G B;  4X88 A;  3ZHS A;  1IBL O;  5B1O A;  4NR1 A;  1VAR A;  3ABU A;  4X8A A;  2Y69 C;  3JSN A;  4WBN B;  2GV9 A;  5JJJ B;  5L3E A;  3E22 B;  3QO5 A;  4B3T B;  1W0K G;  4HBN A;  3ZRS A;  3DC5 A;  1VQ6 V;  3ZBH A;  3M7M X;  1OCR C;  1ZAU A;  4D7T A;  5EC1 C;  2UUC B;  2EIK B;  1HDJ A;  3ZHT A;  2KKW A;  4IHJ B;  4WFH A;  4J7J A;  3RW0 A;  1Q7Y W;  5B3S C;  1ZWI C;  5C8Y A;  4RQF A;  1JX9 A;  4F6E A;  3BA8 A;  3VOU A;  4JYA O;  1PD3 A;  1L0N H;  2F23 A;  4UXN A;  4J7K A;  2VQE B;  2E5L O;  3FX7 A;  2LP7 A;  3JD1 A;  4LBE C;  4JI8 O;  2B1G A;  2ZE7 A;  4I9Q A;  1V55 B;  3JD3 A;  3ASO B;  4MVS A;  4X9Q A;  1YTF B;  4XBF A;  2BTQ B;  4JZ2 A;  4FLU A;  2JGU A;  3CX5 F;  3SPG A;  1VF7 A;  1BSM A;  5CBG A;  4E4E A;  4PI0 A;  1TUE B;  2ZXW B;  3JYC A;  1YEW A;  4I50 A;  4UUJ C;  3I55 V;  1BMF G;  2A3Q A;  4JYY A;  2EJ7 A;  3CRR A;  1BZK A;  2W0X A;  2Y48 A;  4OPA A;  5JH7 B;  1M56 B;  2NLJ C;  1KD1 W;  5BXZ A;  5LP6 A;  4FLX A;  4ZHQ A;  2XAS A;  1AI6 A;  5B3S B;  4JI6 B;  1RFY A;  1OZ0 A;  2OCC C;  1U97 A;  4W4L A;  3JAW B;  3ZMV A;  2KB1 A;  2EIM C;  4QE9 A;  3ETD A;  3D8C A;  5GTI Z;  1XQ8 A;  3FAV B;  1T5E A;  2D2C B;  3CCE V;  2EZP A;  4FPP A;  2ZDI A;  4J9Z B;  5EYP B;  2A9H A;  4JZG A;  3ZRW A;  2R9I A;  2Y4U A;  4LR3 A;  4O4I A;  1IXB A;  2IU0 A;  4X64 B;  4ZIB A;  4F4L A;  4QPJ A;  3RBZ A;  5JJN B;  3GWK C;  2Q67 A;  2PY5 A;  1EBO A;  4I4T B;  1YIJ V;  1JPX A;  1KYO F;  1Q82 W;  4GYC B;  1Q6I A;  4LFA O;  1JJO A;  2L35 A;  2DYS C;  3ETE A;  4UVB A;  4DV5 O;  4EKW A;  3D3Q A;  3B09 A;  4J9Y B;  5IE9 A;  4MSW C;  4O4L B;  4EB6 A;  3OW2 U;  1ORQ C;  4DV6 B;  2QEX V;  5D5P A;  5KHK A;  1I7F A;  4PEL A;  4GZR B;  4JI0 O;  1FJG O;  2Q5Z A;  3SPI A;  4ZOL A;  3W7T A;  4LF6 B;  4YJ3 A;  2DWE C;  1VF6 A;  4X1K B;  3WB0 A;  4C7U A;  1ROP A;  1G4Y B;  5JQG B;  3VBB A;  4F6R B;  4DV0 B;  5K1P A;  1JFF B;  2QTS A;  3RGB A;  5AG2 A;  5KA5 A;  2YEV B;  3N2K A;  1VF6 C;  3MHS C;  4DYL A;  3CD6 V;  4YJ2 A;  2R72 A;  1NH2 D;  2FYU H;  3NR7 A;  1KEC A;  2UXB B;  4DUY B;  1VQN V;  5B66 Z;  2DW4 A;  4EEQ A;  3ZX6 A;  5KHH A;  1AVM A;  3CS5 A;  1XMQ B;  1JQ0 A;  2H3O A;  4MVM A;  2P22 C;  1H2G A;  1US6 A;  3VQY A;  5KAI Z;  4X20 A;  1FD9 A;  1IDS A;  1TAE A;  4GT1 A;  1S72 V;  1Y74 B;  2F93 B;  5LP6 C;  1OCZ C;  1I94 B;  4JI2 B;  2HFE C;  3E35 A;  3JAL A;  3CCU V;  4I50 B;  2HVJ C;  3DXR A;  4BIO A;  2L6L A;  4PDR A;  1KP2 A;  2KSD A;  3ABM C;  1BQ0 A;  2F1M A;  1K8A W;  1QR8 A;  3E22 A;  4MW8 A;  2WLJ A;  1M5I A;  3AG4 B;  1P4R A;  4TUY B;  1WPX A;  4DRX B;  1YJ9 V;  4K35 A;  4HNA A;  2DQ3 A;  1QHT A;  1AR5 A;  1S76 D;  2YIB D;  3B77 A;  3EXA A;  5EK0 A;  1H2K A;  3ZCC A;  2IH3 C;  2QKA A;  1SRY A;  5LMU B;  2ARH A;  2N74 A;  3ZHR A;  4HNA B;  4JYC A;  3K9S A;  4BAY A;  3JD2 A;  2F4V B;  2PTM A;  2JRI A;  5DM6 V;  1MAB G;  2V1D A;  3AG3 B;  2WAM A;  2DE0 X;  1AR1 B;  4D7S A;  3SJQ C;  3EFF K;  3KKY A;  3K9A A;  2ZXW C;  4MS2 A;  4PA4 A;  1XNR B;  3LDD A;  4DV6 O;  1SQG A;  2YI8 A;  3J7A U;  4B3R B;  1Z2G A;  2A79 B;  3JAT A;  2Q7H A;  4DR7 O;  4X66 O;  2HVK C;  1R6K A;  5IJ9 A;  2P7T C;  4YY3 O;  3E2E A;  3K0G A;  3OGC C;  4BWA A;  1UJW B;  4BIZ A;  1XDC A;  1B6Q A;  1ZSP A;  4CH6 A;  4XDJ A;  2DYR B;  2ZCE A;  5CA1 A;  2YUA A;  2YXY A;  2K9P A;  4B3R O;  2EBO A;  4CS3 A;  4LF7 B;  3CCS V;  2DJV A;  1S77 D;  3K03 A;  2Y4T A;  4WCE V;  3BHP A;  4LF6 O;  3IC9 A;  4LF5 B;  2V7Q G;  3W7X A;  3AG3 C;  3GWO A;  4JTA B;  4DUZ B;  2QGN A;  5KLV H;  1SZT A;  2R70 A;  3PN1 A;  2P5O A;  3S3X A;  2RQ6 A;  1FFX A;  2YDE A;  3LDC A;  3OFN G;  4JI6 O;  2JK5 C;  4N23 A;  1RPR A;  3ABK C;  4TV9 B;  5LMU O;  4I5S A;  2CGO A;  4UV8 A;  1VQ5 V;  3BFR A;  3JSL A;  2F43 G;  2WSS G;  2XAJ A;  3CCV V;  1VQP V;  1YVW A;  5CA1 B;  4YHH B;  1GN6 A;  4QIW F;  1TUB A;  5J2T B;  4FLW A;  1XNQ B;  2P4K A;  2RNB A;  4TV8 B;  1XMQ O;  2LGW A;  4B3S B;  1Q86 W;  4FLT A;  1SQF A;  4X65 B;  4J80 A;  5JVD B;  4Q20 A;  2ZM6 B;  1EM1 A;  1PNL A;  3SJA C;  2M7W A;  4G2K A;  3JAR B;  2YIB A;  4O2B A;  2XHB A;  4UB6 Z;  5IYC O;  4JI8 B;  3CHX A;  4JI5 B;  5IYZ B;  4IGG A;  2ITC C;  4BR6 A;  4NTW A;  3ZHU A;  4K8X A;  3L73 H;  1BHB A;  1S0V A;  4RAI A;  4A5U B;  1IBK O;  4JYA B;  4LWS B;  3T1H O;  1YTF D;  1GM7 A;  1N4C A;  2XAF A;  4JGS A;  1VQ9 V;  4NTX A;  4NXN B;  1AI4 A;  3T2M A;  2Q73 A;  3AG2 C;  4G27 B;  5BY1 A;  4P9O A;  3VQV A;  4DR5 O;  2Q7G A;  4MTG A;  1TVK B;  4PI2 A;  4PA9 A;  2UXB O;  4BW5 A;  3B4S A;  2ADP A;  4MVZ A;  1HNX B;  4UVC A;  5KUK A;  1OCO B;  2H8P C;  5KA6 A;  4JI3 B;  2DOS A;  3JAM N;  2N05 A;  2WLK A;  4PA3 A;  5GTH Z;  2QTO A;  3CB2 A;  1KP3 A;  2FKX A;  1FXH A;  4CH3 A;  3R66 A;  4ZBM A;  1NJI W;  3CMA V;  3CCL V;  1NZ6 A;  1WNS A;  1NT2 B;  3LDE A;  1HNZ O;  4JAS A;  1V54 C;  1U96 A;  3K57 A;  3FB5 C;  2JEU A;  1UPG A;  2EIM B;  3K5M A;  1LUV A;  1HWY A;  5BMV A;  5HFM A;  4OXS A;  2RMK B;  1XL4 A;  4DUZ O;  1Q3E A;  5IWA B;  1KC8 W;  2BTO A;  5H9C A;  3JCU Z;  4LNU B;  4IL6 Z;  4GX0 A;  3IFX A;  1MZE A;  2ETN A;  4J41 A;  2K1E A;  4IYH A;  2EIN B;  1BE3 H;  1PL4 A;  4GX1 A;  2YXH A;  3G6B A;  2FB5 A;  4IIJ B;  1VQO V;  3CP1 A;  3SR2 C;  1R6N A;  4I55 A;  5IYD O;  4NB5 A;  1HR0 B;  4YJ3 B;  2OYQ A;  4DW0 A;  1F4N A;  2BOB C;  4LP8 A;  2R9R B;  4TWK A;  1N0J A;  3C3T A;  2PI4 A;  1N32 B;  3M99 B;  1Y76 A;  4O2A A;  4WFF A;  3E8B A;  2Q6A A;  5LXT A;  2CAZ C;  3CC4 V;  4JI0 B;  1FJG B;  2UXC B;  3CC2 V;  2CH7 B;  4AQY O;  1GK9 A;  4FFB B;  1XUQ A;  4PJ0 Z;  2ZIO A;  1PNM A;  1CXZ B;  1ZL8 B;  4FVM A;  4NYK A;  2F4V O;  4P2Z A;  4B3T O;  3TGU H;  3LUT B;  2QA4 V;  4GCZ A;  4DV5 B;  3FYI B;  4FLV A;  4UCV A;  5CBF A;  1WP7 A;  3IC7 A;  3BEH A;  4QNH B;  3UT5 B;  4H37 A;  1K73 W;  2EIK C;  2QKC A;  3IJ4 A;  1XRE A;  4PDM A;  4QGP A;  5JCO C;  3T4Z A;  1IZ3 A;  1V54 B;  4CS4 A;  1F7Y A;  3OAA G;  2Z5U A;  2IBZ H;  1QU7 A;  3JD4 A;  3JAS A;  4H44 B;  2XOK G;  4N21 A;  1P7G A;  1FXK B;  1OJH A;  3K08 A;  2DWD C;  1JCH A;  4GUN A;  1PM9 A;  1K7D A;  3SYO A;  5EIB C;  1GN4 A;  1M57 C;  2A06 H;  5IJ0 A;  2YID A;  2YXL A;  3SJB C;  2QM8 A;  1Y6X A;  4UCR A;  3H1H H;  2CK3 G;  3HKB B;  1ZUQ A;  3CCM V;  4WF9 V;  1SER A;  1R3L C;  5FPO A;  2LFR A;  3H01 A;  4JTD B;  2B9Z A;  1VIB A;  4K8Z A;  1SA0 B;  4KHP B;  3A2F A;  3BRC A;  1X59 A;  3G6E V;  4LFC O;  4LFB B;  4Q6G A;  2LO1 A;  1N33 B;  2HP8 A;  2JGD A;  3T1C A;  2WLH A;  4TUY A;  2YIC A;  3SGI A;  1FXK A;  4PD4 F;  1N0N A;  3L74 H;  2Y0P A;  1RM1 B;  1JA8 A;  4OX9 B;  5BMV B;  1ZX3 A;  5F2V O;  1BHA A;  1FKA O;  4KXR A;  5A9G A;  2BTQ A;  1R1B A;  2ZIM A;  3ZMT A;  2QM7 A;  2NNU A;  4KP4 A;  4UCS A;  2WLM A;  2EX3 A;  4U3F H;  1KKD A;  3RVZ A;  1SQQ H;  3OR6 C;  2OWO A;  1HW7 A;  2ITD C;  1G8M A;  1LR1 A;  4KHP O;  4JAA A;  2UUC O;  5TIS Z;  3K5L A;  2WLN A;  3E8G A;  5FNV B;  4JI5 O;  2BOC C;  5LXT B;  1VQ7 V;  2OIE A;  3OTO B;  5FPR A;  1M1K W;  3LSQ A;  2E75 B;  2WA4 A;  3CCJ V;  4AIL C;  2Q9L A;  3LSU A;  4DR2 O;  2KG7 B;  1EN6 A;  2GTS A;  2XUM A;  1QCE A;  4IT5 A;  3WB1 A;  3K06 A;  4ICG A;  3F7Y C;  2VWJ A;  4I55 B;  1D5N A;  3APO A;  1RPO A;  4YHH O;  5IWA O;  1GTO A;  4YIP A;  3WFV A;  3UT5 A;  1VQ4 V;  4O4H A;  4WFA V;  1BGY H;  3ASN C;  1YSC A;  3F7V C;  4JI4 B;  4ABM A;  1YHQ V;  2OT5 A;  1SC5 B;  3OD4 A;  4TOI A;  5B1A B;  3B40 A;  2AZ0 A;  5LYJ B;  4B08 A;  4UCU A;  1THZ A;  1HNZ B;  3ICX A;  5KHI A;  4HAM A;  3ZRV A;  1IXM A;  4DV4 B;  5GON A;  2UXX A;  3CXC U;  4FZ0 A;  1XI1 A;  3RFR A;  4R50 A;  5KX5 A;  2JJ1 G;  2ZT9 B;  2B1I A;  2M6Y A;  2JJ2 G;  3QG5 A;  2GHY A;  3AK2 A;  5LYJ A;  4GLX A;  2IJJ A;  2B5U A;  3N27 A;  2YS8 A;  3I5D A;  2PYL A;  3UO3 A;  2ZR2 A;  4MVQ A;  5EC2 C;  4O4H B;  4CC6 A;  3K0D A;  1F51 A;  2WLL B;  4IYI A;  2CGN A;  4Z2W A;  3IGA C;  1Q81 W;  3M8A A;  4YY3 B;  1WA8 A;  2EIL C;  4CH5 A;  2AGA A;  2GSM B;  3CJH A;  2GUZ A;  2ZR3 A;  3HKB A;  4EFB A;  1H8E G;  1R6T A;  2WLI A;  4JV5 O;  1FPO A;  2RDC A;  1MZF A;  1YXB A;  3ABL B;  2DQ0 A;  5IY5 B;  1N36 O;  4BIU A;  3JAK A;  2JEX A;  2DMX A;  3UQ8 A;  1DTO A;  4TQF A;  4AHC A;  3ZN1 A;  5JH7 A;  1K3E A;  1LNQ A;  4FJC C;  1E1R G;  1BL8 A;  1F23 A;  2VWK A;  4J10 A;  3ZMZ A;  2IJI A;  5FL7 G;  5LHH A;  3RYF A;  2WA3 A;  4ZKI A;  3T1Y B;  1J5E B;  4P9P A;  1IX9 A;  3NXS A;  1RSO B;  2N04 A;  3AG1 B;  2W6I G;  5CMU A;  4ZI7 A;  4GKJ O;  1N34 B;  1E79 G;  1I5X A;  1Q5O A;  1GN3 A;  3CJH B;  3WG7 B;  2QDO A;  2ZIN A;  3ZN0 A;  3U11 A;  3LNN A;  4BW9 A;  3MDS A;  4QPK A;  4LFB O;  1WJZ A;  2MW2 B;  3A8T A;  2WWW A;  3ZHV A;  2FTK A;  1DLB A;  3RYI A;  2MK3 A;  1NBM G;  4OPH A;  2BCC H;  5D5Q A;  5IY5 C;  4U7O A;  5DEC A;  1YJN V;  1SA0 A;  4UCT A;  2OTJ V;  3K79 A;  5LOV B;  1R3J C;  3L75 H;  1Z5V A;  1A32 A;  2ATK C;  3W7W A;  3CRA A;  4LF9 B;  1NTZ H;  3N2G A;  3PJS K;  5B1B B;  1VQK V;  3LSS A;  4LF5 O;  2LGQ A;  2Y69 B;  1QLE C;  3T4D A;  3STL C;  4ZI7 B;  1FYJ A;  2LW1 A;  2X6B A;  1EN4 A;  1PNK A;  2EIJ B;  3B2E E;  5KMG A;  2P67 A;  1N32 O;  1JMK C;  4LC1 A;  5LA6 A;  4JI1 B;  3TCU A;  5DN6 G;  2X7R B;  3QF7 A;  1QQC A;  4I9W A;  5B1N A;  1N8R W;  1Q6H A;  4DV7 O;  2X0L A;  5EBW C;  4YXW G;  3ABK B;  5EBM C;  5LGT A;  1LUW A;  5LBQ A;  5L3B A;  3OR7 C;  4GKK B;  1K34 A;  3L9D A;  1K9M W;  1CP9 A;  2F66 C;  3CRM A;  3ZRW B;  4I4T A;  1ZTE A;  3FYE B;  1Y74 A;  3G71 V;  4P30 A;  1ZL8 A;  2HG5 C;  4AQY B;  4UVA A;  4Z1V A;  1M4U A;  3SJC C;  1ARO P;  1Y4M A;  4UV9 A;  3QNE A;  1N33 O;  2HLD G;  4GX5 A;  2GUZ B;  1IBK B;  4J7Z A;  3D36 C;  3WG7 C;  3ETG A;  5LGN A;  4WFG A;  1XMO O;  3CRQ A;  5J9P C;  4ZHQ B;  2GTA A;  2XAG A;  3ASN B;  4X1I B;  1NR7 A;  3BAA A;  2X6C A;  4DV4 O;  5CA3 A;  1S5L Z;  3OUS A;  3VQX A;  5FNV A;  4DR1 B;  1H2L A;  1KB9 F;  3DSQ A;  1COW G;  2OCC B;  1AI5 A;  1MG1 A;  3ZED A;  4LF8 B;  4DW1 A;  1ENV A;  3MD0 A;  4F6R A;  2CTW A;  5JWP A;  1XHZ A;  3QVN A;  3KCY A;  4HZ3 A;  5L3C A;  4JI3 O;  1O9H A;  1MSD A;  1BCC H;  2ZDI C;  3S3W A;  1HNX O;  3VQW A;  4NVP A;  3Q4H A;  2EIJ C;  4LF4 O;  4MT8 A;  3IAY A;  2UXN A;  4TT3 G;  1KMI Z;  1H38 A;  3MHH C;  2FML A;  2NR5 A;  3STZ C;  4L8J A;  4MVR A;  3FD9 A;  1YZB A;  4J42 A;  5IT9 N;  4FFK A;  3H1L H;  1VF5 B;  1XNR O;  5JCO A;  2GBO A;  3RYF B;  2W0F C;  1X4T A;  4J11 A;  1M93 A;  2HJF C;  5JVD A;  2EJR A;  5EZY B;  2RJZ A;  1M9N A;  2QKS A;  4JI7 O;  2VQF O;  5CB4 B;  1AP5 A;  4O4I B;  5LA6 B;  1JFF A;  3SYP A;  1IBM B;  2Q0A A;  4H33 A;  1NI8 A;  4R6Z A;  2Q0O C;  4OGQ B;  4DV3 B;  4I7Z B;  1HR0 O;  2ZNJ A;  3H1J H;  5L3D A;  4AI8 A;  1EZJ A;  1D5A A;  2ZM6 O;  4H13 B;  5L3G A;  2X6A A;  4RUF A;  1K4D C;  4U3J B;  1R3K C;  1GM9 A;  2VQF B;  1TVK A;  3DC6 A;  5IJ0 B;  3ZMS A;  3JCZ A;  5EZY A;  4NXN O;  4X1Y A;  1FS0 G;  3K58 A;  2HHH O;  3HKC B;  3CYO A;  4KUM A;  2Z0A A;  4RO2 A;  1B06 A;  1WAZ A;  1SET A;  3E86 A;  2G38 A;  4K0K O;  4EFE A;  3SPH A;  3K3W A;  2JVD A;  4LF4 B;  3H1I H;  4ASU G;  1KUQ A;  3B8M A;  4QE7 A;  1NU1 H;  3DTU B;  5J2T A;  3G80 A;  1OCZ B;  1EN5 A;  1WP8 A;  5B1B C;  3J80 N;  4B3S O;  3FB7 C;  3SYQ A;  1SZX A;  5EBL C;  3P3N A;  1QLE B;  2NN4 A;  2KG7 A;  4FIP C;  3HR0 A;  1I5Y A;  1PV0 A;  3RYI B;  2Q68 A;  3OEE G;  3CRC A;  5B1A C;  1DK1 A;  1K4C C;  3L70 H;  2P06 A;  4B7E A;  2CTP A;  3RVY A;  1S3J A;  2LW7 A;  2VS0 A;  1YF2 A;  2PI5 A;  3U0Z A;  1P84 F;  2WLI B;  1I94 O;  4JI2 O;  4JTC B;  2H94 A;  2UUB O;  3HPL C;  4NKG B;  2PYJ A;  5IYB O;  1AR4 A;  4U7N A;  1VEW A;  2E76 B;  5L3F A;  5IDJ A;  4NXM B;  2UXD O;  1FAF A;  1S5J A;  3OMA B;  3SPJ A;  3E83 A;  3OE7 G;  1M90 W;  1K33 A;  4FZ1 A;  1E1Q G;  1HP8 A;  2DYR C;  3F5T A;  4MTF A;  4O4L A;  4EB6 B;  1XHX A;  2UUA O;  2Q69 A;  4CZZ A;  1GM8 A;  2ZE5 A;  2PZS A;  3ML0 A;  2R9A A;  4FM0 A;  1AI7 A;  2CH7 A;  1JVM A;  3L72 H;  3C90 A;  3BAB A;  3OM3 B;  3D36 A;  5E1A C;  3HB3 B;  4X66 B;  3O65 A;  1OCR B;  1NH2 B;  1WB8 A;  1P7B A;  3CCR V;  4PHZ A;  4DV0 O;  4DO2 A;  3UM7 A;  3OUF A;  4IHJ A;  4U3J A;  3HKD B;  1Y67 A;  2PF4 E;  1XNQ O;  3QO8 A;  5CA0 B;  1JOY A;  3FB6 C; 
#chains in the Genus database with same CATH homology
 2V7Q G;  3W7X A;  1QR9 A;  3K0D A;  1F51 A;  3AG3 C;  2D3O W;  2WLL B;  3GWO A;  4JTA B;  3JD0 A;  2IW5 A;  1SZT A;  1XL6 A;  3IGA C;  5GW7 A;  4MVO A;  4PA7 A;  1Q81 W;  1DF4 A;  2EIL C;  1OHH G;  3LDC A;  3ABL C;  3OFN G;  2GSM B;  2JK5 C;  4N23 A;  1RPR A;  3ABK C;  2ZR3 A;  1YJW V;  1GMG A;  1H8E G;  4I5S A;  2WLI A;  4UV8 A;  4R8C A;  4KFM A;  1VQ5 V;  1R3I C;  1WLE A;  3P30 A;  1K97 A;  2F43 G;  2WSS G;  2XAJ A;  3CCV V;  1VQP V;  1NR1 A;  3AG1 C;  4G28 B;  4QIW F;  4E2L A;  3ABL B;  2DQ0 A;  4JAV A;  4R7C A;  3X2Q B;  5IY5 B;  5BZB A;  4BIU A;  1JJ2 U;  2JEX A;  3E8H A;  2A0L A;  1FFT B;  3AEI A;  1DTO A;  3ABT A;  1QBZ A;  5C93 A;  2IH1 C;  3ZN1 A;  1K3E A;  2YSU B;  1LNQ A;  4FJC C;  1Q86 W;  1E1R G;  1BL8 A;  1F23 A;  2AHZ A;  3ZMZ A;  2IJI A;  4Q20 A;  1VQM V;  5FL7 G;  1PNL A;  5LHH A;  2M7W A;  1QVG U;  4G2K A;  3W7S A;  4ZKI A;  1PL0 A;  2WPD G;  3F5W C;  4MW3 A;  1SES A;  4WFB V;  4P9P A;  2Z3Y A;  4FMT A;  4JPR A;  1NVP B;  5IYC O;  3NXS A;  3UKM A;  2C2A A;  4MVU A;  3LNM B;  2ITC C;  1CPY A;  3AG1 B;  4RQE A;  3W7U A;  2W6I G;  1BHB A;  1MSW D;  3E89 A;  4X89 A;  5CMU A;  1S0V A;  1H8H G;  4RAI A;  1E79 G;  1I5X A;  3WG7 B;  2IU3 A;  1YTF D;  1GM7 A;  3ZN0 A;  2XAF A;  4JGS A;  1VQ9 V;  1QLN A;  1AI4 A;  4QJF B;  3ASO C;  5LHI A;  4QPK A;  1NQT A;  3T2M A;  3AG2 C;  3R65 A;  4G27 B;  4P9O A;  1OCO C;  2WWW A;  2FTK A;  4X88 A;  3E8F A;  1DLB A;  5B1O A;  2MK3 A;  1NBM G;  1L1F A;  4MTG A;  4TSF G;  4U7O A;  5IY5 C;  3ABU A;  4X8A A;  2Y69 C;  4PA9 A;  1YJN V;  5L3E A;  2OTJ V;  2DYS B;  3K79 A;  3QO5 A;  1R3J C;  1W0K G;  3SPC A;  4BW5 A;  2ATK C;  4XDK A;  3ZRS A;  1YIT V;  4MVZ A;  3W7W A;  4UVC A;  1VQ6 V;  5KUK A;  1OCO B;  1NKD A;  2H8P C;  5KA6 A;  1OCR C;  3PJS K;  1FXV A;  5B1B B;  1VQK V;  3LSS A;  5EC1 C;  2EIK B;  2Y69 B;  1QLE C;  3T4D A;  3STL C;  4WFH A;  3RW0 A;  1R73 A;  1Q7Y W;  5B3S C;  1ZWI C;  4RQF A;  2X6B A;  1JX9 A;  1PNK A;  2EIJ B;  3VOU A;  2WLK A;  2P67 A;  4PA3 A;  1PD3 A;  2IJH A;  2QTO A;  4LC1 A;  3TCU A;  1KP3 A;  2EZO A;  5DN6 G;  4UXN A;  3EHB B;  1FXH A;  2X7R B;  1NVP D;  1NJI W;  4ZBM A;  3CMA V;  1AJN A;  1QVF U;  2LP7 A;  4JF3 A;  3CCL V;  4I9W A;  3JD1 A;  4LBE C;  5B1N A;  2B1G A;  2XAH A;  1N8R W;  2AHY A;  3GB7 C;  1S5H C;  4JYB A;  1V55 B;  3JD3 A;  2X0L A;  5EBW C;  4YXW G;  3ASO B;  3LDE A;  4JAS A;  3ABK B;  1V54 C;  4MVS A;  3BY6 A;  5EBM C;  5LGT A;  1YTF B;  4XBF A;  5LBQ A;  5L3B A;  3OR7 C;  3FB5 C;  1K34 A;  2JEU A;  2XAQ A;  2OTL V;  1K9M W;  1CP9 A;  3SPG A;  2EIM B;  5CBG A;  1HWY A;  5HFM A;  3ZRW B;  4OXS A;  1XL4 A;  1KQS U;  3FYE B;  1KC8 W;  1TUE B;  2ZXW B;  3JYC A;  3G71 V;  4P30 A;  4GX2 A;  2HG5 C;  5H9C A;  4UVA A;  4GX0 A;  1ARO P;  1Y4M A;  3IFX A;  4UUJ C;  4UV9 A;  1BMF G;  3QNE A;  3I55 V;  3SYC A;  3CME V;  1VQ8 V;  3A0R A;  2HLD G;  2Y48 A;  4GX5 A;  3SYA A;  1M56 B;  2K1E A;  2NLJ C;  2EIN B;  5CBH A;  1KD1 W;  3WG7 C;  4GX1 A;  3ETG A;  5LGN A;  4WFG A;  2XAS A;  1AI6 A;  5B3S B;  5J9P C;  2XAG A;  1VQO V;  3ASN B;  3CP1 A;  4CBC A;  1OCC C;  1OZ0 A;  1R6N A;  2OCC C;  5IYD O;  1NR7 A;  3ZMV A;  1V55 C;  2KB1 A;  2EIM C;  4QE9 A;  2X6C A;  1PKX A;  3ETD A;  5CA3 A;  1F4N A;  3OUS A;  2BOB C;  4LP8 A;  3CCE V;  2R9R B;  2EZP A;  4FPP A;  3OMI B;  2ZDI A;  4J9Z B;  4TWK A;  2A9H A;  2PI4 A;  3DGE A;  3ZRW A;  2R9I A;  2HKO A;  3M99 B;  4MTO A;  1COW G;  2OCC B;  4WFF A;  3E8B A;  2Q6A A;  1AI5 A;  1MG1 A;  3ABM B;  1ENV A;  3MD0 A;  3CC4 V;  2IU0 A;  3CC2 V;  2JIZ G;  4HZ3 A;  4F4L A;  1GK9 A;  4QPJ A;  3RBZ A;  5L3C A;  1K92 A;  2Q67 A;  1EBO A;  1M56 C;  2ZDI C;  4JAU A;  1YIJ V;  1JPX A;  1Q82 W;  1PNM A;  2HR3 A;  2EIJ C;  4P2Z A;  1W0J G;  3LUT B;  2DYS C;  3P32 A;  4MT8 A;  3ETE A;  2UXN A;  4TT3 G;  4UVB A;  3CCQ V;  2QA4 V;  1H38 A;  3MHH C;  4EKW A;  4GCZ A;  3FYI B;  4J9Y B;  3STZ C;  4MSW C;  5CBF A;  4MVR A;  3OW2 U;  1ORQ C;  3G4S V;  3IC7 A;  3BEH A;  4QNH B;  3X2Q C;  4H37 A;  1K73 W;  2EIK C;  2JDI G;  2QEX V;  4PDM A;  2W0F C;  3T4Z A;  1V54 B;  4PEL A;  1OCC B;  1YI2 V;  2HJF C;  2EJR A;  3SPI A;  5LGU A;  3OAA G;  3W7T A;  1M57 B;  2Z5U A;  2DWE C;  1CEZ A;  1M9N A;  2QKS A;  3JD4 A;  1ROP A;  3ZMU A;  2IJK A;  1G4Y B;  3VBB A;  2XOK G;  4N21 A;  3TET A;  4HYO A;  1FXK B;  3K08 A;  5KA5 A;  2YEV B;  3SYP A;  1AJP A;  4H33 A;  2DWD C;  1JCH A;  3MHS C;  4R6Z A;  3CD6 V;  5KUM A;  4XDL A;  1K7D A;  3SYO A;  1NH2 D;  1M57 C;  3CC7 V;  3QO7 A;  1EFR G;  1KEC A;  2QM8 A;  2CK3 G;  2WLL A;  5L3D A;  1EZJ A;  3CCM V;  1VQN V;  4WF9 V;  1SER A;  1R3L C;  1FXK C;  5L3G A;  5H6Q A;  2X6A A;  2LFR A;  3H01 A;  2DW4 A;  4Z1M G;  2YEV A;  4JTD B;  4RUF A;  1K4D C;  1GO3 F;  3OMN B;  1R3K C;  1JQ0 A;  1GM9 A;  3G6E V;  4RUE A;  4MVM A;  3ZMS A;  3D3I A;  1H2G A;  3JCZ A;  3B8N A;  1FS0 G;  4L87 A;  4FK5 C;  3T1C A;  2WLH A;  4PDL A;  5HFL A;  1FXK A;  3CYO A;  4KUM A;  4RO2 A;  3I56 V;  2XND G;  1SET A;  3E86 A;  4PA6 A;  1S72 V;  4GT1 A;  1RM1 B;  4LCU C;  1OCZ C;  2HFE C;  3E35 A;  1BHA A;  3SPH A;  1K5S A;  2EIN C;  3CCU V;  3K3W A;  4MTX A;  3ZMT A;  3ZIA G;  3ZRX A;  2HVJ C;  4ASU G;  3B8M A;  2QM7 A;  2NNU A;  4KP4 A;  4QE7 A;  2WLM A;  3DTU B;  1J95 A;  1RM1 C;  1KKD A;  1OCZ B;  3RVZ A;  4PDR A;  3OR6 C;  5B1B C;  1KP2 A;  3ABM C;  3FB7 C;  1MOF A;  1Y66 A;  2ITD C;  1G8M A;  5EBL C;  3SYQ A;  1QLE B;  1K8A W;  1QR8 A;  2ZQM A;  4MW8 A;  2WLJ A;  3AG4 B;  2P90 A;  4FIP C;  1P4R A;  1WPX A;  1I5Y A;  1YJ9 V;  2WLN A;  2DQ3 A;  3E8G A;  2Q68 A;  3OEE G;  5B1A C;  1K4C C;  1S76 D;  2BOC C;  3B77 A;  2QE7 G;  5EK0 A;  3ZCC A;  3TK1 A;  2IH3 C;  3RVY A;  1VQ7 V;  1SRY A;  5H6R A;  1VQL V;  2ZD9 A;  1S3J A;  1M1K W;  2PI5 A;  3LSQ A;  4JYC A;  4BAY A;  2P6J A;  2WLI B;  3CPW U;  3CCJ V;  3JD2 A;  4JTC B;  2H94 A;  3HPL C;  5DM6 V;  1MAB G;  2V1D A;  1QCE A;  3AG3 B;  5IYB O;  2WAM A;  4U7N A;  5L3F A;  3K06 A;  5IDJ A;  3F7Y C;  1AR1 B;  3OMA B;  3SJQ C;  4PDV A;  3SPJ A;  3EFF K;  3FB8 C;  2W6J G;  1DF5 A;  3K9A A;  1RPO A;  2ZXW C;  4MS2 A;  3E83 A;  3OE7 G;  1GTO A;  4PA4 A;  1M90 W;  1K33 A;  3WFV A;  1VQ4 V;  3AG4 C;  3LDD A;  3AG2 B;  4WFA V;  1E1Q G;  3ASN C;  2A79 B;  1YSC A;  3F7V C;  2DYR C;  4MTF A;  5CN0 A;  4DXW A;  4WFE A;  1YHQ V;  2Q69 A;  3FKS G;  2OT5 A;  4CZZ A;  5B1A B;  1GM8 A;  3KG2 A;  2HVK C;  1R6K A;  1THZ A;  5LHG A;  3ML0 A;  4HAM A;  2P7T C;  3ZRV A;  1AI7 A;  1IXM A;  1AJQ A;  2LFS A;  3K0G A;  3E2E A;  2UXX A;  3OGC C;  1JVM A;  3K04 A;  3CXC U;  1UJW B;  4BIZ A;  1B6Q A;  3OM3 B;  3D36 A;  5E1A C;  4XDJ A;  1W2B U;  2DYR B;  3HB3 B;  3ZJZ A;  4R50 A;  1F4M A;  2JJ1 G;  1OCR B;  3OEH G;  1NH2 B;  2B1I A;  1P7B A;  3CCR V;  2JJ2 G;  3UM7 A;  2GHY A;  4DO2 A;  2EBO A;  3OUF A;  3CCS V;  2IJJ A;  2EIL B;  1S77 D;  3K03 A;  2B5U A;  4WCE V;  2ZR2 A;  4MVQ A;  1GKF A;  5EC2 C;  3QO8 A;  1JOY A;  1K5Q A;  3FB6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...