2BOCC

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
molecule tags Immune system/transport protein
source organism Streptomyces lividans
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2bocC00
3T4ZA 2JK5C 2HFEC 3K04A 4PA7A 2ATKC 3FB7C 2ITDC 3FB8C 3E86A 4LBEC 2HG5C 4RUFA 4WFFA 5B1AC 4HYOA 2Q6AA 4RO2A 4WFGA 4LCUC 3F7VC 3SPHA 4MVUA 2DYRC 3SJQC 3IFXA 3K0DA 2HJFC 4GX0A 2BOCC 3HPLC 4P9OA 5IY5C 1XL6A 1LNQA 3T1CA 1M56C 4TWKA 2DYSC 3LNMB 3UKMA 1R3JC 1ZWIC 2W0FC 2A0LA 4GX1A 4X89A 1OCOC 3LUTB 4R8CA 4R7CA 2P7TC 4HZ3A 4JTAB 4P2ZA 1QLEC 4PDLA 2WLHA 3UM7A 1ORQC 3AG2C 3K03A 2YEVA 3OR6C 4R50A 5CBHA 3IGAC 4QE7A 2Q68A 2EIKC 2HVKC 3SPJA 2WLMA 4J9YB 4KFMA 3KG2A 3T4DA 3SPIA 4OXSA 3E8FA 1R3IC 5EBLC 3STLC 3SYCA 5KUKA 2QKSA 4PA3A 3SYOA 4P30A 4XDJA 3K06A 4BW5A 5EBMC 2X6BA 3OGCC 2WLJA 3FB6C 5E1AC 1K4CC 5B1BC 2WLIB 2WLLB 3AG3C 5BZBA 1J95A 3E8GA 4MVSA 3ASNC 2A79B 4G27B 3OR7C 2EIJC 4PDMA 1OCCC 3GB7C 4ZBMA 4DXWA 4MVQA 4F4LA 2DWDC 3AG1C 1R3KC 4UUJC 1OCZC 3ASOC 2K1EA 4PA6A 2WLIA 2WLLA 3F5WC 4P9PA 5KUMA 3STZC 3WG7C 4PA4A 1G4YB 2ZD9A 4MW3A 3SYQA 4MVRA 4EKWA 5B3SC 3X2QC 2DWEC 3AG4C 2ITCC 2X6CA 2AHYA 4WFHA 4QNHB 3E8HA 2AHZA 4JTDB 2NLJC 3TETA 4QE9A 1KKDA 4XDLA 2WLKA 4MTFA 4H37A 2IH1C 3FB5C 3OUSA 3ABMC 3E8BA 3SPCA 2OCCC 3E89A 4R6ZA 3F7YC 2Q67A 3RBZA 2EIMC 2Q69A 3R65A 3OUFA 3SYPA 4I9WA 4MVZA 4CBCA 2QTOA 4MVOA 2ZXWC 4H33A 3EFFK 3RVYA 4MTGA 3ABKC 4RUEA 4MVMA 1P7BA 4MSWC 4XDKA 3BEHA 2R9RB 4LP8A 4MS2A 5CBFA 2IH3C 4J9ZB 1XL4A 5CBGA 3ZJZA 3LDCA 4PA9A 1BL8A 3LDDA 2EINC 3E83A 4G28B 2X6AA 4MTOA 1R3LC 5EC1C 3RW0A 3ZRSA 5EC2C 2A9HA 5J9PC 1JVMA 1V55C 4X88A 5EBWC 2Y69C 4RAIA 2EILC 4GX5A 4MW8A 3RVZA 4PDVA 1K4DC 3PJSK 3SPGA 3LDEA 3ABLC 5EK0A 4X8AA 1S5HC 3VOUA 4GX2A 1V54C 4WFEA 3K08A 2WLNA 2BOBC 2H8PC 1M57C 2HVJC 3T2MA 4PDRA 3JYCA 3K0GA 1OCRC 2KB1A 3TCUA 3SYAA 4JTCB
chains in the Genus database with same CATH superfamily
2YC0A 3BCCH 2Q0OC 1K5SA 4W4KA 4U3JB 3RYHA 4JYAO 2NN4A 4GX0A 2ADPA 3CRCA 4TWKA 3JALA 1Q6IA 4X9QA 1AROP 1K5QA 4NTXA 2EZOA 2AXTZ 2Q8VA 1BGYH 3AG2C 5LA6B 4UV8A 4DV7O 2HVKC 1KBHA 5IJ9B 3FFQA 3CWBH 4QGPA 1YJNV 1N33O 4QPKA 2LGWA 2X6BA 2GSMB 2WLJA 1GK9A 3VQWA 4G27B 1IBKO 2UUBO 4UCUA 2XAHA 3SYQA 4EKWA 5KMGA 2OIEA 1E1RG 2IJIA 2VRZA 3JAKB 1SA0A 2UU9B 1YSCA 4YY3B 3DTUB 4X1YA 3ABMC 3WG7B 3ZRWA 2LFSA 2UUAB 1U96A 1N32O 2Q67A 4YJ3A 5IJ0B 4I9WA 4MVZA 4DRXA 5TISZ 1QHTA 4H33A 3JAMN 2QDOA 4PELA 1HP8A 4ASUG 3K5MA 1H8HG 3E83A 1F4MA 4HNAA 3H1IH 1Q43A 2BSKA 1K33A 1SQVH 4ICGA 5ITZA 4PDVA 2E5LB 2YXYA 5J2TA 1D5NA 3RN4A 1EM1A 2JVDA 4N23A 2Q7GA 5KX5B 2YICA 3TCUA 3OMIB 3ZMUA 3K04A 3Q4HA 2ATKC 3B4SA 1XNRB 5KHHA 2B9ZA 3CCJV 1AI6A 3SJQC 1XNQB 1F7YA 5JH7A 1VP7A 4EB6B 2EIKB 1M56C 1HNXB 1E79G 1NH2B 4NXNO 1OCOC 2NNUA 4UFZA 1S5JA 3MHHC 5LXTA 4JI0B 4J10A 1HNWO 3OW2U 4DR1B 3D3IA 4NTYA 1GM8A 1XILA 1XBLA 4IT5A 3OTFA 3LNNA 3SDLA 2QJ1A 3ZRVA 3CCEV 4LWSA 4DXWA 3OR7C 5LOVA 3BVOA 3ZCCA 4UUJC 3MD0A 3IC7A 2K1EA 3T1HO 1W0KG 4H0LB 1K97A 3CCQV 1YVWA 2DWEC 4K0KO 2ITCC 3J80N 3NXSA 2KSDA 4O4JA 2JEXA 2ZXWB 3K5NA 4FJCC 3B09A 4ZOLA 3BFRA 5IE9A 4RWUA 4TV9A 2OT5A 5GTIZ 3ABKC 4JI1O 2ZCEA 4DR5O 4JAAA 2QWPB 2IU3A 1EBOA 1NI8A 2EINC 1PM9A 3RW0A 1PNKA 4UV9A 3RVZA 1NJIW 3ABLC 2CK3G 4X8AA 3ZMZA 5DEDA 1WP8A 2RMKB 3VOUA 4OPHA 5J2UB 4LF9B 3APOA 3WU2Z 3OD4A 4B3RB 2CTQA 2ZE5A 4I0XA 2CE4A 1ZUQA 4J7ZA 5L3EA 4FIPC 3FYIB 3U10A 3CCLV 1SQXH 5JCOC 2JJ2G 1FXVA 3L71H 4JAUA 4I4TB 3HR0A 5IWAB 1IBLO 3C3SA 2HKOA 3LUTB 4J80A 3J7AU 5CA1A 2ZE6A 5CBHA 2RDCA 3AK1A 2EIJB 5LP6C 3L74H 2VQFO 3K06A 1NS1A 4FFKA 1J95A 4KHPO 4I55B 3RYCB 4MVQA 3MDSA 3CPWU 3ZHUA 4X20B 4LF7B 2X6CA 3OAAG 5JVDB 3E8HA 5LHHA 2KG7B 2ZR3A 1BSMA 2M7WA 2LW1A 3EVKA 4U7NA 2RQ6A 4NYKA 2AGAA 2F4VB 1YXBA 2UXCB 2ZE7A 4IYIA 2F1MA 3CMEV 5KLVH 3DGEA 1I0HA 4JI3B 1Y74A 1P7BA 4XDKA 4LP8A 2Y48A 1R1BA 4LH6A 3HKCA 3VQVA 1XL4A 4K35A 4JI8B 1I94O 5KA5A 1KECA 1K7DA 5H6RA 2Y69C 2PUSA 3B2EE 1S0VA 2QSAA 1ROPA 3SGIA 3T1YB 1NTZH 1IVSA 1YEWA 2HLDG 3E22A 1SQBH 3H1HH 4J42A 5JCOA 3FB8C 3E86A 3QF7A 5IYBO 1N36B 2F23A 5FPRA 1BE3H 4YXWG 3BRCA 1Q82W 2BTQA 3CRRA 3IJ4A 1TAEA 2Q4PA 2ZR2A 1XL6A 1Y4MA 2HHHO 3CEIA 3UCSC 3LNMB 3JAWB 2BTOA 4GX1A 3C3TA 2NR5A 4CH5A 4R50A 5LP6A 5B1BB 3W7SA 2DYSB 1AJPA 3T4DA 2UXNA 4I7ZB 1OCZB 1HNXO 4IHJA 2LO1A 1NKDA 3H1JH 2QE7G 5B3SB 1S77D 5EBMC 3WB2A 4DUYO 1K4CC 1YTFD 5LGNA 4ZHQA 2P5OA 4WBNA 1CPYA 2WLLA 4LR3A 3WG7C 4DR1O 5GTHZ 4JYYA 3AG4C 1TUBB 2K9PA 4FK5C 1FD9A 3B8MA 1GTOA 4MTFA 5LYJA 2DE0X 3ZEDA 1TVKA 4W4LA 4Q20A 3M7MX 3CC7V 2G38A 4BIZA 4NB5A 2X0LA 3B77A 4E2LA 2N04A 1VQKV 5DECA 3IC9A 3CD6V 4DK1A 3R66A 2PZSA 3BHPA 1YZBA 5GONA 3S3XA 4BR6A 1AJQA 4MW8A 3FD9A 4LFAO 1M57C 3CMAV 4UCTA 3N2KA 1T5EA 3CSXA 3P32A 5LBQA 3LSQA 1D5AA 4HYOA 5IYCO 3BABA 1CEZA 2DMXA 2JGDA 5BXZA 4AI8A 4PI2A 1QQCA 1B3QA 2ZIOA 4KP4A 3A0RA 1O9GA 1QR8A 3FAVB 3JASA 4R7CA 3UM7A 4DV0O 2CH7A 2YEVA 4GKKB 4I50A 2FL4A 3CJHB 3RYFA 4OXSA 5EBLC 3AG1B 2OWOA 1QVFU 5LL6Y 2H94A 3SYOA 1AVMA 3CC4V 5IYDO 2O57A 2YUAA 1IZ3A 2WLIB 2GUZB 3BPZA 1WA8A 5JJJB 2P22C 4GCZA 4A5UB 3O9OA 2AHYA 1BS3A 4B3SO 1DK1A 4H37A 4UVAA 1K9MW 2EULA 4J11A 4DUZO 3ZS8C 4EFEA 3DC5A 4R6ZA 2W0XA 4NVPA 3FX7A 1YHQV 4GZRB 1RSOA 2GBOA 5CBFA 3CRAA 1MSWD 4LF4B 1V54B 4DV3B 1MSDA 3CS5A 4DR2B 1GN6A 3JARB 1K73W 1V55C 1J5EO 4B08A 4QJFB 1OV9A 1HR0B 5BMVB 1FFXB 5EYPB 4F6RB 4JI8O 2DYRB 2LW7A 4FPPA 1N34O 4JTCB 5H9CA 2JK5C 2WA4A 4FMTA 1I08A 4LFBO 1M5IA 1Y76A 4RO2A 1L1FA 4X62B 1D2DA 4ZI7B 1JX9A 3AG7A 1AP5A 3H1KH 3KCYA 1AI7A 1P4RA 5IY5C 3PN1A 2ZDIC 4PJ0Z 3N2GA 2ADQB 4FZ1A 4TQDA 1VQ5V 1Y6XA 3DSQA 4ABMA 1RFYA 3OR6C 2YS8A 4HAMA 4O4LA 4TV8B 3U11A 2F43G 4LNUB 2C2AA 2HP8A 3STLC 2LP7A 3ASOB 1NH2D 4OGQB 3QNEA 1IDSA 5JQGA 2UUCB 4DV2B 2PF4E 1AI5A 3QO8A 1FS0G 1RP3B 1AJNA 1Q6UA 1PV0A 1JOYA 4PA6A 3CXCU 2WPDG 1ZTEA 3N27A 3JATB 2OCCB 2UXBO 1ZX3A 1WB8A 4KXRA 4O2BA 4LF5B 3TETA 2IJKA 1WP7A 5JJNB 1VEWA 4L8JA 4O4HA 2HJDA 1CP9A 4X1KB 3F7YC 1GN4A 2JGUA 3SYPA 2PY5A 4FM2A 1MOFA 2CGNA 2EZPA 3M8AA 1AR5A 4CS3A 1KYOF 2Q9LA 1VQMV 4IIJB 3JCZA 1CXZB 3BAAA 1U97A 5J9PC 2QM7A 4GX5A 4JI2O 5EK0A 4CZZA 2A3QA 2V7QG 1F51A 4WFEA 1JFFA 2XAJA 1NBMG 1OCRC 2B1GA 4X66B 4UVBA 3ZBHA 2VWKA 5FNVB 5B1AC 1NVPB 4JAVA 2R72A 2ZDIA 4X65B 2R9AA 3OTOB 1XDCA 1M9NA 3ZRXA 2ZM6B 4OX9B 2DYSC 3EXAA 1XQ8A 3U0ZA 3ZX6A 2W0FC 1K8AW 5AG2A 4I55A 3K59A 3JD2A 1QLEC 1VF6C 4O4IB 4DR6B 1HWYA 5FL7G 3K9SA 4GKJB 1FXHA 3ASNB 2E3CA 1LUVA 1URFA 2CTPA 4B3TB 5CA0B 1TGOA 3CHXA 5BZBA 5BR8B 1DGSA 5H2FZ 3L73H 1NT2B 4O2AA 5KHGA 4JPRA 2ZD9A 2DJVA 5KA6A 4JI6O 5HFMA 2AZ0A 2WLKA 4X64O 1PKXA 4K8ZA 3OUSA 1COWG 4AHCA 3BA8A 3RBZA 1Q90D 3OGIB 3R65A 1QR9A 1MZEA 1PPJH 1NZ6A 1ZL8B 3L70H 2VQEB 3GWKC 4J41A 2H3OA 4LF8O 2JJ1G 3SR2C 5CBGA 3ZJZA 5IT9N 4X1IB 5EC1C 5EC2C 2A9HA 2EJRA 3G67A 2Q7EA 4AQYB 5C8YA 3LDEA 5A9GA 2UXDB 1X59A 1S5HC 2XT9A 4DV4B 2CGOA 1YF2A 1ZSPA 3CRQA 3JYCA 5HFLA 2P6JA 3K0GA 4LF4O 1GMGA 4IL6Z 1Z5WA 5LHGA 2CDYA 4DR2O 3RYHB 4DW1A 1IXBA 2FTKA 4DV6O 4DV5O 3UO3A 4CC6A 3JSLA 4DR3B 4LFCO 3H01A 1BZKA 4ZIBA 5EZYA 3JALB 3MAQA 1DF5A 1KD1W 5LMNO 4FLYA 3CCMV 2A0LA 1M1KW 1GKFA 1GM9A 3L75H 3D36C 2YI9A 4FVMA 3QO5A 3SPJA 4FLUA 2XAGA 2WLMA 1OCCB 1WJZA 4DV1B 2A06H 4TSFG 4UXNA 1XMQB 3X2QB 5E1AC 4JYBA 4YJ2A 1NR7A 2DN9A 2JIZG 1XMOO 1KMIZ 5KMGB 1S5LZ 2B5UA 2L35A 2UXXA 2RCVA 1VARA 1XREA 4PA4A 1F4NA 1SA0B 3TK1A 2OYQA 4X1YB 3ZRWB 4G2KA 4YJ3B 4DRXB 3HKEA 3SPCA 1AR1B 2EIMC 2XTAA 4CC5A 4CBCA 5B66Z 4LF5O 1XHZA 5JWPA 1TA8A 4HNAB 1ZAUA 2BSKB 2XOKG 5ITZB 4G28B 2X6AA 5J2TB 4E4EA 2EILC 4JI7B 2RNBA 1RM1C 1FXKC 4CH4A 1SQQH 3Q4HB 3TGUH 3UQ8A 5EIBD 3ETGA 3VBBA 4DW0A 3HKBA 4RUFA 2UU9O 1PD3A 2Q73A 4BW9A 4YY3O 3CE2A 1FJGB 4WFGA 1IX9A 1P7GA 3K3WA 2UUAO 3A0HZ 3CJHA 1Y67A 4DR4B 1K92A 2VWJA 1IBMB 1JMKC 3AG2B 5CB4A 3W7TA 4P9OA 1LNQA 3G6BA 2QGNA 3L72H 2VS0A 2OIGA 1YJ9V 3E2EA 4X89A 3D36A 5LXTB 4DO2A 5H6QA 4R8CA 3K58A 3ZHVA 2GUZA 5KHJA 2WLHA 1VMGA 3K03A 1YDXA 1H2SB 3P30A 4LC1A 2QR4A 1E1QG 4JI5B 2E5LO 3ABTA 5KUKA 4LWSB 4D7SA 4BW5A 5LOVB 2JDIG 3FB6C 2ZT9B 1H2LA 4B3MB 1KKCA 2DQ3A 3AEIA 2YDEA 4DR6O 4ZBMA 4GKJO 2WWWA 1XNRO 2FMLA 1HNZB 3ML0A 4UCSA 4JV5B 3ABMB 4O4JB 1HDJA 4B3TO 3S3WA 3WB1A 4QNHB 2IU0A 2NLJC 3AG3B 1XNQO 4XDLA 1BMFG 4TQFA 4TV9B 1XI1A 1PL4A 2ZINA 4JYAB 4Q6GA 4UB8Z 1YI2V 1US6A 3SJBC 1BQ0A 1WPXA 1H2MA 5L3CA 4JI0O 2YI8A 4MTGA 3UT5A 1PNLA 3DXRB 2Q7HA 1WNSA 5CA3A 2E76B 4NTWA 2ARHA 4H13B 4UCVA 4FFBA 1IXMA 3QTCA 1BQZA 1FXKA 4DV7B 4YHHB 1NTKH 2A7WA 1G6UA 1N33B 3T2MA 3RYIA 4I0XB 1UPGA 2QWOB 4TUYA 3G80A 2XUMA 1IBKB 4Z1MG 2ITDC 1M56B 4GUNA 2UXDO 1OCOB 3F7VC 1WAZA 4U3JA 2ZE8A 3B40A 5LHIA 1M93A 3UKMA 5CA1B 1NR1A 3BA9A 2ODMA 1B04A 2WA3A 1N32B 3CYOA 2YIBD 3OMNB 4FLZA 4PDLA 1QLNA 2PI4A 5IDJA 4DR7B 4WF9V 2EIKC 1FAFA 4J9YB 4KFMA 3JATA 2E74B 1FPOA 1R3IC 5LA6A 2IJHA 2QKSA 3AK3A 5IJ9A 4XDJA 1MA1A 4LF9O 3AK2A 3OGCC 1X4TA 3ZMSA 4RQEA 1EN4A 1FYJA 2IW5A 1SC5B 4B3RO 3GWOA 1SERA 1W2BU 4MVRA 2AZ2A 1G8MA 1EN5A 1NU1H 1XOUA 5B1OA 4NXMB 1SZXA 3WB0A 4C7UA 1AILA 2PI5A 1PL0A 1GH6A 5IWAO 3ABKB 3JAKA 3FB5C 2XNDG 3OT7A 1Q86W 4KL1A 4NR1A 1Y74B 2EINB 5L3FA 3P3NA 1N0JA 2ZXWC 3HKCB 5IJ0A 1WN7A 4RUEA 4MVMA 4NXNB 2AW9A 1PP9H 2ZQMA 1QNMA 3ABLB 2P67A 2QKAA 3ICXA 3JD0A 3ETQA 3LDDA 4MTOA 1VIBA 1HNWB 2PYJA 3SPGA 2XAQA 3QG5A 3K57A 5CMUA 1JA8A 2EX3A 3LSUA 4LF7O 4UCOA 1KP3A 1NQTA 3I55V 4FLXA 2BTQB 4IYHA 3T1HB 5KX5A 4LBEC 2F4VO 1AP6A 2UXCO 4K0KB 1YITV 3I5DA 3HKDB 3QVNA 2YXLA 5L3DA 1Q3EA 4JI3O 1I7FA 5LP6B 2LQTA 2PYLA 4EB6A 5H5NA 4JTAB 2KQXA 1NVPD 2YIAA 1VQ4V 2RN9A 3K5OA 2F95B 2Q68A 4IHJB 4JI1B 2OTJV 5LMUB 4DR5B 3VQXA 2IJJA 4ZHQB 1R73A 3VQYA 3T1YO 2WLLB 2Q5ZA 1R6TA 4Z1VA 1UJWB 4PDMA 2EIJC 4KUMA 4F4LA 2ETNA 4RQFA 5E79Z 3JD3A 1G4YB 4JI5O 5DM6V 1N36O 1ENVA 2GDSA 5LYJB 1BHAA 1TVKB 4JZ2A 1DF4A 5B5EZ 1SZTA 3K79A 1VQ6V 4PI0A 2Y4TA 1KB9F 3CCUV 1PNMA 2QTOA 4MVOA 4K8XA 1SF9A 5D5QA 2R9IA 2Y69B 1IBLB 2QKCA 5GONB 2IH3C 2QTSA 4OPAA 3C90A 1BL8A 1SETA 2B1IA 4LF6B 3JCUZ 2PTMA 1JJOA 2VQFB 1M4UA 1Z2GA 2YSUB 3N2KB 3CC2V 1KP2A 2CTRA 2DQ0A 2ZNJA 3SYAA 3OE7G 4KHPB 3RGBA 4CH6A 5J2UA 4PA7A 3ZHSA 1AI4A 3CX5F 2JGDB 4YHHO 5LGUA 1DLBA 4LCUC 1F23A 5BY1A 3K0DA 3CCSV 3K9AA 3DC6A 5L3BA 1L0LH 1QU7A 3J81N 3JASB 1R6NA 4TT3G 2CH7B 2YEVB 3CXHF 4I50B 4I4TA 2P7TC 3RYFB 1M90W 3IGAC 3NR7A 3ZN0A 1QVGU 2RJZA 3SYCA 5A2QN 1Q8IA 1I94B 2X7RB 3AG4B 2GV9A 2QWQB 1WA8B 1Q5OA 1H8EG 5B1BC 3AG3C 1XUQA 3CB2A 3W7XA 3GB7C 4DR7O 3FYEB 1OCZC 3STZC 5KAIZ 4I5SA 2Y0IA 3D3QA 5B3SC 3RYCA 5K1PA 1XHXA 2GHYA 2AHZA 3JSNA 4X20A 2EJ7A 2V1DA 3ZHQA 2BCCH 5JVDA 2KG7A 2IH1C 4HBNA 4FLWA 1XEQA 5IYZB 3K5LA 3OUFA 1RSOB 4D6TH 3I56V 4GKKO 1YIJV 2HHHB 4NXMO 3W7WA 4CH3A 2PGGA 4FLTA 1WLEA 1OZ0A 3BEHA 5C93A 1YJWV 3CP1A 1SRYA 3G4SV 1M57B 3ZRSA 2P90A 4WFAV 4PD4F 2IBZH 1SESA 2P4VA 1L8DA 5EBWC 4RAIA 1I5XA 3OFNG 3A2FA 5EIBC 4U7OA 2WLNA 2H8PC 1JCHA 1L0NH 4DUYB 1Q7YW 1Y76B 5L3GA 4FLVA 2HFEC 1SS3A 1Q81W 1HW7A 2HG5C 4JGSA 5K1XA 1P84F 2LFRA 1VQ7V 1O9HA 3N2GB 2HJFC 4QPJA 2BOCC 3HPLC 3ZMTA 1K3EA 1VQLV 1MG1A 4BIOA 4WFBV 4O4LB 4I9QA 1OJHA 3SJCC 2GTSA 1R6KA 3JAWA 1H38A 4DV3O 3W7UA 1ORQC 2M6YA 2QA4V 4QE7A 5F2VO 1Z5VA 1KUQA 1DTOA 4YIPA 3KG2A 3CRMA 1HR0O 2QWRB 2R70A 5JQGB 4DYLA 1EN6A 3FKSG 3OEHG 2LGQA 1S76D 1VF6A 1TUEB 2DWDC 2ZIMA 3AG1C 4P9PA 4LFAB 1BHBA 4O2BB 5LMUO 1H2NA 4L87A 1N8RW 4X62O 2Q0AA 3IAYA 4N21A 4WFHA 1S3JA 3DXRA 4UB6Z 1FKAO 4O4HB 3RT3C 1N0NA 1EZVH 1BT8A 1TUBA 2W6IG 2EBOA 3ZHTA 5DN6G 1QBZA 3ETEA 3L9DA 2Z0AA 3KKYA 4EEQA 2JRIA 1V55B 3TXSA 4CS4A 5B1NA 3A8TA 3D8CA 2OCHA 5JJEB 4DV0B 1VQOV 3ZHRA 1R3LC 2KKWA 2P4KA 2UUCO 4CS2A 4DV2O 3UO2A 1JFFB 1JQ0A 1OHHG 1VQ9V 2QEXV 3TJTA 1V54C 4PDRA 3ZN1A 2D3OW 4JI4B 4LF6O 5IY5B 3FB7C 2ZNIA 4WFFA 4UCRA 1MNGA 2HEPA 1V9PA 3H1LH 2N05A 2DYRC 1VQ8V 1AR4A 3IFXA 4B3SB 2D2CB 2GTAA 3T1CA 4F6EA 4DUZB 1VQPV 3ABUA 2QWNB 3OM3B 2QM8A 4HZ3A 4P2ZA 2Z5UA 2F66C 2XASA 1MZFA 3FAVA 4TOIA 3H9VA 2FYUH 5JH7B 3E8FA 2MW2B 3OEEG 2MK3A 4P30A 1EFRG 2JS5A 3TXQA 4O2AB 4H44B 1J5EB 4X66O 2Y0PA 4JF3A 3WFVA 3ASOC 2WLIA 3F5WC 5KUMA 1EZJA 5KHKA 4U3FH 3HB3B 4WCEV 1N34B 4X65O 2XHBA 2Z3YA 1SKVA 3OTOO 1KKDA 3JD4A 2ZM6O 4LFBB 5LGTA 1SQGA 2Y4UA 4OX9O 2YXHA 1Y66A 1RPRA 3E8BA 2OCCC 4FM1A 2YIDA 4PHZA 4JZGA 1S72V 2Q69A 1THZA 5D5PA 4AILC 4JASA 4J9ZB 1W59A 5KHIA 3BY6A 3CCRV 4FZ0A 4ZOLB 5C8YB 1OCRB 1JVMA 5BR8O 4X88A 1N4CA 1K4DC 5CN0A 3KCXA 2N74A 3JARA 5B1AB 2BE3A 4GX2A 3HKDA 1KU9A 3M99B 1VF5B 5BMVA 1FFXA 3APQA 5EYPA 4F6RA 3KZIZ 5EZYB 2HR3A 1GM7A 2UXBB 3B8NA 2YIBA 1QLEB 1VF7A 4EFBA 4ZI7A 4QIWF 1P49A 1R3JC 2VQEO 1ZWIC 4DK0A 3A0BZ 3CCVV 2UUBB 4B7KA 1WPBA 4AQYO 3OMAB 4YJ2B 4TV8A 4LNUA 1LR1A 4DV4O 3QO7A 1W0JG 2QM4A 2WAMA 2JS3A 4BAYA 4MVSA 1JR9A 3ASNC 2A79B 4JI2B 1MABG 1R3KC 3ZMVA 1ZLZA 2P06A 4DR3O 3ZIAG 1SQFA 3EHBB 3HKEB 4PV1B 5FLXN 2XAFA 1UFIA 3LSSA 1BCCH 2IM9A 3E89A 2F93B 4LH7A 1WB7A 1G1XB 4XBFA 1GN3A 4GT1A 4X1KA 3RVYA 4JYCA 2ZKOA 1GO3F 4DV1O 4MSWC 4FM0A 4MS2A 4Z2WA 1H2KA 4GYCB 2L6LA 1XMQO 3RWRD 1KC8W 1JPXA 1AB3A 3PJSK 2WSSG 4IIJA 3SJAC 2CAZC 4UVCA 4BIUA 1YCIA 2BOBC 2HVJC 3HKBB 3F5TA 1Q6HA 3T4ZA 3E35A 2DOSA 2OTLV 1A32A 2FKXA 2Q6AA 2CUGA 1I5YA 5GW7A 5CB4B 3SPHA 4MVUA 5FNVA 1RPOA 1VQNV 4JI6B 5KAFZ 2JEUA 2V4DA 4X64B 2CTWA 4JI4O 3E22B 1IURA 3O65A 1YTFB 2DW4A 1NTMH 5FPOA 4J7KA 1H2GA 4NKGB 1MMMA 4O4IA 1LUWA 4JI7O 3THOA 3MHSC 3SPIA 2W6JG 4D7TA 4LF8B 1GRJA 4PA3A 2E75B 2LJ2A 3E8GA 1FFTB 2ILMA 4ZKIA 5CA0A 1OCCC 4MTXA 5IYZA 4MW3A 1FJGO 4YIOA 3X2QC 1K34A 3G6EV 1GN2A 4BWAA 4MT8A 4DR4O 2EIMB 4JTDB 4IGGA 3RFRA 1IBMO 1B06A 4QE9A 2FB5A 4DV6B 1SQPH 4DV5B 4LFCB 4WBNB 3P3PA 3UT5B 1B6QA 1JJ2U 5LMNB 3EFFK 2EILB 4FFBB 2R9RB 1RM1B 1FXKB 1ZL8A 3LDCA 4K3AA 4PA9A 1KQSU 4B3MO 3G71V 1QCEA 4X1IA 3RYIB 3JD1A 4GLXA 1HNZO 4J7JA 4TUYB 1GAXA 3K08A 4JV5O 4B7EA 3ETDA 2KB1A 1XMOB 3GVMA
chains in the Genus database with same CATH topology
5L3GA 2HFEC 3P32A 1K5SA 5LBQA 3LSQA 4RUFA 1Q81W 2HG5C 4JGSA 1PD3A 4HYOA 5IYCO 4WFGA 2LFRA 3K3WA 1VQ7V 1CEZA 2HJFC 4GX0A 1K92A 4QPJA 3AG2B 2BOCC 3HPLC 3ZMTA 3W7TA 4P9OA 1LNQA 1K3EA 1VQLV 4TWKA 1MG1A 4WFBV 1YJ9V 3E2EA 4X89A 3D36A 4DO2A 5H6QA 4KP4A 1AROP 3A0RA 4R8CA 1K5QA 1QR8A 4R7CA 2EZOA 1R6KA 3UM7A 1H38A 2WLHA 3W7UA 1ORQC 3AG2C 3K03A 2YEVA 2QA4V 4QE7A 3P30A 4LC1A 4UV8A 2HVKC 1DTOA 1E1QG 3KG2A 4OXSA 3ABTA 3AG1B 5EBLC 5KUKA 1YJNV 1QVFU 2H94A 3SYOA 4QPKA 3CC4V 5IYDO 4BW5A 2X6BA 2GSMB 2JDIG 1GK9A 2WLJA 3FB6C 3FKSG 3OEHG 2WLIB 2DQ3A 3AEIA 4ZBMA 4G27B 1S76D 2WWWA 1TUEB 2DWDC 3AG1C 4P9PA 3ML0A 4GCZA 1BHBA 2XAHA 3SYQA 4L87A 4EKWA 1N8RW 3ABMB 1E1RG 2IJIA 4N21A 2AHYA 4WFHA 1S3JA 4QNHB 2IU0A 2NLJC 3AG3B 4XDLA 1BMFG 4H37A 2W6IG 2EBOA 4UVAA 5DN6G 1K9MW 1QBZA 1YSCA 3DTUB 3ETEA 3ABMC 3WG7B 3ZRWA 2LFSA 4R6ZA 2Q67A 1YI2V 4I9WA 4MVZA 1WPXA 4H33A 5L3CA 1V55B 1YHQV 4MTGA 1PNLA 5B1NA 4PELA 5CBFA 5CA3A 4ASUG 1MSWD 1V54B 1H8HG 3E83A 1F4MA 1VQOV 1R3LC 1IXMA 1FXKA 1K73W 1V55C 1K33A 4QJFB 1JQ0A 4PDVA 1OHHG 1VQ9V 2QEXV 4N23A 1V54C 3T2MA 4PDRA 3ZN1A 2DYRB 3TCUA 4FPPA 3OMIB 3ZMUA 4JTCB 2D3OW 5H9CA 2JK5C 3K04A 4Z1MG 2ATKC 5IY5B 4FMTA 3FB7C 2ITDC 1M56B 4WFFA 4RO2A 1L1FA 1OCOB 3F7VC 3CCJV 1AI6A 1JX9A 2DYRC 3SJQC 3IFXA 1VQ8V 1AI7A 1P4RA 5IY5C 2ZDIC 5LHIA 3T1CA 2EIKB 1M56C 3UKMA 1E79G 1NH2B 1VQ5V 1NR1A 1OCOC 1VQPV 2NNUA 3ABUA 3OM3B 2QM8A 3CYOA 4HZ3A 4P2ZA 3OMNB 2Z5UA 4PDLA 1QLNA 3OR6C 2PI4A 3MHHC 5IDJA 2XASA 4HAMA 4WF9V 2EIKC 2F43G 3OW2U 4J9YB 2C2AA 4KFMA 3D3IA 2LP7A 1R3IC 3E8FA 1GM8A 3STLC 3ASOB 2IJHA 2QKSA 3OEEG 2MK3A 4P30A 1NH2D 1EFRG 4XDJA 3QNEA 3OGCC 3ZMSA 4RQEA 3ZRVA 3CCEV 1AI5A 3QO8A 4DXWA 1FS0G 3OR7C 1AJNA 2IW5A 3GWOA 4JF3A 3ZCCA 1JOYA 4UUJC 3MD0A 3IC7A 3ASOC 4PA6A 2K1EA 3WFVA 2WLIA 2WPDG 3F5WC 1W0KG 5KUMA 3CXCU 1W2BU 1EZJA 4MVRA 1K97A 3HB3B 2DWEC 3CCQV 2OCCB 1G8MA 2ITCC 4WCEV 5B1OA 3NXSA 2Z3YA 3TETA 2IJKA 1KKDA 3JD4A 2JEXA 2ZXWB 2PI5A 1PL0A 5LGTA 3ABKB 4FJCC 1Y66A 3FB5C 1RPRA 3E8BA 2OCCC 1CP9A 3F7YC 2XNDG 1S72V 1Q86W 2Q69A 3SYPA 2EINB 5L3FA 2OT5A 2ZXWC 1MOFA 2EZPA 3ABKC 4RUEA 4MVMA 1THZA 2ZQMA 3ABLB 4JASA 2IU3A 4J9ZB 2P67A 1VQMV 1EBOA 3BY6A 3JD0A 3CCRV 4MTOA 3LDDA 2EINC 3JCZA 3RW0A 1PNKA 4UV9A 1OCRB 5J9PC 2QM7A 1JVMA 4X88A 4GX5A 3RVZA 1K4DC 3SPGA 2XAQA 1NJIW 3ABLC 5CN0A 5EK0A 2CK3G 4X8AA 3ZMZA 5CMUA 5B1AB 4CZZA 2V7QG 3VOUA 4GX2A 1F51A 4WFEA 1KP3A 2XAJA 1NBMG 1OCRC 3M99B 1NQTA 2B1GA 3I55V 4UVBA 5B1AC 4LBEC 5L3EA 1NVPB 4FIPC 2HR3A 3FYIB 1GM7A 4JAVA 3CCLV 2ZDIA 1YITV 2JJ2G 3B8NA 1FXVA 1QLEB 1SERA 4JAUA 1M9NA 3ZRXA 4QIWF 2DYSC 1R3JC 5L3DA 2HKOA 1K8AW 1ZWIC 2W0FC 3LUTB 4JTAB 3JD2A 1QLEC 1NVPD 3CCVV 1VQ4V 1HWYA 5FL7G 5CBHA 1FXHA 2Q68A 3ASNB 2EIJB 2OTJV 3OMAB 2IJJA 1R73A 3K06A 3QO7A 1W0JG 2WLLB 2WAMA 5BZBA 4BAYA 1J95A 4MVSA 1UJWB 3ASNC 2A79B 4PDMA 2EIJC 4KUMA 4MVQA 4F4LA 1MABG 1R3KC 3ZMVA 3CPWU 4RQFA 4JPRA 3JD3A 1G4YB 2ZD9A 5DM6V 3ZIAG 2X6CA 1ENVA 3OAAG 3E8HA 5LHHA 1BHAA 2ZR3A 3EHBB 5KA6A 2XAFA 2M7WA 5HFMA 4U7NA 2WLKA 1PKXA 1DF4A 3LSSA 3OUSA 1COWG 1SZTA 3E89A 3K79A 1VQ6V 3RBZA 3R65A 1QR9A 3CMEV 4XBFA 3CCUV 1PNMA 2QTOA 4GT1A 4MVOA 3DGEA 3RVYA 4JYCA 2R9IA 2Y69B 1GO3F 1P7BA 4MSWC 4XDKA 4LP8A 2Y48A 4MS2A 2IH3C 2JJ1G 1XL4A 5CBGA 3ZJZA 5KA5A 1BL8A 1SETA 2B1IA 5EC1C 1KC8W 5EC2C 1KECA 2A9HA 2EJRA 1K7DA 5H6RA 2Y69C 1JPXA 3PJSK 2WSSG 3LDEA 1S5HC 4UVCA 1S0VA 2YSUB 1ROPA 4BIUA 3CC2V 1KP2A 2BOBC 2HVJC 2DQ0A 3JYCA 5HFLA 2P6JA 3K0GA 2HLDG 3SYAA 1GMGA 3OE7G 5LHGA 3T4ZA 3E35A 4PA7A 2OTLV 1AI4A 2FTKA 3FB8C 3E86A 5LGUA 2Q6AA 1DLBA 5IYBO 1I5YA 4LCUC 1F23A 3H01A 5GW7A 4YXWG 3SPHA 4MVUA 1Q82W 1RPOA 3K0DA 3CCSV 3K9AA 1VQNV 5L3BA 1DF5A 2ZR2A 2JEUA 1XL6A 1KD1W 1Y4MA 1R6NA 3LNMB 4TT3G 3CCMV 2A0LA 2YEVB 4GX1A 1M1KW 1YTFB 2DW4A 1GKFA 1GM9A 2P7TC 1M90W 1H2GA 4R50A 3IGAC 3QO5A 5B1BB 3W7SA 3SPJA 3ZN0A 2XAGA 1QVGU 2DYSB 2WLMA 1AJPA 1OCCB 3T4DA 3MHSC 2UXNA 3SPIA 3SYCA 2W6JG 4TSFG 1OCZB 4PA3A 1NKDA 4UXNA 2QE7G 5B3SB 1S77D 5EBMC 2X7RB 3AG4B 3X2QB 5E1AC 1YTFD 1H8EG 1K4CC 4JYBA 1NR7A 5B1BC 3AG3C 2JIZG 3E8GA 1FFTB 5LGNA 4ZKIA 3W7XA 1OCCC 3GB7C 2B5UA 3FYEB 4MTXA 1OCZC 2UXXA 1CPYA 3STZC 2WLLA 4I5SA 3WG7C 4PA4A 5B3SC 4MW3A 3X2QC 3AG4C 1K34A 1F4NA 3TK1A 3G6EV 2GHYA 4MT8A 2AHZA 2EIMB 4JTDB 4FK5C 3B8MA 1GTOA 3ZRWB 2V1DA 4QE9A 4MTFA 4G2KA 2IH1C 3SPCA 4Q20A 1AR1B 2EIMC 1B6QA 3CC7V 3OUFA 4CBCA 4BIZA 3I56V 1JJ2U 1YIJV 2X0LA 3EFFK 3W7WA 2EILB 3B77A 4E2LA 1WLEA 1OZ0A 3BEHA 1VQKV 2R9RB 1RM1B 1FXKB 5C93A 1YJWV 3CP1A 3CD6V 2XOKG 3LDCA 4PA9A 1SRYA 3G4SV 1M57B 2X6AA 4G28B 3ZRSA 2P90A 4WFAV 1SESA 1KQSU 5EBWC 3G71V 4RAIA 1I5XA 1AJQA 1QCEA 2EILC 4MW8A 3OFNG 3JD1A 1RM1C 1FXKC 4U7OA 3K08A 2WLNA 2H8PC 1M57C 3CMAV 1JCHA 1Q7YW 3ETDA 2KB1A 3ETGA 3VBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4Z A;  2JK5 C;  2HFE C;  3K04 A;  4PA7 A;  2ATK C;  3FB7 C;  2ITD C;  3FB8 C;  3E86 A;  4LBE C;  2HG5 C;  4RUF A;  4WFF A;  5B1A C;  4HYO A;  2Q6A A;  4RO2 A;  4WFG A;  4LCU C;  3F7V C;  3SPH A;  4MVU A;  2DYR C;  3SJQ C;  3IFX A;  3K0D A;  2HJF C;  4GX0 A;  2BOC C;  3HPL C;  4P9O A;  5IY5 C;  1XL6 A;  1LNQ A;  3T1C A;  1M56 C;  4TWK A;  2DYS C;  3LNM B;  3UKM A;  1R3J C;  1ZWI C;  2W0F C;  2A0L A;  4GX1 A;  4X89 A;  1OCO C;  3LUT B;  4R8C A;  4R7C A;  2P7T C;  4HZ3 A;  4JTA B;  4P2Z A;  1QLE C;  4PDL A;  2WLH A;  3UM7 A;  1ORQ C;  3AG2 C;  3K03 A;  2YEV A;  3OR6 C;  4R50 A;  5CBH A;  3IGA C;  4QE7 A;  2Q68 A;  2EIK C;  2HVK C;  3SPJ A;  2WLM A;  4J9Y B;  4KFM A;  3KG2 A;  3T4D A;  3SPI A;  4OXS A;  3E8F A;  1R3I C;  5EBL C;  3STL C;  3SYC A;  5KUK A;  2QKS A;  4PA3 A;  3SYO A;  4P30 A;  4XDJ A;  3K06 A;  4BW5 A;  5EBM C;  2X6B A;  3OGC C;  2WLJ A;  3FB6 C;  5E1A C;  1K4C C;  5B1B C;  2WLI B;  2WLL B;  3AG3 C;  5BZB A;  1J95 A;  3E8G A;  4MVS A;  3ASN C;  2A79 B;  4G27 B;  3OR7 C;  2EIJ C;  4PDM A;  1OCC C;  3GB7 C;  4ZBM A;  4DXW A;  4MVQ A;  4F4L A;  2DWD C;  3AG1 C;  1R3K C;  4UUJ C;  1OCZ C;  3ASO C;  2K1E A;  4PA6 A;  2WLI A;  2WLL A;  3F5W C;  4P9P A;  5KUM A;  3STZ C;  3WG7 C;  4PA4 A;  1G4Y B;  2ZD9 A;  4MW3 A;  3SYQ A;  4MVR A;  4EKW A;  5B3S C;  3X2Q C;  2DWE C;  3AG4 C;  2ITC C;  2X6C A;  2AHY A;  4WFH A;  4QNH B;  3E8H A;  2AHZ A;  4JTD B;  2NLJ C;  3TET A;  4QE9 A;  1KKD A;  4XDL A;  2WLK A;  4MTF A;  4H37 A;  2IH1 C;  3FB5 C;  3OUS A;  3ABM C;  3E8B A;  3SPC A;  2OCC C;  3E89 A;  4R6Z A;  3F7Y C;  2Q67 A;  3RBZ A;  2EIM C;  2Q69 A;  3R65 A;  3OUF A;  3SYP A;  4I9W A;  4MVZ A;  4CBC A;  2QTO A;  4MVO A;  2ZXW C;  4H33 A;  3EFF K;  3RVY A;  4MTG A;  3ABK C;  4RUE A;  4MVM A;  1P7B A;  4MSW C;  4XDK A;  3BEH A;  2R9R B;  4LP8 A;  4MS2 A;  5CBF A;  2IH3 C;  4J9Z B;  1XL4 A;  5CBG A;  3ZJZ A;  3LDC A;  4PA9 A;  1BL8 A;  3LDD A;  2EIN C;  3E83 A;  4G28 B;  2X6A A;  4MTO A;  1R3L C;  5EC1 C;  3RW0 A;  3ZRS A;  5EC2 C;  2A9H A;  5J9P C;  1JVM A;  1V55 C;  4X88 A;  5EBW C;  2Y69 C;  4RAI A;  2EIL C;  4GX5 A;  4MW8 A;  3RVZ A;  4PDV A;  1K4D C;  3PJS K;  3SPG A;  3LDE A;  3ABL C;  5EK0 A;  4X8A A;  1S5H C;  3VOU A;  4GX2 A;  1V54 C;  4WFE A;  3K08 A;  2WLN A;  2BOB C;  2H8P C;  1M57 C;  2HVJ C;  3T2M A;  4PDR A;  3JYC A;  3K0G A;  1OCR C;  2KB1 A;  3TCU A;  3SYA A;  4JTC B; 
#chains in the Genus database with same CATH topology
 2YC0 A;  3BCC H;  2Q0O C;  1K5S A;  4W4K A;  4U3J B;  3RYH A;  4JYA O;  2NN4 A;  4GX0 A;  2ADP A;  3CRC A;  4TWK A;  3JAL A;  1Q6I A;  4X9Q A;  1ARO P;  1K5Q A;  4NTX A;  2EZO A;  2AXT Z;  2Q8V A;  1BGY H;  3AG2 C;  5LA6 B;  4UV8 A;  4DV7 O;  2HVK C;  1KBH A;  5IJ9 B;  3FFQ A;  3CWB H;  4QGP A;  1YJN V;  1N33 O;  4QPK A;  2LGW A;  2X6B A;  2GSM B;  2WLJ A;  1GK9 A;  3VQW A;  4G27 B;  1IBK O;  2UUB O;  4UCU A;  2XAH A;  3SYQ A;  4EKW A;  5KMG A;  2OIE A;  1E1R G;  2IJI A;  2VRZ A;  3JAK B;  1SA0 A;  2UU9 B;  1YSC A;  4YY3 B;  3DTU B;  4X1Y A;  3ABM C;  3WG7 B;  3ZRW A;  2LFS A;  2UUA B;  1U96 A;  1N32 O;  2Q67 A;  4YJ3 A;  5IJ0 B;  4I9W A;  4MVZ A;  4DRX A;  5TIS Z;  1QHT A;  4H33 A;  3JAM N;  2QDO A;  4PEL A;  1HP8 A;  4ASU G;  3K5M A;  1H8H G;  3E83 A;  1F4M A;  4HNA A;  3H1I H;  1Q43 A;  2BSK A;  1K33 A;  1SQV H;  4ICG A;  5ITZ A;  4PDV A;  2E5L B;  2YXY A;  5J2T A;  1D5N A;  3RN4 A;  1EM1 A;  2JVD A;  4N23 A;  2Q7G A;  5KX5 B;  2YIC A;  3TCU A;  3OMI B;  3ZMU A;  3K04 A;  3Q4H A;  2ATK C;  3B4S A;  1XNR B;  5KHH A;  2B9Z A;  3CCJ V;  1AI6 A;  3SJQ C;  1XNQ B;  1F7Y A;  5JH7 A;  1VP7 A;  4EB6 B;  2EIK B;  1M56 C;  1HNX B;  1E79 G;  1NH2 B;  4NXN O;  1OCO C;  2NNU A;  4UFZ A;  1S5J A;  3MHH C;  5LXT A;  4JI0 B;  4J10 A;  1HNW O;  3OW2 U;  4DR1 B;  3D3I A;  4NTY A;  1GM8 A;  1XIL A;  1XBL A;  4IT5 A;  3OTF A;  3LNN A;  3SDL A;  2QJ1 A;  3ZRV A;  3CCE V;  4LWS A;  4DXW A;  3OR7 C;  5LOV A;  3BVO A;  3ZCC A;  4UUJ C;  3MD0 A;  3IC7 A;  2K1E A;  3T1H O;  1W0K G;  4H0L B;  1K97 A;  3CCQ V;  1YVW A;  2DWE C;  4K0K O;  2ITC C;  3J80 N;  3NXS A;  2KSD A;  4O4J A;  2JEX A;  2ZXW B;  3K5N A;  4FJC C;  3B09 A;  4ZOL A;  3BFR A;  5IE9 A;  4RWU A;  4TV9 A;  2OT5 A;  5GTI Z;  3ABK C;  4JI1 O;  2ZCE A;  4DR5 O;  4JAA A;  2QWP B;  2IU3 A;  1EBO A;  1NI8 A;  2EIN C;  1PM9 A;  3RW0 A;  1PNK A;  4UV9 A;  3RVZ A;  1NJI W;  3ABL C;  2CK3 G;  4X8A A;  3ZMZ A;  5DED A;  1WP8 A;  2RMK B;  3VOU A;  4OPH A;  5J2U B;  4LF9 B;  3APO A;  3WU2 Z;  3OD4 A;  4B3R B;  2CTQ A;  2ZE5 A;  4I0X A;  2CE4 A;  1ZUQ A;  4J7Z A;  5L3E A;  4FIP C;  3FYI B;  3U10 A;  3CCL V;  1SQX H;  5JCO C;  2JJ2 G;  1FXV A;  3L71 H;  4JAU A;  4I4T B;  3HR0 A;  5IWA B;  1IBL O;  3C3S A;  2HKO A;  3LUT B;  4J80 A;  3J7A U;  5CA1 A;  2ZE6 A;  5CBH A;  2RDC A;  3AK1 A;  2EIJ B;  5LP6 C;  3L74 H;  2VQF O;  3K06 A;  1NS1 A;  4FFK A;  1J95 A;  4KHP O;  4I55 B;  3RYC B;  4MVQ A;  3MDS A;  3CPW U;  3ZHU A;  4X20 B;  4LF7 B;  2X6C A;  3OAA G;  5JVD B;  3E8H A;  5LHH A;  2KG7 B;  2ZR3 A;  1BSM A;  2M7W A;  2LW1 A;  3EVK A;  4U7N A;  2RQ6 A;  4NYK A;  2AGA A;  2F4V B;  1YXB A;  2UXC B;  2ZE7 A;  4IYI A;  2F1M A;  3CME V;  5KLV H;  3DGE A;  1I0H A;  4JI3 B;  1Y74 A;  1P7B A;  4XDK A;  4LP8 A;  2Y48 A;  1R1B A;  4LH6 A;  3HKC A;  3VQV A;  1XL4 A;  4K35 A;  4JI8 B;  1I94 O;  5KA5 A;  1KEC A;  1K7D A;  5H6R A;  2Y69 C;  2PUS A;  3B2E E;  1S0V A;  2QSA A;  1ROP A;  3SGI A;  3T1Y B;  1NTZ H;  1IVS A;  1YEW A;  2HLD G;  3E22 A;  1SQB H;  3H1H H;  4J42 A;  5JCO A;  3FB8 C;  3E86 A;  3QF7 A;  5IYB O;  1N36 B;  2F23 A;  5FPR A;  1BE3 H;  4YXW G;  3BRC A;  1Q82 W;  2BTQ A;  3CRR A;  3IJ4 A;  1TAE A;  2Q4P A;  2ZR2 A;  1XL6 A;  1Y4M A;  2HHH O;  3CEI A;  3UCS C;  3LNM B;  3JAW B;  2BTO A;  4GX1 A;  3C3T A;  2NR5 A;  4CH5 A;  4R50 A;  5LP6 A;  5B1B B;  3W7S A;  2DYS B;  1AJP A;  3T4D A;  2UXN A;  4I7Z B;  1OCZ B;  1HNX O;  4IHJ A;  2LO1 A;  1NKD A;  3H1J H;  2QE7 G;  5B3S B;  1S77 D;  5EBM C;  3WB2 A;  4DUY O;  1K4C C;  1YTF D;  5LGN A;  4ZHQ A;  2P5O A;  4WBN A;  1CPY A;  2WLL A;  4LR3 A;  3WG7 C;  4DR1 O;  5GTH Z;  4JYY A;  3AG4 C;  1TUB B;  2K9P A;  4FK5 C;  1FD9 A;  3B8M A;  1GTO A;  4MTF A;  5LYJ A;  2DE0 X;  3ZED A;  1TVK A;  4W4L A;  4Q20 A;  3M7M X;  3CC7 V;  2G38 A;  4BIZ A;  4NB5 A;  2X0L A;  3B77 A;  4E2L A;  2N04 A;  1VQK V;  5DEC A;  3IC9 A;  3CD6 V;  4DK1 A;  3R66 A;  2PZS A;  3BHP A;  1YZB A;  5GON A;  3S3X A;  4BR6 A;  1AJQ A;  4MW8 A;  3FD9 A;  4LFA O;  1M57 C;  3CMA V;  4UCT A;  3N2K A;  1T5E A;  3CSX A;  3P32 A;  5LBQ A;  3LSQ A;  1D5A A;  4HYO A;  5IYC O;  3BAB A;  1CEZ A;  2DMX A;  2JGD A;  5BXZ A;  4AI8 A;  4PI2 A;  1QQC A;  1B3Q A;  2ZIO A;  4KP4 A;  3A0R A;  1O9G A;  1QR8 A;  3FAV B;  3JAS A;  4R7C A;  3UM7 A;  4DV0 O;  2CH7 A;  2YEV A;  4GKK B;  4I50 A;  2FL4 A;  3CJH B;  3RYF A;  4OXS A;  5EBL C;  3AG1 B;  2OWO A;  1QVF U;  5LL6 Y;  2H94 A;  3SYO A;  1AVM A;  3CC4 V;  5IYD O;  2O57 A;  2YUA A;  1IZ3 A;  2WLI B;  2GUZ B;  3BPZ A;  1WA8 A;  5JJJ B;  2P22 C;  4GCZ A;  4A5U B;  3O9O A;  2AHY A;  1BS3 A;  4B3S O;  1DK1 A;  4H37 A;  4UVA A;  1K9M W;  2EUL A;  4J11 A;  4DUZ O;  3ZS8 C;  4EFE A;  3DC5 A;  4R6Z A;  2W0X A;  4NVP A;  3FX7 A;  1YHQ V;  4GZR B;  1RSO A;  2GBO A;  5CBF A;  3CRA A;  1MSW D;  4LF4 B;  1V54 B;  4DV3 B;  1MSD A;  3CS5 A;  4DR2 B;  1GN6 A;  3JAR B;  1K73 W;  1V55 C;  1J5E O;  4B08 A;  4QJF B;  1OV9 A;  1HR0 B;  5BMV B;  1FFX B;  5EYP B;  4F6R B;  4JI8 O;  2DYR B;  2LW7 A;  4FPP A;  1N34 O;  4JTC B;  5H9C A;  2JK5 C;  2WA4 A;  4FMT A;  1I08 A;  4LFB O;  1M5I A;  1Y76 A;  4RO2 A;  1L1F A;  4X62 B;  1D2D A;  4ZI7 B;  1JX9 A;  3AG7 A;  1AP5 A;  3H1K H;  3KCY A;  1AI7 A;  1P4R A;  5IY5 C;  3PN1 A;  2ZDI C;  4PJ0 Z;  3N2G A;  2ADQ B;  4FZ1 A;  4TQD A;  1VQ5 V;  1Y6X A;  3DSQ A;  4ABM A;  1RFY A;  3OR6 C;  2YS8 A;  4HAM A;  4O4L A;  4TV8 B;  3U11 A;  2F43 G;  4LNU B;  2C2A A;  2HP8 A;  3STL C;  2LP7 A;  3ASO B;  1NH2 D;  4OGQ B;  3QNE A;  1IDS A;  5JQG A;  2UUC B;  4DV2 B;  2PF4 E;  1AI5 A;  3QO8 A;  1FS0 G;  1RP3 B;  1AJN A;  1Q6U A;  1PV0 A;  1JOY A;  4PA6 A;  3CXC U;  2WPD G;  1ZTE A;  3N27 A;  3JAT B;  2OCC B;  2UXB O;  1ZX3 A;  1WB8 A;  4KXR A;  4O2B A;  4LF5 B;  3TET A;  2IJK A;  1WP7 A;  5JJN B;  1VEW A;  4L8J A;  4O4H A;  2HJD A;  1CP9 A;  4X1K B;  3F7Y C;  1GN4 A;  2JGU A;  3SYP A;  2PY5 A;  4FM2 A;  1MOF A;  2CGN A;  2EZP A;  3M8A A;  1AR5 A;  4CS3 A;  1KYO F;  2Q9L A;  1VQM V;  4IIJ B;  3JCZ A;  1CXZ B;  3BAA A;  1U97 A;  5J9P C;  2QM7 A;  4GX5 A;  4JI2 O;  5EK0 A;  4CZZ A;  2A3Q A;  2V7Q G;  1F51 A;  4WFE A;  1JFF A;  2XAJ A;  1NBM G;  1OCR C;  2B1G A;  4X66 B;  4UVB A;  3ZBH A;  2VWK A;  5FNV B;  5B1A C;  1NVP B;  4JAV A;  2R72 A;  2ZDI A;  4X65 B;  2R9A A;  3OTO B;  1XDC A;  1M9N A;  3ZRX A;  2ZM6 B;  4OX9 B;  2DYS C;  3EXA A;  1XQ8 A;  3U0Z A;  3ZX6 A;  2W0F C;  1K8A W;  5AG2 A;  4I55 A;  3K59 A;  3JD2 A;  1QLE C;  1VF6 C;  4O4I B;  4DR6 B;  1HWY A;  5FL7 G;  3K9S A;  4GKJ B;  1FXH A;  3ASN B;  2E3C A;  1LUV A;  1URF A;  2CTP A;  4B3T B;  5CA0 B;  1TGO A;  3CHX A;  5BZB A;  5BR8 B;  1DGS A;  5H2F Z;  3L73 H;  1NT2 B;  4O2A A;  5KHG A;  4JPR A;  2ZD9 A;  2DJV A;  5KA6 A;  4JI6 O;  5HFM A;  2AZ0 A;  2WLK A;  4X64 O;  1PKX A;  4K8Z A;  3OUS A;  1COW G;  4AHC A;  3BA8 A;  3RBZ A;  1Q90 D;  3OGI B;  3R65 A;  1QR9 A;  1MZE A;  1PPJ H;  1NZ6 A;  1ZL8 B;  3L70 H;  2VQE B;  3GWK C;  4J41 A;  2H3O A;  4LF8 O;  2JJ1 G;  3SR2 C;  5CBG A;  3ZJZ A;  5IT9 N;  4X1I B;  5EC1 C;  5EC2 C;  2A9H A;  2EJR A;  3G67 A;  2Q7E A;  4AQY B;  5C8Y A;  3LDE A;  5A9G A;  2UXD B;  1X59 A;  1S5H C;  2XT9 A;  4DV4 B;  2CGO A;  1YF2 A;  1ZSP A;  3CRQ A;  3JYC A;  5HFL A;  2P6J A;  3K0G A;  4LF4 O;  1GMG A;  4IL6 Z;  1Z5W A;  5LHG A;  2CDY A;  4DR2 O;  3RYH B;  4DW1 A;  1IXB A;  2FTK A;  4DV6 O;  4DV5 O;  3UO3 A;  4CC6 A;  3JSL A;  4DR3 B;  4LFC O;  3H01 A;  1BZK A;  4ZIB A;  5EZY A;  3JAL B;  3MAQ A;  1DF5 A;  1KD1 W;  5LMN O;  4FLY A;  3CCM V;  2A0L A;  1M1K W;  1GKF A;  1GM9 A;  3L75 H;  3D36 C;  2YI9 A;  4FVM A;  3QO5 A;  3SPJ A;  4FLU A;  2XAG A;  2WLM A;  1OCC B;  1WJZ A;  4DV1 B;  2A06 H;  4TSF G;  4UXN A;  1XMQ B;  3X2Q B;  5E1A C;  4JYB A;  4YJ2 A;  1NR7 A;  2DN9 A;  2JIZ G;  1XMO O;  1KMI Z;  5KMG B;  1S5L Z;  2B5U A;  2L35 A;  2UXX A;  2RCV A;  1VAR A;  1XRE A;  4PA4 A;  1F4N A;  1SA0 B;  3TK1 A;  2OYQ A;  4X1Y B;  3ZRW B;  4G2K A;  4YJ3 B;  4DRX B;  3HKE A;  3SPC A;  1AR1 B;  2EIM C;  2XTA A;  4CC5 A;  4CBC A;  5B66 Z;  4LF5 O;  1XHZ A;  5JWP A;  1TA8 A;  4HNA B;  1ZAU A;  2BSK B;  2XOK G;  5ITZ B;  4G28 B;  2X6A A;  5J2T B;  4E4E A;  2EIL C;  4JI7 B;  2RNB A;  1RM1 C;  1FXK C;  4CH4 A;  1SQQ H;  3Q4H B;  3TGU H;  3UQ8 A;  5EIB D;  3ETG A;  3VBB A;  4DW0 A;  3HKB A;  4RUF A;  2UU9 O;  1PD3 A;  2Q73 A;  4BW9 A;  4YY3 O;  3CE2 A;  1FJG B;  4WFG A;  1IX9 A;  1P7G A;  3K3W A;  2UUA O;  3A0H Z;  3CJH A;  1Y67 A;  4DR4 B;  1K92 A;  2VWJ A;  1IBM B;  1JMK C;  3AG2 B;  5CB4 A;  3W7T A;  4P9O A;  1LNQ A;  3G6B A;  2QGN A;  3L72 H;  2VS0 A;  2OIG A;  1YJ9 V;  3E2E A;  4X89 A;  3D36 A;  5LXT B;  4DO2 A;  5H6Q A;  4R8C A;  3K58 A;  3ZHV A;  2GUZ A;  5KHJ A;  2WLH A;  1VMG A;  3K03 A;  1YDX A;  1H2S B;  3P30 A;  4LC1 A;  2QR4 A;  1E1Q G;  4JI5 B;  2E5L O;  3ABT A;  5KUK A;  4LWS B;  4D7S A;  4BW5 A;  5LOV B;  2JDI G;  3FB6 C;  2ZT9 B;  1H2L A;  4B3M B;  1KKC A;  2DQ3 A;  3AEI A;  2YDE A;  4DR6 O;  4ZBM A;  4GKJ O;  2WWW A;  1XNR O;  2FML A;  1HNZ B;  3ML0 A;  4UCS A;  4JV5 B;  3ABM B;  4O4J B;  1HDJ A;  4B3T O;  3S3W A;  3WB1 A;  4QNH B;  2IU0 A;  2NLJ C;  3AG3 B;  1XNQ O;  4XDL A;  1BMF G;  4TQF A;  4TV9 B;  1XI1 A;  1PL4 A;  2ZIN A;  4JYA B;  4Q6G A;  4UB8 Z;  1YI2 V;  1US6 A;  3SJB C;  1BQ0 A;  1WPX A;  1H2M A;  5L3C A;  4JI0 O;  2YI8 A;  4MTG A;  3UT5 A;  1PNL A;  3DXR B;  2Q7H A;  1WNS A;  5CA3 A;  2E76 B;  4NTW A;  2ARH A;  4H13 B;  4UCV A;  4FFB A;  1IXM A;  3QTC A;  1BQZ A;  1FXK A;  4DV7 B;  4YHH B;  1NTK H;  2A7W A;  1G6U A;  1N33 B;  3T2M A;  3RYI A;  4I0X B;  1UPG A;  2QWO B;  4TUY A;  3G80 A;  2XUM A;  1IBK B;  4Z1M G;  2ITD C;  1M56 B;  4GUN A;  2UXD O;  1OCO B;  3F7V C;  1WAZ A;  4U3J A;  2ZE8 A;  3B40 A;  5LHI A;  1M93 A;  3UKM A;  5CA1 B;  1NR1 A;  3BA9 A;  2ODM A;  1B04 A;  2WA3 A;  1N32 B;  3CYO A;  2YIB D;  3OMN B;  4FLZ A;  4PDL A;  1QLN A;  2PI4 A;  5IDJ A;  4DR7 B;  4WF9 V;  2EIK C;  1FAF A;  4J9Y B;  4KFM A;  3JAT A;  2E74 B;  1FPO A;  1R3I C;  5LA6 A;  2IJH A;  2QKS A;  3AK3 A;  5IJ9 A;  4XDJ A;  1MA1 A;  4LF9 O;  3AK2 A;  3OGC C;  1X4T A;  3ZMS A;  4RQE A;  1EN4 A;  1FYJ A;  2IW5 A;  1SC5 B;  4B3R O;  3GWO A;  1SER A;  1W2B U;  4MVR A;  2AZ2 A;  1G8M A;  1EN5 A;  1NU1 H;  1XOU A;  5B1O A;  4NXM B;  1SZX A;  3WB0 A;  4C7U A;  1AIL A;  2PI5 A;  1PL0 A;  1GH6 A;  5IWA O;  3ABK B;  3JAK A;  3FB5 C;  2XND G;  3OT7 A;  1Q86 W;  4KL1 A;  4NR1 A;  1Y74 B;  2EIN B;  5L3F A;  3P3N A;  1N0J A;  2ZXW C;  3HKC B;  5IJ0 A;  1WN7 A;  4RUE A;  4MVM A;  4NXN B;  2AW9 A;  1PP9 H;  2ZQM A;  1QNM A;  3ABL B;  2P67 A;  2QKA A;  3ICX A;  3JD0 A;  3ETQ A;  3LDD A;  4MTO A;  1VIB A;  1HNW B;  2PYJ A;  3SPG A;  2XAQ A;  3QG5 A;  3K57 A;  5CMU A;  1JA8 A;  2EX3 A;  3LSU A;  4LF7 O;  4UCO A;  1KP3 A;  1NQT A;  3I55 V;  4FLX A;  2BTQ B;  4IYH A;  3T1H B;  5KX5 A;  4LBE C;  2F4V O;  1AP6 A;  2UXC O;  4K0K B;  1YIT V;  3I5D A;  3HKD B;  3QVN A;  2YXL A;  5L3D A;  1Q3E A;  4JI3 O;  1I7F A;  5LP6 B;  2LQT A;  2PYL A;  4EB6 A;  5H5N A;  4JTA B;  2KQX A;  1NVP D;  2YIA A;  1VQ4 V;  2RN9 A;  3K5O A;  2F95 B;  2Q68 A;  4IHJ B;  4JI1 B;  2OTJ V;  5LMU B;  4DR5 B;  3VQX A;  2IJJ A;  4ZHQ B;  1R73 A;  3VQY A;  3T1Y O;  2WLL B;  2Q5Z A;  1R6T A;  4Z1V A;  1UJW B;  4PDM A;  2EIJ C;  4KUM A;  4F4L A;  2ETN A;  4RQF A;  5E79 Z;  3JD3 A;  1G4Y B;  4JI5 O;  5DM6 V;  1N36 O;  1ENV A;  2GDS A;  5LYJ B;  1BHA A;  1TVK B;  4JZ2 A;  1DF4 A;  5B5E Z;  1SZT A;  3K79 A;  1VQ6 V;  4PI0 A;  2Y4T A;  1KB9 F;  3CCU V;  1PNM A;  2QTO A;  4MVO A;  4K8X A;  1SF9 A;  5D5Q A;  2R9I A;  2Y69 B;  1IBL B;  2QKC A;  5GON B;  2IH3 C;  2QTS A;  4OPA A;  3C90 A;  1BL8 A;  1SET A;  2B1I A;  4LF6 B;  3JCU Z;  2PTM A;  1JJO A;  2VQF B;  1M4U A;  1Z2G A;  2YSU B;  3N2K B;  3CC2 V;  1KP2 A;  2CTR A;  2DQ0 A;  2ZNJ A;  3SYA A;  3OE7 G;  4KHP B;  3RGB A;  4CH6 A;  5J2U A;  4PA7 A;  3ZHS A;  1AI4 A;  3CX5 F;  2JGD B;  4YHH O;  5LGU A;  1DLB A;  4LCU C;  1F23 A;  5BY1 A;  3K0D A;  3CCS V;  3K9A A;  3DC6 A;  5L3B A;  1L0L H;  1QU7 A;  3J81 N;  3JAS B;  1R6N A;  4TT3 G;  2CH7 B;  2YEV B;  3CXH F;  4I50 B;  4I4T A;  2P7T C;  3RYF B;  1M90 W;  3IGA C;  3NR7 A;  3ZN0 A;  1QVG U;  2RJZ A;  3SYC A;  5A2Q N;  1Q8I A;  1I94 B;  2X7R B;  3AG4 B;  2GV9 A;  2QWQ B;  1WA8 B;  1Q5O A;  1H8E G;  5B1B C;  3AG3 C;  1XUQ A;  3CB2 A;  3W7X A;  3GB7 C;  4DR7 O;  3FYE B;  1OCZ C;  3STZ C;  5KAI Z;  4I5S A;  2Y0I A;  3D3Q A;  5B3S C;  3RYC A;  5K1P A;  1XHX A;  2GHY A;  2AHZ A;  3JSN A;  4X20 A;  2EJ7 A;  2V1D A;  3ZHQ A;  2BCC H;  5JVD A;  2KG7 A;  2IH1 C;  4HBN A;  4FLW A;  1XEQ A;  5IYZ B;  3K5L A;  3OUF A;  1RSO B;  4D6T H;  3I56 V;  4GKK O;  1YIJ V;  2HHH B;  4NXM O;  3W7W A;  4CH3 A;  2PGG A;  4FLT A;  1WLE A;  1OZ0 A;  3BEH A;  5C93 A;  1YJW V;  3CP1 A;  1SRY A;  3G4S V;  1M57 B;  3ZRS A;  2P90 A;  4WFA V;  4PD4 F;  2IBZ H;  1SES A;  2P4V A;  1L8D A;  5EBW C;  4RAI A;  1I5X A;  3OFN G;  3A2F A;  5EIB C;  4U7O A;  2WLN A;  2H8P C;  1JCH A;  1L0N H;  4DUY B;  1Q7Y W;  1Y76 B;  5L3G A;  4FLV A;  2HFE C;  1SS3 A;  1Q81 W;  1HW7 A;  2HG5 C;  4JGS A;  5K1X A;  1P84 F;  2LFR A;  1VQ7 V;  1O9H A;  3N2G B;  2HJF C;  4QPJ A;  2BOC C;  3HPL C;  3ZMT A;  1K3E A;  1VQL V;  1MG1 A;  4BIO A;  4WFB V;  4O4L B;  4I9Q A;  1OJH A;  3SJC C;  2GTS A;  1R6K A;  3JAW A;  1H38 A;  4DV3 O;  3W7U A;  1ORQ C;  2M6Y A;  2QA4 V;  4QE7 A;  5F2V O;  1Z5V A;  1KUQ A;  1DTO A;  4YIP A;  3KG2 A;  3CRM A;  1HR0 O;  2QWR B;  2R70 A;  5JQG B;  4DYL A;  1EN6 A;  3FKS G;  3OEH G;  2LGQ A;  1S76 D;  1VF6 A;  1TUE B;  2DWD C;  2ZIM A;  3AG1 C;  4P9P A;  4LFA B;  1BHB A;  4O2B B;  5LMU O;  1H2N A;  4L87 A;  1N8R W;  4X62 O;  2Q0A A;  3IAY A;  4N21 A;  4WFH A;  1S3J A;  3DXR A;  4UB6 Z;  1FKA O;  4O4H B;  3RT3 C;  1N0N A;  1EZV H;  1BT8 A;  1TUB A;  2W6I G;  2EBO A;  3ZHT A;  5DN6 G;  1QBZ A;  3ETE A;  3L9D A;  2Z0A A;  3KKY A;  4EEQ A;  2JRI A;  1V55 B;  3TXS A;  4CS4 A;  5B1N A;  3A8T A;  3D8C A;  2OCH A;  5JJE B;  4DV0 B;  1VQO V;  3ZHR A;  1R3L C;  2KKW A;  2P4K A;  2UUC O;  4CS2 A;  4DV2 O;  3UO2 A;  1JFF B;  1JQ0 A;  1OHH G;  1VQ9 V;  2QEX V;  3TJT A;  1V54 C;  4PDR A;  3ZN1 A;  2D3O W;  4JI4 B;  4LF6 O;  5IY5 B;  3FB7 C;  2ZNI A;  4WFF A;  4UCR A;  1MNG A;  2HEP A;  1V9P A;  3H1L H;  2N05 A;  2DYR C;  1VQ8 V;  1AR4 A;  3IFX A;  4B3S B;  2D2C B;  2GTA A;  3T1C A;  4F6E A;  4DUZ B;  1VQP V;  3ABU A;  2QWN B;  3OM3 B;  2QM8 A;  4HZ3 A;  4P2Z A;  2Z5U A;  2F66 C;  2XAS A;  1MZF A;  3FAV A;  4TOI A;  3H9V A;  2FYU H;  5JH7 B;  3E8F A;  2MW2 B;  3OEE G;  2MK3 A;  4P30 A;  1EFR G;  2JS5 A;  3TXQ A;  4O2A B;  4H44 B;  1J5E B;  4X66 O;  2Y0P A;  4JF3 A;  3WFV A;  3ASO C;  2WLI A;  3F5W C;  5KUM A;  1EZJ A;  5KHK A;  4U3F H;  3HB3 B;  4WCE V;  1N34 B;  4X65 O;  2XHB A;  2Z3Y A;  1SKV A;  3OTO O;  1KKD A;  3JD4 A;  2ZM6 O;  4LFB B;  5LGT A;  1SQG A;  2Y4U A;  4OX9 O;  2YXH A;  1Y66 A;  1RPR A;  3E8B A;  2OCC C;  4FM1 A;  2YID A;  4PHZ A;  4JZG A;  1S72 V;  2Q69 A;  1THZ A;  5D5P A;  4AIL C;  4JAS A;  4J9Z B;  1W59 A;  5KHI A;  3BY6 A;  3CCR V;  4FZ0 A;  4ZOL B;  5C8Y B;  1OCR B;  1JVM A;  5BR8 O;  4X88 A;  1N4C A;  1K4D C;  5CN0 A;  3KCX A;  2N74 A;  3JAR A;  5B1A B;  2BE3 A;  4GX2 A;  3HKD A;  1KU9 A;  3M99 B;  1VF5 B;  5BMV A;  1FFX A;  3APQ A;  5EYP A;  4F6R A;  3KZI Z;  5EZY B;  2HR3 A;  1GM7 A;  2UXB B;  3B8N A;  2YIB A;  1QLE B;  1VF7 A;  4EFB A;  4ZI7 A;  4QIW F;  1P49 A;  1R3J C;  2VQE O;  1ZWI C;  4DK0 A;  3A0B Z;  3CCV V;  2UUB B;  4B7K A;  1WPB A;  4AQY O;  3OMA B;  4YJ2 B;  4TV8 A;  4LNU A;  1LR1 A;  4DV4 O;  3QO7 A;  1W0J G;  2QM4 A;  2WAM A;  2JS3 A;  4BAY A;  4MVS A;  1JR9 A;  3ASN C;  2A79 B;  4JI2 B;  1MAB G;  1R3K C;  3ZMV A;  1ZLZ A;  2P06 A;  4DR3 O;  3ZIA G;  1SQF A;  3EHB B;  3HKE B;  4PV1 B;  5FLX N;  2XAF A;  1UFI A;  3LSS A;  1BCC H;  2IM9 A;  3E89 A;  2F93 B;  4LH7 A;  1WB7 A;  1G1X B;  4XBF A;  1GN3 A;  4GT1 A;  4X1K A;  3RVY A;  4JYC A;  2ZKO A;  1GO3 F;  4DV1 O;  4MSW C;  4FM0 A;  4MS2 A;  4Z2W A;  1H2K A;  4GYC B;  2L6L A;  1XMQ O;  3RWR D;  1KC8 W;  1JPX A;  1AB3 A;  3PJS K;  2WSS G;  4IIJ A;  3SJA C;  2CAZ C;  4UVC A;  4BIU A;  1YCI A;  2BOB C;  2HVJ C;  3HKB B;  3F5T A;  1Q6H A;  3T4Z A;  3E35 A;  2DOS A;  2OTL V;  1A32 A;  2FKX A;  2Q6A A;  2CUG A;  1I5Y A;  5GW7 A;  5CB4 B;  3SPH A;  4MVU A;  5FNV A;  1RPO A;  1VQN V;  4JI6 B;  5KAF Z;  2JEU A;  2V4D A;  4X64 B;  2CTW A;  4JI4 O;  3E22 B;  1IUR A;  3O65 A;  1YTF B;  2DW4 A;  1NTM H;  5FPO A;  4J7K A;  1H2G A;  4NKG B;  1MMM A;  4O4I A;  1LUW A;  4JI7 O;  3THO A;  3MHS C;  3SPI A;  2W6J G;  4D7T A;  4LF8 B;  1GRJ A;  4PA3 A;  2E75 B;  2LJ2 A;  3E8G A;  1FFT B;  2ILM A;  4ZKI A;  5CA0 A;  1OCC C;  4MTX A;  5IYZ A;  4MW3 A;  1FJG O;  4YIO A;  3X2Q C;  1K34 A;  3G6E V;  1GN2 A;  4BWA A;  4MT8 A;  4DR4 O;  2EIM B;  4JTD B;  4IGG A;  3RFR A;  1IBM O;  1B06 A;  4QE9 A;  2FB5 A;  4DV6 B;  1SQP H;  4DV5 B;  4LFC B;  4WBN B;  3P3P A;  3UT5 B;  1B6Q A;  1JJ2 U;  5LMN B;  3EFF K;  2EIL B;  4FFB B;  2R9R B;  1RM1 B;  1FXK B;  1ZL8 A;  3LDC A;  4K3A A;  4PA9 A;  1KQS U;  4B3M O;  3G71 V;  1QCE A;  4X1I A;  3RYI B;  3JD1 A;  4GLX A;  1HNZ O;  4J7J A;  4TUY B;  1GAX A;  3K08 A;  4JV5 O;  4B7E A;  3ETD A;  2KB1 A;  1XMO B;  3GVM A; 
#chains in the Genus database with same CATH homology
 5L3G A;  2HFE C;  3P32 A;  1K5S A;  5LBQ A;  3LSQ A;  4RUF A;  1Q81 W;  2HG5 C;  4JGS A;  1PD3 A;  4HYO A;  5IYC O;  4WFG A;  2LFR A;  3K3W A;  1VQ7 V;  1CEZ A;  2HJF C;  4GX0 A;  1K92 A;  4QPJ A;  3AG2 B;  2BOC C;  3HPL C;  3ZMT A;  3W7T A;  4P9O A;  1LNQ A;  1K3E A;  1VQL V;  4TWK A;  1MG1 A;  4WFB V;  1YJ9 V;  3E2E A;  4X89 A;  3D36 A;  4DO2 A;  5H6Q A;  4KP4 A;  1ARO P;  3A0R A;  4R8C A;  1K5Q A;  1QR8 A;  4R7C A;  2EZO A;  1R6K A;  3UM7 A;  1H38 A;  2WLH A;  3W7U A;  1ORQ C;  3AG2 C;  3K03 A;  2YEV A;  2QA4 V;  4QE7 A;  3P30 A;  4LC1 A;  4UV8 A;  2HVK C;  1DTO A;  1E1Q G;  3KG2 A;  4OXS A;  3ABT A;  3AG1 B;  5EBL C;  5KUK A;  1YJN V;  1QVF U;  2H94 A;  3SYO A;  4QPK A;  3CC4 V;  5IYD O;  4BW5 A;  2X6B A;  2GSM B;  2JDI G;  1GK9 A;  2WLJ A;  3FB6 C;  3FKS G;  3OEH G;  2WLI B;  2DQ3 A;  3AEI A;  4ZBM A;  4G27 B;  1S76 D;  2WWW A;  1TUE B;  2DWD C;  3AG1 C;  4P9P A;  3ML0 A;  4GCZ A;  1BHB A;  2XAH A;  3SYQ A;  4L87 A;  4EKW A;  1N8R W;  3ABM B;  1E1R G;  2IJI A;  4N21 A;  2AHY A;  4WFH A;  1S3J A;  4QNH B;  2IU0 A;  2NLJ C;  3AG3 B;  4XDL A;  1BMF G;  4H37 A;  2W6I G;  2EBO A;  4UVA A;  5DN6 G;  1K9M W;  1QBZ A;  1YSC A;  3DTU B;  3ETE A;  3ABM C;  3WG7 B;  3ZRW A;  2LFS A;  4R6Z A;  2Q67 A;  1YI2 V;  4I9W A;  4MVZ A;  1WPX A;  4H33 A;  5L3C A;  1V55 B;  1YHQ V;  4MTG A;  1PNL A;  5B1N A;  4PEL A;  5CBF A;  5CA3 A;  4ASU G;  1MSW D;  1V54 B;  1H8H G;  3E83 A;  1F4M A;  1VQO V;  1R3L C;  1IXM A;  1FXK A;  1K73 W;  1V55 C;  1K33 A;  4QJF B;  1JQ0 A;  4PDV A;  1OHH G;  1VQ9 V;  2QEX V;  4N23 A;  1V54 C;  3T2M A;  4PDR A;  3ZN1 A;  2DYR B;  3TCU A;  4FPP A;  3OMI B;  3ZMU A;  4JTC B;  2D3O W;  5H9C A;  2JK5 C;  3K04 A;  4Z1M G;  2ATK C;  5IY5 B;  4FMT A;  3FB7 C;  2ITD C;  1M56 B;  4WFF A;  4RO2 A;  1L1F A;  1OCO B;  3F7V C;  3CCJ V;  1AI6 A;  1JX9 A;  2DYR C;  3SJQ C;  3IFX A;  1VQ8 V;  1AI7 A;  1P4R A;  5IY5 C;  2ZDI C;  5LHI A;  3T1C A;  2EIK B;  1M56 C;  3UKM A;  1E79 G;  1NH2 B;  1VQ5 V;  1NR1 A;  1OCO C;  1VQP V;  2NNU A;  3ABU A;  3OM3 B;  2QM8 A;  3CYO A;  4HZ3 A;  4P2Z A;  3OMN B;  2Z5U A;  4PDL A;  1QLN A;  3OR6 C;  2PI4 A;  3MHH C;  5IDJ A;  2XAS A;  4HAM A;  4WF9 V;  2EIK C;  2F43 G;  3OW2 U;  4J9Y B;  2C2A A;  4KFM A;  3D3I A;  2LP7 A;  1R3I C;  3E8F A;  1GM8 A;  3STL C;  3ASO B;  2IJH A;  2QKS A;  3OEE G;  2MK3 A;  4P30 A;  1NH2 D;  1EFR G;  4XDJ A;  3QNE A;  3OGC C;  3ZMS A;  4RQE A;  3ZRV A;  3CCE V;  1AI5 A;  3QO8 A;  4DXW A;  1FS0 G;  3OR7 C;  1AJN A;  2IW5 A;  3GWO A;  4JF3 A;  3ZCC A;  1JOY A;  4UUJ C;  3MD0 A;  3IC7 A;  3ASO C;  4PA6 A;  2K1E A;  3WFV A;  2WLI A;  2WPD G;  3F5W C;  1W0K G;  5KUM A;  3CXC U;  1W2B U;  1EZJ A;  4MVR A;  1K97 A;  3HB3 B;  2DWE C;  3CCQ V;  2OCC B;  1G8M A;  2ITC C;  4WCE V;  5B1O A;  3NXS A;  2Z3Y A;  3TET A;  2IJK A;  1KKD A;  3JD4 A;  2JEX A;  2ZXW B;  2PI5 A;  1PL0 A;  5LGT A;  3ABK B;  4FJC C;  1Y66 A;  3FB5 C;  1RPR A;  3E8B A;  2OCC C;  1CP9 A;  3F7Y C;  2XND G;  1S72 V;  1Q86 W;  2Q69 A;  3SYP A;  2EIN B;  5L3F A;  2OT5 A;  2ZXW C;  1MOF A;  2EZP A;  3ABK C;  4RUE A;  4MVM A;  1THZ A;  2ZQM A;  3ABL B;  4JAS A;  2IU3 A;  4J9Z B;  2P67 A;  1VQM V;  1EBO A;  3BY6 A;  3JD0 A;  3CCR V;  4MTO A;  3LDD A;  2EIN C;  3JCZ A;  3RW0 A;  1PNK A;  4UV9 A;  1OCR B;  5J9P C;  2QM7 A;  1JVM A;  4X88 A;  4GX5 A;  3RVZ A;  1K4D C;  3SPG A;  2XAQ A;  1NJI W;  3ABL C;  5CN0 A;  5EK0 A;  2CK3 G;  4X8A A;  3ZMZ A;  5CMU A;  5B1A B;  4CZZ A;  2V7Q G;  3VOU A;  4GX2 A;  1F51 A;  4WFE A;  1KP3 A;  2XAJ A;  1NBM G;  1OCR C;  3M99 B;  1NQT A;  2B1G A;  3I55 V;  4UVB A;  5B1A C;  4LBE C;  5L3E A;  1NVP B;  4FIP C;  2HR3 A;  3FYI B;  1GM7 A;  4JAV A;  3CCL V;  2ZDI A;  1YIT V;  2JJ2 G;  3B8N A;  1FXV A;  1QLE B;  1SER A;  4JAU A;  1M9N A;  3ZRX A;  4QIW F;  2DYS C;  1R3J C;  5L3D A;  2HKO A;  1K8A W;  1ZWI C;  2W0F C;  3LUT B;  4JTA B;  3JD2 A;  1QLE C;  1NVP D;  3CCV V;  1VQ4 V;  1HWY A;  5FL7 G;  5CBH A;  1FXH A;  2Q68 A;  3ASN B;  2EIJ B;  2OTJ V;  3OMA B;  2IJJ A;  1R73 A;  3K06 A;  3QO7 A;  1W0J G;  2WLL B;  2WAM A;  5BZB A;  4BAY A;  1J95 A;  4MVS A;  1UJW B;  3ASN C;  2A79 B;  4PDM A;  2EIJ C;  4KUM A;  4MVQ A;  4F4L A;  1MAB G;  1R3K C;  3ZMV A;  3CPW U;  4RQF A;  4JPR A;  3JD3 A;  1G4Y B;  2ZD9 A;  5DM6 V;  3ZIA G;  2X6C A;  1ENV A;  3OAA G;  3E8H A;  5LHH A;  1BHA A;  2ZR3 A;  3EHB B;  5KA6 A;  2XAF A;  2M7W A;  5HFM A;  4U7N A;  2WLK A;  1PKX A;  1DF4 A;  3LSS A;  3OUS A;  1COW G;  1SZT A;  3E89 A;  3K79 A;  1VQ6 V;  3RBZ A;  3R65 A;  1QR9 A;  3CME V;  4XBF A;  3CCU V;  1PNM A;  2QTO A;  4GT1 A;  4MVO A;  3DGE A;  3RVY A;  4JYC A;  2R9I A;  2Y69 B;  1GO3 F;  1P7B A;  4MSW C;  4XDK A;  4LP8 A;  2Y48 A;  4MS2 A;  2IH3 C;  2JJ1 G;  1XL4 A;  5CBG A;  3ZJZ A;  5KA5 A;  1BL8 A;  1SET A;  2B1I A;  5EC1 C;  1KC8 W;  5EC2 C;  1KEC A;  2A9H A;  2EJR A;  1K7D A;  5H6R A;  2Y69 C;  1JPX A;  3PJS K;  2WSS G;  3LDE A;  1S5H C;  4UVC A;  1S0V A;  2YSU B;  1ROP A;  4BIU A;  3CC2 V;  1KP2 A;  2BOB C;  2HVJ C;  2DQ0 A;  3JYC A;  5HFL A;  2P6J A;  3K0G A;  2HLD G;  3SYA A;  1GMG A;  3OE7 G;  5LHG A;  3T4Z A;  3E35 A;  4PA7 A;  2OTL V;  1AI4 A;  2FTK A;  3FB8 C;  3E86 A;  5LGU A;  2Q6A A;  1DLB A;  5IYB O;  1I5Y A;  4LCU C;  1F23 A;  3H01 A;  5GW7 A;  4YXW G;  3SPH A;  4MVU A;  1Q82 W;  1RPO A;  3K0D A;  3CCS V;  3K9A A;  1VQN V;  5L3B A;  1DF5 A;  2ZR2 A;  2JEU A;  1XL6 A;  1KD1 W;  1Y4M A;  1R6N A;  3LNM B;  4TT3 G;  3CCM V;  2A0L A;  2YEV B;  4GX1 A;  1M1K W;  1YTF B;  2DW4 A;  1GKF A;  1GM9 A;  2P7T C;  1M90 W;  1H2G A;  4R50 A;  3IGA C;  3QO5 A;  5B1B B;  3W7S A;  3SPJ A;  3ZN0 A;  2XAG A;  1QVG U;  2DYS B;  2WLM A;  1AJP A;  1OCC B;  3T4D A;  3MHS C;  2UXN A;  3SPI A;  3SYC A;  2W6J G;  4TSF G;  1OCZ B;  4PA3 A;  1NKD A;  4UXN A;  2QE7 G;  5B3S B;  1S77 D;  5EBM C;  2X7R B;  3AG4 B;  3X2Q B;  5E1A C;  1YTF D;  1H8E G;  1K4C C;  4JYB A;  1NR7 A;  5B1B C;  3AG3 C;  2JIZ G;  3E8G A;  1FFT B;  5LGN A;  4ZKI A;  3W7X A;  1OCC C;  3GB7 C;  2B5U A;  3FYE B;  4MTX A;  1OCZ C;  2UXX A;  1CPY A;  3STZ C;  2WLL A;  4I5S A;  3WG7 C;  4PA4 A;  5B3S C;  4MW3 A;  3X2Q C;  3AG4 C;  1K34 A;  1F4N A;  3TK1 A;  3G6E V;  2GHY A;  4MT8 A;  2AHZ A;  2EIM B;  4JTD B;  4FK5 C;  3B8M A;  1GTO A;  3ZRW B;  2V1D A;  4QE9 A;  4MTF A;  4G2K A;  2IH1 C;  3SPC A;  4Q20 A;  1AR1 B;  2EIM C;  1B6Q A;  3CC7 V;  3OUF A;  4CBC A;  4BIZ A;  3I56 V;  1JJ2 U;  1YIJ V;  2X0L A;  3EFF K;  3W7W A;  2EIL B;  3B77 A;  4E2L A;  1WLE A;  1OZ0 A;  3BEH A;  1VQK V;  2R9R B;  1RM1 B;  1FXK B;  5C93 A;  1YJW V;  3CP1 A;  3CD6 V;  2XOK G;  3LDC A;  4PA9 A;  1SRY A;  3G4S V;  1M57 B;  2X6A A;  4G28 B;  3ZRS A;  2P90 A;  4WFA V;  1SES A;  1KQS U;  5EBW C;  3G71 V;  4RAI A;  1I5X A;  1AJQ A;  1QCE A;  2EIL C;  4MW8 A;  3OFN G;  3JD1 A;  1RM1 C;  1FXK C;  4U7O A;  3K08 A;  2WLN A;  2H8P C;  1M57 C;  3CMA V;  1JCH A;  1Q7Y W;  3ETD A;  2KB1 A;  3ETG A;  3VBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...