2BOCC

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2bocC00
4BW5A 5EK0A 5EBMC 3FB8C 1OCOC 4MW8A 3E89A 2Q6AA 2WLIB 2WLJA 4KFMA 4LBEC 3TCUA 4WFHA 4WFGA 3RW0A 1P7BA 3K04A 3OUFA 1R3IC 2DWEC 3R65A 2OCCC 3SYQA 2HVJC 4XDLA 2BOCC 2IH1C 1OCZC 4GX0A 3ABMC 1LNQA 1R3JC 1R3KC 1V54C 2A9HA 2K1EA 4JTCB 1V55C 4R8CA 3K0DA 3LNMB 4RO2A 4P2ZA 4LP8A 2WLNA 3RVZA 2X6AA 3K06A 3E8BA 4J9YB 3E8FA 3SPGA 2HG5C 2NLJC 3LDCA 5B1AC 1XL4A 4ZBMA 1K4DC 2HJFC 4MTFA 2ITDC 2HVKC 3T1CA 1QLEC 2Q69A 2KB1A 3F5WC 3OUSA 2WLLB 4GX5A 4MVRA 4PA4A 2WLMA 4HZ3A 5CBFA 4MVMA 2A79B 4MSWC 5B1BC 2H8PC 2W0FC 2EILC 4G27B 5EC2C 3AG1C 3LUTB 4MTOA 4PDLA 3SJQC 4MW3A 2P7TC 3AG4C 2ITCC 4GX2A 3K03A 2A0LA 4GX1A 3ZRSA 3F7VC 4R7CA 5CBHA 3WG7C 5IY5C 1S5HC 2EIMC 2ZD9A 4I9WA 4PDMA 1G4YB 3OR7C 5CBGA 4PA6A 4MVOA 2IH3C 4PA9A 3LDDA 2ZXWC 3OR6C 4QE9A 4X89A 3BEHA 3RVYA 4WFFA 4JTDB 3ZJZA 3F7YC 2WLIA 1BL8A 4MTGA 1R3LC 4H37A 2DYRC 3ASNC 4X8AA 2ATKC 5BZBA 4TWKA 2WLLA 2EINC 2WLHA 4XDKA 5KUMA 4RAIA 5E1AC 1ORQC 3SYCA 4PA3A 5B3SC 3FB6C 2WLKA 4PDVA 1K4CC 2QKSA 1JVMA 3IGAC 5EBLC 3SPHA 4F4LA 1J95A 4MVQA 2EIKC 3EFFK 3KG2A 1KKDA 4LCUC 4UUJC 2EIJC 3T4ZA 3SYOA 4G28B 4J9ZB 1M56C 4EKWA 2BOBC 3SPJA 3VOUA 4P9PA 3RBZA 3E8HA 2YEVA 2DWDC 4PDRA 5EC1C 3JYCA 4HYOA 4RUEA 3ABLC 3UKMA 2JK5C 4OXSA 4MVSA 1ZWIC 5J9PC 5KUKA 3E8GA 4XDJA 2QTOA 3UM7A 3AG3C 3GB7C 3PJSK 3T4DA 2AHZA 3E86A 3SPCA 3X2QC 3TETA 4X88A 4RUFA 1XL6A 3LDEA 4MVZA 2DYSC 4CBCA 2HFEC 4P9OA 4MVUA 4PA7A 3STZC 4H33A 4MS2A 2X6BA 3ABKC 3IFXA 4WFEA 4DXWA 2AHYA 3FB7C 3K08A 3STLC 2Q68A 2Q67A 1OCRC 2Y69C 3SYAA 4P30A 3SYPA 2R9RB 3FB5C 3HPLC 3K0GA 3T2MA 4JTAB 3SPIA 4QNHB 3AG2C 3ASOC 3E83A 3OGCC 4QE7A 4R50A 2X6CA 1M57C 1OCCC 5EBWC 4R6ZA
chains in the Genus database with same CATH superfamily
2QA4V 1GN3A 1CP9A 3H01A 1XMOB 3A2FA 1GAXA 2F66C 1NI8A 1NH2D 1B3QA 5IJ9B 2HEPA 1NQTA 1RM1B 3K9SA 4G2KA 3ZMUA 2VRZA 3RYHA 2UUAB 1BQ0A 3K06A 4UV9A 1ZUQA 2ZE6A 3ZRWA 1M57B 5DN6G 2YIBA 4O4HA 4I50A 1OCOB 3RN4A 2WLMA 4HZ3A 5H6QA 1N33O 1AP6A 3CHXA 3AG1C 3FD9A 5LXTB 4AQYO 4DV2O 2JVDA 3FX7A 4LF8O 4QE9A 2ZXWC 3CRQA 2PYJA 1YF2A 1NT2B 1IVSA 2L35A 3BVOA 5DM6V 4X66O 3ASNC 3L74H 4X8AA 3HKCB 1TVKB 1BZKA 5E1AC 3SYCA 1E1RG 1YIJV 3BPZA 2HKOA 4GZRB 2ZIOA 4UUJC 3HKBB 1GM9A 4GT1A 2E75B 2Y4TA 1ZWIC 3HKEA 1WAZA 1AILA 1R6NA 1G6UA 1M93A 4X9QA 3CJHB 5IYCO 1K3EA 1IXBA 1MOFA 4B3TB 3N2KA 5CA1B 2V1DA 2AHYA 2PYLA 5LXTA 3LSSA 5KHJA 1H2GA 1OZ0A 2Q68A 5CA3A 2LGQA 4BWAA 2QM8A 4EFEA 5IYBO 2W0XA 1MNGA 2EIKB 4KP4A 2XT9A 2ODMA 1PD3A 4FM1A 1M56B 3AG2B 1MSDA 3FAVA 2PI4A 1Q8IA 2UUAO 4TOIA 2GDSA 1MA1A 3K59A 2HVJC 4ZI7B 1IBMB 1SQQH 4O4LB 3G67A 5A2QN 3DXRB 3CCRV 4TSFG 5LYJB 1R3KC 3R66A 1XNQB 1QVFU 1VQ4V 5CA0B 1FYJA 3G80A 1FS0G 1GKFA 2Q73A 2ETNA 5CB4B 2GTAA 2OT5A 4JAVA 2YIAA 4FJCC 4ASUG 1Y74B 1OCCB 3AK3A 3RYCA 3J81N 2PZSA 2Q0OC 4DR5B 3F5WC 4GX5A 4I55B 2QKAA 1MMMA 1QU7A 4JI1B 4EB6B 4GX1A 3BA9A 3RWRD 5JJNB 3L72H 1TUBA 3PN1A 4MVOA 1JPXA 2JEUA 2XHBA 2LFSA 3TK1A 1R3LC 4H37A 2OIGA 3OW2U 4J42A 3BCCH 4D7SA 4ZI7A 3ZRXA 4B3RB 4PA3A 4TUYB 3B77A 4LNUB 3DXRA 4MVQA 3OEHG 4B3TO 3T4ZA 2OIEA 4FMTA 3SPJA 4X1YB 1RSOB 4K0KB 4RUEA 3E35A 4FVMA 3W7TA 3K58A 2QTOA 5EIBD 1JX9A 1SESA 3P3NA 1IXMA 2Q4PA 5LHIA 3ZN1A 4P9OA 3CC2V 1XQ8A 4Q20A 1K7DA 1AI5A 2WA3A 1HWYA 3ABKC 4DXWA 4EB6A 3ICXA 2HR3A 3OFNG 2KKWA 2W6JG 4JI0B 3E83A 2YI9A 2B9ZA 2KQXA 1N32O 2BTOA 5EK0A 1AI4A 1XNQO 1YTFB 4WFGA 4X1KB 1AJQA 1VQLV 4JYBA 4YIOA 4TUYA 2DN9A 2LQTA 4D7TA 4FLUA 3M8AA 4LNUA 3MD0A 1WB7A 4N21A 1P4RA 2QKCA 4DR5O 3ZMZA 2UXCO 3E22B 1JJOA 4JYYA 1H38A 2X0LA 4O4IB 4HNAA 3M99B 3E8FA 3QNEA 5LP6B 1I5YA 4J7JA 5B1AC 4ZBMA 4DV0B 2HVKC 1HDJA 1RFYA 1I08A 3JSLA 5JCOA 2A79B 2Z5UA 4UCVA 3H1JH 1O9HA 1VQ6V 4B3RO 3ETQA 4PA9A 5LOVB 3OR6C 3QO7A 2YIDA 2VQEB 4X1KA 5TISZ 1P49A 5L3BA 4K0KO 4X62B 3CE2A 1AI6A 4JF3A 2QJ1A 1D5AA 1QHTA 4DR4B 1QLNA 2EBOA 3CRRA 2JS5A 3GVMA 4DR2B 1XNRB 5KHIA 3WU2Z 5EBLC 1J95A 3N27A 2UUBO 2GTSA 2R70A 1VARA 2BOBC 3RBZA 3H1HH 2ZQMA 2EILB 3L75H 3ZHRA 2EJ7A 4DUYO 2CDYA 1NBMG 1P7GA 2IM9A 3T4DA 3W7SA 3E86A 3SPCA 3W7XA 1XDCA 1T5EA 2YUAA 2EULA 4RUFA 2IW5A 4IIJB 2Q7EA 3K3WA 4TV8B 1IURA 2P90A 1AR5A 1EBOA 2P6JA 1MZFA 5EZYB 5LOVA 1M57C 5HFLA 4YXWG 3D36C 3CYOA 5FL7G 4CH5A 1OCOC 1FFTB 2Q6AA 4LBEC 3JAMN 1YTFD 4YJ3B 2WA4A 2QE7G 4NXNB 1N0JA 4DRXB 4YJ2A 2IH1C 2XNDG 1BT8A 5JH7B 2RMKB 4I4TB 1YDXA 3AG7A 4ICGA 2VWJA 1XBLA 2MK3A 2ZT9B 4JTCB 3LNMB 2Y69B 2G38A 1ZL8B 1V55B 3UT5B 4TV9A 2A3QA 1HNWB 4QPKA 3CCUV 4AI8A 4TV8A 2JJ2G 2P4KA 1SRYA 2Y0PA 2W0FC 2VQEO 2C2AA 2NNUA 5K1PA 2JEXA 5GTIZ 4X62O 3B40A 5JQGB 4DR4O 5EIBC 2KG7A 2E74B 4DR2O 3AK2A 4NKGB 5BMVB 2MW2B 3ZMSA 1V54B 3E2EA 1NTKH 2EZPA 5BZBA 1QQCA 1Y76B 2WLLA 2ZINA 1G8MA 4N23A 2AZ2A 5JH7A 2UXNA 1IZ3A 4I4TA 1Q6UA 3HR0A 2EIKC 2VS0A 3N2GA 5JVDB 4FLVA 1M56C 1PKXA 3VOUA 1TAEA 2V7QG 5EC1C 4OPHA 5JJEB 5J9PC 4X1IB 4W4KA 2BCCH 2UU9B 3UT5A 4X88A 2QWRB 3LDEA 3JCUZ 4YIPA 1B6QA 1H2LA 5IJ0A 3CC7V 4BIZA 4DR7B 1HW7A 3OE7G 3FB7C 1Q90D 2P5OA 3RGBA 3QO8A 5KA5A 3SYAA 4NXNO 1M5IA 1Q6IA 2UXBB 3ZHVA 4H44B 1SERA 2X6CA 1AJPA 1OCCC 4J41A 2CAZC 1COWG 1AJNA 2ZNJA 3RW0A 2P22C 2O57A 4FZ1A 1TGOA 5IYDO 3AG3B 1N4CA 1WA8A 1VF5B 1ZLZA 1HNWO 3CRMA 1QR9A 1YXBA 5GONB 5FNVA 4P2ZA 2DMXA 3JALB 1A32A 2IBZH 2NLJC 1N36B 1AB3A 2GUZA 3ETDA 1JFFB 2ZNIA 1FD9A 1YZBA 2XASA 4JI3O 3B09A 2OTJV 1KD1W 2YC0A 2VWKA 3A0RA 4MW3A 3SR2C 2A0LA 1K5QA 3F7VC 2ZD9A 2CE4A 5BXZA 2RDCA 1S72V 4WFFA 3QO5A 4JAUA 2DOSA 2L6LA 1W2BU 3OD4A 1MZEA 4JI8B 4DV7B 1KMIZ 2UU9O 1FFXA 1PNLA 1H8HG 4EKWA 3M7MX 4G28B 1SA0B 4JI4O 1W59A 4U7NA 2JK5C 4DV5B 2JRIA 3GB7C 4DV1B 4I0XA 1N33B 1RPRA 1JFFA 2JDIG 2UXBO 3CCEV 4JYAB 4AQYB 3CSXA 2YICA 3WFVA 2ZM6B 1B04A 3L73H 3VBBA 4ZHQA 4PI2A 4K3AA 4OX9B 3TGUH 5LP6C 1G1XB 4YY3O 3KKYA 3AK1A 4FPPA 1WJZA 1L0NH 2E5LB 5EBMC 3FB8C 3RYHB 1E79G 3TCUA 1AI7A 2DWEC 1EN6A 4O2AA 4O4HB 3CXCU 5D5QA 1ZSPA 1XMQO 2BOCC 2M6YA 4JI6B 1SQPH 4HAMA 1R3JC 1VF7A 1R1BA 4KUMA 1BS3A 1Q3EA 1O9GA 3TXSA 2HLDG 4LF4B 2OCHA 2EX3A 3AEIA 2N74A 4J80A 4X65O 2DQ3A 1BE3H 2Q0AA 3UO3A 1TA8A 2QWPB 4NTYA 3BY6A 4FIPC 3L71H 3G4SV 2ILMA 4MSWC 2CGOA 5B1BC 2BTQB 2EILC 2F95B 3K03A 3WB0A 3ZRSA 3CB2A 4JI8O 4PA6A 4DV7O 1EZJA 3LDDA 5C93A 4AHCA 1F7YA 3HKEB 4LFCB 1QBZA 3CCSV 1N8RW 3H1LH 4DV5O 4DV1O 1VQ9V 3N2KB 4JPRA 4JYAO 1ENVA 1IBKB 1P84F 4LH7A 5KA6A 2ZM6O 4MVSA 2FKXA 2P67A 2R9IA 3EXAA 4OX9O 1DF4A 3X2QC 2QGNA 3FAVB 3JD3A 1I94O 2E5LO 4H33A 2KSDA 2BTQA 3QF7A 1EN4A 1W0KG 2FL4A 2QM7A 1SS3A 2Y69C 2R9RB 1L0LH 3K0GA 1YCIA 1H2KA 4KHPO 4JI6O 4H13B 4FLTA 1MSWD 2ZR2A 3DC5A 4LF4O 1PL4A 4OGQB 3RYCB 1R3IC 2YIBD 3SYQA 3F5TA 3SJAC 1YJ9V 4X64O 4NTWA 3W7UA 1XEQA 2K1EA 1V54C 1F23A 2YSUB 3K5OA 1TUBB 4LP8A 3RFRA 3D8CA 2ZE7A 2GV9A 4Z1MG 4IHJA 1H8EG 3LDCA 1KU9A 4Q6GA 1CPYA 1XL4A 2UXXA 1W0JG 1BHAA 3K5LA 2RQ6A 3APQA 4LFCO 4O2BA 1N32B 5KHHA 1PP9H 3H1IH 1CXZB 2OCCB 1WLEA 2K9PA 3OT7A 1SQFA 5JJJB 4DR6O 1IBKO 1K9MW 1BL8A 1VIBA 2AW9A 2DW4A 4FLXA 1ORQC 1Q81W 2UXCB 1JCHA 4J7ZA 3IGAC 3SPHA 4NTXA 3T1HB 3SJBC 3SYOA 4PELA 1NTZH 3QVNA 1K8AW 5LL6Y 2YEVA 2DWDC 5L3FA 2PUSA 4B7EA 4CH4A 4XDJA 3AG3C 2HP8A 4BW9A 3TETA 1ZX3A 2WPDG 1KC8W 4WBNA 1Y67A 4MVUA 1SQXH 1BMFG 1DK1A 1JJ2U 1SC5B 1FKAO 1YSCA 1H2NA 3GWKC 4P30A 4A5UB 4ZKIA 3OGCC 4R50A 5LMNB 2FTKA 2AXTZ 5B66Z 1HNXO 5LBQA 4MW8A 4IT5A 4HNAB 1NVPB 4U3FH 3CRAA 1Y66A 2UUBB 4DW0A 4E2LA 3RYIA 1SZTA 1XOUA 4DUYB 3ABMC 1Q43A 3EVKA 3G6EV 1SKVA 2X6AA 4F6RA 1PL0A 3ZHUA 4FLYA 1YHQV 1XREA 4UB8Z 3T1CA 1GH6A 4HBNA 2JGDB 1QR8A 3U11A 5H9CA 1VQOV 4WCEV 1FXKA 3OMNB 5IY5C 4J11A 3WG7C 1KQSU 1S5HC 2GHYA 1YJWV 2QWOB 4QGPA 4LF5O 4ZIBA 1HNZO 3ZJZA 1LR1A 3T1HO 3D3QA 3SDLA 3JARA 3JD0A 1FAFA 4UCSA 3RYFA 2DYRB 3FB6C 1K4CC 1PV0A 5IT9N 3NXSA 4CH3A 3DSQA 2ZDIA 1KUQA 4LF9B 2ADQB 3CP1A 2Q9LA 3S3XA 3LSUA 3OMIB 4B7KA 4GKKO 5B1NA 2ZR3A 4CS4A 5L3GA 3NR7A 1S77D 3UQ8A 5LMNO 2JGDA 4DV6B 1SF9A 1XILA 3OMAB 2X6BA 1Q86W 4WFEA 1EM1A 3BFRA 4CC6A 4YJ2B 2Y4UA 5CMUA 1D2DA 1GRJA 1BSMA 2JIZG 5IWAO 1H2MA 4UCUA 5C8YB 2JS3A 2EIJB 5EYPA 4PI0A 3ASOB 1XHXA 1EN5A 5IE9A 2D2CB 3ZN0A 1NVPD 4NYKA 4BAYA 3OUFA 3CWBH 4TV9B 4U3JA 3OTOB 3WB2A 4XDLA 2DYSB 1RM1C 2XAJA 2P06A 3ZCCA 1J5EB 2N04A 1AR4A 5LA6A 1VF6A 2KG7B 1UJWB 1B06A 1KB9F 1F51A 4MTFA 2JJ1G 5BR8B 2M7WA 3I56V 2Q69A 3OUSA 2WLLB 1HP8A 4MVMA 3CMAV 4MTXA 1M90W 4G27B 3LUTB 5CBHA 5CN0A 2ADPA 2XAFA 5FLXN 4PDMA 5KMGB 3OR7C 3N2GB 1OCZB 1PM9A 3UCSC 1Y4MA 4K8XA 5C8YA 3BEHA 2BSKB 2ZXWB 2YI8A 4LF9O 1K33A 3C3TA 2LP7A 2XAGA 3ETGA 3SJCC 3G6BA 4DR3O 5IJ0B 2QKSA 5KX5A 5L3EA 1QLEB 1Y6XA 4DV6O 3S3WA 3JATA 1VMGA 3ZRVA 3LNNA 4UB6Z 4NVPA 3CPWU 3DTUB 4JI3B 3UM7A 1BCCH 4L87A 2ZIMA 2HHHB 3STZC 3K79A 1U97A 2ARHA 4MS2A 3IFXA 4Z1VA 4OPAA 4EFBA 1WA8B 2Z3YA 5KMGA 3L70H 3FYIB 3CCJV 3OTOO 3AG2C 2HJDA 5FNVB 4BR6A 1NTMH 2BSKA 2CTRA 4FFBA 3W7WA 1J5EO 2Q8VA 4DW1A 2GUZB 3K9AA 2AZ0A 2OCCC 4JI4B 3CCVV 1GM8A 2WAMA 4JYCA 2PY5A 1KYOF 4QJFB 3JAWA 5BR8O 4JI2B 5LHHA 2OWOA 1AP5A 3VQYA 5IDJA 4F6EA 1X4TA 3QG5A 4X20B 1Q6HA 3P32A 3OM3B 2ITDC 4C7UA 1L1FA 5IYZA 4J10A 5L3CA 3HKDB 4O4JA 4YY3B 1WP7A 1VQNV 2P7TC 1FFXB 4I9WA 1G4YB 5CBGA 2IH3C 2IJKA 1LUWA 4DUZB 1XMQB 1GK9A 4I0XB 3ZBHA 1SETA 3D3IA 1JVMA 2XAQA 3KG2A 2HHHO 4H0LB 4LCUC 2OTLV 4X65B 1VP7A 4ZHQB 5KLVH 1I5XA 3UKMA 4UFZA 4OXSA 5KUKA 3KZIZ 4X20A 3JAKA 1FPOA 2ZE8A 5B5EZ 3JASA 5JCOC 4U7OA 3HKDA 1DF5A 3JD1A 4O2AB 4I7ZB 2EINB 5ITZA 4CC5A 3FB5C 3ABKB 4QNHB 4JTAB 2XTAA 1VEWA 3JD2A 4JI2O 4AILC 3ML0A 1EZVH 3L9DA 1S5LZ 2CK3G 2CH7A 3K5NA 2F43G 1LNQA 4IYHA 3ZMTA 3CMEV 1M4UA 2JGUA 2CUGA 1Z5VA 3IJ4A 1N0NA 2VQFB 1I94B 4K35A 2RNBA 1K4DC 1SQGA 3CXHF 2KB1A 1YVWA 1NU1H 4DUZO 1DTOA 4PV1B 4KHPB 3Q4HA 5FPOA 1F4NA 3JCZA 4LF6B 2OYQA 1THZA 1SQBH 2F1MA 5KHKA 2CTQA 4X64B 2IJIA 2ZE5A 4PDVA 4DV3O 3T1YO 2LGWA 2EIJC 3OGIB 4J9ZB 5A9GA 4UCTA 3JYCA 4KL1A 2Q7GA 3AG4B 1FJGB 4DK1A 1HR0O 4EEQA 4JGSA 1VQ5V 2DYSC 5J2TA 3K08A 1JMKC 3WB1A 1BQZA 4DR6B 4UCRA 4D6TH 1NR7A 5EBWC 4GYCB 5E79Z 4LWSA 4JV5O 2B5UA 1GN2A 1R6KA 3A8TA 4IHJB 1K73W 3O9OA 3R65A 2LFRA 2VQFO 4PD4F 3CCMV 1OCZC 4JZGA 4O2BB 4QIWF 2EZOA 1V55C 4R8CA 2B1IA 2RJZA 4CH6A 4L8JA 1UFIA 1NZ6A 1V9PA 4LF6O 1QLEC 4CZZA 5IJ9A 3RT3C 1S3JA 5CBFA 3OEEG 3OTFA 1BGYH 5H2FZ 1HNXB 1BHBA 3B8MA 1GN4A 3KCXA 1JOYA 2R72A 2QM4A 4X89A 5DEDA 3B8NA 3ZHSA 2YEVB 2Q7HA 3D36A 3JD4A 2Q5ZA 4RQEA 2ATKC 3KCYA 2YXLA 4XDKA 1FJGO 1K34A 4WBNB 1AROP 4NR1A 4PJ0Z 3IC9A 4BIOA 4LFBB 4F4LA 1XMOO 1GN6A 3EFFK 3ZEDA 4GUNA 4DR1B 3MHSC 3CS5A 3C3SA 2F93B 1Z2GA 2N05A 2EIMB 1S0VA 3GWOA 3HKCA 3C90A 3PJSK 1TVKA 5K1XA 2R9AA 4MVZA 2D3OW 4J7KA 1CEZA 1RPOA 1FXVA 1NKDA 2PF4E 3HKBA 3STLC 4JI7B 4W4LA 3RYIB 3FYEB 5LGUA 1HNZB 5J2UB 4LF5B 2UXDB 2F23A 4QE7A 2QDOA 1YEWA 4R6ZA 4BW5A 4TT3G 3G71V 1Q7YW 4UVBA 4FZ0A 4F6RB 3CJHA 1JA8A 1WN7A 1VQPV 1VQ8V 2RN9A 5CA1A 2YDEA 2GSMB 2A06H 2QTSA 4JI5B 4GKKB 1FXKB 1XUQA 3J80N 3IC7A 3K0DA 4RO2A 1OCRB 1NJIW 5H5NA 2HG5C 2P4VA 3ABUA 3P3PA 1XI1A 3JARB 2XAHA 3FKSG 1F4MA 1X59A 3RYFB 3ZX6A 1KBHA 3CCQV 4BIUA 3K57A 4O4LA 5IWAB 4NXMB 1JR9A 5LYJA 5J2UA 4RWUA 4UV8A 5CA0A 1WNSA 2B1GA 2H3OA 1NS1A 5CB4A 3CCLV 4LFBO 3CC4V 3IAYA 1Y74A 4DR1O 3CEIA 5D5PA 1Q82W 1DLBA 1QCEA 1KKCA 1R73A 4I55A 4DO2A 2EINC 1UPGA 4LR3A 3K5MA 2F4VB 4RAIA 2WLKA 4JASA 2UUCB 2BE3A 1H2SB 4ABMA 4LC1A 2XUMA 1IBMO 4LH6A 1M9NA 5JWPA 3MDSA 4PDRA 3EHBB 1M1KW 3B2EE 4CS3A 3VQVA 4LFAB 4JI7O 2UXDO 3J7AU 3CD6V 2NN4A 5EYPB 4FLWA 4PA7A 3BHPA 4U3JB 2QWNB 5LMUB 4LF7B 3THOA 2Q67A 3SYPA 5KAIZ 5B3SB 4X1YA 1RSOA 2FMLA 4WFAV 4DYLA 4JI1O 5LA6B 4JI5O 3E89A 4DR3B 2WSSG 2WLJA 4GLXA 4MT8A 5L3DA 3ABLB 1P7BA 3K04A 3I55V 2IJJA 1ZTEA 1U96A 3VQXA 5LGTA 4QPJA 2A9HA 5FPRA 3ZHQA 1KP2A 4NXMO 3E8BA 4J9YB 2IU3A 2DQ0A 2ZCEA 2Y0IA 3UO2A 2H8PC 5EC2C 4IL6Z 3SJQC 5KX5B 2LJ2A 3AG4C 2CTWA 3E22A 4GX2A 1N34B 2F4VO 5B1BB 4B3SB 4O4IA 2UUCO 1D5NA 3BAAA 3JATB 5LP6A 2E3CA 4JI0O 2W6IG 3DC6A 3TXQA 4Z2WA 2ZKOA 2PI5A 5KUMA 4LFAO 3O65A 3TJTA 1IBLB 1ZAUA 4XBFA 3ZHTA 1YI2V 1KKDA 2CGNA 3BRCA 4JAAA 3AG1B 5LMUO 4LF7O 2WWWA 2GBOA 2LW1A 4FFBB 4ZOLB 4GKJB 1RP3B 4KXRA 3X2QB 3ASNB 4DV0O 5AG2A 1ROPA 3JAWB 5LGNA 2YXHA 4CS2A 1PPJH 1EFRG 4IGGA 4B08A 2DJVA 1OV9A 3BABA 3OAAG 1AR1B 4K8ZA 1WPXA 1GTOA 1I0HA 2WLIB 4IIJA 4KFMA 2FYUH 5GTHZ 4DV4B 2PGGA 1WB8A 3P30A 5IYZB 4NB5A 1FXHA 1OHHG 1US6A 4O4JB 5EZYA 3QTCA 1XNRO 3ZMVA 4FK5C 2IU0A 1URFA 1Z5WA 2WLNA 5HFMA 1DGSA 3SPGA 1N34O 4B3SO 4YJ3A 4ZOLA 1IDSA 1SQVH 4DRXA 4MVRA 1JQ0A 3ABTA 4PDLA 4UXNA 2ITCC 5BY1A 2EIMC 2A7WA 2FB5A 2NR5A 1IBLO 4WF9V 1MABG 3FFQA 5LHGA 1ZL8A 4WFBV 1PNMA 1YITV 4JTDB 2WLIA 1SZXA 3JAKB 2CTPA 1S76D 3A0BZ 2QSAA 1E1QG 3JASB 1VQKV 1TUEB 2QWQB 3I5DA 4PHZA 2RCVA 1XHZA 1K92A 5JQGA 1GO3F 4GKJO 5ITZB 4P9PA 5BMVA 4HYOA 2PTMA 2Z0AA 1K97A 3SGIA 4FLZA 4UVCA 1PNKA 3CRCA 1Y76A 3ZS8C 1KP3A 1WP8A 1XL6A 3CX5F 4CBCA 2HFEC 4E4EA 5B1OA 1FXKC 1Q5OA 3DGEA 5JVDA 2CH7B 1OCRC 3APOA 1NR1A 4DV4O 3MHHC 3T2MA 3SPIA 4X1IA 1GMGA 3JSNA 5DECA 4B3MB 4DV3B 1GM7A 3VQWA 1LUVA 2H94A 4WFHA 5KHGA 2LO1A 4I5SA 3T1YB 4YHHB 1NH2B 2ZDIC 4GX0A 1HR0B 2QR4A 3Q4HB 3ABMB 2V4DA 2X7RB 3RVZA 4IYIA 3ETEA 2HJFC 2AGAA 4FM2A 3B4SA 2EJRA 4PA4A 2LW7A 4UCOA 1S5JA 4MTOA 5GONA 1MG1A 2XOKG 2DE0X 4R7CA 1KECA 4JV5B 4DR7O 3JALA 3ZIAG 2E76B 5GW7A 3U10A 5IY5B 3WG7B 3RVYA 1R6TA 3F7YC 3MAQA 4RQFA 4MTGA 2DYRC 1AVMA 4UVAA 4TWKA 2YXYA 2WLHA 2IJHA 5F2VO 4DV2B 5B3SC 4LF8B 4TQFA 5B1AB 1VQ7V 5J2TB 4FM0A 3H1KH 1YJNV 1VF6C 4X66B 3HB3B 4JZ2A 3E8HA 4GCZA 1L8DA 2Y48A 3ABLC 4DK0A 1VQMV 3E8GA 1IX9A 2AHZA 3U0ZA 4LWSB 3ZRWB 3LSQA 5KAFZ 1K5SA 3BA8A 4I50B 1N36O 1WPBA 4B3MO 1I7FA 5H6RA 1SA0A 4FFKA 1QNMA 1OJHA 3HPLC 2YS8A 3H9VA 3A0HZ 3ASOC 2QEXV 4YHHO 4I9QA 4TQDA 1QVGU
chains in the Genus database with same CATH topology
4BW5A 4TT3G 2EIJB 3G71V 2QA4V 1Q7YW 3ASOB 4UVBA 1COWG 3ZN0A 1NVPD 1AJNA 1CP9A 3RW0A 4BAYA 3H01A 3OUFA 1VQPV 1VQ8V 5IYDO 3AG3B 2GSMB 4XDLA 1NH2D 2DYSB 1RM1C 1QR9A 2XAJA 3ZCCA 1FXKB 1NQTA 1RM1B 3IC7A 3K0DA 4G2KA 4RO2A 3ZMUA 4P2ZA 1OCRB 1UJWB 1NJIW 3K06A 4UV9A 2HG5C 2NLJC 3ABUA 3ZRWA 3ETDA 1M57B 5DN6G 1F51A 4MTFA 2JJ1G 2M7WA 2XAHA 3FKSG 1F4MA 1OCOB 2Q69A 2XASA 3OUSA 2WLLB 3I56V 2WLMA 4HZ3A 3CCQV 4MVMA 5H6QA 2OTJV 4BIUA 3CMAV 4MTXA 1M90W 1KD1W 4G27B 3AG1C 3LUTB 3A0RA 4MW3A 5CBHA 2A0LA 1K5QA 2XAFA 3F7VC 4UV8A 5CN0A 2ZD9A 4PDMA 3OR7C 2B1GA 1OCZB 1Y4MA 4QE9A 2ZXWC 3CCLV 3CC4V 3BEHA 1S72V 4WFFA 3QO5A 4JAUA 2ZXWB 5DM6V 1Q82W 3ASNC 4X8AA 1W2BU 1DLBA 1K33A 2LP7A 1QCEA 1R73A 4DO2A 2XAGA 2EINC 3ETGA 4RAIA 5E1AC 1E1RG 3SYCA 2WLKA 1YIJV 4JASA 2QKSA 2HKOA 5L3EA 1PNLA 1QLEB 1H8HG 4LC1A 4UUJC 4EKWA 4G28B 1GM9A 1M9NA 4GT1A 4PDRA 3EHBB 3ZRVA 1M1KW 4U7NA 2JK5C 1ZWIC 3CPWU 3DTUB 3UM7A 4L87A 3GB7C 3CD6V 1RPRA 2JDIG 1R6NA 3CCEV 5IYCO 1K3EA 1MOFA 4PA7A 3STZC 3K79A 4MS2A 3WFVA 3IFXA 2V1DA 2AHYA 3LSSA 1H2GA 1OZ0A 2Q68A 2Q67A 5CA3A 3SYPA 3VBBA 5B3SB 2QM8A 2Z3YA 3FYIB 4WFAV 3CCJV 3AG2C 5IYBO 2EIKB 4KP4A 4FPPA 1PD3A 5EBMC 1M56B 3AG2B 3FB8C 1E79G 3E89A 2WSSG 3W7WA 2WLJA 3TCUA 4MT8A 5L3DA 3ABLB 2PI4A 1AI7A 1P7BA 3K04A 3I55V 2IJJA 3K9AA 2DWEC 2OCCC 2HVJC 5LGTA 3CXCU 3CCVV 1GM8A 2WAMA 2BOCC 4JYCA 4QPJA 4QJFB 4HAMA 1R3JC 3CCRV 5LHHA 4TSFG 1R3KC 5IDJA 2A9HA 4KUMA 1QVFU 1VQ4V 2HLDG 1KP2A 1FS0G 1GKFA 3AEIA 3E8BA 4J9YB 2IU3A 2DQ0A 2OT5A 4JAVA 2DQ3A 4FJCC 4ASUG 3P32A 1OCCB 3OM3B 2ITDC 1L1FA 3F5WC 4GX5A 3BY6A 4FIPC 5L3CA 3G4SV 4MSWC 5B1BC 2H8PC 2EILC 5EC2C 3SJQC 1VQNV 2P7TC 3AG4C 4GX1A 4GX2A 3K03A 3ZRSA 4I9WA 5B1BB 1G4YB 5CBGA 4PA6A 4MVOA 1EZJA 2IH3C 1JPXA 2IJKA 2JEUA 3LDDA 2LFSA 3TK1A 5C93A 1R3LC 4H37A 3OW2U 2W6IG 1QBZA 3CCSV 1GK9A 2PI5A 1SETA 3D3IA 5KUMA 3ZRXA 1N8RW 4PA3A 1JVMA 4XBFA 1VQ9V 3B77A 1YI2V 2XAQA 4JPRA 4MVQA 3OEHG 3KG2A 1ENVA 1KKDA 4LCUC 3T4ZA 2OTLV 4FMTA 3SPJA 3AG1B 1I5XA 4RUEA 3UKMA 2WWWA 3E35A 5KA6A 4OXSA 4MVSA 5KUKA 3W7TA 2P67A 2QTOA 1JX9A 1SESA 2R9IA 1DF4A 3X2QC 1IXMA 5LHIA 3ZN1A 3JD3A 4P9OA 4H33A 4U7OA 3CC2V 3X2QB 3ASNB 1K7DA 1DF5A 1AI5A 1HWYA 3ABKC 1W0KG 3JD1A 4Q20A 4DXWA 2QM7A 2EINB 2HR3A 2Y69C 1ROPA 3OFNG 2R9RB 3FB5C 3ABKB 2W6JG 5LGNA 3K0GA 4QNHB 4JTAB 3E83A 1EFRG 1QVGU 3JD2A 3OAAG 1AR1B 1MSWD 1WPXA 1GTOA 5EK0A 1AI4A 2ZR2A 2WLIB 4KFMA 3ML0A 1YTFB 4WFGA 1AJQA 1VQLV 1R3IC 4JYBA 3SYQA 3P30A 1YJ9V 2CK3G 1FXHA 3MD0A 1OHHG 2F43G 3W7UA 1LNQA 3ZMTA 4N21A 1P4RA 3ZMZA 2K1EA 1V54C 3ZMVA 3CMEV 1F23A 2YSUB 1H38A 4FK5C 2X0LA 2IU0A 4LP8A 2WLNA 5HFMA 3SPGA 3M99B 3E8FA 3QNEA 4Z1MG 1I5YA 1H8EG 3LDCA 1CPYA 5B1AC 1XL4A 4ZBMA 2UXXA 1K4DC 1W0JG 1BHAA 2HVKC 2KB1A 4MVRA 1JQ0A 2A79B 2Z5UA 3ABTA 1DTOA 1VQ6V 4PDLA 4UXNA 2ITCC 2OCCB 1F4NA 3JCZA 1WLEA 2EIMC 4WF9V 1MABG 4PA9A 5LHGA 3OR6C 4WFBV 1PNMA 1YITV 3QO7A 4JTDB 1K9MW 2WLIA 1THZA 1BL8A 2DW4A 5L3BA 2IJIA 1S76D 1AI6A 4JF3A 1E1QG 1ORQC 1VQKV 1Q81W 1TUEB 1JCHA 4PDVA 2EBOA 1QLNA 3IGAC 5EBLC 3SPHA 1K92A 1J95A 1GO3F 2EIJC 3SYOA 4J9ZB 4PELA 1K8AW 2BOBC 4P9PA 3RBZA 2ZQMA 2EILB 2YEVA 2DWDC 5L3FA 3JYCA 4HYOA 3AG4B 1K97A 4XDJA 4UVCA 1NBMG 3AG3C 3W7SA 1PNKA 3T4DA 3E86A 3SPCA 3TETA 4JGSA 2WPDG 3W7XA 1KC8W 1KP3A 4RUFA 1XL6A 2IW5A 1VQ5V 2DYSC 4CBCA 2HFEC 4MVUA 1BMFG 3K3WA 1JJ2U 5B1OA 1FXKC 1YSCA 3DGEA 2P90A 3K08A 1EBOA 1OCRC 4P30A 2P6JA 1NR1A 3MHHC 1NR7A 3T2MA 3SPIA 4ZKIA 3OGCC 4R50A 2FTKA 1M57C 5HFLA 4YXWG 5EBWC 3CYOA 5FL7G 1GMGA 5LBQA 1OCOC 4MW8A 1FFTB 2B5UA 1GM7A 2Q6AA 1R6KA 2H94A 4LBEC 1NVPB 1YTFD 4WFHA 1K73W 4I5SA 1Y66A 2QE7G 3R65A 2LFRA 3CCMV 1NH2B 2IH1C 2XNDG 1OCZC 4E2LA 2ZDIC 1SZTA 4GX0A 3ABMC 4QIWF 2EZOA 3G6EV 2MK3A 4JTCB 1V55C 3ABMB 3LNMB 4R8CA 2B1IA 2X7RB 2Y69B 3RVZA 2X6AA 1PL0A 3ETEA 1V55B 1YHQV 2HJFC 3T1CA 4QPKA 1QLEC 3CCUV 4CZZA 2EJRA 1S3JA 2JJ2G 4PA4A 5CBFA 1SRYA 3OEEG 2W0FC 1QR8A 2C2AA 2NNUA 4MTOA 5H9CA 2JEXA 1MG1A 4WCEV 1VQOV 1BHBA 1FXKA 2XOKG 3B8MA 3OMNB 4R7CA 5IY5C 3WG7C 1KQSU 1S5HC 1KECA 1JOYA 2GHYA 3ZIAG 1YJWV 4X89A 5GW7A 5IY5B 3B8NA 3WG7B 2YEVB 3RVYA 3ZJZA 3ZMSA 3F7YC 1V54B 4RQFA 3D36A 3E2EA 3JD4A 4MTGA 2DYRC 3JD0A 4RQEA 2EZPA 4UVAA 2ATKC 5BZBA 4TWKA 2WLLA 2WLHA 2IJHA 4XDKA 5B3SC 1K34A 2DYRB 3FB6C 1AROP 5B1AB 1G8MA 1K4CC 4N23A 1VQ7V 2UXNA 3NXSA 4F4LA 2EIKC 3EFFK 1YJNV 2ZDIA 1M56C 3MHSC 3HB3B 1PKXA 3VOUA 3E8HA 4GCZA 2V7QG 3CP1A 5EC1C 2Y48A 3ABLC 5J9PC 1VQMV 3E8GA 3OMIB 2EIMB 1S0VA 3GWOA 5B1NA 2ZR3A 5L3GA 3PJSK 2AHZA 4X88A 1S77D 3LDEA 3LSQA 4MVZA 3ZRWB 1B6QA 2D3OW 1K5SA 3CC7V 3OMAB 4BIZA 2X6BA 1Q86W 4WFEA 3OE7G 1CEZA 1RPOA 1FXVA 1NKDA 3FB7C 3STLC 5H6RA 3QO8A 5KA5A 3SYAA 5LGUA 3FYEB 5CMUA 3HPLC 4QE7A 3ASOC 1SERA 2QEXV 2JIZG 2X6CA 1AJPA 1OCCC 4R6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW5 A;  5EK0 A;  5EBM C;  3FB8 C;  1OCO C;  4MW8 A;  3E89 A;  2Q6A A;  2WLI B;  2WLJ A;  4KFM A;  4LBE C;  3TCU A;  4WFH A;  4WFG A;  3RW0 A;  1P7B A;  3K04 A;  3OUF A;  1R3I C;  2DWE C;  3R65 A;  2OCC C;  3SYQ A;  2HVJ C;  4XDL A;  2BOC C;  2IH1 C;  1OCZ C;  4GX0 A;  3ABM C;  1LNQ A;  1R3J C;  1R3K C;  1V54 C;  2A9H A;  2K1E A;  4JTC B;  1V55 C;  4R8C A;  3K0D A;  3LNM B;  4RO2 A;  4P2Z A;  4LP8 A;  2WLN A;  3RVZ A;  2X6A A;  3K06 A;  3E8B A;  4J9Y B;  3E8F A;  3SPG A;  2HG5 C;  2NLJ C;  3LDC A;  5B1A C;  1XL4 A;  4ZBM A;  1K4D C;  2HJF C;  4MTF A;  2ITD C;  2HVK C;  3T1C A;  1QLE C;  2Q69 A;  2KB1 A;  3F5W C;  3OUS A;  2WLL B;  4GX5 A;  4MVR A;  4PA4 A;  2WLM A;  4HZ3 A;  5CBF A;  4MVM A;  2A79 B;  4MSW C;  5B1B C;  2H8P C;  2W0F C;  2EIL C;  4G27 B;  5EC2 C;  3AG1 C;  3LUT B;  4MTO A;  4PDL A;  3SJQ C;  4MW3 A;  2P7T C;  3AG4 C;  2ITC C;  4GX2 A;  3K03 A;  2A0L A;  4GX1 A;  3ZRS A;  3F7V C;  4R7C A;  5CBH A;  3WG7 C;  5IY5 C;  1S5H C;  2EIM C;  2ZD9 A;  4I9W A;  4PDM A;  1G4Y B;  3OR7 C;  5CBG A;  4PA6 A;  4MVO A;  2IH3 C;  4PA9 A;  3LDD A;  2ZXW C;  3OR6 C;  4QE9 A;  4X89 A;  3BEH A;  3RVY A;  4WFF A;  4JTD B;  3ZJZ A;  3F7Y C;  2WLI A;  1BL8 A;  4MTG A;  1R3L C;  4H37 A;  2DYR C;  3ASN C;  4X8A A;  2ATK C;  5BZB A;  4TWK A;  2WLL A;  2EIN C;  2WLH A;  4XDK A;  5KUM A;  4RAI A;  5E1A C;  1ORQ C;  3SYC A;  4PA3 A;  5B3S C;  3FB6 C;  2WLK A;  4PDV A;  1K4C C;  2QKS A;  1JVM A;  3IGA C;  5EBL C;  3SPH A;  4F4L A;  1J95 A;  4MVQ A;  2EIK C;  3EFF K;  3KG2 A;  1KKD A;  4LCU C;  4UUJ C;  2EIJ C;  3T4Z A;  3SYO A;  4G28 B;  4J9Z B;  1M56 C;  4EKW A;  2BOB C;  3SPJ A;  3VOU A;  4P9P A;  3RBZ A;  3E8H A;  2YEV A;  2DWD C;  4PDR A;  5EC1 C;  3JYC A;  4HYO A;  4RUE A;  3ABL C;  3UKM A;  2JK5 C;  4OXS A;  4MVS A;  1ZWI C;  5J9P C;  5KUK A;  3E8G A;  4XDJ A;  2QTO A;  3UM7 A;  3AG3 C;  3GB7 C;  3PJS K;  3T4D A;  2AHZ A;  3E86 A;  3SPC A;  3X2Q C;  3TET A;  4X88 A;  4RUF A;  1XL6 A;  3LDE A;  4MVZ A;  2DYS C;  4CBC A;  2HFE C;  4P9O A;  4MVU A;  4PA7 A;  3STZ C;  4H33 A;  4MS2 A;  2X6B A;  3ABK C;  3IFX A;  4WFE A;  4DXW A;  2AHY A;  3FB7 C;  3K08 A;  3STL C;  2Q68 A;  2Q67 A;  1OCR C;  2Y69 C;  3SYA A;  4P30 A;  3SYP A;  2R9R B;  3FB5 C;  3HPL C;  3K0G A;  3T2M A;  4JTA B;  3SPI A;  4QNH B;  3AG2 C;  3ASO C;  3E83 A;  3OGC C;  4QE7 A;  4R50 A;  2X6C A;  1M57 C;  1OCC C;  5EBW C;  4R6Z A; 
#chains in the Genus database with same CATH topology
 2QA4 V;  1GN3 A;  1CP9 A;  3H01 A;  1XMO B;  3A2F A;  1GAX A;  2F66 C;  1NI8 A;  1NH2 D;  1B3Q A;  5IJ9 B;  2HEP A;  1NQT A;  1RM1 B;  3K9S A;  4G2K A;  3ZMU A;  2VRZ A;  3RYH A;  2UUA B;  1BQ0 A;  3K06 A;  4UV9 A;  1ZUQ A;  2ZE6 A;  3ZRW A;  1M57 B;  5DN6 G;  2YIB A;  4O4H A;  4I50 A;  1OCO B;  3RN4 A;  2WLM A;  4HZ3 A;  5H6Q A;  1N33 O;  1AP6 A;  3CHX A;  3AG1 C;  3FD9 A;  5LXT B;  4AQY O;  4DV2 O;  2JVD A;  3FX7 A;  4LF8 O;  4QE9 A;  2ZXW C;  3CRQ A;  2PYJ A;  1YF2 A;  1NT2 B;  1IVS A;  2L35 A;  3BVO A;  5DM6 V;  4X66 O;  3ASN C;  3L74 H;  4X8A A;  3HKC B;  1TVK B;  1BZK A;  5E1A C;  3SYC A;  1E1R G;  1YIJ V;  3BPZ A;  2HKO A;  4GZR B;  2ZIO A;  4UUJ C;  3HKB B;  1GM9 A;  4GT1 A;  2E75 B;  2Y4T A;  1ZWI C;  3HKE A;  1WAZ A;  1AIL A;  1R6N A;  1G6U A;  1M93 A;  4X9Q A;  3CJH B;  5IYC O;  1K3E A;  1IXB A;  1MOF A;  4B3T B;  3N2K A;  5CA1 B;  2V1D A;  2AHY A;  2PYL A;  5LXT A;  3LSS A;  5KHJ A;  1H2G A;  1OZ0 A;  2Q68 A;  5CA3 A;  2LGQ A;  4BWA A;  2QM8 A;  4EFE A;  5IYB O;  2W0X A;  1MNG A;  2EIK B;  4KP4 A;  2XT9 A;  2ODM A;  1PD3 A;  4FM1 A;  1M56 B;  3AG2 B;  1MSD A;  3FAV A;  2PI4 A;  1Q8I A;  2UUA O;  4TOI A;  2GDS A;  1MA1 A;  3K59 A;  2HVJ C;  4ZI7 B;  1IBM B;  1SQQ H;  4O4L B;  3G67 A;  5A2Q N;  3DXR B;  3CCR V;  4TSF G;  5LYJ B;  1R3K C;  3R66 A;  1XNQ B;  1QVF U;  1VQ4 V;  5CA0 B;  1FYJ A;  3G80 A;  1FS0 G;  1GKF A;  2Q73 A;  2ETN A;  5CB4 B;  2GTA A;  2OT5 A;  4JAV A;  2YIA A;  4FJC C;  4ASU G;  1Y74 B;  1OCC B;  3AK3 A;  3RYC A;  3J81 N;  2PZS A;  2Q0O C;  4DR5 B;  3F5W C;  4GX5 A;  4I55 B;  2QKA A;  1MMM A;  1QU7 A;  4JI1 B;  4EB6 B;  4GX1 A;  3BA9 A;  3RWR D;  5JJN B;  3L72 H;  1TUB A;  3PN1 A;  4MVO A;  1JPX A;  2JEU A;  2XHB A;  2LFS A;  3TK1 A;  1R3L C;  4H37 A;  2OIG A;  3OW2 U;  4J42 A;  3BCC H;  4D7S A;  4ZI7 A;  3ZRX A;  4B3R B;  4PA3 A;  4TUY B;  3B77 A;  4LNU B;  3DXR A;  4MVQ A;  3OEH G;  4B3T O;  3T4Z A;  2OIE A;  4FMT A;  3SPJ A;  4X1Y B;  1RSO B;  4K0K B;  4RUE A;  3E35 A;  4FVM A;  3W7T A;  3K58 A;  2QTO A;  5EIB D;  1JX9 A;  1SES A;  3P3N A;  1IXM A;  2Q4P A;  5LHI A;  3ZN1 A;  4P9O A;  3CC2 V;  1XQ8 A;  4Q20 A;  1K7D A;  1AI5 A;  2WA3 A;  1HWY A;  3ABK C;  4DXW A;  4EB6 A;  3ICX A;  2HR3 A;  3OFN G;  2KKW A;  2W6J G;  4JI0 B;  3E83 A;  2YI9 A;  2B9Z A;  2KQX A;  1N32 O;  2BTO A;  5EK0 A;  1AI4 A;  1XNQ O;  1YTF B;  4WFG A;  4X1K B;  1AJQ A;  1VQL V;  4JYB A;  4YIO A;  4TUY A;  2DN9 A;  2LQT A;  4D7T A;  4FLU A;  3M8A A;  4LNU A;  3MD0 A;  1WB7 A;  4N21 A;  1P4R A;  2QKC A;  4DR5 O;  3ZMZ A;  2UXC O;  3E22 B;  1JJO A;  4JYY A;  1H38 A;  2X0L A;  4O4I B;  4HNA A;  3M99 B;  3E8F A;  3QNE A;  5LP6 B;  1I5Y A;  4J7J A;  5B1A C;  4ZBM A;  4DV0 B;  2HVK C;  1HDJ A;  1RFY A;  1I08 A;  3JSL A;  5JCO A;  2A79 B;  2Z5U A;  4UCV A;  3H1J H;  1O9H A;  1VQ6 V;  4B3R O;  3ETQ A;  4PA9 A;  5LOV B;  3OR6 C;  3QO7 A;  2YID A;  2VQE B;  4X1K A;  5TIS Z;  1P49 A;  5L3B A;  4K0K O;  4X62 B;  3CE2 A;  1AI6 A;  4JF3 A;  2QJ1 A;  1D5A A;  1QHT A;  4DR4 B;  1QLN A;  2EBO A;  3CRR A;  2JS5 A;  3GVM A;  4DR2 B;  1XNR B;  5KHI A;  3WU2 Z;  5EBL C;  1J95 A;  3N27 A;  2UUB O;  2GTS A;  2R70 A;  1VAR A;  2BOB C;  3RBZ A;  3H1H H;  2ZQM A;  2EIL B;  3L75 H;  3ZHR A;  2EJ7 A;  4DUY O;  2CDY A;  1NBM G;  1P7G A;  2IM9 A;  3T4D A;  3W7S A;  3E86 A;  3SPC A;  3W7X A;  1XDC A;  1T5E A;  2YUA A;  2EUL A;  4RUF A;  2IW5 A;  4IIJ B;  2Q7E A;  3K3W A;  4TV8 B;  1IUR A;  2P90 A;  1AR5 A;  1EBO A;  2P6J A;  1MZF A;  5EZY B;  5LOV A;  1M57 C;  5HFL A;  4YXW G;  3D36 C;  3CYO A;  5FL7 G;  4CH5 A;  1OCO C;  1FFT B;  2Q6A A;  4LBE C;  3JAM N;  1YTF D;  4YJ3 B;  2WA4 A;  2QE7 G;  4NXN B;  1N0J A;  4DRX B;  4YJ2 A;  2IH1 C;  2XND G;  1BT8 A;  5JH7 B;  2RMK B;  4I4T B;  1YDX A;  3AG7 A;  4ICG A;  2VWJ A;  1XBL A;  2MK3 A;  2ZT9 B;  4JTC B;  3LNM B;  2Y69 B;  2G38 A;  1ZL8 B;  1V55 B;  3UT5 B;  4TV9 A;  2A3Q A;  1HNW B;  4QPK A;  3CCU V;  4AI8 A;  4TV8 A;  2JJ2 G;  2P4K A;  1SRY A;  2Y0P A;  2W0F C;  2VQE O;  2C2A A;  2NNU A;  5K1P A;  2JEX A;  5GTI Z;  4X62 O;  3B40 A;  5JQG B;  4DR4 O;  5EIB C;  2KG7 A;  2E74 B;  4DR2 O;  3AK2 A;  4NKG B;  5BMV B;  2MW2 B;  3ZMS A;  1V54 B;  3E2E A;  1NTK H;  2EZP A;  5BZB A;  1QQC A;  1Y76 B;  2WLL A;  2ZIN A;  1G8M A;  4N23 A;  2AZ2 A;  5JH7 A;  2UXN A;  1IZ3 A;  4I4T A;  1Q6U A;  3HR0 A;  2EIK C;  2VS0 A;  3N2G A;  5JVD B;  4FLV A;  1M56 C;  1PKX A;  3VOU A;  1TAE A;  2V7Q G;  5EC1 C;  4OPH A;  5JJE B;  5J9P C;  4X1I B;  4W4K A;  2BCC H;  2UU9 B;  3UT5 A;  4X88 A;  2QWR B;  3LDE A;  3JCU Z;  4YIP A;  1B6Q A;  1H2L A;  5IJ0 A;  3CC7 V;  4BIZ A;  4DR7 B;  1HW7 A;  3OE7 G;  3FB7 C;  1Q90 D;  2P5O A;  3RGB A;  3QO8 A;  5KA5 A;  3SYA A;  4NXN O;  1M5I A;  1Q6I A;  2UXB B;  3ZHV A;  4H44 B;  1SER A;  2X6C A;  1AJP A;  1OCC C;  4J41 A;  2CAZ C;  1COW G;  1AJN A;  2ZNJ A;  3RW0 A;  2P22 C;  2O57 A;  4FZ1 A;  1TGO A;  5IYD O;  3AG3 B;  1N4C A;  1WA8 A;  1VF5 B;  1ZLZ A;  1HNW O;  3CRM A;  1QR9 A;  1YXB A;  5GON B;  5FNV A;  4P2Z A;  2DMX A;  3JAL B;  1A32 A;  2IBZ H;  2NLJ C;  1N36 B;  1AB3 A;  2GUZ A;  3ETD A;  1JFF B;  2ZNI A;  1FD9 A;  1YZB A;  2XAS A;  4JI3 O;  3B09 A;  2OTJ V;  1KD1 W;  2YC0 A;  2VWK A;  3A0R A;  4MW3 A;  3SR2 C;  2A0L A;  1K5Q A;  3F7V C;  2ZD9 A;  2CE4 A;  5BXZ A;  2RDC A;  1S72 V;  4WFF A;  3QO5 A;  4JAU A;  2DOS A;  2L6L A;  1W2B U;  3OD4 A;  1MZE A;  4JI8 B;  4DV7 B;  1KMI Z;  2UU9 O;  1FFX A;  1PNL A;  1H8H G;  4EKW A;  3M7M X;  4G28 B;  1SA0 B;  4JI4 O;  1W59 A;  4U7N A;  2JK5 C;  4DV5 B;  2JRI A;  3GB7 C;  4DV1 B;  4I0X A;  1N33 B;  1RPR A;  1JFF A;  2JDI G;  2UXB O;  3CCE V;  4JYA B;  4AQY B;  3CSX A;  2YIC A;  3WFV A;  2ZM6 B;  1B04 A;  3L73 H;  3VBB A;  4ZHQ A;  4PI2 A;  4K3A A;  4OX9 B;  3TGU H;  5LP6 C;  1G1X B;  4YY3 O;  3KKY A;  3AK1 A;  4FPP A;  1WJZ A;  1L0N H;  2E5L B;  5EBM C;  3FB8 C;  3RYH B;  1E79 G;  3TCU A;  1AI7 A;  2DWE C;  1EN6 A;  4O2A A;  4O4H B;  3CXC U;  5D5Q A;  1ZSP A;  1XMQ O;  2BOC C;  2M6Y A;  4JI6 B;  1SQP H;  4HAM A;  1R3J C;  1VF7 A;  1R1B A;  4KUM A;  1BS3 A;  1Q3E A;  1O9G A;  3TXS A;  2HLD G;  4LF4 B;  2OCH A;  2EX3 A;  3AEI A;  2N74 A;  4J80 A;  4X65 O;  2DQ3 A;  1BE3 H;  2Q0A A;  3UO3 A;  1TA8 A;  2QWP B;  4NTY A;  3BY6 A;  4FIP C;  3L71 H;  3G4S V;  2ILM A;  4MSW C;  2CGO A;  5B1B C;  2BTQ B;  2EIL C;  2F95 B;  3K03 A;  3WB0 A;  3ZRS A;  3CB2 A;  4JI8 O;  4PA6 A;  4DV7 O;  1EZJ A;  3LDD A;  5C93 A;  4AHC A;  1F7Y A;  3HKE B;  4LFC B;  1QBZ A;  3CCS V;  1N8R W;  3H1L H;  4DV5 O;  4DV1 O;  1VQ9 V;  3N2K B;  4JPR A;  4JYA O;  1ENV A;  1IBK B;  1P84 F;  4LH7 A;  5KA6 A;  2ZM6 O;  4MVS A;  2FKX A;  2P67 A;  2R9I A;  3EXA A;  4OX9 O;  1DF4 A;  3X2Q C;  2QGN A;  3FAV B;  3JD3 A;  1I94 O;  2E5L O;  4H33 A;  2KSD A;  2BTQ A;  3QF7 A;  1EN4 A;  1W0K G;  2FL4 A;  2QM7 A;  1SS3 A;  2Y69 C;  2R9R B;  1L0L H;  3K0G A;  1YCI A;  1H2K A;  4KHP O;  4JI6 O;  4H13 B;  4FLT A;  1MSW D;  2ZR2 A;  3DC5 A;  4LF4 O;  1PL4 A;  4OGQ B;  3RYC B;  1R3I C;  2YIB D;  3SYQ A;  3F5T A;  3SJA C;  1YJ9 V;  4X64 O;  4NTW A;  3W7U A;  1XEQ A;  2K1E A;  1V54 C;  1F23 A;  2YSU B;  3K5O A;  1TUB B;  4LP8 A;  3RFR A;  3D8C A;  2ZE7 A;  2GV9 A;  4Z1M G;  4IHJ A;  1H8E G;  3LDC A;  1KU9 A;  4Q6G A;  1CPY A;  1XL4 A;  2UXX A;  1W0J G;  1BHA A;  3K5L A;  2RQ6 A;  3APQ A;  4LFC O;  4O2B A;  1N32 B;  5KHH A;  1PP9 H;  3H1I H;  1CXZ B;  2OCC B;  1WLE A;  2K9P A;  3OT7 A;  1SQF A;  5JJJ B;  4DR6 O;  1IBK O;  1K9M W;  1BL8 A;  1VIB A;  2AW9 A;  2DW4 A;  4FLX A;  1ORQ C;  1Q81 W;  2UXC B;  1JCH A;  4J7Z A;  3IGA C;  3SPH A;  4NTX A;  3T1H B;  3SJB C;  3SYO A;  4PEL A;  1NTZ H;  3QVN A;  1K8A W;  5LL6 Y;  2YEV A;  2DWD C;  5L3F A;  2PUS A;  4B7E A;  4CH4 A;  4XDJ A;  3AG3 C;  2HP8 A;  4BW9 A;  3TET A;  1ZX3 A;  2WPD G;  1KC8 W;  4WBN A;  1Y67 A;  4MVU A;  1SQX H;  1BMF G;  1DK1 A;  1JJ2 U;  1SC5 B;  1FKA O;  1YSC A;  1H2N A;  3GWK C;  4P30 A;  4A5U B;  4ZKI A;  3OGC C;  4R50 A;  5LMN B;  2FTK A;  2AXT Z;  5B66 Z;  1HNX O;  5LBQ A;  4MW8 A;  4IT5 A;  4HNA B;  1NVP B;  4U3F H;  3CRA A;  1Y66 A;  2UUB B;  4DW0 A;  4E2L A;  3RYI A;  1SZT A;  1XOU A;  4DUY B;  3ABM C;  1Q43 A;  3EVK A;  3G6E V;  1SKV A;  2X6A A;  4F6R A;  1PL0 A;  3ZHU A;  4FLY A;  1YHQ V;  1XRE A;  4UB8 Z;  3T1C A;  1GH6 A;  4HBN A;  2JGD B;  1QR8 A;  3U11 A;  5H9C A;  1VQO V;  4WCE V;  1FXK A;  3OMN B;  5IY5 C;  4J11 A;  3WG7 C;  1KQS U;  1S5H C;  2GHY A;  1YJW V;  2QWO B;  4QGP A;  4LF5 O;  4ZIB A;  1HNZ O;  3ZJZ A;  1LR1 A;  3T1H O;  3D3Q A;  3SDL A;  3JAR A;  3JD0 A;  1FAF A;  4UCS A;  3RYF A;  2DYR B;  3FB6 C;  1K4C C;  1PV0 A;  5IT9 N;  3NXS A;  4CH3 A;  3DSQ A;  2ZDI A;  1KUQ A;  4LF9 B;  2ADQ B;  3CP1 A;  2Q9L A;  3S3X A;  3LSU A;  3OMI B;  4B7K A;  4GKK O;  5B1N A;  2ZR3 A;  4CS4 A;  5L3G A;  3NR7 A;  1S77 D;  3UQ8 A;  5LMN O;  2JGD A;  4DV6 B;  1SF9 A;  1XIL A;  3OMA B;  2X6B A;  1Q86 W;  4WFE A;  1EM1 A;  3BFR A;  4CC6 A;  4YJ2 B;  2Y4U A;  5CMU A;  1D2D A;  1GRJ A;  1BSM A;  2JIZ G;  5IWA O;  1H2M A;  4UCU A;  5C8Y B;  2JS3 A;  2EIJ B;  5EYP A;  4PI0 A;  3ASO B;  1XHX A;  1EN5 A;  5IE9 A;  2D2C B;  3ZN0 A;  1NVP D;  4NYK A;  4BAY A;  3OUF A;  3CWB H;  4TV9 B;  4U3J A;  3OTO B;  3WB2 A;  4XDL A;  2DYS B;  1RM1 C;  2XAJ A;  2P06 A;  3ZCC A;  1J5E B;  2N04 A;  1AR4 A;  5LA6 A;  1VF6 A;  2KG7 B;  1UJW B;  1B06 A;  1KB9 F;  1F51 A;  4MTF A;  2JJ1 G;  5BR8 B;  2M7W A;  3I56 V;  2Q69 A;  3OUS A;  2WLL B;  1HP8 A;  4MVM A;  3CMA V;  4MTX A;  1M90 W;  4G27 B;  3LUT B;  5CBH A;  5CN0 A;  2ADP A;  2XAF A;  5FLX N;  4PDM A;  5KMG B;  3OR7 C;  3N2G B;  1OCZ B;  1PM9 A;  3UCS C;  1Y4M A;  4K8X A;  5C8Y A;  3BEH A;  2BSK B;  2ZXW B;  2YI8 A;  4LF9 O;  1K33 A;  3C3T A;  2LP7 A;  2XAG A;  3ETG A;  3SJC C;  3G6B A;  4DR3 O;  5IJ0 B;  2QKS A;  5KX5 A;  5L3E A;  1QLE B;  1Y6X A;  4DV6 O;  3S3W A;  3JAT A;  1VMG A;  3ZRV A;  3LNN A;  4UB6 Z;  4NVP A;  3CPW U;  3DTU B;  4JI3 B;  3UM7 A;  1BCC H;  4L87 A;  2ZIM A;  2HHH B;  3STZ C;  3K79 A;  1U97 A;  2ARH A;  4MS2 A;  3IFX A;  4Z1V A;  4OPA A;  4EFB A;  1WA8 B;  2Z3Y A;  5KMG A;  3L70 H;  3FYI B;  3CCJ V;  3OTO O;  3AG2 C;  2HJD A;  5FNV B;  4BR6 A;  1NTM H;  2BSK A;  2CTR A;  4FFB A;  3W7W A;  1J5E O;  2Q8V A;  4DW1 A;  2GUZ B;  3K9A A;  2AZ0 A;  2OCC C;  4JI4 B;  3CCV V;  1GM8 A;  2WAM A;  4JYC A;  2PY5 A;  1KYO F;  4QJF B;  3JAW A;  5BR8 O;  4JI2 B;  5LHH A;  2OWO A;  1AP5 A;  3VQY A;  5IDJ A;  4F6E A;  1X4T A;  3QG5 A;  4X20 B;  1Q6H A;  3P32 A;  3OM3 B;  2ITD C;  4C7U A;  1L1F A;  5IYZ A;  4J10 A;  5L3C A;  3HKD B;  4O4J A;  4YY3 B;  1WP7 A;  1VQN V;  2P7T C;  1FFX B;  4I9W A;  1G4Y B;  5CBG A;  2IH3 C;  2IJK A;  1LUW A;  4DUZ B;  1XMQ B;  1GK9 A;  4I0X B;  3ZBH A;  1SET A;  3D3I A;  1JVM A;  2XAQ A;  3KG2 A;  2HHH O;  4H0L B;  4LCU C;  2OTL V;  4X65 B;  1VP7 A;  4ZHQ B;  5KLV H;  1I5X A;  3UKM A;  4UFZ A;  4OXS A;  5KUK A;  3KZI Z;  4X20 A;  3JAK A;  1FPO A;  2ZE8 A;  5B5E Z;  3JAS A;  5JCO C;  4U7O A;  3HKD A;  1DF5 A;  3JD1 A;  4O2A B;  4I7Z B;  2EIN B;  5ITZ A;  4CC5 A;  3FB5 C;  3ABK B;  4QNH B;  4JTA B;  2XTA A;  1VEW A;  3JD2 A;  4JI2 O;  4AIL C;  3ML0 A;  1EZV H;  3L9D A;  1S5L Z;  2CK3 G;  2CH7 A;  3K5N A;  2F43 G;  1LNQ A;  4IYH A;  3ZMT A;  3CME V;  1M4U A;  2JGU A;  2CUG A;  1Z5V A;  3IJ4 A;  1N0N A;  2VQF B;  1I94 B;  4K35 A;  2RNB A;  1K4D C;  1SQG A;  3CXH F;  2KB1 A;  1YVW A;  1NU1 H;  4DUZ O;  1DTO A;  4PV1 B;  4KHP B;  3Q4H A;  5FPO A;  1F4N A;  3JCZ A;  4LF6 B;  2OYQ A;  1THZ A;  1SQB H;  2F1M A;  5KHK A;  2CTQ A;  4X64 B;  2IJI A;  2ZE5 A;  4PDV A;  4DV3 O;  3T1Y O;  2LGW A;  2EIJ C;  3OGI B;  4J9Z B;  5A9G A;  4UCT A;  3JYC A;  4KL1 A;  2Q7G A;  3AG4 B;  1FJG B;  4DK1 A;  1HR0 O;  4EEQ A;  4JGS A;  1VQ5 V;  2DYS C;  5J2T A;  3K08 A;  1JMK C;  3WB1 A;  1BQZ A;  4DR6 B;  4UCR A;  4D6T H;  1NR7 A;  5EBW C;  4GYC B;  5E79 Z;  4LWS A;  4JV5 O;  2B5U A;  1GN2 A;  1R6K A;  3A8T A;  4IHJ B;  1K73 W;  3O9O A;  3R65 A;  2LFR A;  2VQF O;  4PD4 F;  3CCM V;  1OCZ C;  4JZG A;  4O2B B;  4QIW F;  2EZO A;  1V55 C;  4R8C A;  2B1I A;  2RJZ A;  4CH6 A;  4L8J A;  1UFI A;  1NZ6 A;  1V9P A;  4LF6 O;  1QLE C;  4CZZ A;  5IJ9 A;  3RT3 C;  1S3J A;  5CBF A;  3OEE G;  3OTF A;  1BGY H;  5H2F Z;  1HNX B;  1BHB A;  3B8M A;  1GN4 A;  3KCX A;  1JOY A;  2R72 A;  2QM4 A;  4X89 A;  5DED A;  3B8N A;  3ZHS A;  2YEV B;  2Q7H A;  3D36 A;  3JD4 A;  2Q5Z A;  4RQE A;  2ATK C;  3KCY A;  2YXL A;  4XDK A;  1FJG O;  1K34 A;  4WBN B;  1ARO P;  4NR1 A;  4PJ0 Z;  3IC9 A;  4BIO A;  4LFB B;  4F4L A;  1XMO O;  1GN6 A;  3EFF K;  3ZED A;  4GUN A;  4DR1 B;  3MHS C;  3CS5 A;  3C3S A;  2F93 B;  1Z2G A;  2N05 A;  2EIM B;  1S0V A;  3GWO A;  3HKC A;  3C90 A;  3PJS K;  1TVK A;  5K1X A;  2R9A A;  4MVZ A;  2D3O W;  4J7K A;  1CEZ A;  1RPO A;  1FXV A;  1NKD A;  2PF4 E;  3HKB A;  3STL C;  4JI7 B;  4W4L A;  3RYI B;  3FYE B;  5LGU A;  1HNZ B;  5J2U B;  4LF5 B;  2UXD B;  2F23 A;  4QE7 A;  2QDO A;  1YEW A;  4R6Z A;  4BW5 A;  4TT3 G;  3G71 V;  1Q7Y W;  4UVB A;  4FZ0 A;  4F6R B;  3CJH A;  1JA8 A;  1WN7 A;  1VQP V;  1VQ8 V;  2RN9 A;  5CA1 A;  2YDE A;  2GSM B;  2A06 H;  2QTS A;  4JI5 B;  4GKK B;  1FXK B;  1XUQ A;  3J80 N;  3IC7 A;  3K0D A;  4RO2 A;  1OCR B;  1NJI W;  5H5N A;  2HG5 C;  2P4V A;  3ABU A;  3P3P A;  1XI1 A;  3JAR B;  2XAH A;  3FKS G;  1F4M A;  1X59 A;  3RYF B;  3ZX6 A;  1KBH A;  3CCQ V;  4BIU A;  3K57 A;  4O4L A;  5IWA B;  4NXM B;  1JR9 A;  5LYJ A;  5J2U A;  4RWU A;  4UV8 A;  5CA0 A;  1WNS A;  2B1G A;  2H3O A;  1NS1 A;  5CB4 A;  3CCL V;  4LFB O;  3CC4 V;  3IAY A;  1Y74 A;  4DR1 O;  3CEI A;  5D5P A;  1Q82 W;  1DLB A;  1QCE A;  1KKC A;  1R73 A;  4I55 A;  4DO2 A;  2EIN C;  1UPG A;  4LR3 A;  3K5M A;  2F4V B;  4RAI A;  2WLK A;  4JAS A;  2UUC B;  2BE3 A;  1H2S B;  4ABM A;  4LC1 A;  2XUM A;  1IBM O;  4LH6 A;  1M9N A;  5JWP A;  3MDS A;  4PDR A;  3EHB B;  1M1K W;  3B2E E;  4CS3 A;  3VQV A;  4LFA B;  4JI7 O;  2UXD O;  3J7A U;  3CD6 V;  2NN4 A;  5EYP B;  4FLW A;  4PA7 A;  3BHP A;  4U3J B;  2QWN B;  5LMU B;  4LF7 B;  3THO A;  2Q67 A;  3SYP A;  5KAI Z;  5B3S B;  4X1Y A;  1RSO A;  2FML A;  4WFA V;  4DYL A;  4JI1 O;  5LA6 B;  4JI5 O;  3E89 A;  4DR3 B;  2WSS G;  2WLJ A;  4GLX A;  4MT8 A;  5L3D A;  3ABL B;  1P7B A;  3K04 A;  3I55 V;  2IJJ A;  1ZTE A;  1U96 A;  3VQX A;  5LGT A;  4QPJ A;  2A9H A;  5FPR A;  3ZHQ A;  1KP2 A;  4NXM O;  3E8B A;  4J9Y B;  2IU3 A;  2DQ0 A;  2ZCE A;  2Y0I A;  3UO2 A;  2H8P C;  5EC2 C;  4IL6 Z;  3SJQ C;  5KX5 B;  2LJ2 A;  3AG4 C;  2CTW A;  3E22 A;  4GX2 A;  1N34 B;  2F4V O;  5B1B B;  4B3S B;  4O4I A;  2UUC O;  1D5N A;  3BAA A;  3JAT B;  5LP6 A;  2E3C A;  4JI0 O;  2W6I G;  3DC6 A;  3TXQ A;  4Z2W A;  2ZKO A;  2PI5 A;  5KUM A;  4LFA O;  3O65 A;  3TJT A;  1IBL B;  1ZAU A;  4XBF A;  3ZHT A;  1YI2 V;  1KKD A;  2CGN A;  3BRC A;  4JAA A;  3AG1 B;  5LMU O;  4LF7 O;  2WWW A;  2GBO A;  2LW1 A;  4FFB B;  4ZOL B;  4GKJ B;  1RP3 B;  4KXR A;  3X2Q B;  3ASN B;  4DV0 O;  5AG2 A;  1ROP A;  3JAW B;  5LGN A;  2YXH A;  4CS2 A;  1PPJ H;  1EFR G;  4IGG A;  4B08 A;  2DJV A;  1OV9 A;  3BAB A;  3OAA G;  1AR1 B;  4K8Z A;  1WPX A;  1GTO A;  1I0H A;  2WLI B;  4IIJ A;  4KFM A;  2FYU H;  5GTH Z;  4DV4 B;  2PGG A;  1WB8 A;  3P30 A;  5IYZ B;  4NB5 A;  1FXH A;  1OHH G;  1US6 A;  4O4J B;  5EZY A;  3QTC A;  1XNR O;  3ZMV A;  4FK5 C;  2IU0 A;  1URF A;  1Z5W A;  2WLN A;  5HFM A;  1DGS A;  3SPG A;  1N34 O;  4B3S O;  4YJ3 A;  4ZOL A;  1IDS A;  1SQV H;  4DRX A;  4MVR A;  1JQ0 A;  3ABT A;  4PDL A;  4UXN A;  2ITC C;  5BY1 A;  2EIM C;  2A7W A;  2FB5 A;  2NR5 A;  1IBL O;  4WF9 V;  1MAB G;  3FFQ A;  5LHG A;  1ZL8 A;  4WFB V;  1PNM A;  1YIT V;  4JTD B;  2WLI A;  1SZX A;  3JAK B;  2CTP A;  1S76 D;  3A0B Z;  2QSA A;  1E1Q G;  3JAS B;  1VQK V;  1TUE B;  2QWQ B;  3I5D A;  4PHZ A;  2RCV A;  1XHZ A;  1K92 A;  5JQG A;  1GO3 F;  4GKJ O;  5ITZ B;  4P9P A;  5BMV A;  4HYO A;  2PTM A;  2Z0A A;  1K97 A;  3SGI A;  4FLZ A;  4UVC A;  1PNK A;  3CRC A;  1Y76 A;  3ZS8 C;  1KP3 A;  1WP8 A;  1XL6 A;  3CX5 F;  4CBC A;  2HFE C;  4E4E A;  5B1O A;  1FXK C;  1Q5O A;  3DGE A;  5JVD A;  2CH7 B;  1OCR C;  3APO A;  1NR1 A;  4DV4 O;  3MHH C;  3T2M A;  3SPI A;  4X1I A;  1GMG A;  3JSN A;  5DEC A;  4B3M B;  4DV3 B;  1GM7 A;  3VQW A;  1LUV A;  2H94 A;  4WFH A;  5KHG A;  2LO1 A;  4I5S A;  3T1Y B;  4YHH B;  1NH2 B;  2ZDI C;  4GX0 A;  1HR0 B;  2QR4 A;  3Q4H B;  3ABM B;  2V4D A;  2X7R B;  3RVZ A;  4IYI A;  3ETE A;  2HJF C;  2AGA A;  4FM2 A;  3B4S A;  2EJR A;  4PA4 A;  2LW7 A;  4UCO A;  1S5J A;  4MTO A;  5GON A;  1MG1 A;  2XOK G;  2DE0 X;  4R7C A;  1KEC A;  4JV5 B;  4DR7 O;  3JAL A;  3ZIA G;  2E76 B;  5GW7 A;  3U10 A;  5IY5 B;  3WG7 B;  3RVY A;  1R6T A;  3F7Y C;  3MAQ A;  4RQF A;  4MTG A;  2DYR C;  1AVM A;  4UVA A;  4TWK A;  2YXY A;  2WLH A;  2IJH A;  5F2V O;  4DV2 B;  5B3S C;  4LF8 B;  4TQF A;  5B1A B;  1VQ7 V;  5J2T B;  4FM0 A;  3H1K H;  1YJN V;  1VF6 C;  4X66 B;  3HB3 B;  4JZ2 A;  3E8H A;  4GCZ A;  1L8D A;  2Y48 A;  3ABL C;  4DK0 A;  1VQM V;  3E8G A;  1IX9 A;  2AHZ A;  3U0Z A;  4LWS B;  3ZRW B;  3LSQ A;  5KAF Z;  1K5S A;  3BA8 A;  4I50 B;  1N36 O;  1WPB A;  4B3M O;  1I7F A;  5H6R A;  1SA0 A;  4FFK A;  1QNM A;  1OJH A;  3HPL C;  2YS8 A;  3H9V A;  3A0H Z;  3ASO C;  2QEX V;  4YHH O;  4I9Q A;  4TQD A;  1QVG U; 
#chains in the Genus database with same CATH homology
 4BW5 A;  4TT3 G;  2EIJ B;  3G71 V;  2QA4 V;  1Q7Y W;  3ASO B;  4UVB A;  1COW G;  3ZN0 A;  1NVP D;  1AJN A;  1CP9 A;  3RW0 A;  4BAY A;  3H01 A;  3OUF A;  1VQP V;  1VQ8 V;  5IYD O;  3AG3 B;  2GSM B;  4XDL A;  1NH2 D;  2DYS B;  1RM1 C;  1QR9 A;  2XAJ A;  3ZCC A;  1FXK B;  1NQT A;  1RM1 B;  3IC7 A;  3K0D A;  4G2K A;  4RO2 A;  3ZMU A;  4P2Z A;  1OCR B;  1UJW B;  1NJI W;  3K06 A;  4UV9 A;  2HG5 C;  2NLJ C;  3ABU A;  3ZRW A;  3ETD A;  1M57 B;  5DN6 G;  1F51 A;  4MTF A;  2JJ1 G;  2M7W A;  2XAH A;  3FKS G;  1F4M A;  1OCO B;  2Q69 A;  2XAS A;  3OUS A;  2WLL B;  3I56 V;  2WLM A;  4HZ3 A;  3CCQ V;  4MVM A;  5H6Q A;  2OTJ V;  4BIU A;  3CMA V;  4MTX A;  1M90 W;  1KD1 W;  4G27 B;  3AG1 C;  3LUT B;  3A0R A;  4MW3 A;  5CBH A;  2A0L A;  1K5Q A;  2XAF A;  3F7V C;  4UV8 A;  5CN0 A;  2ZD9 A;  4PDM A;  3OR7 C;  2B1G A;  1OCZ B;  1Y4M A;  4QE9 A;  2ZXW C;  3CCL V;  3CC4 V;  3BEH A;  1S72 V;  4WFF A;  3QO5 A;  4JAU A;  2ZXW B;  5DM6 V;  1Q82 W;  3ASN C;  4X8A A;  1W2B U;  1DLB A;  1K33 A;  2LP7 A;  1QCE A;  1R73 A;  4DO2 A;  2XAG A;  2EIN C;  3ETG A;  4RAI A;  5E1A C;  1E1R G;  3SYC A;  2WLK A;  1YIJ V;  4JAS A;  2QKS A;  2HKO A;  5L3E A;  1PNL A;  1QLE B;  1H8H G;  4LC1 A;  4UUJ C;  4EKW A;  4G28 B;  1GM9 A;  1M9N A;  4GT1 A;  4PDR A;  3EHB B;  3ZRV A;  1M1K W;  4U7N A;  2JK5 C;  1ZWI C;  3CPW U;  3DTU B;  3UM7 A;  4L87 A;  3GB7 C;  3CD6 V;  1RPR A;  2JDI G;  1R6N A;  3CCE V;  5IYC O;  1K3E A;  1MOF A;  4PA7 A;  3STZ C;  3K79 A;  4MS2 A;  3WFV A;  3IFX A;  2V1D A;  2AHY A;  3LSS A;  1H2G A;  1OZ0 A;  2Q68 A;  2Q67 A;  5CA3 A;  3SYP A;  3VBB A;  5B3S B;  2QM8 A;  2Z3Y A;  3FYI B;  4WFA V;  3CCJ V;  3AG2 C;  5IYB O;  2EIK B;  4KP4 A;  4FPP A;  1PD3 A;  5EBM C;  1M56 B;  3AG2 B;  3FB8 C;  1E79 G;  3E89 A;  2WSS G;  3W7W A;  2WLJ A;  3TCU A;  4MT8 A;  5L3D A;  3ABL B;  2PI4 A;  1AI7 A;  1P7B A;  3K04 A;  3I55 V;  2IJJ A;  3K9A A;  2DWE C;  2OCC C;  2HVJ C;  5LGT A;  3CXC U;  3CCV V;  1GM8 A;  2WAM A;  2BOC C;  4JYC A;  4QPJ A;  4QJF B;  4HAM A;  1R3J C;  3CCR V;  5LHH A;  4TSF G;  1R3K C;  5IDJ A;  2A9H A;  4KUM A;  1QVF U;  1VQ4 V;  2HLD G;  1KP2 A;  1FS0 G;  1GKF A;  3AEI A;  3E8B A;  4J9Y B;  2IU3 A;  2DQ0 A;  2OT5 A;  4JAV A;  2DQ3 A;  4FJC C;  4ASU G;  3P32 A;  1OCC B;  3OM3 B;  2ITD C;  1L1F A;  3F5W C;  4GX5 A;  3BY6 A;  4FIP C;  5L3C A;  3G4S V;  4MSW C;  5B1B C;  2H8P C;  2EIL C;  5EC2 C;  3SJQ C;  1VQN V;  2P7T C;  3AG4 C;  4GX1 A;  4GX2 A;  3K03 A;  3ZRS A;  4I9W A;  5B1B B;  1G4Y B;  5CBG A;  4PA6 A;  4MVO A;  1EZJ A;  2IH3 C;  1JPX A;  2IJK A;  2JEU A;  3LDD A;  2LFS A;  3TK1 A;  5C93 A;  1R3L C;  4H37 A;  3OW2 U;  2W6I G;  1QBZ A;  3CCS V;  1GK9 A;  2PI5 A;  1SET A;  3D3I A;  5KUM A;  3ZRX A;  1N8R W;  4PA3 A;  1JVM A;  4XBF A;  1VQ9 V;  3B77 A;  1YI2 V;  2XAQ A;  4JPR A;  4MVQ A;  3OEH G;  3KG2 A;  1ENV A;  1KKD A;  4LCU C;  3T4Z A;  2OTL V;  4FMT A;  3SPJ A;  3AG1 B;  1I5X A;  4RUE A;  3UKM A;  2WWW A;  3E35 A;  5KA6 A;  4OXS A;  4MVS A;  5KUK A;  3W7T A;  2P67 A;  2QTO A;  1JX9 A;  1SES A;  2R9I A;  1DF4 A;  3X2Q C;  1IXM A;  5LHI A;  3ZN1 A;  3JD3 A;  4P9O A;  4H33 A;  4U7O A;  3CC2 V;  3X2Q B;  3ASN B;  1K7D A;  1DF5 A;  1AI5 A;  1HWY A;  3ABK C;  1W0K G;  3JD1 A;  4Q20 A;  4DXW A;  2QM7 A;  2EIN B;  2HR3 A;  2Y69 C;  1ROP A;  3OFN G;  2R9R B;  3FB5 C;  3ABK B;  2W6J G;  5LGN A;  3K0G A;  4QNH B;  4JTA B;  3E83 A;  1EFR G;  1QVG U;  3JD2 A;  3OAA G;  1AR1 B;  1MSW D;  1WPX A;  1GTO A;  5EK0 A;  1AI4 A;  2ZR2 A;  2WLI B;  4KFM A;  3ML0 A;  1YTF B;  4WFG A;  1AJQ A;  1VQL V;  1R3I C;  4JYB A;  3SYQ A;  3P30 A;  1YJ9 V;  2CK3 G;  1FXH A;  3MD0 A;  1OHH G;  2F43 G;  3W7U A;  1LNQ A;  3ZMT A;  4N21 A;  1P4R A;  3ZMZ A;  2K1E A;  1V54 C;  3ZMV A;  3CME V;  1F23 A;  2YSU B;  1H38 A;  4FK5 C;  2X0L A;  2IU0 A;  4LP8 A;  2WLN A;  5HFM A;  3SPG A;  3M99 B;  3E8F A;  3QNE A;  4Z1M G;  1I5Y A;  1H8E G;  3LDC A;  1CPY A;  5B1A C;  1XL4 A;  4ZBM A;  2UXX A;  1K4D C;  1W0J G;  1BHA A;  2HVK C;  2KB1 A;  4MVR A;  1JQ0 A;  2A79 B;  2Z5U A;  3ABT A;  1DTO A;  1VQ6 V;  4PDL A;  4UXN A;  2ITC C;  2OCC B;  1F4N A;  3JCZ A;  1WLE A;  2EIM C;  4WF9 V;  1MAB G;  4PA9 A;  5LHG A;  3OR6 C;  4WFB V;  1PNM A;  1YIT V;  3QO7 A;  4JTD B;  1K9M W;  2WLI A;  1THZ A;  1BL8 A;  2DW4 A;  5L3B A;  2IJI A;  1S76 D;  1AI6 A;  4JF3 A;  1E1Q G;  1ORQ C;  1VQK V;  1Q81 W;  1TUE B;  1JCH A;  4PDV A;  2EBO A;  1QLN A;  3IGA C;  5EBL C;  3SPH A;  1K92 A;  1J95 A;  1GO3 F;  2EIJ C;  3SYO A;  4J9Z B;  4PEL A;  1K8A W;  2BOB C;  4P9P A;  3RBZ A;  2ZQM A;  2EIL B;  2YEV A;  2DWD C;  5L3F A;  3JYC A;  4HYO A;  3AG4 B;  1K97 A;  4XDJ A;  4UVC A;  1NBM G;  3AG3 C;  3W7S A;  1PNK A;  3T4D A;  3E86 A;  3SPC A;  3TET A;  4JGS A;  2WPD G;  3W7X A;  1KC8 W;  1KP3 A;  4RUF A;  1XL6 A;  2IW5 A;  1VQ5 V;  2DYS C;  4CBC A;  2HFE C;  4MVU A;  1BMF G;  3K3W A;  1JJ2 U;  5B1O A;  1FXK C;  1YSC A;  3DGE A;  2P90 A;  3K08 A;  1EBO A;  1OCR C;  4P30 A;  2P6J A;  1NR1 A;  3MHH C;  1NR7 A;  3T2M A;  3SPI A;  4ZKI A;  3OGC C;  4R50 A;  2FTK A;  1M57 C;  5HFL A;  4YXW G;  5EBW C;  3CYO A;  5FL7 G;  1GMG A;  5LBQ A;  1OCO C;  4MW8 A;  1FFT B;  2B5U A;  1GM7 A;  2Q6A A;  1R6K A;  2H94 A;  4LBE C;  1NVP B;  1YTF D;  4WFH A;  1K73 W;  4I5S A;  1Y66 A;  2QE7 G;  3R65 A;  2LFR A;  3CCM V;  1NH2 B;  2IH1 C;  2XND G;  1OCZ C;  4E2L A;  2ZDI C;  1SZT A;  4GX0 A;  3ABM C;  4QIW F;  2EZO A;  3G6E V;  2MK3 A;  4JTC B;  1V55 C;  3ABM B;  3LNM B;  4R8C A;  2B1I A;  2X7R B;  2Y69 B;  3RVZ A;  2X6A A;  1PL0 A;  3ETE A;  1V55 B;  1YHQ V;  2HJF C;  3T1C A;  4QPK A;  1QLE C;  3CCU V;  4CZZ A;  2EJR A;  1S3J A;  2JJ2 G;  4PA4 A;  5CBF A;  1SRY A;  3OEE G;  2W0F C;  1QR8 A;  2C2A A;  2NNU A;  4MTO A;  5H9C A;  2JEX A;  1MG1 A;  4WCE V;  1VQO V;  1BHB A;  1FXK A;  2XOK G;  3B8M A;  3OMN B;  4R7C A;  5IY5 C;  3WG7 C;  1KQS U;  1S5H C;  1KEC A;  1JOY A;  2GHY A;  3ZIA G;  1YJW V;  4X89 A;  5GW7 A;  5IY5 B;  3B8N A;  3WG7 B;  2YEV B;  3RVY A;  3ZJZ A;  3ZMS A;  3F7Y C;  1V54 B;  4RQF A;  3D36 A;  3E2E A;  3JD4 A;  4MTG A;  2DYR C;  3JD0 A;  4RQE A;  2EZP A;  4UVA A;  2ATK C;  5BZB A;  4TWK A;  2WLL A;  2WLH A;  2IJH A;  4XDK A;  5B3S C;  1K34 A;  2DYR B;  3FB6 C;  1ARO P;  5B1A B;  1G8M A;  1K4C C;  4N23 A;  1VQ7 V;  2UXN A;  3NXS A;  4F4L A;  2EIK C;  3EFF K;  1YJN V;  2ZDI A;  1M56 C;  3MHS C;  3HB3 B;  1PKX A;  3VOU A;  3E8H A;  4GCZ A;  2V7Q G;  3CP1 A;  5EC1 C;  2Y48 A;  3ABL C;  5J9P C;  1VQM V;  3E8G A;  3OMI B;  2EIM B;  1S0V A;  3GWO A;  5B1N A;  2ZR3 A;  5L3G A;  3PJS K;  2AHZ A;  4X88 A;  1S77 D;  3LDE A;  3LSQ A;  4MVZ A;  3ZRW B;  1B6Q A;  2D3O W;  1K5S A;  3CC7 V;  3OMA B;  4BIZ A;  2X6B A;  1Q86 W;  4WFE A;  3OE7 G;  1CEZ A;  1RPO A;  1FXV A;  1NKD A;  3FB7 C;  3STL C;  5H6R A;  3QO8 A;  5KA5 A;  3SYA A;  5LGU A;  3FYE B;  5CMU A;  3HPL C;  4QE7 A;  3ASO C;  1SER A;  2QEX V;  2JIZ G;  2X6C A;  1AJP A;  1OCC C;  4R6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...