2BOCC

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2bocC00
4LCUC 2R9RB 2A9HA 4MTFA 4P30A 2H8PC 2A0LA 4X88A 4MVMA 5CBFA 1LNQA 3AG4C 3K0DA 1K4CC 2ZD9A 3OUFA 3SYCA 3T2MA 2QKSA 2W0FC 3SYPA 1R3IC 2EILC 3AG3C 3LDCA 3FB6C 2QTOA 3E83A 1ZWIC 5CBHA 4MVRA 5EBWC 2HVJC 2WLHA 3EFFK 2HJFC 1XL6A 4QNHB 4MTGA 4MVSA 4EKWA 5EK0A 4XDLA 4R50A 5CBGA 1K4DC 2WLNA 2WLKA 3SPHA 4MS2A 2P7TC 2WLLB 3AG2C 3E8FA 4R6ZA 4JTDB 2X6AA 2Q6AA 4HZ3A 4P2ZA 3K03A 2ZXWC 3GB7C 3KG2A 3IGAC 4R7CA 4PA3A 4RUFA 3UKMA 1OCCC 3OUSA 4GX5A 4LP8A 4DXWA 2DYSC 3K06A 4TWKA 5J9PC 1R3JC 4J9YB 5EC2C 3FB7C 2ATKC 4PA7A 3SJQC 5BZBA 2WLIA 1OCZC 2X6BA 1OCOC 5E1AC 2A79B 3RVZA 3STLC 3VOUA 4X89A 4GX1A 3ABMC 3FB8C 1P7BA 2HFEC 3T4DA 4X8AA 2BOBC 4P9PA 2EIJC 3ASNC 4JTCB 4RAIA 2K1EA 4MW3A 5B3SC 3SYOA 4JTAB 2AHZA 3RW0A 2IH3C 5EBLC 3SYAA 2Q68A 3E89A 1J95A 4CBCA 1V54C 3ABKC 5IY5C 4H33A 5KUMA 1KKDA 3F7VC 2WLJA 3UM7A 3K08A 3TETA 3BEHA 3SPJA 1R3KC 4H37A 1S5HC 3RBZA 3LNMB 4MVQA 2ITCC 3OR6C 1M57C 4WFFA 4PDVA 4QE7A 3TCUA 4GX2A 2ITDC 4PA9A 4UUJC 3FB5C 4HYOA 4PA4A 4WFEA 2HVKC 2WLIB 3LUTB 2DWEC 2DYRC 2NLJC 3AG1C 1OCRC 3SYQA 4RO2A 2EIKC 4OXSA 4PA6A 1QLEC 2Q69A 1BL8A 4MVUA 2AHYA 2Y69C 2JK5C 4J9ZB 3OGCC 3LDEA 3E8BA 3IFXA 2HG5C 3ZJZA 2X6CA 3E8GA 4G27B 5EBMC 3X2QC 2EIMC 2WLLA 4GX0A 4G28B 4RUEA 5B1AC 3SPIA 3PJSK 4MTOA 1XL4A 3STZC 2YEVA 3K0GA 3F7YC 1M56C 3E86A 3T4ZA 2EINC 2Q67A 5KUKA 4WFGA 3E8HA 4KFMA 3SPGA 4MVZA 4LBEC 4MVOA 4R8CA 2WLMA 4XDJA 5B1BC 1JVMA 3F5WC 4BW5A 3K04A 2DWDC 1G4YB 4WFHA 4XDKA 3SPCA 4MW8A 3WG7C 4PDRA 3LDDA 3RVYA 1R3LC 4ZBMA 4QE9A 4F4LA 2BOCC 3JYCA 3ABLC 4I9WA 4MSWC 2IH1C 3ASOC 3OR7C 4PDMA 4PDLA 5EC1C 3ZRSA 1V55C 4P9OA 3HPLC 1ORQC 3T1CA 2KB1A 2OCCC 3R65A
chains in the Genus database with same CATH superfamily
4MT8A 2H8PC 1VF6A 3ABTA 5DEDA 2UUBO 4TV9B 4DUYO 4JF3A 3E83A 4JI8O 2EINB 2PY5A 1TUBA 2HJFC 3WU2Z 3ABUA 4NB5A 4AI8A 2LFSA 3I56V 1Q86W 1US6A 3UQ8A 2OWOA 4P2ZA 5IYCO 4K0KO 3IGAC 4PA3A 2ZE6A 3SJAC 1GH6A 3ZIAG 4FFBB 3E22A 4FLYA 3W7WA 1XI1A 4JI6O 5CA3A 1MA1A 1K73W 1IBLB 3SYAA 4DR2B 1QHTA 4EFBA 3UM7A 4X20B 1JA8A 2KQXA 2XHBA 4O4JB 4FM1A 3JSLA 2LJ2A 3LNMB 4YJ3A 5CMUA 3ABMB 3CS5A 1XBLA 4JAUA 5ITZB 3ICXA 4PA4A 1I0HA 3AG1C 4RO2A 1Q6UA 4JI2O 4FPPA 2YICA 4JYAB 1PNKA 1QLNA 1QU7A 2HG5C 4LF8B 2DQ0A 4LH7A 4RUEA 3SPIA 1R6NA 2YEVA 3H1HH 5KMGA 1RPOA 4UV9A 4LWSA 2CAZC 3AK1A 4MVZA 1Y76A 5KHJA 1GN2A 4NXMO 4CH3A 1AR1B 4AQYB 4JI1O 1VQNV 5B1BC 3F5WC 4NTYA 1U96A 1WA8B 3K58A 4WFHA 2VWJA 1PP9H 1MSDA 3ETGA 4PDRA 3AK2A 3HKEB 4IT5A 4OX9B 2FTKA 4TQFA 2ARHA 3ASOC 1LUWA 1SQVH 1VQOV 4ZKIA 3CC7V 4CS3A 1YXBA 2OYQA 4B7KA 4MVSA 1XUQA 3UO3A 4DR5B 2P22C 1YVWA 4DV6O 2KSDA 4QPJA 1XMQB 4HZ3A 2ZXWC 1QBZA 4AQYO 2M6YA 2Q7GA 1OCCC 4UCRA 1AI6A 2AZ0A 3M8AA 1MZEA 3CC4V 1ENVA 4Q20A 1IVSA 3IJ4A 3K5OA 2F4VO 3STLC 1XOUA 2EJ7A 3ABLB 3H1IH 5LGNA 4DR3B 4B3MB 2YUAA 4RQFA 3SYOA 1XHZA 2VS0A 3EVKA 4GYCB 1ZUQA 1IZ3A 3LNNA 2NNUA 4H37A 3ZRWB 3RBZA 4YHHB 4DUZB 1PV0A 4PHZA 4K8XA 4OXSA 3L9DA 4XBFA 4WF9V 1IBMB 1NR1A 1KKCA 4WFBV 2RCVA 4UCSA 3CHXA 1OV9A 4LNUA 2Z0AA 4NXNO 5JJNB 2IJKA 3B8MA 3CCMV 3RWRD 1K5QA 4ZHQA 4CZZA 3KZIZ 5BMVB 4XDKA 5LOVA 3SPCA 2JEXA 1Q6HA 2ZR2A 3TXSA 3CEIA 4CS4A 4JI5B 1VF6C 1OCZB 3HPLC 3ZS8C 4IL6Z 2KB1A 4DO2A 1HNXO 3P30A 4X64O 5KHKA 1MMMA 3K79A 1H2LA 2IJIA 2ZT9B 1ZL8A 1XNRO 4IIJB 5EK0A 3BAAA 3FX7A 5L3BA 4BIZA 1S0VA 1FXKC 2ADPA 4X9QA 4X1IA 4R7CA 4DXWA 1JR9A 4CC5A 2UUAO 3QF7A 2CDYA 3K9SA 2X6BA 5K1XA 1GTOA 2PZSA 2JVDA 3P3NA 4ZI7A 1OCOB 1N0JA 4I50A 2G38A 2EZPA 2ZE7A 1UPGA 4FMTA 3CYOA 1CEZA 1OJHA 4BIUA 3UT5A 1PM9A 2ZM6O 2UXCB 3OTOO 2EBOA 4O4HB 3BA8A 4FVMA 4B7EA 1NS1A 3ETDA 1JMKC 3CXCU 2LW1A 4JZGA 4X66B 5GONA 2WLLA 1HNZB 1AILA 2W6JG 2MW2B 1KB9F 2HKOA 1PD3A 1Q90D 1EM1A 4QJFB 1PL0A 3UCSC 3D3QA 4W4LA 4YHHO 2IBZH 1E1RG 1VQ4V 2FYUH 3AEIA 4GKJO 2RDCA 2YI8A 3RYFB 1RP3B 2YIAA 1Y67A 3CCSV 2EULA 3JYCA 3ABLC 4TT3G 3T1CA 3G6EV 4ZOLB 2CE4A 2FL4A 4DV5O 2A0LA 1LNQA 2F4VB 1VQMV 3T2MA 1R3IC 1S77D 1WP7A 3OD4A 1VP7A 2B1IA 3OMNB 3LSSA 4XDLA 3W7TA 2DN9A 2PUSA 1P4RA 4IIJA 1M4UA 3AG2C 5IYBO 2Q6AA 3K03A 3OEHG 1KP3A 1DF4A 1R3JC 3OT7A 1H2SB 4X1YB 2P4KA 4X64B 3FYIB 1E79G 3B4SA 5LXTA 2A79B 1VQ7V 1H2MA 3RYHB 1WLEA 2ZNJA 3VBBA 3JD2A 4RAIA 1GO3F 4FM0A 1K34A 2WWWA 2E76B 1FS0G 2GTSA 2DMXA 1WPXA 5IWAB 2QKCA 1Y6XA 2P4VA 3CE2A 4QE7A 2ITDC 5KA6A 3FB5C 2WLIB 4BAYA 5KAFZ 5E79Z 2VQEO 4U7NA 4DR3O 1F23A 2ZXWB 2DJVA 1K8AW 3AG1B 1XMOB 3ZMTA 4O2BB 2UUCO 4LH6A 4YIPA 1SQQH 4DV4B 2QDOA 4U3JB 1FFXA 2BTQB 4MVOA 1GMGA 5EYPB 4KHPB 4LF9O 1IURA 3JD3A 4MW8A 1YHQV 4QE9A 2OIGA 5EC1C 3K59A 4FFKA 3CMEV 2F1MA 1FYJA 2ZD9A 3OUFA 3BVOA 1IXBA 1XMQO 2Y4UA 4JI7O 2P7TC 3FKSG 3OTFA 1FPOA 4FJCC 4RUFA 4DUZO 3OW2U 2BTOA 4N23A 2XNDG 3OTOB 3HKDB 3G67A 4JI8B 5BZBA 1VQ9V 4X65B 1KYOF 4GX1A 3T4DA 3ZHSA 1RSOB 4JTCB 1L0LH 1Y66A 2GDSA 2ILMA 5JVDB 3WB0A 1HNZO 4FK5C 4YJ2A 4DR1O 1J95A 1OCCB 1FD9A 1V54C 5EYPA 1RM1C 2UUBB 3JASB 3K08A 3NR7A 1N0NA 1AI7A 4X65O 3RYCB 2R70A 1Q43A 2Q5ZA 1NKDA 2E5LO 5BMVA 2F66C 5JJEB 3J81N 4C7UA 4JV5O 1A32A 2X6CA 3E8GA 3T1YB 1NBMG 4L8JA 2YDEA 1XNRB 1T5EA 4ZHQB 3B77A 4DV5B 1XDCA 4YIOA 1YDXA 1W2BU 5H6QA 3SR2C 4LBEC 2YIBA 3ABKB 4CH6A 3CCLV 4J10A 1YF2A 2GV9A 2ODMA 4I7ZB 1QVFU 4DV1B 4I9WA 5L3CA 4JPRA 2UU9B 3HKCB 4FFBA 3AG3B 4P30A 2JEUA 4LFCO 2ZIMA 5IYDO 4DYLA 1N34O 1WB7A 5DECA 1VQPV 3FB6C 2QTOA 3F5TA 4ZOLA 4MVRA 3J7AU 3EFFK 4UVBA 5CA0B 3T1HO 4KHPO 2WLNA 5JVDA 4GKJB 4R6ZA 4X1KB 1VQKV 4JYYA 2E75B 4OPAA 3ZN0A 5JJJB 1SETA 4GX5A 3JALA 4OGQB 4PI0A 4UFZA 4JI0O 1L8DA 4X62O 5J2TB 3CD6V 4OPHA 4F6EA 3VOUA 4LC1A 3FB8C 1P7BA 5JQGA 5KX5A 3ASNC 3JAWA 2UXXA 2AZ2A 1Q7YW 5IWAO 3CRQA 4IYHA 3ABKC 1U97A 2WA3A 1M57B 2JGDA 5IJ0A 2CTWA 1BSMA 1GN3A 1WAZA 3HKEA 3MHHC 3HKDA 2FMLA 4J7ZA 2QWOB 1BL8A 4MVUA 4FZ0A 4GLXA 1SQPH 3SDLA 2P06A 1K9MW 4I50B 2CK3G 1COWG 4IYIA 3G6BA 5B1AC 2KG7A 5C8YB 1AJQA 3E86A 2EINC 1F7YA 2N04A 3J80N 1THZA 1FXHA 4KXRA 3ZHVA 4JYCA 4YXWG 4EB6B 3ML0A 2R9AA 1HWYA 4DR5O 1F51A 4NTWA 1Z5WA 1P7GA 2XASA 3N2GA 4U7OA 5FNVA 1NU1H 4I5SA 4P9OA 5TISZ 2Q7HA 1X4TA 3IC7A 2ZDIA 1PPJH 3R65A 4JI1B 2WAMA 3IC9A 3WFVA 3CRMA 4FM2A 4HNAA 4UCVA 4DR7B 1QLEB 1BHAA 1SZXA 1N36O 1PNLA 1H2GA 2BSKB 4GZRB 3CXHF 4LWSB 1IDSA 1F4NA 5H6RA 3PN1A 5KAIZ 3BFRA 2IW5A 1JX9A 3ZHQA 2ZIOA 2V7QG 1L0NH 3JSNA 4YJ3B 2UXBO 1WPBA 1N36B 4FLUA 3AG2B 4PA7A 1YEWA 2WLIA 1OCOC 2YI9A 4JI2B 4ASUG 1JCHA 4JI7B 1CP9A 3DXRB 1IBKB 2DYSB 3RW0A 1EZJA 2Q68A 4JYBA 4MTXA 4CBCA 4K8ZA 4H33A 4LR3A 2DOSA 4AHCA 1V55B 4MVQA 4J42A 4DK0A 4PV1B 1M57C 1S72V 4JI4B 3ZRWA 1JQ0A 3SYQA 2YSUB 5B66Z 4D7TA 3P32A 4DV3B 2Q4PA 2B5UA 4L87A 3S3WA 2QM4A 1QVGU 4CS2A 5F2VO 5HFLA 1M1KW 4MTOA 3U0ZA 1BGYH 1GN4A 1UFIA 5LP6B 5GTHZ 3G4SV 3SGIA 5JH7B 1TGOA 5CB4B 2GHYA 2GUZA 1WP8A 1JVMA 4Z1MG 1Q5OA 1BE3H 2V1DA 2YXLA 4LF4O 5BR8B 4K0KB 3FFQA 4LF8O 4JI3O 2F93B 4U3FH 1N33B 4UB8Z 3EHBB 5IJ9B 1XILA 1QCEA 1DGSA 2A9HA 3CC2V 4DV2B 1SQGA 3A0RA 1NTKH 3CCUV 1EN4A 1BQ0A 3NXSA 3JCUZ 2WLKA 3N2GB 1ZLZA 1VQ8V 3SPHA 5J2UA 2WLLB 3E8FA 2Q73A 1Q6IA 1DK1A 2YXYA 3QG5A 4FLVA 4DV2O 4NTXA 3TJTA 2EJRA 1DF5A 5E1AC 2ZCEA 3L70H 4LFCB 2F23A 5LHHA 3ZX6A 3QO8A 3O65A 1D5NA 5EZYA 4TV8A 1H38A 1YJNV 4NKGB 1YTFB 3T1HB 2Y0PA 3IAYA 2RN9A 5L3EA 3TETA 3SPJA 1N32O 1IXMA 1FAFA 4DV7B 2UU9O 2PI4A 2UUCB 4HYOA 1MOFA 2W6IG 5KA5A 2XT9A 4JI5O 2YEVB 3HKBA 4LFBB 2JGUA 1HDJA 2JIZG 1SS3A 3JAKA 3ZMSA 4DR7O 2L6LA 3B40A 1H8EG 2E5LB 3E22B 2HHHO 1B04A 1Z2GA 3AG4B 1EZVH 3UO2A 1FXKB 3T1YO 1HW7A 1EN6A 5B3SC 5JQGB 3OMIB 3OR7C 2HJDA 4LF5B 2QR4A 3LSQA 4JZ2A 2WSSG 5CA1B 4DRXA 1AI4A 4B3TB 2UXBB 4B08A 5CBFA 5D5PA 1YJWV 2ZR3A 2FB5A 3SYCA 4DW0A 3SYPA 1ZAUA 4ZIBA 1MABG 4QNHB 1KU9A 2LQTA 3THOA 1ZSPA 5LP6C 4I4TA 1D5AA 2XAGA 4O4LA 4JI3B 3TK1A 3GB7C 4HBNA 3QVNA 4TWKA 1N34B 5IDJA 2JS5A 4IHJB 3A0BZ 1VIBA 5EC2C 2ATKC 5LHGA 4WCEV 2GBOA 2Q8VA 4DRXB 4BR6A 2V4DA 2HP8A 1DLBA 1WN7A 3ZBHA 2QGNA 1M90W 2BSKA 1RPRA 3RT3C 2BE3A 5IE9A 5EBLC 3BABA 2HR3A 2CTPA 4JV5B 3M99B 1N8RW 4X62B 5LGTA 1FXKA 2ZE8A 1HNWB 3HB3B 2NR5A 3OR6C 3H1JH 3TCUA 1NH2B 2OIEA 4DW1A 2NLJC 3D36A 3JCZA 3CRAA 2EIKC 1IBKO 1D2DA 5IY5B 2M7WA 1BT8A 1QR8A 2GTAA 4I55A 4WFAV 1BMFG 3ZJZA 1NH2D 5LMNO 5FPRA 2QWPB 3HKBB 4DR4O 4TUYA 1SQBH 4HNAB 1SERA 1H2NA 4JAAA 3B8NA 1SA0A 3LSUA 3OM3B 4LFAO 3K3WA 4QGPA 1XMOO 2XUMA 5EIBD 1M5IA 5J2UB 1TVKA 3RFRA 2CH7B 3H1LH 5GTIZ 4PDMA 2IH1C 1V55C 2EILB 3A2FA 4H44B 4QPKA 5KHGA 3MHSC 2EILC 2KG7B 3AG3C 3JARB 4EB6A 2H3OA 5KHIA 5IJ9A 4UVCA 4JI0B 1XREA 3VQWA 5C8YA 5CBGA 3APQA 1NVPD 4G2KA 3ZHTA 3D3IA 1KQSU 4K3AA 4O4HA 1AP5A 1SKVA 2QWQB 1CXZB 4CH4A 2ZE5A 2EIKB 5IJ0B 4DV7O 1N33O 2EIJB 3DC5A 1VQLV 5LBQA 4LF7O 1OCZC 4UXNA 2QM8A 3RVZA 4X89A 2DQ3A 1GN6A 4NR1A 2EIJC 3D36C 1J5EB 1AR5A 4ZI7B 2Y0IA 1UJWB 1R1BA 3CCJV 5CN0A 5KUMA 3ETQA 4D6TH 3HKCA 1Y4MA 1WB8A 3RYIB 1M9NA 2A7WA 3W7SA 1YTFD 1KUQA 4GX2A 4EKWA 3U11A 1JJ2U 2HVKC 2UXNA 3BPZA 4PA6A 1SC5B 4TQDA 1K33A 2Y69C 2IU0A 1K97A 3IFXA 5EBMC 3ZMUA 3A0HZ 1S5LZ 3MD0A 2YC0A 1AP6A 1TUBB 4KFMA 5A2QN 2FKXA 2AXTZ 3SPGA 1SESA 4H0LB 4YY3B 5LA6A 2P5OA 3APOA 2JJ1G 3B09A 1GM8A 4WBNB 2DYRB 3B2EE 2XAJA 2BOCC 1MZFA 4B3SO 5LXTB 4IGGA 4O4IB 1S3JA 3X2QB 4NXMB 4LCUC 5A9GA 5LMUO 4LF7B 3W7XA 4LNUB 1GM9A 4UCOA 3FAVA 4B3RO 4DR6O 1ZWIC 5BR8O 2IJHA 4LF4B 5EBWC 2QTSA 3A8TA 4UB6Z 4MTGA 4I9QA 3CX5F 1QNMA 1Q82W 4I0XB 3JAKB 1GM7A 3K9AA 3JATA 4TSFG 3SJCC 1O9HA 2QA4V 2LW7A 5H2FZ 1KC8W 5K1PA 1GAXA 3ABMC 2HFEC 1SQXH 2BOBC 2QM7A 2AHZA 4D7SA 2YXHA 4LF6O 5B1BB 4BWAA 4DV4O 4DR6B 4TV8B 5EZYB 1YZBA 2ZQMA 3CCEV 1R3KC 2DE0X 4LF9B 4UCTA 4FZ1A 1ZX3A 1YSCA 4PA9A 4UUJC 1IX9A 4GUNA 5LYJA 3C90A 1OHHG 4DV1O 2AHYA 2HEPA 4UCUA 3L73H 3Q4HB 3L74H 1G6UA 2EIMC 4GX0A 1YITV 4G28B 4X1IB 3F7YC 5C93A 5KUKA 2Y4TA 2EZOA 5CB4A 3H9VA 2ADQB 1PKXA 4NVPA 2Z5UA 4R8CA 2GSMB 1SZTA 4O4JA 2AW9A 3DGEA 1R3LC 2ZINA 3CJHB 1JOYA 3BHPA 2XAHA 2Q0OC 3ZRXA 2HHHB 2R9RB 4MTFA 5KMGB 1XQ8A 4NYKA 4TOIA 1PNMA 4E4EA 3FD9A 3K57A 1NI8A 3G80A 2WLHA 2WA4A 1XL6A 3WB2A 3CSXA 4W4KA 3RGBA 2XTAA 5B1OA 4O2BA 5CA0A 1Q81W 3MAQA 3ZMVA 1B06A 1SQFA 4PJ0Z 5ITZA 5LP6A 3BA9A 4QIWF 3OE7G 1BCCH 5J9PC 3CP1A 2PF4E 3ZHRA 2RNBA 3ZHUA 1ZTEA 2JJ2G 2A06H 2YIDA 5BY1A 1TUEB 4X8AA 1K3EA 1MNGA 4MW3A 4Z1VA 1R6KA 3FYEB 2X0LA 1G1XB 2N05A 1KKDA 5H5NA 4PDVA 3RYFA 3STZC 1JPXA 1E1QG 2DYRC 2P6JA 2PYLA 1QLEC 4DV0B 2PI5A 1FJGB 4PD4F 3CJHA 4K35A 1R6TA 1XNQB 3CB2A 3X2QC 1H2KA 1RSOA 2P90A 1B6QA 1XL4A 2Q67A 4PELA 4FLZA 4WFGA 3QTCA 2P67A 3HR0A 1V54B 1AJPA 4DK1A 4XDJA 4NXNB 1PL4A 1G4YB 5LHIA 3JASA 3Q4HA 4Z2WA 4ZBMA 3C3SA 4MSWC 4EEQA 5IT9N 4YJ2B 3S3XA 2CGOA 2IM9A 2CUGA 3QO7A 1ORQC 2JS3A 1I7FA 1EBOA 3M7MX 2Q9LA 1K4CC 2HLDG 3AG7A 4ABMA 2W0FC 4KUMA 4J80A 1VMGA 1XNQO 1XEQA 1M93A 2EX3A 3EXAA 4KP4A 2X7RB 1KMIZ 1SA0B 3OFNG 2RMKB 2X6AA 2QKAA 2QWRB 3KG2A 1VEWA 4LP8A 5FLXN 3P3PA 2Z3YA 4U3JA 1NTMH 4A5UB 3GWKC 2UXDB 5LMUB 3CMAV 1M56B 1KD1W 1VQ6V 1X59A 4P9PA 1YIJV 3O9OA 5KLVH 2CH7A 1BZKA 2LGQA 5BXZA 2VQEB 2OTLV 1NTZH 3K5MA 1AB3A 1W59A 3JAWB 5IY5C 2WPDG 4J7KA 2WLJA 3BEHA 1VQ5V 2LFRA 4WFFA 2GUZB 2UUAB 4WFEA 4BIOA 3WG7B 3LUTB 1P84F 2B1GA 3QNEA 4I55B 1QR9A 3JD4A 1AI5A 3H1KH 3LDEA 4G27B 1JJOA 1VF7A 4X1KA 1WNSA 2PTMA 3W7UA 5IYZB 1MSWD 5JWPA 1I5YA 4JI4O 4B3RB 1ZL8B 3E8HA 1BQZA 2Q0AA 5DM6V 4X1YA 4E2LA 3DSQA 5EIBC 2DW4A 5B1NA 3KCXA 5AG2A 1S76D 1SF9A 3KKYA 4O4LB 4RWUA 4LFBO 1KECA 1AVMA 2L35A 5B5EZ 3RYIA 3GWOA 2OCCC 2ETNA 3E2EA 5LOVB 5CA1A 3ZCCA 4YY3O 3RYHA 2CTRA 3K0DA 1VARA 2Y48A 1QQCA 5DN6G 2O57A 5LMNB 5FPOA 3CWBH 2F95B 3DC6A 2YS8A 1K92A 3RN4A 4B3SB 4B3MO 4F6RB 4HAMA 4JTDB 4FIPC 1R73A 2ZM6B 2UXCO 3UKMA 2W0XA 3K06A 3ASNB 4J9YB 2NN4A 3SJQC 1K5SA 4GKKB 4FLXA 2XAFA 3OMAB 1Y74A 4JGSA 2QE7G 3WB1A 4X66O 2N74A 1TAEA 5JCOA 2ZDIC 2K1EA 4JTAB 3BY6A 2CGNA 2R9IA 1NVPB 1NJIW 1Q8IA 3E89A 5HFMA 4JAVA 1IBMO 2XAQA 3ZN1A 2AGAA 4FLWA 1NR7A 3OGIB 4BW9A 1H8HG 2QSAA 4Q6GA 2LGWA 4PI2A 2DWEC 3N2KA 5KHHA 3CCQV 1OCRC 1FXVA 1J5EO 5B1AB 4DR1B 1RFYA 1N4CA 4LF6B 2PGGA 1GKFA 1GRJA 2JK5C 4J9ZB 3OGCC 1DTOA 1XHXA 2XOKG 3E8BA 5GW7A 3ZEDA 2ZKOA 2VQFO 2QJ1A 3CCRV 3K0GA 3T4ZA 1M56C 1O9GA 4TUYB 4DR2O 1HNXB 2CTQA 2Q7EA 3BRCA 1LR1A 1AROP 5H9CA 1HNWO 2QWNB 2DWDC 3N27A 4CH5A 3U10A 1NT2B 3H01A 3VQVA 4UV8A 4DV0O 1FJGO 3ZRSA 4UVAA 3JATB 4LFAB 4GKKO 4JI6B 3FAVB 5L3DA 3AG4C 2QKSA 2LP7A 3E35A 3G71V 3L72H 1FFXB 3LDCA 4I0XA 1Y76B 4FLTA 2VQFB 2QEXV 2BCCH 4R50A 2BTQA 3K5LA 4CC6A 1YCIA 4WBNA 3JALB 1URFA 3I5DA 1BS3A 1I08A 3I55V 4LF5O 5JH7A 3KCYA 4IHJA 4F6RA 3QO5A 4O4IA 2IJJA 1V9PA 2ZNIA 2E74B 1P49A 4X20A 4ICGA 4DR4B 4O2AA 2IH3C 4J11A 1OCRB 1Y74B 2YIBD 1B3QA 5LA6B 3F7VC 2JDIG 1NQTA 3JD1A 1KBHA 2ITCC 5B3SB 4GT1A 4O2AB 1YI2V 1K7DA 2F43G 2R72A 4DV6B 2RJZA 3JAMN 3K5NA 3MDSA 2Q69A 3ZMZA 4OX9O 2K9PA 2OT5A 1WJZA 2OCCB 3DXRA 4H13B 3VQXA 3CCVV 4EFEA 5LGUA 1IBLO 1N32B 3PJSK 4TV9A 2PYJA 3OEEG 5IYZA 4DUYB 1HR0B 4J7JA 5FL7G 1NZ6A 3R66A 4BW5A 4GCZA 3ZRVA 4AILC 3TXQA 3LDDA 4RQEA 4F4LA 5L3GA 4JYAO 1BHBA 2KKWA 1TA8A 2MK3A 2UXDO 2RQ6A 4X88A 1RM1B 4MVMA 5FNVB 3BCCH 2B9ZA 5CBHA 1I5XA 2HVJC 1SRYA 1AJNA 3ASOB 5L3FA 1K4DC 4J41A 1MG1A 4MS2A 5LL6Y 5GONB 2VRZA 1I94O 3JARA 1LUVA 1JFFA 3JD0A 2VWKA 3OUSA 2DYSC 3RYCA 2IU3A 3FB7C 1S5JA 1W0JG 1G8MA 1JFFB 5LYJB 1W0KG 3OAAG 2EIMB 1TVKB 1FFTB 1Q3EA 3L71H 3L75H 3CRRA 3UT5B 1OZ0A 3ETEA 1HR0O 3N2KB 1S5HC 3GVMA 1WA8A 3CPWU 1KP2A 3TGUH 1I94B 5KX5B 2OTJV 1GK9A 1AR4A 1FKAO 1L1FA 5D5QA 1YJ9V 1F4MA 2LO1A 2JRIA 3AK3A 2E3CA 3VQYA 5J2TA 2JGDB 4B3TO 5JCOC 1ROPA 2H94A 2D3OW 2WLMA 1Z5VA 2Y69B 1VF5B 3K04A 3C3TA 3D8CA 1HP8A 2D2CB 3DTUB 2A3QA 1CPYA 3WG7C 4I4TB 4JASA 3RVYA 1EN5A 2OCHA 4DV3O 3SJBC 4PDLA 1EFRG 3CRCA 4KL1A 2C2AA 4N21A
chains in the Genus database with same CATH topology
4MT8A 5CBFA 2H8PC 1YJWV 1K4CC 2ZD9A 2HLDG 2ZR3A 3OUFA 3SYCA 3ABTA 2W0FC 4JF3A 4KUMA 3SYPA 3E83A 2EINB 4KP4A 2HJFC 1MABG 4QNHB 3ABUA 2X7RB 2LFSA 3I56V 2P7TC 3FKSG 3OFNG 1Q86W 2XAGA 2X6AA 4P2ZA 5IYCO 3TK1A 3GB7C 4FJCC 3KG2A 3IGAC 4RUFA 4PA3A 3OW2U 4N23A 4LP8A 4TWKA 5IDJA 2XNDG 3ZIAG 2Z3YA 5EC2C 5LHGA 2ATKC 5BZBA 3W7WA 4WCEV 1VQ9V 3CMAV 4GX1A 1M56B 5CA3A 1KD1W 1DLBA 1VQ6V 3T4DA 1M90W 4P9PA 4JTCB 1YIJV 1RPRA 1Y66A 1K73W 4FK5C 2OTLV 5EBLC 3SYAA 1J95A 1OCCB 1V54C 5IY5C 2WPDG 2HR3A 1RM1C 3M99B 1N8RW 2WLJA 3UM7A 3K08A 5LGTA 3BEHA 1AI7A 1FXKA 1VQ5V 2LFRA 3HB3B 3LNMB 5CMUA 3OR6C 3ABMB 4WFFA 4JAUA 3TCUA 1NH2B 1NKDA 4PA4A 4WFEA 3WG7B 3LUTB 3AG1C 2NLJC 3D36A 3JCZA 4RO2A 2EIKC 5IY5B 2M7WA 2B1GA 3QNEA 1QR9A 3JD4A 1AI5A 4FPPA 1QR8A 3LDEA 4WFAV 1BMFG 1PNKA 3ZJZA 2HG5C 1QLNA 1NH2D 2X6CA 3E8GA 4G27B 1NBMG 2DQ0A 3W7UA 4RUEA 3SPIA 1R6NA 1MSWD 3B77A 2YEVA 1I5YA 1RPOA 4UV9A 1SERA 3E8HA 1W2BU 5DM6V 4E2LA 5H6QA 4MVZA 4LBEC 3B8NA 3OM3B 3ABKB 1AR1B 1VQNV 5B1BC 3K3WA 2DW4A 3F5WC 5B1NA 1S76D 3CCLV 4WFHA 1KECA 3ETGA 4PDRA 1QVFU 4PDMA 2FTKA 4I9WA 5L3CA 2IH1C 3ASOC 1VQOV 1V55C 4ZKIA 2EILB 3GWOA 3CC7V 4JPRA 2OCCC 3E2EA 3ZCCA 3AG3B 4P30A 2JEUA 5IYDO 3K0DA 4QPKA 3MHSC 2Y48A 1VQPV 2EILC 3AG3C 3FB6C 2QTOA 4UVCA 5DN6G 4MVRA 3EFFK 4UVBA 4MVSA 1K92A 5CBGA 1NVPD 2WLNA 4G2KA 3D3IA 4HAMA 4QPJA 4JTDB 4R6ZA 4HZ3A 1KQSU 1VQKV 4FIPC 1R73A 2ZXWC 1QBZA 3UKMA 3ZN0A 1SETA 1OCCC 2EIKB 4GX5A 1AI6A 3K06A 2EIJB 3ASNB 1VQLV 4J9YB 3CC4V 1ENVA 5LBQA 3SJQC 4Q20A 1K5SA 3CD6V 1OCZC 2XAFA 4UXNA 2QM8A 3OMAB 3RVZA 3STLC 4LC1A 3ABLB 4JGSA 4X89A 2DQ3A 3VOUA 3FB8C 1P7BA 5LGNA 2QE7G 2EIJC 3ASNC 2ZDIC 2K1EA 4RQFA 3SYOA 4JTAB 3BY6A 2R9IA 1NVPB 1NJIW 3E89A 5HFMA 2UXXA 1UJWB 1Q7YW 3CCJV 4JAVA 3ABKC 2XAQA 3ZN1A 5CN0A 5KUMA 1Y4MA 1M57B 4H37A 2NNUA 3ZRWB 3RBZA 1M9NA 3W7SA 1NR7A 1H8HG 1YTFD 4GX2A 4EKWA 3MHHC 1JJ2U 2HVKC 2DWEC 3CCQV 1OCRC 2UXNA 1FXVA 4OXSA 4PA6A 5B1AB 1K33A 4XBFA 1BL8A 1GKFA 4MVUA 2Y69C 4WF9V 2IU0A 2JK5C 4J9ZB 3OGCC 1DTOA 2XOKG 3E8BA 1K97A 3IFXA 1K9MW 5GW7A 2CK3G 1COWG 1NR1A 5EBMC 3ZMUA 4WFBV 5B1AC 3CCRV 3MD0A 3K0GA 1AJQA 3T4ZA 1M56C 3E86A 2EINC 1THZA 1FXHA 4KFMA 2IJKA 3B8MA 3SPGA 4JYCA 4YXWG 3CCMV 1SESA 1K5QA 2JJ1G 3ML0A 1AROP 1GM8A 1HWYA 5H9CA 4CZZA 1F51A 2DWDC 4XDKA 3SPCA 2JEXA 2DYRB 2XAJA 2ZR2A 3H01A 2XASA 2BOCC 4U7OA 4UV8A 3ZRSA 1OCZB 4I5SA 4P9OA 3HPLC 4UVAA 1S3JA 2KB1A 2ZDIA 3IC7A 3X2QB 4DO2A 3P30A 3R65A 2WAMA 4LCUC 3WFVA 3W7XA 5L3DA 3AG4C 1GM9A 3K79A 1QLEB 2QKSA 2LP7A 3E35A 3G71V 1BHAA 3LDCA 1PNLA 1H2GA 1ZWIC 2IJHA 2IJIA 5EBWC 2QEXV 1F4NA 4MTGA 5EK0A 4R50A 5H6RA 2IW5A 1JX9A 5L3BA 1Q82W 2V7QG 4BIZA 1S0VA 1FXKC 4R7CA 4DXWA 1GM7A 3K9AA 3I55V 3AG2B 4PA7A 4TSFG 2WLIA 2QA4V 2X6BA 3QO5A 2IJJA 1KC8W 1OCOC 1GTOA 3ABMC 2HFEC 4ASUG 2BOBC 1JCHA 1OCOB 2QM7A 1CP9A 2DYSB 2AHZA 3RW0A 2IH3C 2EZPA 5B1BB 1EZJA 2Q68A 4JYBA 4MTXA 1OCRB 4CBCA 4H33A 4FMTA 3CYOA 3F7VC 2JDIG 2ZQMA 1NQTA 3JD1A 1R3KC 3CCEV 1V55B 1CEZA 4MVQA 2ITCC 4BIUA 5B3SB 1M57C 4GT1A 1S72V 1YSCA 3ZRWA 2EBOA 1YI2V 1JQ0A 1K7DA 4PA9A 4UUJC 2F43G 3SYQA 2YSUB 3P32A 2Q69A 3ZMZA 1OHHG 2AHYA 2B5UA 2OT5A 3ETDA 3CXCU 4L87A 2OCCB 1QVGU 2EIMC 2WLLA 4GX0A 1YITV 4G28B 5HFLA 5LGUA 3CCVV 1M1KW 3PJSK 4MTOA 2W6JG 3F7YC 3OEEG 5C93A 5KUKA 3G4SV 2HKOA 2EZOA 1PD3A 5FL7G 4QJFB 1PKXA 1PL0A 2GHYA 2Z5UA 4R8CA 2GSMB 1JVMA 1SZTA 4BW5A 4Z1MG 1E1RG 4GCZA 3ZRVA 1VQ4V 2V1DA 3AEIA 3DGEA 3LDDA 1R3LC 4RQEA 3CCSV 4F4LA 1JOYA 5L3GA 3JYCA 3ABLC 1BHBA 2XAHA 4TT3G 3T1CA 2MK3A 3G6EV 3EHBB 1QCEA 3ZRXA 2R9RB 2A9HA 4MTFA 4X88A 2A0LA 1RM1B 4MVMA 1LNQA 1VQMV 3CC2V 3T2MA 1R3IC 1S77D 1PNMA 5CBHA 1I5XA 3A0RA 2HVJC 1SRYA 3CCUV 2WLHA 1XL6A 2B1IA 3OMNB 1AJNA 3LSSA 3ASOB 4XDLA 5B1OA 5L3FA 1K4DC 1P4RA 3NXSA 3W7TA 2WLKA 1MG1A 1VQ8V 3SPHA 4MS2A 2WLLB 1Q81W 3AG2C 3E8FA 5IYBO 3ZMVA 2Q6AA 3K03A 3OEHG 1KP3A 4QIWF 1DF4A 3JD0A 3OE7G 3OUSA 5J9PC 2DYSC 3CP1A 1R3JC 2IU3A 3FB7C 1W0JG 3FYIB 1E79G 2EJRA 1DF5A 1G8MA 5E1AC 2A79B 1VQ7V 2JJ2G 5LHHA 1TUEB 4X8AA 1WLEA 3VBBA 1W0KG 3QO8A 3OAAG 3JD2A 4RAIA 1K3EA 2EIMB 4MW3A 1FFTB 1H38A 1YJNV 1GO3F 1YTFB 1R6KA 3FYEB 2X0LA 1K34A 2WWWA 1OZ0A 3ETEA 1KKDA 5L3EA 3TETA 3SPJA 1FS0G 1S5HC 1WPXA 1IXMA 4PDVA 4QE7A 2PI4A 2ITDC 3CPWU 5KA6A 3FB5C 4HYOA 3STZC 2WLIB 1JPXA 1E1QG 1MOFA 2DYRC 2P6JA 4BAYA 2W6IG 1KP2A 1QLEC 5KA5A 2OTJV 2PI5A 1GK9A 4U7NA 2YEVB 1F23A 2ZXWB 3X2QC 1K8AW 3AG1B 1L1FA 2P90A 1B6QA 3ZMTA 1XL4A 2JIZG 1YJ9V 1F4MA 3ZMSA 2Q67A 4PELA 4WFGA 1H8EG 2P67A 1ROPA 2H94A 1V54B 4MVOA 1GMGA 2D3OW 1AJPA 2WLMA 4XDJA 2Y69B 3AG4B 3K04A 3JD3A 1FXKB 1G4YB 5LHIA 3DTUB 1CPYA 4MW8A 3WG7C 4JASA 1YHQV 3RVYA 4ZBMA 4QE9A 5B3SC 4MSWC 4PDLA 1EFRG 3OMIB 3OR7C 5EC1C 3QO7A 3LSQA 2WSSG 2C2AA 1ORQC 1AI4A 4N21A 3CMEV 1EBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCU C;  2R9R B;  2A9H A;  4MTF A;  4P30 A;  2H8P C;  2A0L A;  4X88 A;  4MVM A;  5CBF A;  1LNQ A;  3AG4 C;  3K0D A;  1K4C C;  2ZD9 A;  3OUF A;  3SYC A;  3T2M A;  2QKS A;  2W0F C;  3SYP A;  1R3I C;  2EIL C;  3AG3 C;  3LDC A;  3FB6 C;  2QTO A;  3E83 A;  1ZWI C;  5CBH A;  4MVR A;  5EBW C;  2HVJ C;  2WLH A;  3EFF K;  2HJF C;  1XL6 A;  4QNH B;  4MTG A;  4MVS A;  4EKW A;  5EK0 A;  4XDL A;  4R50 A;  5CBG A;  1K4D C;  2WLN A;  2WLK A;  3SPH A;  4MS2 A;  2P7T C;  2WLL B;  3AG2 C;  3E8F A;  4R6Z A;  4JTD B;  2X6A A;  2Q6A A;  4HZ3 A;  4P2Z A;  3K03 A;  2ZXW C;  3GB7 C;  3KG2 A;  3IGA C;  4R7C A;  4PA3 A;  4RUF A;  3UKM A;  1OCC C;  3OUS A;  4GX5 A;  4LP8 A;  4DXW A;  2DYS C;  3K06 A;  4TWK A;  5J9P C;  1R3J C;  4J9Y B;  5EC2 C;  3FB7 C;  2ATK C;  4PA7 A;  3SJQ C;  5BZB A;  2WLI A;  1OCZ C;  2X6B A;  1OCO C;  5E1A C;  2A79 B;  3RVZ A;  3STL C;  3VOU A;  4X89 A;  4GX1 A;  3ABM C;  3FB8 C;  1P7B A;  2HFE C;  3T4D A;  4X8A A;  2BOB C;  4P9P A;  2EIJ C;  3ASN C;  4JTC B;  4RAI A;  2K1E A;  4MW3 A;  5B3S C;  3SYO A;  4JTA B;  2AHZ A;  3RW0 A;  2IH3 C;  5EBL C;  3SYA A;  2Q68 A;  3E89 A;  1J95 A;  4CBC A;  1V54 C;  3ABK C;  5IY5 C;  4H33 A;  5KUM A;  1KKD A;  3F7V C;  2WLJ A;  3UM7 A;  3K08 A;  3TET A;  3BEH A;  3SPJ A;  1R3K C;  4H37 A;  1S5H C;  3RBZ A;  3LNM B;  4MVQ A;  2ITC C;  3OR6 C;  1M57 C;  4WFF A;  4PDV A;  4QE7 A;  3TCU A;  4GX2 A;  2ITD C;  4PA9 A;  4UUJ C;  3FB5 C;  4HYO A;  4PA4 A;  4WFE A;  2HVK C;  2WLI B;  3LUT B;  2DWE C;  2DYR C;  2NLJ C;  3AG1 C;  1OCR C;  3SYQ A;  4RO2 A;  2EIK C;  4OXS A;  4PA6 A;  1QLE C;  2Q69 A;  1BL8 A;  4MVU A;  2AHY A;  2Y69 C;  2JK5 C;  4J9Z B;  3OGC C;  3LDE A;  3E8B A;  3IFX A;  2HG5 C;  3ZJZ A;  2X6C A;  3E8G A;  4G27 B;  5EBM C;  3X2Q C;  2EIM C;  2WLL A;  4GX0 A;  4G28 B;  4RUE A;  5B1A C;  3SPI A;  3PJS K;  4MTO A;  1XL4 A;  3STZ C;  2YEV A;  3K0G A;  3F7Y C;  1M56 C;  3E86 A;  3T4Z A;  2EIN C;  2Q67 A;  5KUK A;  4WFG A;  3E8H A;  4KFM A;  3SPG A;  4MVZ A;  4LBE C;  4MVO A;  4R8C A;  2WLM A;  4XDJ A;  5B1B C;  1JVM A;  3F5W C;  4BW5 A;  3K04 A;  2DWD C;  1G4Y B;  4WFH A;  4XDK A;  3SPC A;  4MW8 A;  3WG7 C;  4PDR A;  3LDD A;  3RVY A;  1R3L C;  4ZBM A;  4QE9 A;  4F4L A;  2BOC C;  3JYC A;  3ABL C;  4I9W A;  4MSW C;  2IH1 C;  3ASO C;  3OR7 C;  4PDM A;  4PDL A;  5EC1 C;  3ZRS A;  1V55 C;  4P9O A;  3HPL C;  1ORQ C;  3T1C A;  2KB1 A;  2OCC C;  3R65 A; 
#chains in the Genus database with same CATH topology
 4MT8 A;  2H8P C;  1VF6 A;  3ABT A;  5DED A;  2UUB O;  4TV9 B;  4DUY O;  4JF3 A;  3E83 A;  4JI8 O;  2EIN B;  2PY5 A;  1TUB A;  2HJF C;  3WU2 Z;  3ABU A;  4NB5 A;  4AI8 A;  2LFS A;  3I56 V;  1Q86 W;  1US6 A;  3UQ8 A;  2OWO A;  4P2Z A;  5IYC O;  4K0K O;  3IGA C;  4PA3 A;  2ZE6 A;  3SJA C;  1GH6 A;  3ZIA G;  4FFB B;  3E22 A;  4FLY A;  3W7W A;  1XI1 A;  4JI6 O;  5CA3 A;  1MA1 A;  1K73 W;  1IBL B;  3SYA A;  4DR2 B;  1QHT A;  4EFB A;  3UM7 A;  4X20 B;  1JA8 A;  2KQX A;  2XHB A;  4O4J B;  4FM1 A;  3JSL A;  2LJ2 A;  3LNM B;  4YJ3 A;  5CMU A;  3ABM B;  3CS5 A;  1XBL A;  4JAU A;  5ITZ B;  3ICX A;  4PA4 A;  1I0H A;  3AG1 C;  4RO2 A;  1Q6U A;  4JI2 O;  4FPP A;  2YIC A;  4JYA B;  1PNK A;  1QLN A;  1QU7 A;  2HG5 C;  4LF8 B;  2DQ0 A;  4LH7 A;  4RUE A;  3SPI A;  1R6N A;  2YEV A;  3H1H H;  5KMG A;  1RPO A;  4UV9 A;  4LWS A;  2CAZ C;  3AK1 A;  4MVZ A;  1Y76 A;  5KHJ A;  1GN2 A;  4NXM O;  4CH3 A;  1AR1 B;  4AQY B;  4JI1 O;  1VQN V;  5B1B C;  3F5W C;  4NTY A;  1U96 A;  1WA8 B;  3K58 A;  4WFH A;  2VWJ A;  1PP9 H;  1MSD A;  3ETG A;  4PDR A;  3AK2 A;  3HKE B;  4IT5 A;  4OX9 B;  2FTK A;  4TQF A;  2ARH A;  3ASO C;  1LUW A;  1SQV H;  1VQO V;  4ZKI A;  3CC7 V;  4CS3 A;  1YXB A;  2OYQ A;  4B7K A;  4MVS A;  1XUQ A;  3UO3 A;  4DR5 B;  2P22 C;  1YVW A;  4DV6 O;  2KSD A;  4QPJ A;  1XMQ B;  4HZ3 A;  2ZXW C;  1QBZ A;  4AQY O;  2M6Y A;  2Q7G A;  1OCC C;  4UCR A;  1AI6 A;  2AZ0 A;  3M8A A;  1MZE A;  3CC4 V;  1ENV A;  4Q20 A;  1IVS A;  3IJ4 A;  3K5O A;  2F4V O;  3STL C;  1XOU A;  2EJ7 A;  3ABL B;  3H1I H;  5LGN A;  4DR3 B;  4B3M B;  2YUA A;  4RQF A;  3SYO A;  1XHZ A;  2VS0 A;  3EVK A;  4GYC B;  1ZUQ A;  1IZ3 A;  3LNN A;  2NNU A;  4H37 A;  3ZRW B;  3RBZ A;  4YHH B;  4DUZ B;  1PV0 A;  4PHZ A;  4K8X A;  4OXS A;  3L9D A;  4XBF A;  4WF9 V;  1IBM B;  1NR1 A;  1KKC A;  4WFB V;  2RCV A;  4UCS A;  3CHX A;  1OV9 A;  4LNU A;  2Z0A A;  4NXN O;  5JJN B;  2IJK A;  3B8M A;  3CCM V;  3RWR D;  1K5Q A;  4ZHQ A;  4CZZ A;  3KZI Z;  5BMV B;  4XDK A;  5LOV A;  3SPC A;  2JEX A;  1Q6H A;  2ZR2 A;  3TXS A;  3CEI A;  4CS4 A;  4JI5 B;  1VF6 C;  1OCZ B;  3HPL C;  3ZS8 C;  4IL6 Z;  2KB1 A;  4DO2 A;  1HNX O;  3P30 A;  4X64 O;  5KHK A;  1MMM A;  3K79 A;  1H2L A;  2IJI A;  2ZT9 B;  1ZL8 A;  1XNR O;  4IIJ B;  5EK0 A;  3BAA A;  3FX7 A;  5L3B A;  4BIZ A;  1S0V A;  1FXK C;  2ADP A;  4X9Q A;  4X1I A;  4R7C A;  4DXW A;  1JR9 A;  4CC5 A;  2UUA O;  3QF7 A;  2CDY A;  3K9S A;  2X6B A;  5K1X A;  1GTO A;  2PZS A;  2JVD A;  3P3N A;  4ZI7 A;  1OCO B;  1N0J A;  4I50 A;  2G38 A;  2EZP A;  2ZE7 A;  1UPG A;  4FMT A;  3CYO A;  1CEZ A;  1OJH A;  4BIU A;  3UT5 A;  1PM9 A;  2ZM6 O;  2UXC B;  3OTO O;  2EBO A;  4O4H B;  3BA8 A;  4FVM A;  4B7E A;  1NS1 A;  3ETD A;  1JMK C;  3CXC U;  2LW1 A;  4JZG A;  4X66 B;  5GON A;  2WLL A;  1HNZ B;  1AIL A;  2W6J G;  2MW2 B;  1KB9 F;  2HKO A;  1PD3 A;  1Q90 D;  1EM1 A;  4QJF B;  1PL0 A;  3UCS C;  3D3Q A;  4W4L A;  4YHH O;  2IBZ H;  1E1R G;  1VQ4 V;  2FYU H;  3AEI A;  4GKJ O;  2RDC A;  2YI8 A;  3RYF B;  1RP3 B;  2YIA A;  1Y67 A;  3CCS V;  2EUL A;  3JYC A;  3ABL C;  4TT3 G;  3T1C A;  3G6E V;  4ZOL B;  2CE4 A;  2FL4 A;  4DV5 O;  2A0L A;  1LNQ A;  2F4V B;  1VQM V;  3T2M A;  1R3I C;  1S77 D;  1WP7 A;  3OD4 A;  1VP7 A;  2B1I A;  3OMN B;  3LSS A;  4XDL A;  3W7T A;  2DN9 A;  2PUS A;  1P4R A;  4IIJ A;  1M4U A;  3AG2 C;  5IYB O;  2Q6A A;  3K03 A;  3OEH G;  1KP3 A;  1DF4 A;  1R3J C;  3OT7 A;  1H2S B;  4X1Y B;  2P4K A;  4X64 B;  3FYI B;  1E79 G;  3B4S A;  5LXT A;  2A79 B;  1VQ7 V;  1H2M A;  3RYH B;  1WLE A;  2ZNJ A;  3VBB A;  3JD2 A;  4RAI A;  1GO3 F;  4FM0 A;  1K34 A;  2WWW A;  2E76 B;  1FS0 G;  2GTS A;  2DMX A;  1WPX A;  5IWA B;  2QKC A;  1Y6X A;  2P4V A;  3CE2 A;  4QE7 A;  2ITD C;  5KA6 A;  3FB5 C;  2WLI B;  4BAY A;  5KAF Z;  5E79 Z;  2VQE O;  4U7N A;  4DR3 O;  1F23 A;  2ZXW B;  2DJV A;  1K8A W;  3AG1 B;  1XMO B;  3ZMT A;  4O2B B;  2UUC O;  4LH6 A;  4YIP A;  1SQQ H;  4DV4 B;  2QDO A;  4U3J B;  1FFX A;  2BTQ B;  4MVO A;  1GMG A;  5EYP B;  4KHP B;  4LF9 O;  1IUR A;  3JD3 A;  4MW8 A;  1YHQ V;  4QE9 A;  2OIG A;  5EC1 C;  3K59 A;  4FFK A;  3CME V;  2F1M A;  1FYJ A;  2ZD9 A;  3OUF A;  3BVO A;  1IXB A;  1XMQ O;  2Y4U A;  4JI7 O;  2P7T C;  3FKS G;  3OTF A;  1FPO A;  4FJC C;  4RUF A;  4DUZ O;  3OW2 U;  2BTO A;  4N23 A;  2XND G;  3OTO B;  3HKD B;  3G67 A;  4JI8 B;  5BZB A;  1VQ9 V;  4X65 B;  1KYO F;  4GX1 A;  3T4D A;  3ZHS A;  1RSO B;  4JTC B;  1L0L H;  1Y66 A;  2GDS A;  2ILM A;  5JVD B;  3WB0 A;  1HNZ O;  4FK5 C;  4YJ2 A;  4DR1 O;  1J95 A;  1OCC B;  1FD9 A;  1V54 C;  5EYP A;  1RM1 C;  2UUB B;  3JAS B;  3K08 A;  3NR7 A;  1N0N A;  1AI7 A;  4X65 O;  3RYC B;  2R70 A;  1Q43 A;  2Q5Z A;  1NKD A;  2E5L O;  5BMV A;  2F66 C;  5JJE B;  3J81 N;  4C7U A;  4JV5 O;  1A32 A;  2X6C A;  3E8G A;  3T1Y B;  1NBM G;  4L8J A;  2YDE A;  1XNR B;  1T5E A;  4ZHQ B;  3B77 A;  4DV5 B;  1XDC A;  4YIO A;  1YDX A;  1W2B U;  5H6Q A;  3SR2 C;  4LBE C;  2YIB A;  3ABK B;  4CH6 A;  3CCL V;  4J10 A;  1YF2 A;  2GV9 A;  2ODM A;  4I7Z B;  1QVF U;  4DV1 B;  4I9W A;  5L3C A;  4JPR A;  2UU9 B;  3HKC B;  4FFB A;  3AG3 B;  4P30 A;  2JEU A;  4LFC O;  2ZIM A;  5IYD O;  4DYL A;  1N34 O;  1WB7 A;  5DEC A;  1VQP V;  3FB6 C;  2QTO A;  3F5T A;  4ZOL A;  4MVR A;  3J7A U;  3EFF K;  4UVB A;  5CA0 B;  3T1H O;  4KHP O;  2WLN A;  5JVD A;  4GKJ B;  4R6Z A;  4X1K B;  1VQK V;  4JYY A;  2E75 B;  4OPA A;  3ZN0 A;  5JJJ B;  1SET A;  4GX5 A;  3JAL A;  4OGQ B;  4PI0 A;  4UFZ A;  4JI0 O;  1L8D A;  4X62 O;  5J2T B;  3CD6 V;  4OPH A;  4F6E A;  3VOU A;  4LC1 A;  3FB8 C;  1P7B A;  5JQG A;  5KX5 A;  3ASN C;  3JAW A;  2UXX A;  2AZ2 A;  1Q7Y W;  5IWA O;  3CRQ A;  4IYH A;  3ABK C;  1U97 A;  2WA3 A;  1M57 B;  2JGD A;  5IJ0 A;  2CTW A;  1BSM A;  1GN3 A;  1WAZ A;  3HKE A;  3MHH C;  3HKD A;  2FML A;  4J7Z A;  2QWO B;  1BL8 A;  4MVU A;  4FZ0 A;  4GLX A;  1SQP H;  3SDL A;  2P06 A;  1K9M W;  4I50 B;  2CK3 G;  1COW G;  4IYI A;  3G6B A;  5B1A C;  2KG7 A;  5C8Y B;  1AJQ A;  3E86 A;  2EIN C;  1F7Y A;  2N04 A;  3J80 N;  1THZ A;  1FXH A;  4KXR A;  3ZHV A;  4JYC A;  4YXW G;  4EB6 B;  3ML0 A;  2R9A A;  1HWY A;  4DR5 O;  1F51 A;  4NTW A;  1Z5W A;  1P7G A;  2XAS A;  3N2G A;  4U7O A;  5FNV A;  1NU1 H;  4I5S A;  4P9O A;  5TIS Z;  2Q7H A;  1X4T A;  3IC7 A;  2ZDI A;  1PPJ H;  3R65 A;  4JI1 B;  2WAM A;  3IC9 A;  3WFV A;  3CRM A;  4FM2 A;  4HNA A;  4UCV A;  4DR7 B;  1QLE B;  1BHA A;  1SZX A;  1N36 O;  1PNL A;  1H2G A;  2BSK B;  4GZR B;  3CXH F;  4LWS B;  1IDS A;  1F4N A;  5H6R A;  3PN1 A;  5KAI Z;  3BFR A;  2IW5 A;  1JX9 A;  3ZHQ A;  2ZIO A;  2V7Q G;  1L0N H;  3JSN A;  4YJ3 B;  2UXB O;  1WPB A;  1N36 B;  4FLU A;  3AG2 B;  4PA7 A;  1YEW A;  2WLI A;  1OCO C;  2YI9 A;  4JI2 B;  4ASU G;  1JCH A;  4JI7 B;  1CP9 A;  3DXR B;  1IBK B;  2DYS B;  3RW0 A;  1EZJ A;  2Q68 A;  4JYB A;  4MTX A;  4CBC A;  4K8Z A;  4H33 A;  4LR3 A;  2DOS A;  4AHC A;  1V55 B;  4MVQ A;  4J42 A;  4DK0 A;  4PV1 B;  1M57 C;  1S72 V;  4JI4 B;  3ZRW A;  1JQ0 A;  3SYQ A;  2YSU B;  5B66 Z;  4D7T A;  3P32 A;  4DV3 B;  2Q4P A;  2B5U A;  4L87 A;  3S3W A;  2QM4 A;  1QVG U;  4CS2 A;  5F2V O;  5HFL A;  1M1K W;  4MTO A;  3U0Z A;  1BGY H;  1GN4 A;  1UFI A;  5LP6 B;  5GTH Z;  3G4S V;  3SGI A;  5JH7 B;  1TGO A;  5CB4 B;  2GHY A;  2GUZ A;  1WP8 A;  1JVM A;  4Z1M G;  1Q5O A;  1BE3 H;  2V1D A;  2YXL A;  4LF4 O;  5BR8 B;  4K0K B;  3FFQ A;  4LF8 O;  4JI3 O;  2F93 B;  4U3F H;  1N33 B;  4UB8 Z;  3EHB B;  5IJ9 B;  1XIL A;  1QCE A;  1DGS A;  2A9H A;  3CC2 V;  4DV2 B;  1SQG A;  3A0R A;  1NTK H;  3CCU V;  1EN4 A;  1BQ0 A;  3NXS A;  3JCU Z;  2WLK A;  3N2G B;  1ZLZ A;  1VQ8 V;  3SPH A;  5J2U A;  2WLL B;  3E8F A;  2Q73 A;  1Q6I A;  1DK1 A;  2YXY A;  3QG5 A;  4FLV A;  4DV2 O;  4NTX A;  3TJT A;  2EJR A;  1DF5 A;  5E1A C;  2ZCE A;  3L70 H;  4LFC B;  2F23 A;  5LHH A;  3ZX6 A;  3QO8 A;  3O65 A;  1D5N A;  5EZY A;  4TV8 A;  1H38 A;  1YJN V;  4NKG B;  1YTF B;  3T1H B;  2Y0P A;  3IAY A;  2RN9 A;  5L3E A;  3TET A;  3SPJ A;  1N32 O;  1IXM A;  1FAF A;  4DV7 B;  2UU9 O;  2PI4 A;  2UUC B;  4HYO A;  1MOF A;  2W6I G;  5KA5 A;  2XT9 A;  4JI5 O;  2YEV B;  3HKB A;  4LFB B;  2JGU A;  1HDJ A;  2JIZ G;  1SS3 A;  3JAK A;  3ZMS A;  4DR7 O;  2L6L A;  3B40 A;  1H8E G;  2E5L B;  3E22 B;  2HHH O;  1B04 A;  1Z2G A;  3AG4 B;  1EZV H;  3UO2 A;  1FXK B;  3T1Y O;  1HW7 A;  1EN6 A;  5B3S C;  5JQG B;  3OMI B;  3OR7 C;  2HJD A;  4LF5 B;  2QR4 A;  3LSQ A;  4JZ2 A;  2WSS G;  5CA1 B;  4DRX A;  1AI4 A;  4B3T B;  2UXB B;  4B08 A;  5CBF A;  5D5P A;  1YJW V;  2ZR3 A;  2FB5 A;  3SYC A;  4DW0 A;  3SYP A;  1ZAU A;  4ZIB A;  1MAB G;  4QNH B;  1KU9 A;  2LQT A;  3THO A;  1ZSP A;  5LP6 C;  4I4T A;  1D5A A;  2XAG A;  4O4L A;  4JI3 B;  3TK1 A;  3GB7 C;  4HBN A;  3QVN A;  4TWK A;  1N34 B;  5IDJ A;  2JS5 A;  4IHJ B;  3A0B Z;  1VIB A;  5EC2 C;  2ATK C;  5LHG A;  4WCE V;  2GBO A;  2Q8V A;  4DRX B;  4BR6 A;  2V4D A;  2HP8 A;  1DLB A;  1WN7 A;  3ZBH A;  2QGN A;  1M90 W;  2BSK A;  1RPR A;  3RT3 C;  2BE3 A;  5IE9 A;  5EBL C;  3BAB A;  2HR3 A;  2CTP A;  4JV5 B;  3M99 B;  1N8R W;  4X62 B;  5LGT A;  1FXK A;  2ZE8 A;  1HNW B;  3HB3 B;  2NR5 A;  3OR6 C;  3H1J H;  3TCU A;  1NH2 B;  2OIE A;  4DW1 A;  2NLJ C;  3D36 A;  3JCZ A;  3CRA A;  2EIK C;  1IBK O;  1D2D A;  5IY5 B;  2M7W A;  1BT8 A;  1QR8 A;  2GTA A;  4I55 A;  4WFA V;  1BMF G;  3ZJZ A;  1NH2 D;  5LMN O;  5FPR A;  2QWP B;  3HKB B;  4DR4 O;  4TUY A;  1SQB H;  4HNA B;  1SER A;  1H2N A;  4JAA A;  3B8N A;  1SA0 A;  3LSU A;  3OM3 B;  4LFA O;  3K3W A;  4QGP A;  1XMO O;  2XUM A;  5EIB D;  1M5I A;  5J2U B;  1TVK A;  3RFR A;  2CH7 B;  3H1L H;  5GTI Z;  4PDM A;  2IH1 C;  1V55 C;  2EIL B;  3A2F A;  4H44 B;  4QPK A;  5KHG A;  3MHS C;  2EIL C;  2KG7 B;  3AG3 C;  3JAR B;  4EB6 A;  2H3O A;  5KHI A;  5IJ9 A;  4UVC A;  4JI0 B;  1XRE A;  3VQW A;  5C8Y A;  5CBG A;  3APQ A;  1NVP D;  4G2K A;  3ZHT A;  3D3I A;  1KQS U;  4K3A A;  4O4H A;  1AP5 A;  1SKV A;  2QWQ B;  1CXZ B;  4CH4 A;  2ZE5 A;  2EIK B;  5IJ0 B;  4DV7 O;  1N33 O;  2EIJ B;  3DC5 A;  1VQL V;  5LBQ A;  4LF7 O;  1OCZ C;  4UXN A;  2QM8 A;  3RVZ A;  4X89 A;  2DQ3 A;  1GN6 A;  4NR1 A;  2EIJ C;  3D36 C;  1J5E B;  1AR5 A;  4ZI7 B;  2Y0I A;  1UJW B;  1R1B A;  3CCJ V;  5CN0 A;  5KUM A;  3ETQ A;  4D6T H;  3HKC A;  1Y4M A;  1WB8 A;  3RYI B;  1M9N A;  2A7W A;  3W7S A;  1YTF D;  1KUQ A;  4GX2 A;  4EKW A;  3U11 A;  1JJ2 U;  2HVK C;  2UXN A;  3BPZ A;  4PA6 A;  1SC5 B;  4TQD A;  1K33 A;  2Y69 C;  2IU0 A;  1K97 A;  3IFX A;  5EBM C;  3ZMU A;  3A0H Z;  1S5L Z;  3MD0 A;  2YC0 A;  1AP6 A;  1TUB B;  4KFM A;  5A2Q N;  2FKX A;  2AXT Z;  3SPG A;  1SES A;  4H0L B;  4YY3 B;  5LA6 A;  2P5O A;  3APO A;  2JJ1 G;  3B09 A;  1GM8 A;  4WBN B;  2DYR B;  3B2E E;  2XAJ A;  2BOC C;  1MZF A;  4B3S O;  5LXT B;  4IGG A;  4O4I B;  1S3J A;  3X2Q B;  4NXM B;  4LCU C;  5A9G A;  5LMU O;  4LF7 B;  3W7X A;  4LNU B;  1GM9 A;  4UCO A;  3FAV A;  4B3R O;  4DR6 O;  1ZWI C;  5BR8 O;  2IJH A;  4LF4 B;  5EBW C;  2QTS A;  3A8T A;  4UB6 Z;  4MTG A;  4I9Q A;  3CX5 F;  1QNM A;  1Q82 W;  4I0X B;  3JAK B;  1GM7 A;  3K9A A;  3JAT A;  4TSF G;  3SJC C;  1O9H A;  2QA4 V;  2LW7 A;  5H2F Z;  1KC8 W;  5K1P A;  1GAX A;  3ABM C;  2HFE C;  1SQX H;  2BOB C;  2QM7 A;  2AHZ A;  4D7S A;  2YXH A;  4LF6 O;  5B1B B;  4BWA A;  4DV4 O;  4DR6 B;  4TV8 B;  5EZY B;  1YZB A;  2ZQM A;  3CCE V;  1R3K C;  2DE0 X;  4LF9 B;  4UCT A;  4FZ1 A;  1ZX3 A;  1YSC A;  4PA9 A;  4UUJ C;  1IX9 A;  4GUN A;  5LYJ A;  3C90 A;  1OHH G;  4DV1 O;  2AHY A;  2HEP A;  4UCU A;  3L73 H;  3Q4H B;  3L74 H;  1G6U A;  2EIM C;  4GX0 A;  1YIT V;  4G28 B;  4X1I B;  3F7Y C;  5C93 A;  5KUK A;  2Y4T A;  2EZO A;  5CB4 A;  3H9V A;  2ADQ B;  1PKX A;  4NVP A;  2Z5U A;  4R8C A;  2GSM B;  1SZT A;  4O4J A;  2AW9 A;  3DGE A;  1R3L C;  2ZIN A;  3CJH B;  1JOY A;  3BHP A;  2XAH A;  2Q0O C;  3ZRX A;  2HHH B;  2R9R B;  4MTF A;  5KMG B;  1XQ8 A;  4NYK A;  4TOI A;  1PNM A;  4E4E A;  3FD9 A;  3K57 A;  1NI8 A;  3G80 A;  2WLH A;  2WA4 A;  1XL6 A;  3WB2 A;  3CSX A;  4W4K A;  3RGB A;  2XTA A;  5B1O A;  4O2B A;  5CA0 A;  1Q81 W;  3MAQ A;  3ZMV A;  1B06 A;  1SQF A;  4PJ0 Z;  5ITZ A;  5LP6 A;  3BA9 A;  4QIW F;  3OE7 G;  1BCC H;  5J9P C;  3CP1 A;  2PF4 E;  3ZHR A;  2RNB A;  3ZHU A;  1ZTE A;  2JJ2 G;  2A06 H;  2YID A;  5BY1 A;  1TUE B;  4X8A A;  1K3E A;  1MNG A;  4MW3 A;  4Z1V A;  1R6K A;  3FYE B;  2X0L A;  1G1X B;  2N05 A;  1KKD A;  5H5N A;  4PDV A;  3RYF A;  3STZ C;  1JPX A;  1E1Q G;  2DYR C;  2P6J A;  2PYL A;  1QLE C;  4DV0 B;  2PI5 A;  1FJG B;  4PD4 F;  3CJH A;  4K35 A;  1R6T A;  1XNQ B;  3CB2 A;  3X2Q C;  1H2K A;  1RSO A;  2P90 A;  1B6Q A;  1XL4 A;  2Q67 A;  4PEL A;  4FLZ A;  4WFG A;  3QTC A;  2P67 A;  3HR0 A;  1V54 B;  1AJP A;  4DK1 A;  4XDJ A;  4NXN B;  1PL4 A;  1G4Y B;  5LHI A;  3JAS A;  3Q4H A;  4Z2W A;  4ZBM A;  3C3S A;  4MSW C;  4EEQ A;  5IT9 N;  4YJ2 B;  3S3X A;  2CGO A;  2IM9 A;  2CUG A;  3QO7 A;  1ORQ C;  2JS3 A;  1I7F A;  1EBO A;  3M7M X;  2Q9L A;  1K4C C;  2HLD G;  3AG7 A;  4ABM A;  2W0F C;  4KUM A;  4J80 A;  1VMG A;  1XNQ O;  1XEQ A;  1M93 A;  2EX3 A;  3EXA A;  4KP4 A;  2X7R B;  1KMI Z;  1SA0 B;  3OFN G;  2RMK B;  2X6A A;  2QKA A;  2QWR B;  3KG2 A;  1VEW A;  4LP8 A;  5FLX N;  3P3P A;  2Z3Y A;  4U3J A;  1NTM H;  4A5U B;  3GWK C;  2UXD B;  5LMU B;  3CMA V;  1M56 B;  1KD1 W;  1VQ6 V;  1X59 A;  4P9P A;  1YIJ V;  3O9O A;  5KLV H;  2CH7 A;  1BZK A;  2LGQ A;  5BXZ A;  2VQE B;  2OTL V;  1NTZ H;  3K5M A;  1AB3 A;  1W59 A;  3JAW B;  5IY5 C;  2WPD G;  4J7K A;  2WLJ A;  3BEH A;  1VQ5 V;  2LFR A;  4WFF A;  2GUZ B;  2UUA B;  4WFE A;  4BIO A;  3WG7 B;  3LUT B;  1P84 F;  2B1G A;  3QNE A;  4I55 B;  1QR9 A;  3JD4 A;  1AI5 A;  3H1K H;  3LDE A;  4G27 B;  1JJO A;  1VF7 A;  4X1K A;  1WNS A;  2PTM A;  3W7U A;  5IYZ B;  1MSW D;  5JWP A;  1I5Y A;  4JI4 O;  4B3R B;  1ZL8 B;  3E8H A;  1BQZ A;  2Q0A A;  5DM6 V;  4X1Y A;  4E2L A;  3DSQ A;  5EIB C;  2DW4 A;  5B1N A;  3KCX A;  5AG2 A;  1S76 D;  1SF9 A;  3KKY A;  4O4L B;  4RWU A;  4LFB O;  1KEC A;  1AVM A;  2L35 A;  5B5E Z;  3RYI A;  3GWO A;  2OCC C;  2ETN A;  3E2E A;  5LOV B;  5CA1 A;  3ZCC A;  4YY3 O;  3RYH A;  2CTR A;  3K0D A;  1VAR A;  2Y48 A;  1QQC A;  5DN6 G;  2O57 A;  5LMN B;  5FPO A;  3CWB H;  2F95 B;  3DC6 A;  2YS8 A;  1K92 A;  3RN4 A;  4B3S B;  4B3M O;  4F6R B;  4HAM A;  4JTD B;  4FIP C;  1R73 A;  2ZM6 B;  2UXC O;  3UKM A;  2W0X A;  3K06 A;  3ASN B;  4J9Y B;  2NN4 A;  3SJQ C;  1K5S A;  4GKK B;  4FLX A;  2XAF A;  3OMA B;  1Y74 A;  4JGS A;  2QE7 G;  3WB1 A;  4X66 O;  2N74 A;  1TAE A;  5JCO A;  2ZDI C;  2K1E A;  4JTA B;  3BY6 A;  2CGN A;  2R9I A;  1NVP B;  1NJI W;  1Q8I A;  3E89 A;  5HFM A;  4JAV A;  1IBM O;  2XAQ A;  3ZN1 A;  2AGA A;  4FLW A;  1NR7 A;  3OGI B;  4BW9 A;  1H8H G;  2QSA A;  4Q6G A;  2LGW A;  4PI2 A;  2DWE C;  3N2K A;  5KHH A;  3CCQ V;  1OCR C;  1FXV A;  1J5E O;  5B1A B;  4DR1 B;  1RFY A;  1N4C A;  4LF6 B;  2PGG A;  1GKF A;  1GRJ A;  2JK5 C;  4J9Z B;  3OGC C;  1DTO A;  1XHX A;  2XOK G;  3E8B A;  5GW7 A;  3ZED A;  2ZKO A;  2VQF O;  2QJ1 A;  3CCR V;  3K0G A;  3T4Z A;  1M56 C;  1O9G A;  4TUY B;  4DR2 O;  1HNX B;  2CTQ A;  2Q7E A;  3BRC A;  1LR1 A;  1ARO P;  5H9C A;  1HNW O;  2QWN B;  2DWD C;  3N27 A;  4CH5 A;  3U10 A;  1NT2 B;  3H01 A;  3VQV A;  4UV8 A;  4DV0 O;  1FJG O;  3ZRS A;  4UVA A;  3JAT B;  4LFA B;  4GKK O;  4JI6 B;  3FAV B;  5L3D A;  3AG4 C;  2QKS A;  2LP7 A;  3E35 A;  3G71 V;  3L72 H;  1FFX B;  3LDC A;  4I0X A;  1Y76 B;  4FLT A;  2VQF B;  2QEX V;  2BCC H;  4R50 A;  2BTQ A;  3K5L A;  4CC6 A;  1YCI A;  4WBN A;  3JAL B;  1URF A;  3I5D A;  1BS3 A;  1I08 A;  3I55 V;  4LF5 O;  5JH7 A;  3KCY A;  4IHJ A;  4F6R A;  3QO5 A;  4O4I A;  2IJJ A;  1V9P A;  2ZNI A;  2E74 B;  1P49 A;  4X20 A;  4ICG A;  4DR4 B;  4O2A A;  2IH3 C;  4J11 A;  1OCR B;  1Y74 B;  2YIB D;  1B3Q A;  5LA6 B;  3F7V C;  2JDI G;  1NQT A;  3JD1 A;  1KBH A;  2ITC C;  5B3S B;  4GT1 A;  4O2A B;  1YI2 V;  1K7D A;  2F43 G;  2R72 A;  4DV6 B;  2RJZ A;  3JAM N;  3K5N A;  3MDS A;  2Q69 A;  3ZMZ A;  4OX9 O;  2K9P A;  2OT5 A;  1WJZ A;  2OCC B;  3DXR A;  4H13 B;  3VQX A;  3CCV V;  4EFE A;  5LGU A;  1IBL O;  1N32 B;  3PJS K;  4TV9 A;  2PYJ A;  3OEE G;  5IYZ A;  4DUY B;  1HR0 B;  4J7J A;  5FL7 G;  1NZ6 A;  3R66 A;  4BW5 A;  4GCZ A;  3ZRV A;  4AIL C;  3TXQ A;  3LDD A;  4RQE A;  4F4L A;  5L3G A;  4JYA O;  1BHB A;  2KKW A;  1TA8 A;  2MK3 A;  2UXD O;  2RQ6 A;  4X88 A;  1RM1 B;  4MVM A;  5FNV B;  3BCC H;  2B9Z A;  5CBH A;  1I5X A;  2HVJ C;  1SRY A;  1AJN A;  3ASO B;  5L3F A;  1K4D C;  4J41 A;  1MG1 A;  4MS2 A;  5LL6 Y;  5GON B;  2VRZ A;  1I94 O;  3JAR A;  1LUV A;  1JFF A;  3JD0 A;  2VWK A;  3OUS A;  2DYS C;  3RYC A;  2IU3 A;  3FB7 C;  1S5J A;  1W0J G;  1G8M A;  1JFF B;  5LYJ B;  1W0K G;  3OAA G;  2EIM B;  1TVK B;  1FFT B;  1Q3E A;  3L71 H;  3L75 H;  3CRR A;  3UT5 B;  1OZ0 A;  3ETE A;  1HR0 O;  3N2K B;  1S5H C;  3GVM A;  1WA8 A;  3CPW U;  1KP2 A;  3TGU H;  1I94 B;  5KX5 B;  2OTJ V;  1GK9 A;  1AR4 A;  1FKA O;  1L1F A;  5D5Q A;  1YJ9 V;  1F4M A;  2LO1 A;  2JRI A;  3AK3 A;  2E3C A;  3VQY A;  5J2T A;  2JGD B;  4B3T O;  5JCO C;  1ROP A;  2H94 A;  2D3O W;  2WLM A;  1Z5V A;  2Y69 B;  1VF5 B;  3K04 A;  3C3T A;  3D8C A;  1HP8 A;  2D2C B;  3DTU B;  2A3Q A;  1CPY A;  3WG7 C;  4I4T B;  4JAS A;  3RVY A;  1EN5 A;  2OCH A;  4DV3 O;  3SJB C;  4PDL A;  1EFR G;  3CRC A;  4KL1 A;  2C2A A;  4N21 A; 
#chains in the Genus database with same CATH homology
 4MT8 A;  5CBF A;  2H8P C;  1YJW V;  1K4C C;  2ZD9 A;  2HLD G;  2ZR3 A;  3OUF A;  3SYC A;  3ABT A;  2W0F C;  4JF3 A;  4KUM A;  3SYP A;  3E83 A;  2EIN B;  4KP4 A;  2HJF C;  1MAB G;  4QNH B;  3ABU A;  2X7R B;  2LFS A;  3I56 V;  2P7T C;  3FKS G;  3OFN G;  1Q86 W;  2XAG A;  2X6A A;  4P2Z A;  5IYC O;  3TK1 A;  3GB7 C;  4FJC C;  3KG2 A;  3IGA C;  4RUF A;  4PA3 A;  3OW2 U;  4N23 A;  4LP8 A;  4TWK A;  5IDJ A;  2XND G;  3ZIA G;  2Z3Y A;  5EC2 C;  5LHG A;  2ATK C;  5BZB A;  3W7W A;  4WCE V;  1VQ9 V;  3CMA V;  4GX1 A;  1M56 B;  5CA3 A;  1KD1 W;  1DLB A;  1VQ6 V;  3T4D A;  1M90 W;  4P9P A;  4JTC B;  1YIJ V;  1RPR A;  1Y66 A;  1K73 W;  4FK5 C;  2OTL V;  5EBL C;  3SYA A;  1J95 A;  1OCC B;  1V54 C;  5IY5 C;  2WPD G;  2HR3 A;  1RM1 C;  3M99 B;  1N8R W;  2WLJ A;  3UM7 A;  3K08 A;  5LGT A;  3BEH A;  1AI7 A;  1FXK A;  1VQ5 V;  2LFR A;  3HB3 B;  3LNM B;  5CMU A;  3OR6 C;  3ABM B;  4WFF A;  4JAU A;  3TCU A;  1NH2 B;  1NKD A;  4PA4 A;  4WFE A;  3WG7 B;  3LUT B;  3AG1 C;  2NLJ C;  3D36 A;  3JCZ A;  4RO2 A;  2EIK C;  5IY5 B;  2M7W A;  2B1G A;  3QNE A;  1QR9 A;  3JD4 A;  1AI5 A;  4FPP A;  1QR8 A;  3LDE A;  4WFA V;  1BMF G;  1PNK A;  3ZJZ A;  2HG5 C;  1QLN A;  1NH2 D;  2X6C A;  3E8G A;  4G27 B;  1NBM G;  2DQ0 A;  3W7U A;  4RUE A;  3SPI A;  1R6N A;  1MSW D;  3B77 A;  2YEV A;  1I5Y A;  1RPO A;  4UV9 A;  1SER A;  3E8H A;  1W2B U;  5DM6 V;  4E2L A;  5H6Q A;  4MVZ A;  4LBE C;  3B8N A;  3OM3 B;  3ABK B;  1AR1 B;  1VQN V;  5B1B C;  3K3W A;  2DW4 A;  3F5W C;  5B1N A;  1S76 D;  3CCL V;  4WFH A;  1KEC A;  3ETG A;  4PDR A;  1QVF U;  4PDM A;  2FTK A;  4I9W A;  5L3C A;  2IH1 C;  3ASO C;  1VQO V;  1V55 C;  4ZKI A;  2EIL B;  3GWO A;  3CC7 V;  4JPR A;  2OCC C;  3E2E A;  3ZCC A;  3AG3 B;  4P30 A;  2JEU A;  5IYD O;  3K0D A;  4QPK A;  3MHS C;  2Y48 A;  1VQP V;  2EIL C;  3AG3 C;  3FB6 C;  2QTO A;  4UVC A;  5DN6 G;  4MVR A;  3EFF K;  4UVB A;  4MVS A;  1K92 A;  5CBG A;  1NVP D;  2WLN A;  4G2K A;  3D3I A;  4HAM A;  4QPJ A;  4JTD B;  4R6Z A;  4HZ3 A;  1KQS U;  1VQK V;  4FIP C;  1R73 A;  2ZXW C;  1QBZ A;  3UKM A;  3ZN0 A;  1SET A;  1OCC C;  2EIK B;  4GX5 A;  1AI6 A;  3K06 A;  2EIJ B;  3ASN B;  1VQL V;  4J9Y B;  3CC4 V;  1ENV A;  5LBQ A;  3SJQ C;  4Q20 A;  1K5S A;  3CD6 V;  1OCZ C;  2XAF A;  4UXN A;  2QM8 A;  3OMA B;  3RVZ A;  3STL C;  4LC1 A;  3ABL B;  4JGS A;  4X89 A;  2DQ3 A;  3VOU A;  3FB8 C;  1P7B A;  5LGN A;  2QE7 G;  2EIJ C;  3ASN C;  2ZDI C;  2K1E A;  4RQF A;  3SYO A;  4JTA B;  3BY6 A;  2R9I A;  1NVP B;  1NJI W;  3E89 A;  5HFM A;  2UXX A;  1UJW B;  1Q7Y W;  3CCJ V;  4JAV A;  3ABK C;  2XAQ A;  3ZN1 A;  5CN0 A;  5KUM A;  1Y4M A;  1M57 B;  4H37 A;  2NNU A;  3ZRW B;  3RBZ A;  1M9N A;  3W7S A;  1NR7 A;  1H8H G;  1YTF D;  4GX2 A;  4EKW A;  3MHH C;  1JJ2 U;  2HVK C;  2DWE C;  3CCQ V;  1OCR C;  2UXN A;  1FXV A;  4OXS A;  4PA6 A;  5B1A B;  1K33 A;  4XBF A;  1BL8 A;  1GKF A;  4MVU A;  2Y69 C;  4WF9 V;  2IU0 A;  2JK5 C;  4J9Z B;  3OGC C;  1DTO A;  2XOK G;  3E8B A;  1K97 A;  3IFX A;  1K9M W;  5GW7 A;  2CK3 G;  1COW G;  1NR1 A;  5EBM C;  3ZMU A;  4WFB V;  5B1A C;  3CCR V;  3MD0 A;  3K0G A;  1AJQ A;  3T4Z A;  1M56 C;  3E86 A;  2EIN C;  1THZ A;  1FXH A;  4KFM A;  2IJK A;  3B8M A;  3SPG A;  4JYC A;  4YXW G;  3CCM V;  1SES A;  1K5Q A;  2JJ1 G;  3ML0 A;  1ARO P;  1GM8 A;  1HWY A;  5H9C A;  4CZZ A;  1F51 A;  2DWD C;  4XDK A;  3SPC A;  2JEX A;  2DYR B;  2XAJ A;  2ZR2 A;  3H01 A;  2XAS A;  2BOC C;  4U7O A;  4UV8 A;  3ZRS A;  1OCZ B;  4I5S A;  4P9O A;  3HPL C;  4UVA A;  1S3J A;  2KB1 A;  2ZDI A;  3IC7 A;  3X2Q B;  4DO2 A;  3P30 A;  3R65 A;  2WAM A;  4LCU C;  3WFV A;  3W7X A;  5L3D A;  3AG4 C;  1GM9 A;  3K79 A;  1QLE B;  2QKS A;  2LP7 A;  3E35 A;  3G71 V;  1BHA A;  3LDC A;  1PNL A;  1H2G A;  1ZWI C;  2IJH A;  2IJI A;  5EBW C;  2QEX V;  1F4N A;  4MTG A;  5EK0 A;  4R50 A;  5H6R A;  2IW5 A;  1JX9 A;  5L3B A;  1Q82 W;  2V7Q G;  4BIZ A;  1S0V A;  1FXK C;  4R7C A;  4DXW A;  1GM7 A;  3K9A A;  3I55 V;  3AG2 B;  4PA7 A;  4TSF G;  2WLI A;  2QA4 V;  2X6B A;  3QO5 A;  2IJJ A;  1KC8 W;  1OCO C;  1GTO A;  3ABM C;  2HFE C;  4ASU G;  2BOB C;  1JCH A;  1OCO B;  2QM7 A;  1CP9 A;  2DYS B;  2AHZ A;  3RW0 A;  2IH3 C;  2EZP A;  5B1B B;  1EZJ A;  2Q68 A;  4JYB A;  4MTX A;  1OCR B;  4CBC A;  4H33 A;  4FMT A;  3CYO A;  3F7V C;  2JDI G;  2ZQM A;  1NQT A;  3JD1 A;  1R3K C;  3CCE V;  1V55 B;  1CEZ A;  4MVQ A;  2ITC C;  4BIU A;  5B3S B;  1M57 C;  4GT1 A;  1S72 V;  1YSC A;  3ZRW A;  2EBO A;  1YI2 V;  1JQ0 A;  1K7D A;  4PA9 A;  4UUJ C;  2F43 G;  3SYQ A;  2YSU B;  3P32 A;  2Q69 A;  3ZMZ A;  1OHH G;  2AHY A;  2B5U A;  2OT5 A;  3ETD A;  3CXC U;  4L87 A;  2OCC B;  1QVG U;  2EIM C;  2WLL A;  4GX0 A;  1YIT V;  4G28 B;  5HFL A;  5LGU A;  3CCV V;  1M1K W;  3PJS K;  4MTO A;  2W6J G;  3F7Y C;  3OEE G;  5C93 A;  5KUK A;  3G4S V;  2HKO A;  2EZO A;  1PD3 A;  5FL7 G;  4QJF B;  1PKX A;  1PL0 A;  2GHY A;  2Z5U A;  4R8C A;  2GSM B;  1JVM A;  1SZT A;  4BW5 A;  4Z1M G;  1E1R G;  4GCZ A;  3ZRV A;  1VQ4 V;  2V1D A;  3AEI A;  3DGE A;  3LDD A;  1R3L C;  4RQE A;  3CCS V;  4F4L A;  1JOY A;  5L3G A;  3JYC A;  3ABL C;  1BHB A;  2XAH A;  4TT3 G;  3T1C A;  2MK3 A;  3G6E V;  3EHB B;  1QCE A;  3ZRX A;  2R9R B;  2A9H A;  4MTF A;  4X88 A;  2A0L A;  1RM1 B;  4MVM A;  1LNQ A;  1VQM V;  3CC2 V;  3T2M A;  1R3I C;  1S77 D;  1PNM A;  5CBH A;  1I5X A;  3A0R A;  2HVJ C;  1SRY A;  3CCU V;  2WLH A;  1XL6 A;  2B1I A;  3OMN B;  1AJN A;  3LSS A;  3ASO B;  4XDL A;  5B1O A;  5L3F A;  1K4D C;  1P4R A;  3NXS A;  3W7T A;  2WLK A;  1MG1 A;  1VQ8 V;  3SPH A;  4MS2 A;  2WLL B;  1Q81 W;  3AG2 C;  3E8F A;  5IYB O;  3ZMV A;  2Q6A A;  3K03 A;  3OEH G;  1KP3 A;  4QIW F;  1DF4 A;  3JD0 A;  3OE7 G;  3OUS A;  5J9P C;  2DYS C;  3CP1 A;  1R3J C;  2IU3 A;  3FB7 C;  1W0J G;  3FYI B;  1E79 G;  2EJR A;  1DF5 A;  1G8M A;  5E1A C;  2A79 B;  1VQ7 V;  2JJ2 G;  5LHH A;  1TUE B;  4X8A A;  1WLE A;  3VBB A;  1W0K G;  3QO8 A;  3OAA G;  3JD2 A;  4RAI A;  1K3E A;  2EIM B;  4MW3 A;  1FFT B;  1H38 A;  1YJN V;  1GO3 F;  1YTF B;  1R6K A;  3FYE B;  2X0L A;  1K34 A;  2WWW A;  1OZ0 A;  3ETE A;  1KKD A;  5L3E A;  3TET A;  3SPJ A;  1FS0 G;  1S5H C;  1WPX A;  1IXM A;  4PDV A;  4QE7 A;  2PI4 A;  2ITD C;  3CPW U;  5KA6 A;  3FB5 C;  4HYO A;  3STZ C;  2WLI B;  1JPX A;  1E1Q G;  1MOF A;  2DYR C;  2P6J A;  4BAY A;  2W6I G;  1KP2 A;  1QLE C;  5KA5 A;  2OTJ V;  2PI5 A;  1GK9 A;  4U7N A;  2YEV B;  1F23 A;  2ZXW B;  3X2Q C;  1K8A W;  3AG1 B;  1L1F A;  2P90 A;  1B6Q A;  3ZMT A;  1XL4 A;  2JIZ G;  1YJ9 V;  1F4M A;  3ZMS A;  2Q67 A;  4PEL A;  4WFG A;  1H8E G;  2P67 A;  1ROP A;  2H94 A;  1V54 B;  4MVO A;  1GMG A;  2D3O W;  1AJP A;  2WLM A;  4XDJ A;  2Y69 B;  3AG4 B;  3K04 A;  3JD3 A;  1FXK B;  1G4Y B;  5LHI A;  3DTU B;  1CPY A;  4MW8 A;  3WG7 C;  4JAS A;  1YHQ V;  3RVY A;  4ZBM A;  4QE9 A;  5B3S C;  4MSW C;  4PDL A;  1EFR G;  3OMI B;  3OR7 C;  5EC1 C;  3QO7 A;  3LSQ A;  2WSS G;  2C2A A;  1ORQ C;  1AI4 A;  4N21 A;  3CME V;  1EBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...