2BODX

Catalytic domain of endo-1,4-glucanase cel6a from thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
285
structure length
279
Chain Sequence
b'DSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVYNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E-2
publication title Crystal Structure of Thermobifida Fusca Endoglucanase Cel6A in Complex with Substrate and Inhibitor: The Role of Tyrosine Y73 in Substrate Ring Distortion.
pubmed doi rcsb
source organism Thermomonospora fusca
molecule tags Hydrolase
total genus 104
structure length 279
sequence length 285
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 2bodX00
2BOFX 3A9BA 1HGWA 1OC6A 3VOIA 1DYSA 1OC5A 3VOFA 3VOJA 1QJWA 2BVWA 3ABXA 1GZ1A 1OCBA 3RPTA 4AU0A 1TMLA 2BODX 1QK2A 1BVWA 1OCJA 2BOEX 1OCNA 3RU8X 2BOGX 1UP2A 3VOGA 4AVOA 1UP3A 4I5RA 4AX7A 1CB2A 4AVNA 1UP0A 3A64A 3VOHA 4B4HA 1OC7A 1UOZA 4AX6A 4A05A 1HGYA 1QK0A 4I5UA 4B4FA
chains in the Genus database with same CATH superfamily
3W2JA 3B0XA 4O8AA 1H2JA 3N1AA 4Y9PA 4E0CA 2WSKA 3FYYA 5T26A 2DORA 3NQCA 4INFA 3AHYA 4F66A 5F7UA 1GGOA 2AKZA 4UFHA 5F1VA 1JZ8A 3LSBA 1BF6A 2Z24A 3F4CA 4XZWA 1AL8A 3BDKA 2B31A 1Q8JA 2DSVA 2A3EA 1KV8A 4DJEC 1QW7A 4ZXLA 3W1QA 2H9AA 1IR1A 2B4GA 1QPOA 1TWWA 3PJXA 4LY8A 2J8TA 3GX9A 1J0KA 9XIMA 3WK0A 3UQNA 3P80A 3MUIA 5EMJA 2WYSA 1ALDA 5DXXA 5I3JA 5A6AA 1Q7QA 2EPOA 3O6DA 1TPB1 2HVOA 4WJ8A 2BY2A 3FIGA 3CLWA 2Q09A 5I23A 3MUAA 3SR7A 1RPKA 4LF2A 4GE8A 2HVMA 2XU2A 1GUVA 3GQYA 3MCNA 2Y8VA 1RV8A 5A5WA 2FDMA 3M0MA 4GUFA 1ZPTA 3VUSA 6ALDA 1MUMA 3DYMA 4EAMA 3URNA 1D7FA 5AYBA 1B90A 4CQBA 1VCGA 4LAUA 1YPFA 1F3EA 3MMUA 4O0QA 2FGZA 4KS0A 4BY3A 3R8RA 5EBAA 4C1LA 3DIPA 3FS2A 1KFEA 3F4NA 3HV9A 3W1AA 4M3PA 1KM6A 1BKHA 4FX6M 1MSSA 2IQ0A 4LEFA 1GW9A 4MKNA 4RW5A 5ENLA 2OKTA 2R9RA 4TXEA 1CLKA 3AIVA 2IMRA 3I7SA 4GUHA 4RCXA 1V0LA 3THUA 1KM4A 1HX0A 4RNFA 1KFCA 3UETA 1SR9A 3MUCA 1I8JA 3KFTA 1LL6A 3EOUA 2VGBA 3WLOA 1X6NA 2VELA 2WZEA 1NFBA 4D6HA 1KC7A 1BGAA 4PN2A 3KDNA 5BRPA 2V6AA 5I3GA 2ZYFA 3UF9A 4Z1BA 3D46A 3QHOA 1WOAA 2FPTA 2FMOA 3ID7A 3VA8A 4F0HA 1EDGA 1XFBA 5AN7A 3CHFA 5A94A 1UD3A 3B4UA 3VABA 2Y7DA 4OUIA 3DFNA 2PWFA 1W9UA 4K37A 3ZR4A 5HR7A 4AG0A 3N6QA 1CLXA 4TX9A 3VIPA 3WUFA 1ITCA 4E4PA 2X16A 3TFXA 1ONEA 3G1FA 5C54A 3B04A 1K9EA 1Q7MA 5DLCA 3C2YA 3VIHA 4MB4A 2W5FA 1A4MA 1IF2A 5MKGB 4H6RA 2VL4A 1CTNA 1YADA 4OT7A 5D2XA 4QISA 3WH7A 5CGQA 4H1ZA 4M8UA 5LNSA 3IVSA 1E6NA 2XSXA 5AYIA 5IFPA 5CPLA 1LF1A 3N2BA 1POJA 2ZZ6A 3NZGA 4RX0A 1VFLA 2X2YA 2ZXBA 3LPGA 2ZQ0A 3MI3A 3ZT6A 4O0KA 4J40A 1M7PA 3UY7A 4ZR8A 4H6KA 5F2LA 2GVGA 2QUNA 3L23A 2J7GA 3H2FA 1OCQA 3P0XA 1GVIA 4IHCA 4U28A 1HKKA 4WX2A 2PTDA 3OYXA 4FOJA 3WDIA 4ORMA 1IEVA 2OXNA 5LYRA 2ZZ7A 1W5OA 2EQDA 2YCEA 4DXXA 2E1WA 1GT8A 3NTYA 1NDZA 2BOFX 2XWEA 3WBWA 1C9WA 3N25A 3O15A 2NXHA 1OX4A 1KLYA 1B9BA 5DMLA 5CZ0A 1YQ2A 3ARTA 3V1PA 3SGGA 2HISA 2VDGA 1W37A 4AB4A 1PXGA 1US3A 2GK1A 1TWZA 2ZUUA 1FXQA 4JIQA 2PCQA 4WVXA 3U2EA 1PCKA 3TN6A 1JXKA 1LLZA 4QE5A 3ABXA 7TAAA 4UOQA 4REQA 5SWUA 1JUEA 3RITA 4MZ8A 2YA1A 4V1YA 3IJQA 2WKJA 5AC6A 1LUCB 4ALDA 1A0EA 3HQPA 1SW0A 3M07A 1VYPX 1R3SA 1XUZA 1SO3A 3B8DA 3OB8A 5BNKA 1JD9A 1GJUA 4ZZ9A 3NYZA 3NSXA 4XIMA 2ZZ2A 1W2VA 3GNDA 4MHBA 5T8GA 2J7FA 2FFIA 2VKZG 5D2YA 4J3XA 3QTGA 1GYMA 3T44A 3MO7A 4KF1A 4OECA 4PMOA 3LHWA 2PGRA 1NARA 5ABFA 3W2LA 1BWKA 1Q6RA 2A3CA 3UWVA 1KV5A 1GQNA 1XUUA 1YDVA 1UP3A 3TNBA 5DRCA 3B8SA 3N3MA 2Y1HA 3W29A 4M7SA 3NUKA 4BQ3A 4IGNA 5CPSA 1SZGA 2R82A 3KZPA 1I1WA 3QHMA 5D8ZA 3S3GA 3LV6A 1L8NA 4FHAA 4WOQA 2DSZA 4MG4A 4NZCA 4CVUA 4KRTA 1XC6A 4G7EB 4OU1A 2IW0A 2CBJA 3W74A 4JTRA 3UR5A 1BG9A 4ZO8A 2X7WA 4Q4RA 2Q3OA 3I3BA 2XG9A 2J4GA 4FXRA 3RCNA 4C6PA 2IPGA 4O52A 3BVJA 7ODCA 3ERPA 1S2UA 4RW3A 5FJUA 2D0GA 5EB8A 4JTJA 1CNVA 2BZNA 3WK3A 3TIMA 4GGHA 1K6WA 5LXEA 1R47A 1XRFA 1V02A 4A4AA 3A4WA 1RA0A 2XM1A 2VZVA 2R24A 3Q45A 1AA1B 3AAMA 4HA3A 5CG0A 3MHFA 4L9YA 2VTFA 3VKJA 1JJKA 4CNOA 1VLWA 4O1BA 3U2ZA 4YTTA 4Q4QA 1W9BM 1UWQA 3NXLA 1VD6A 4CD4A 3T09A 4MUZA 2BX7A 4OOZA 1YKWA 5AKQA 3PZVA 2PGFA 3MYPA 2PP0A 5FA5A 3F2BA 1H7PA 4GX8A 3NEHA 5F4SA 4H01A 1DEDA 3BMXA 4NJJA 1OGBA 2BNJA 3HURA 1CI1A 3VM7A 1KM1A 3KOWA 4JYDA 2W62A 5LIUX 3MUY1 1KQYA 3B0YA 1JZ6A 3EPOA 3CWOX 4MNJA 1Q2SA 4AISA 4OWGA 4JTLA 5A6MA 4AY1A 3QTPA 4HOZA 2VDHA 3LGDA 4F9JA 4O4WA 4IT1A 4R7JA 5AC5A 1V3HA 4FLQA 4NRSA 3W7EA 5C55A 2QCNA 5E9AA 1L2UA 4FR6A 3AMCA 3KCJA 3SSZA 2WSYA 1UWTA 3TU9A 4JIPA 4DZHA 4H9UA 1MRQA 3R10A 4OZOA 8TIMA 1A5OC 3WCZA 3RMEA 3CHDA 3RAOA 1E15A 3RM4A 1O7AA 1ISVA 4RDWA 4BWLA 4XZLX 4PCPA 2YR1A 3UCQA 1XDMA 1TIWA 5FOOA 2QULA 1OFAA 3SIMA 1UUMA 1CWYA 3C4UA 3HF3A 3GUWA 2JEPA 6REQB 3IJ7A 5CG7A 1PDYA 4JPGA 3TC3A 1YIXA 4X0VA 4AAJA 2OTDA 3QFEA 4RPQA 1HZYA 1M53A 4FX8A 1C91A 3TXZA 1JDEA 3CL6A 3O06A 4UTWA 4HZ7A 4ZO9A 4RDYA 5D37A 5D05A 4HZ6A 4NF7A 5D2WA 1SJDA 1LL4A 1HT6A 3BURA 3SRDA 1GNXA 4AU0A 1MEWA 1GZJA 3E2QA 1Q6OA 3TSMA 4LPCA 4HHPA 3ZSSA 5FJIA 1UJQA 1K9FA 5AZ1A 2FJUB 1XKJA 3N2TA 3EDDA 1Q63A 3U48A 3DESA 2C0HA 3AHXA 1F3WA 3VMNA 1QNPA 2ONEA 2ZZ5A 3OYZA 3CV1A 5AOUA 2YL6A 4QE4A 2BHYA 4MWAE 4O53A 4E3VA 3E74A 1AW5A 2ZUTA 5CCZA 2HXUA 1UPMB 4ILSA 3E5PA 2WPBA 1C8QA 1G6CA 4MDPA 2QJHA 3WLSA 1CXFA 2DIJA 3S5YA 2QVHA 1LT8A 3NURA 3RMJA 5BXRA 2WC4A 4A2SA 3S42A 4GKLA 4UC5A 2NT1A 1GG1A 2V3DA 1E9YB 4ZMGA 1CGWA 1G4SA 2RAGA 2WMIA 1F4AA 2PEVA 4KETA 3ITVA 2NVCA 4MZYA 4UCGA 1REQB 4ADTA 4DJFC 2B7NA 1HP4A 4NAFA 3CB3A 3UNDA 4M1BA 3QQ0A 2ZA2A 3ABSA 3ARYA 3DUGA 3DERA 2ZRXA 2WVVA 3L9CA 4GPNA 4O50A 4MKSA 2A1YA 2R1MA 3HOJA 2XINA 3L66A 1N2VA 3B8UA 4HCDA 2NXGA 3GNOA 3IJ6A 4GGBA 4AHOA 1QCWA 5I2UA 3FJNA 1IXOA 3HGRA 3UPBA 4IUGA 1B2YA 1PE1A 4CEUC 3LBCA 1ZFJA 2HK0A 4LRTA 5EBUA 3KBWA 1R86A 1ZL1A 1ZALA 1IWPA 1JFHA 3IPWA 4KH2A 1GQLA 3GG7A 3N13A 3TXVA 2ISDA 4HVXA 1XCXA 2Z26A 3CK5A 4UBPC 3W7LA 5TQLA 2E68A 1CBGA 1DXEA 3MV11 2PUZA 3DH7A 4LBRA 5CSRA 1OY0A 3A9BA 2V81A 1Z9AA 3FAXA 1PX8A 3LGGA 3IEBA 4PUMA 4LT9A 1S1PA 3BV4A 1W8SA 3WLRA 3SW6A 4F0RA 1ZENA 2QV4A 2AGTA 1S5MA 4QQUA 1UA7A 2DVUA 4CD5A 1VLIA 3BGGA 4H3DA 3TA9A 3PUOA 3EDKA 2QZRA 4JTQA 3UWWA 1JPIA 3LM7A 1QI5A 3AFBA 4LB3A 3L4XA 4JR5A 2E25A 3LYEA 1K1DA 4GCXA 5A8QA 4I7WA 1GYNA 1FOBA 1MEHA 1QOXA 4RE3A 3RCMA 3IIPA 9RUBA 2BV9A 3OBKA 1W3NA 3V16A 4JS3A 2X1IA 3LRLA 3TQPA 3GH5A 1JDDA 4Q4KA 1KBJA 4C91A 3KRBA 2GSHA 4HOXA 4MWAB 3WLMA 3OGSA 1H61A 4CEXC 2V5KA 4PEEA 4P61A 3ES7A 1FFQA 4FNSA 3BPWA 3GO2A 2X1TA 3FA3A 5J5DA 1UZ4A 1AH4A 2PTZA 3N15A 4O1AA 4PA8A 3GTHA 3E02A 1ITQA 3FKRA 4XUGA 5BROA 2HRWA 3E1F1 2INEA 5FF4A 1KBIA 3BG5A 1SZNA 1XGDA 4NT0A 5E0KA 3TQKA 4Q4PA 1H62A 4P7LA 3TYBA 2VZTA 4R5EA 3W38A 1T5AA 1ZCOA 3BAXA 3NWRA 1WPCA 3M0IA 1LG1A 2PGEA 3QY6A 1EGZA 3COTA 3W6LA 7XIMA 4F2TA 5FESA 2CHOA 4L61A 3PULA 1KWGA 5DCBA 4D6IA 3W1XA 4Z17A 5FF2A 1WO2A 3VNYA 2QJGA 1R87A 3OVPA 4QDPA 3VD5A 3U5UA 1R3WA 4GQQA 3WH6A 4IMDA 4C5YA 2PP3A 3M64A 1EHAA 3MT1A 1GW1A 4JBRA 3QPZA 4IMCA 3LV5A 3SEPA 2OMAA 4LVFA 1XBXA 2CLFA 4UFKA 5CJMA 1Q13A 3MKKA 4H04A 3WQPA 3WF4A 3HMCA 3RGTA 2OWCA 3PJTA 1E71M 1EUNA 1C8YA 2DEPA 1WDSA 2PDMA 2AKMA 3T1GA 1CXIA 3E9AA 2G8ZA 1OG0A 2BY1A 1G94A 3OG3A 4HMEA 1RSCA 3IUHA 3CAQA 3NM3A 2RDXA 1FWBC 4JICA 3HO8A 4LAKA 2C1HA 2NUXA 5LNRA 3H12A 1L8PA 3SCTA 4LV9A 1KO0A 3PK7A 3WQVA 2JGQA 3U0HA 2OSYA 3L0GA 1SPQA 2GWNA 1UJPA 5EKYA 3OLGA 1G1YA 1HJVA 2DFAA 1A47A 4PMDA 3NSMA 1Z6KA 1JZ7A 3M5ZA 2P3EA 1NM9A 2EAWA 3IUIA 5D03A 4JTFA 3QJAA 4JFSA 4TVUA 4DM2A 3LMYA 2QF7A 2EEXA 2NLYA 4AUBA 2Z00A 2D23A 2XGZA 2YCLA 3OVRA 4MYXA 4X9YA 4A3RA 1M1BA 3O16A 4IFKA 1SJBA 3UPMA 3CV7A 2DW7A 1XP3A 2FTYA 4H8UA 3W25A 2WM1A 5IHSA 2CFFA 4ERGA 2ATMA 2G3FA 1M6JA 3Q67A 4AWEA 4M51A 1KTNA 3CIXA 3FGCB 1OFEA 3MS8A 3G6MA 1RH9A 3HZ3A 4FOUA 5KZDA 1MUCA 3N29A 4QNWA 4J3VA 5K4ZA 3AXKA 3L5MA 4IX2A 4RZ4A 1X98A 2VOTA 1CGVA 4DI9A 4Q8OA 1GKQA 4MSSA 3AWNA 2BB0A 3DFTA 3GVWA 3GNXA 2GZXA 3W1PA 4B2DD 3KBSA 1PIIA 4AIEA 4HMCA 4EXQA 3S9YA 3WMCA 3KRUA 2HSAA 4ZFMA 2XTKA 3GC4A 2GUUA 3JS3A 4YJ5A 3F5LA 4WOZA 5FEWA 3W84A 4YVPA 1WXYA 3N19B 4XVDA 3BLOA 4ZA0A 3SCOA 4OVXA 2REQB 4O15A 1BD0A 4NP7A 1RZMA 3B9EA 1Y5XA 4PTNA 4AVFA 4ERAA 4AWSA 3DGRA 2DQXA 5C9WA 3G0XA 4DZ5A 4GXWA 1IXNA 3K1DA 1ISXA 4CGTA 2W92A 4MB3A 3WQFA 1J6OA 1WZMA 2DJLA 5CC3A 2PD5A 4HHHA 3VMPA 2GQ3A 3L2LA 5JIWA 3STFA 3NO1A 2NQ9A 3DC0A 3P0WA 1WDPA 3SJNA 5A6KA 3LUTA 3BARA 4WQ6A 4E2BA 5C2GA 3P6LA 3DFSA 3RRAA 2QJIA 3VDGA 2YLLA 1D3GA 4QGCA 5J04A 3AQUA 1TUFA 4C6MA 2D1ZA 3U5YA 4AEEA 4QJ4B 2QHAA 3EWZA 4YVXA 2CZ5A 2YA0A 1F61A 3I3EA 3HJEA 1RY0A 1XYLA 4DBSA 3M0YA 3CZLA 1GVEA 2D0FA 2A6LA 3ARRA 3C6CA 2FVLA 3GNNA 1VYSX 4O1FA 1EJRC 1JRBA 5KTLA 1QU4A 2QS8A 5CAHA 3R2GA 3N4EA 5BXTA 1PAMA 1VFMA 3E49A 3QR1A 5FF3A 3GNRA 3ZSTA 2H3BA 3LQGA 2TAAA 3PZMA 3L5LA 2YXGA 1B3WA 4L4OA 3PZIA 1DJZA 3NZ1A 2VGGA 5AC4A 3UD6A 3CH9A 2Q3RA 2PC4A 2PF0A 1OC5A 1TPUA 1D9EA 1JDAA 1OF8A 2J6VA 3RG6A 3PZUA 4XZ9A 4U3AA 5CPMA 4YTRA 4WR3A 1R7AA 1TJPA 4DBEA 3KTCA 3ZM8A 3RLUA 3MKCA 2Z2BA 5FJTA 4UFIA 3UR7A 3OZPA 3K46A 3DFPA 3ARWA 1F9CA 3LDVA 3ITOA 1W56A 3CB8A 4RXFA 4K68A 5HOSA 2ZC1A 1MXSA 2BXYA 2PP1A 4IOTA 4YCOA 2HNHA 4HN4A 3HV8A 4Y8EA 1HG3A 2XH2A 4UMAA 5GPRA 1RPXA 4L9ZA 2H6RA 2ZADA 1XJBA 4HMDA 1ISWA 7REQB 1TQJA 1XL9A 2YKKA 1PHQA 2Q8LA 4TVCA 3MMTA 2PDYA 2Z2UA 1NF7A 3MY9A 3TYUA 5AY7A 2E8YA 1EJSC 4E2OA 3UR8A 4PE8A 1K03A 3QQ1A 4FSAA 3PTQA 1U5VA 3E5BA 1GORA 4PBEA 1EEPA 2YIHA 3E0FA 2BODX 4LJ3A 4ECLA 1IZKA 2P0IA 1BTCA 1S2VA 4QBXA 2WMJA 4DO4A 3QPEA 3V35A 1XYMA 4Q8PA 3NDOA 1NH6A 3K30A 3S6DA 4ZOEA 4HPXA 4HU3A 3CIVA 1S38A 3OJGA 2CCRA 5B80A 2YXXA 1GCYA 2DY3A 3PZNA 1PSCA 3W86A 1P0NA 1YW1A 5H8UA 1EDQA 3AS1A 2E9LA 4JN7A 1XWYA 1GOQA 3H2NA 3PTKA 3P8JA 1G4PA 1RALA 2Z0IA 4GXMA 1GQJA 3G1SA 2BOEX 3TN3A 1WDDA 2VEKA 1ZS2A 4UTJA 3SUVA 2CEQA 4MGGA 4HP5A 2FB2A 3NQFA 1PHWA 3CYVA 2Q8XA 3OVGA 3MI2A 4JYEA 1TX2A 1H49A 2G50A 2GL5A 4N9EA 1TZZA 5MKGA 3DHPA 3O3RA 3AUOA 4XKYB 1P6BA 3URAA 1F74A 1AUSL 1XLKA 3A12A 4WJXA 1H1ZA 4RPPA 1I0DA 3LI1A 1XH0A 4DWDA 4GG9A 2VM8A 4D8ZA 3ARUA 1KCZA 4KCTA 3CQJA 4KWVA 2R14A 5HNRA 1UD2A 3VK5A 4U31A 1E1FA 3PZOA 2BY3A 4MJ2A 4FLRA 2EPKX 1EP2A 4N9CA 1VBHA 2OQYA 3TKFA 3W76A 4HPGA 1FCBA 1PV8A 3ZZ1A 3FJ6A 1K7FA 4E4UA 2W4XA 1HFBA 4L6HA 5EMUA 1KA9F 3SB0A 4RNIA 1EIBA 3OGRA 4O1DA 1G01A 3VOCA 2X1SA 2IQDA 2PDHA 2C71A 1A3XA 3QMTA 3CUIA 2A6NA 2FH8A 1ZBVA 3C0LA 3WO8A 2PTYA 3LK6A 5DT7A 1EJXC 3T55A 4QDWA 1JZ4A 2J7CA 3BXWA 3AXHA 1RCOB 2V9DA 4R9XA 4QSHA 3GUGA 3XISA 4A3QA 2OZ0A 4M80A 2P8BA 2RJGA 1J11A 1DIOA 4FO4A 1ZGDA 2BGNE 4DUXA 4GD0A 3THAA 3W7KA 1J0YA 4NX0A 1LUCA 4UB9A 1VFHA 2PB1A 2JKAA 4L6OA 3FAWA 5AVNA 4AZIA 3TTOA 1OJXA 2ADAA 3AISA 4LC8A 4DJFA 3ANYA 3VXGA 3PC0A 5CH9A 1TIMA 3W0KA 1XHGA 3GXDA 3LRMA 4POCA 3KHDA 4NJHA 2PRHA 1BRLB 1A0CA 4GI4A 2XIMA 4DI8A 1E56A 1KXQA 2YGYA 1TJ1A 2IS7A 4GIEA 3KX6A 2XIJA 4HYRA 3SO7A 1XPYA 3IGHX 1HGYA 2KAUC 1IZJA 3TROA 2BG5A 3WQEA 3NNTA 1ICSA 3O6YX 4ZQPA 3H6OA 3W2KA 3BK0A 4K8GA 2ISFA 3M43A 3BL3A 4XAFA 1TE6A 3W6MA 3MDUA 2PPGA 2DZSA 2V30A 3HPXA 1U33A 1EX1A 1UR8A 3QVQA 1VENA 2OB3A 1X6LA 1JZ5A 3GG0A 3L5AA 4K3ZA 3ZLHA 3NQ2A 3MVTA 5FCZA 2DUXA 3GFYA 4L1WA 3GKFA 1RY8A 4HB7A 2NQHA 1K02A 1TPFA 4IPIA 2WJEA 3CH0A 2O9OA 4GMEA 1ESWA 3W6YA 5I3IA 4JX6A 3RO6A 3PPGA 5D09A 2CHRA 1IT8A 3RU8X 2OWXA 4P8VA 2A21A 2CZVA 2AAMA 3EAUA 3H53A 5CPQA 1LLOA 4KFOA 1FWCC 1QPNA 1BPLB 2WZTA 4J2PA 3T2QA 1PKLA 1A5NC 3W72A 4UNIA 4DZIA 3ABOA 1B3XA 3HQOA 2VX6A 1R3VA 4IFRA 3EWWA 3A4JA 7PTDA 4P8WA 5JIPA 4KEUA 1HKIA 2V5JA 3OLDA 2R1NA 1CB2A 4UZSA 1UP0A 1AJ2A 2JKEA 4A05A 1UG6A 4D6FA 3G0UA 3N9SA 4WGHA 3F5JA 3TWAA 2YL9A 3L12A 5TNVA 5D8WA 4C7FA 1FP9A 2CWXA 2HWGA 4CCCA 3ZJ8A 4D71A 4MUPA 2J75A 1Y5WA 3LSCA 1VCFA 4ZE4A 3K1GA 4IJBA 4MM1A 2HQAA 2RFGA 5L6UA 3EEZA 4DO7A 3VC6A 3H24A 5ABTA 2WZIA 1RAKA 3B03A 2VO5A 3DC8A 3WK1A 1XYCA 3WNPA 1QRQA 2PTWA 1C9DA 1AH0A 4JOMA 3JRKA 1EX5A 4IGSA 3KBJA 4C6QA 2OT1A 3ENLA 4ZOBA 4PMQA 4GBDA 1BYCA 1GQKA 1LLWA 3FN9A 3VOFA 5G2HA 1WZKA 3TNOA 1E72M 3BQ6A 1C93A 3H7RA 5K9XA 3UJEA 5LA2A 3CT2A 3MZNA 2ZIDA 3WQ5A 1BXNA 1PDZA 3QFWA 4S2CA 3OLEA 4HA1A 2BWGA 4S3CA 2FVKA 1QDSA 1W9VA 4GX9A 1JZ3A 1O4UA 2PDFA 3DHFA 1EJUC 5F2IA 4Y6GA 4GQ0A 4B3LA 1NWUA 4WY0F 2BP1A 3M0HA 2J13A 4NJGA 4IGHA 2X8RA 3GIQA 1XCWA 3EBVA 4C65A 4YVVA 1BSIA 6REQA 1IT0A 4GCAA 3A5FA 1OHLA 5HULA 2DT2A 4AZCB 3VC5A 3LX9A 2QUMA 4M81A 2INZA 5XIAA 2PTXA 4W9TA 2ZRWA 1C7TA 4OTKA 5GNXA 1EXPA 2G5WA 3G3DA 1B54A 5ABGA 1ZZMA 5BW6A 5TIMA 1M9HA 3A3XA 3APTA 4CQCA 4WKHA 3K8MA 3HG4A 5G2WA 4GVHA 3M5XA 2EF9A 3G77A 2UY3A 3JZUA 2ISWA 3T0TA 2IKHA 1IXPA 2WAGA 1PL9A 3EB4A 4NZ4A 1IEIA 2BFGA 4FXJA 1OABA 1ADOA 3ZQ9A 2PWUA 2ZTKA 1WV2A 6TIMA 1TO3A 2RH9A 1A3WA 4MJZA 1Z44A 4Y9MA 3UERA 3C3UA 3DAQA 2ZXDA 1N8IA 3SCWA 2YCKX 1Z3NA 2IKGA 1EF2A 4P5UA 3NQAA 1ITUA 2GGEA 1E43A 3M5VA 3P2VA 1SJCA 3WQ6A 3KVLA 1Q4WA 3CIWA 3GRIA 3PFMA 1UKQA 1W6TA 3P82A 3MC5A 1XSJA 2V2CA 3P14A 1UW9A 1EQPA 3GB6A 4PYSA 1MI3A 4UTFA 1O5KA 4K39A 1JNDA 1NTHA 3BOLA 4YTQA 4IZGA 5LA1A 4DJDC 1REQA 4NVTA 3CV2A 3ORWA 3MWAA 4H2CA 4N42A 3EMZA 3D5HA 4HJWA 2QCEA 2BVWA 4UXDA 3BMVA 5BXPA 4V15A 2QVNA 3VGDA 2BASA 1GOWA 4GABA 5I77A 3PS7A 1S3TC 3XINA 3SM0A 4O1EA 5IOBA 3ITTA 1M7OA 2ZFAA 1AW2A 3VVGA 4XISA 1E5NA 1QT1A 1D2KA 2ZZ3A 3PJUA 4FMVA 2J78A 4M24A 2VFEA 3OVQA 2J9YA 1U2YA 4NUWA 2ZA1A 3LCGA 2TPSA 3PPFA 1DE6A 1TV4A 3UG8A 4HSOA 3ZLGA 3TCSA 3K5XA 3VNJA 2PU1A 2NX1A 3ALFA 3SAZA 4C6IA 4WKAA 3TTQA 6PTDA 3LCHA 4WHBA 1IT7A 4DO6A 3WLKX 3G1RA 2I17A 1X8FA 2PURA 4ORIA 3V4BA 1ZCCA 4ZGYA 1V6WA 1YYAA 1ZUAX 4AD5A 5F4XA 1XBYA 4O0ZA 1H5VA 1YDYA 4C6JA 1J93A 3JW7A 4ZENA 2VURA 5H8MA 3IUDA 3HM7A 2D2HA 1V03A 3QV6A 4Q4OA 3AJ7A 4AZBA 3IGUA 1C92A 2VXNA 1WA3A 2B0MA 4XV0A 2QCCA 4EWJA 4LYKA 1QNQA 5FIPA 3RR1A 1AQMA 3N2CA 1MO0A 3TYZA 3JZEA 2WMHA 3MP5A 1YBQB 5LIKX 1SSDA 2RGLA 3AU6A 2DZUA 4RV3A 4AIOA 4EX4A 4S3FA 1JL8A 4HU4A 3POCA 2NX3A 4NZ3A 1FHUA 4PMJA 4IQDA 3LD5A 4DB7A 5AHMA 2ACQA 4MWAA 2Y89A 4JNZA 2F38A 5D2TA 2G4JA 3LTYA 3O2LA 4FNUA 4YL2A 1RCXB 3G5EA 4IPJA 2VZUA 2AL2B 2CYGA 3ZYZA 4FXSA 1OGGA 4A8LA 5EFFA 1VZWA 4D6JA 1JPDX 3V18A 3WD0A 1MXDA 4NG3A 4C1KA 5K4XA 1R3YA 3KCLA 3RX3A 1KM5A 3PZQA 3UW6A 4ZO7A 2CBUA 3N18A 1N8FA 2BLEA 3IANA 9CGTA 4J3WA 4DVOA 2POTA 4PEKA 4HYWA 4DIAA 4O11A 2EG6A 3RLVA 4TOQA 1SU5A 3Q58A 3WN6A 3DG6A 4YN5A 4JTTA 4UTHA 3CHVA 1Q65A 4M6VA 1TV5A 4ATLA 2GVYA 4C90A 4OBSA 1OM0A 1H60A 1CDGA 1C7SA 3UZWA 1QO5A 1L0PA 3ZOAA 4REQB 2NV9A 2XUCA 3ELFA 4AZ6A 4O14A 3KHJA 4XQ6A 3C2RA 4W87A 3R12A 5HWNA 3RF9A 3UG4A 3QPYA 1RD5A 4M56A 2PDUA 4FX7A 3U8GA 3HPFA 1FVPA 5LIXX 2J24A 2WCSA 1OQFA 4GYPC 1M65A 4IIEA 4LTSA 4I6VA 4DEFA 3S4TA 5A8PA 3G1YA 4I7VA 2X41A 1ZNNA 1XIGA 5DF0A 1A49A 1QVBA 3PPHA 4Y9OA 2ZUWA 2WQDA 4FALA 2PDGA 4QCEA 5ABFB 1VRXA 4GUGA 3MVIA 3VAVA 3AIQA 3BW4A 1FKWA 1SZFA 1DWJM 2OKOA 2VNCA 3OZMA 4W89A 1T7LA 3RR4A 4LNCA 4HBKA 1Q4NX 2ANUA 4F2UA 1AZ2A 5I3DA 1IE7C 1UASA 3MSGA 4GXPA 2WBGA 1L2QA 5C0QA 5LZLA 3S6TA 4S3GA 3SY8A 1QK0A 2V3EA 1HGWA 3CZ8A 3QHNA 1PIFA 4JN8A 1L9WA 3VOJA 4Q8VA 2QGYA 1BQCA 4B9YA 5FL1A 4LFYA 2PDJA 1TYGA 1S5TA 4BI5A 3P74A 4B5XA 3GR4A 4JL2A 3SCQA 2E6DA 1MW0A 1KXVA 3O0KA 1YTKA 3OQ8A 4XZHA 3HU7A 5DCEA 1H7OA 3WNNA 1W1VA 4XBKA 4PUNA 1SMDA 3OZOA 3VX0A 1XLBA 1YE4A 2YDQA 2NUYA 2VR2A 2H90A 1CXEA 3SRHA 5D30A 3UBPC 4KWUA 2WZMA 3G1VA 1XF0A 3S46A 3GVRA 4PRTA 1E0UA 4ZXOA 4YTUA 1A5MC 3RUBL 3MYOA 3UWQA 5CZTA 2XVNA 3M41A 3MP3A 2HS6A 1DIDA 1Z8AA 1FH9A 3RRXA 3WD2A 2ZRYA 3EX6A 3VD9A 3U2CA 4KWWA 2XPKA 4H6EA 4RE4A 1QOQA 3W7JA 1EC9A 3B8VA 3FA5A 2J6XA 1R46A 2YLAA 1WKYA 1ZP3A 2OYKA 3N9RA 4PTVA 1QW8A 3GWQA 2Y7EA 1JVNA 2BVDA 3UJRA 3A64A 3S1XA 4AH7A 3WF0A 1AZ1A 4E4FA 3W7RA 4QG6A 4H9YA 4MKVA 1NP0A 4KESA 3TN4A 1F05A 3E2SA 3KXQA 1OCBA 1I2PA 1KR0A 1DIEA 4UZUA 1OX6A 2OSWA 3THDA 4AZ5A 4WXZA 3QN3A 3FHAA 4ML4A 4DBUA 1R30A 3BAKA 1XD1A 2OOFA 5LKYA 4ZEPA 4JQ2A 3BAWA 3KVMA 1NOWA 4QS6A 1G4TA 1POKA 3PUGA 2GUYA 1TPDA 2Y8UA 1E6ZA 4EPKA 4CN4A 4EKJA 4I9JA 2ZUSA 1DWHM 4QLJA 1RK6A 5EMLA 3WH5A 1JAEA 4B91A 2EO7A 3ARQA 3CEPA 1GHSA 3VMOA 1AL7A 2CHNA 3GBEA 3P7YA 2GQAA 3QW3A 3VNZA 1WAWA 2ZCGA 1O1ZA 1A50A 1YHTA 1UA3A 3PHAA 1D8CA 2V8ZA 4JDBA 4W7WA 2J47A 4PRRA 3DEQA 1P7TB 2VYOA 2XIBA 4QAIA 4Z2JA 3CUFA 3KOFA 4I5RA 3ES8A 1XXXA 2BY0A 1WCGA 3LU2A 3EWDA 1JRCA 2PI6A 4X63A 4JKMA 3BSHA 2DUAA 2YCIX 4PTDA 1HKJA 2VR4A 2B7QA 3UVIA 2WMGA 4LYPA 3LERA 2E6AA 3P61A 1Q3NA 1HTIA 2I14A 1DJYA 1V93A 3TYCA 5DT5A 2GVJA 1S2WA 2XJ7A 3OODA 4PL1A 4Q22A 3AMGA 1E1CB 2Q8ZA 4LB4A 4UTIA 3PBWA 4QITA 1X97A 3CMGA 4LVBA 1OADA 2E8ZA 5CLWA 1BFNA 3PTMA 1WZLA 2DZAA 1W2PA 2YDSA 2Y5SA 4DWSB 2ZC8A 1QHPA 4UFJA 4U2ZA 4PH6A 2WHLA 2D69A 4W4QA 1HL9A 1RQEA 4XO6A 1YLVA 1VKFA 1UR0A 5JMUA 4GHRA 1P43A 3J7HA 3WJSA 2YXOA 1KGXA 5CQ1A 5A69A 2DT1A 3RFAA 5CBIA 5BYWA 1XLGA 3VGFA 1PX4A 1FDZA 4HGXA 3AOFA 1XIBA 2TODA 4IIHA 1TCMA 4DF2A 4MB1A 1TPH1 4AZ7A 7REQA 4JHZA 3FEMA 3SY5A 2JKPA 3I3DA 2WVUA 2RJHA 2W79A 3W71A 3MU7A 4LUYA 2SFPA 1EH9A 3WLNA 4MY1A 3SUWA 4S3JA 2EJ1A 1XI3A 4O57A 1PX3A 3MSDA 4I90A 1JEZA 3DXIA 1B9ZA 3V5OA 4PFMA 3VDBA 5IDZA 4BQ5A 3UZZA 3E0VA 4LYRA 1JCJA 1W31A 4PTWA 4I5XA 1PZ3A 3E3HA 3R79A 1DXFA 3VKAA 3PBVA 2G41A 4LSBA 3W2UA 3P5ZA 3IVTA 3FXGA 3DN5A 4NI3A 5RUBA 2ZXQA 4JHOA 4XWUA 2J77A 2WK2A 4J2MA 1FUYA 2DW6A 2FKPA 3CMFA 3VCCA 4BZYA 1M41A 2VCBA 4NNAA 2BHUA 4AWTA 3BGJA 3L21A 1AG1O 4K7VA 5ABHA 1DJWA 4B4HA 3ONCA 1U1JA 4JEJA 2YPIA 2ZX8A 4QEEA 4UTMA 2BDQA 2OELA 5IRPA 3BLPX 1DHKA 5KETA 2OG9A 3LLDA 3TMLA 4TUFA 3OQEA 4LYQA 1WE5A 3A21A 1YMYA 2YL5A 4S39A 1LBFA 3U4FA 1VH7A 2Y63A 3HG3A 4I9MA 1KRCC 1BG4A 1X1NA 1BQGA 1E9ZB 4HNOA 4LALA 1IZCA 4LBSA 3TMQA 2YFOA 1EGVA 1FWAC 1E1EA 4Z1DA 6XIAA 3APGA 2AQWA 3WY1A 3ZXWA 3QMRA 2QPXA 5CSSA 3ZFHA 1NOFA 3WNOA 5G1TA 4Q4SA 3KAOA 2CLLA 3L65A 1YNQA 1A0DA 3WBYA 1QW9A 1HN1A 5DX7A 4UTTA 2JBMA 1N82A 2XN0A 5IDIA 5IBXC 3I6TA 2I7GA 3PZGA 2X05A 5I3HA 5HATA 2UBPC 3KVKA 2VX4A 3CO4A 2NQJA 1HNYA 2DZTA 1MQQA 1S2AA 1LOQA 1W1PA 1SZEA 1M01A 1VJIA 3VTRA 3WEZA 1DJQA 1XIMA 4WD0A 2FIQA 2VR5A 3FVDA 4CD8A 1G9HA 4R3UA 2VCAA 4WDWA 3TONA 1H4PA 3BAYA 4HIBA 3R0KA 1VP5A 4AD3A 2G95A 3K2GA 2E1DA 3PAOA 1CB7B 1MFUA 1NWSA 4M6QA 4CCEA 3NZRA 5GJPA 3MUXA 5CZJA 5I6SA 4GISA 5A2AA 3HN3A 3ZO9A 4D9PA 2JEQA 3K8LA 1W5NA 5J8LA 3VOHA 4O16A 2DSKA 4GFIA 1QMLA 1EXBA 5A1AA 3QH2A 2AOSA 1ONRA 3UR2A 4AD0A 3ECQA 1F3XA 1TPVA 4C1NA 3KBNA 1Q6GA 3W7HA 1S2TA 2PD9A 4DJDA 4ZQCA 3DFQA 2P1FA 3VD7A 2ZX5A 3LCFA 1EYEA 4YU1A 1F07A 2GGJA 3WQ8A 3MQTA 3BJSA 4EF8A 2XFRA 2PDWA 2I9EA 1F6PA 4OUEA 3WL1A 1B3ZA 2QT3A 3UJFA 3H4GA 3U3HA 4QJ3B 1OFPA 1XYFA 5A6BA 1XISA 5AHNA 2EPLX 4KMQA 3NO5A 2CNCA 3W02A 5FKYA 3IS4A 3SCUA 3GDMA 2J7HA 3OW1A 1VPQA 1Y8BA 2PLJA 1BYDA 2OZTA 3E0IA 3C2FA 3GR8A 4JIHA 2UY4A 5C9XA 1EZWA 4NSBA 4ONVA 4F3HA 3TJ4A 5DQPA 2J7DA 1UH3A 3NOYA 1V0NA 4RZ6A 1E3XA 4JIIX 3A13A 1FWDC 4GY1A 3TVAA 2DV0A 2XN2A 2G96A 1EEXA 4N7QA 1J2WA 3M1ZA 2PE4A 3BICA 1J18A 2CESA 4IIFA 1K9DA 4AIUA 1SFSA 3WSUA 4XD6A 3URBA 3H4XA 3W73A 1JI2A 2OX4A 5DRIA 4IQEA 4IIBA 1ME7A 2Q02A 1EC7A 1QI4A 1AK5A 4E5TA 4I8YA 4HNTA 4KRZA 4IFKB 3EB3A 1AW1A 2OYMA 1TMLA 5A8MA 1A5BA 3PY2A 3W70A 4NYUA 1JYNA 3QZEA 1JYXA 3BV7A 4U2YA 5C9ZA 5I03A 2WLYA 3P62A 3U6WA 4UQ9A 5BOEA 2WJDA 2OLHA 1IIGA 3BLKA 5I02A 5D9MA 3CZEA 1L6WA 3MB9A 3TZFA 3WQOA 2X42A 1V3LA 4RK8A 5T9BG 1FWTA 3QSTA 3CHEA 3UFYA 2D0HA 4PUEA 4RNHA 3VIKA 1KM3A 5BRQA 3PTDA 1XW8A 1SW7A 1YPIA 1JNEA 2ZICA 3REQB 1XGEA 3SN1A 2PLMA 1B3VA 5FF7A 4FNQA 5DMYA 4X61A 2QCGA 3F4WA 4MNLA 4O13A 3UA3A 2XZ7A 2FH6A 4PB3A 4MPQA 4D1IA 4L80A 5I07A 1TREA 4LS2A 2HPMA 3P5YA 2CERA 2Z1VA 2QIWA 4QX4A 3IGXA 1ZP4A 2J7EA 1F8MA 4Q8MA 3VIFA 4JTSA 3C0SA 5LSMA 3D3AA 3LBMA 2ZDRA 2YFNA 3T07A 1E5JA 4EIVA 1MZRA 1SMAA 1TUXA 2ZX6A 2XHYA 1SM9A 4MB5A 1YXDA 3FYPA 3UG3A 3BAIA 3BGAA 4GYPA 3U9IA 2FZ8A 1RQHA 4PTMA 3STPA 2PWVA 5C8BB 2QMJA 3BLEA 4LY4A 3CAWA 1V0MA 3TTEA 3G2GA 4FNPA 5AECA 4RKAA 2V82A 2DSWA 1O95A 3OZYA 2V3GA 5EFDA 3GFXA 4AZCA 4F9DA 3KOZA 3L4ZA 4AFYA 2D3NA 4PZVA 3UGRA 1K7XA 4B3ZA 1OYCA 1JULA 1W5QA 1GK8A 2WVTA 1B4EA 2X1RA 4GNKB 5CGTA 1HKMA 4P2VA 1SW3A 4JFUA 1VHNA 4BA0A 4LF1A 1T0OA 3KEHA 1W3HA 1SVDA 3VOGA 2CITA 5E5CA 3HG5A 4CNTA 1S3HA 3AO0A 1XV8A 4J3SA 2Y6ZA 1GOIA 1GZGA 1EA0A 3VO0A 3T0BA 1D8WA 3CYJA 1KXTA 3H70A 5TD4A 1NDVA 3UG5A 1V3KA 4US5A 3KRSA 3LHVA 4JQ3A 1Q6DA 6A3HA 3DI1A 4A3YA 4HOWA 2G37A 1T8XA 2J62A 3UXDA 3PNUA 4BF7A 2GLKA 1DQWA 1XQLA 3ARPA 5A8GA 3OA5A 3UXIA 2DVXA 4H9TA 4EK7A 1FDJA 1S5WA 4QG8A 3UP8A 3AALA 4O10A 4FP1A 1SR0A 4M6UA 4MY9A 4OBRA 2VJXA 2E77A 3FFSA 3MKVA 1GKPA 3NOEA 4DYKA 2WANA 3QV7A 2C19A 3VIMA 3VNDA 6XIMA 1QTWA 2Z28A 1Z7AA 3OBEA 2XFFA 4PCSA 1VBRA 2HS8A 1CGXA 1H0IA 3RJYA 3N12A 3WF2A 3QGVA 4MYAA 1XH2A 1MVYA 4OJYA 3S2CA 1JGIA 3SRKA 1OCNA 1NF0A 3TSBA 1J4EA 4WSHA 3CQKA 5CLTA 2CLKA 1ICQA 5FJOA 1NJJA 3TA6A 2YZRA 3R1ZA 2PBOA 2AMXA 2DT0A 1XGZA 2J9XA 3PBGA 4B5UA 4MF4A 1OFRA 5KSWA 3L4YA 3JUGA 3MDWA 1UZ1A 1E0XA 3GXMA 3ABZA 1A5CA 3H2CA 3RU6A 3MI6A 3Q4DA 5EU9A 3WLLA 2FMNA 3SUUA 2YCJA 3WEOA 1YTDA 4D6GA 2ZTJA 3CMJA 1GPWA 1LRQA 3EDFA 1TRIA 1K6AA 4H19A 4HPJA 3T8QA 2RDTA 1AJ0A 1QNOA 4PMYA 1RHCA 2XDFA 4LNYA 1LOSA 4UQCA 5REQB 3WNKA 2P5NA 4FAMA 5A3HA 4FEZA 2Z1SA 3QKEA 4XD3A 3GH4A 3CUZA 4HNCA 4XAZA 1W17A 5D04C 3SGZA 1XLMA 1H7WA 1M04A 2D22A 5D9NA 4XZIA 2VQUA 1FWHC 1J9YA 1QO2A 4QM1A 4QS5A 2EGZA 2GJXB 1QWGA 3UCDA 1LWJA 3W23A 1IR2A 3K8KA 4GQGA 1Q85A 2GGIA 7ENLA 1YBQA 3NQ7A 3AU2A 2HROA 1R6WA 1OVDA 4QAWA 3WQ4A 5HMFA 5HBFA 1DORA 2DH2A 4C6FA 3NIYA 1FP8A 3AHVA 3RCYA 5BWAA 1M03A 1XDLA 3TJXA 4BFAA 3AUJA 4GJ1A 1IIHA 4LQ1A 1PWMA 3WMLA 2HMCA 1J2BA 4R88A 3NDYA 4GC4A 3WBXA 2AL2A 1QR7A 3B05A 4ZOCA 3BMWA 2CLEA 1E4MM 3GXNA 5LNVA 4N9BA 4XAGA 2VFIA 2WM0A 3LI0A 4AXNA 1W1A1 2YDAA 2EJAA 4JGDA 4F2BA 2RHGA 1OT1A 4FXFA 1GEHA 1U83A 2ODOA 2WNZA 3IJ8A 3AZTA 3CU2A 3LPFA 5DXYA 1Q2RA 3VDCA 1O94A 3S0CA 3FW6A 2XH7A 3TAOA 4HT3A 3P8IA 1TWDA 2VCCA 3CXOA 1UR1A 3SECA 3WFZA 3NSNA 1OC6A 2J74A 4UCFA 5E93A 3RPTA 1KFLA 4FS9A 1IWAA 4OE7A 1RJRA 2CZDA 1VIZA 1S5NA 1PWLA 4EE9A 1P1MA 1J5SA 4G2DA 3KVJA 4KCVA 3QC3A 1WUFA 3NQBA 4RNJA 2XSBA 5XIMA 3RLHA 4TR9A 5E6ZA 4EP8C 2OFJA 4PMXA 5AHLA 1RP9A 1PEZA 4NZ5A 2XVKA 3E38A 3U4AA 3IJDA 3V5CA 3QRHA 1KM0A 2WPGA 4M1RA 4GKTA 3R13A 2RDUA 3MBDA 1BYAA 4YCPA 1P48A 1V6VA 3EMQA 2GOUA 4PULA 6ENLA 1GYLA 2GSJA 2WHKA 5I06A 4IM4A 3LPOA 1P0KA 1C3FA 1K77A 3R94A 3AYVA 2A7NA 3LN3A 3UVAA 1FWRA 1OX5A 1TJ0A 4O4VA 3MHUA 2P53A 3GHRA 2DDXA 3UCCA 2F7FA 4TU1A 4Y2WA 4BHYA 3VZYA 8RUCA 4W86A 3M0VA 3TZNA 5JBEA 1QBAA 3VGHA 3KTSA 2GJLA 1RR2A 4S23A 4C6NA 3G18A 3GZ3A 3EOSA 1QPRA 4ROQA 1M3UA 3O05A 3W1MA 2QUVA 1O5XA 3CTLA 4MNMA 2VT0A 2PS2A 4GIAA 1DPMA 5DBTA 1TFVA 4PBGA 4XAPA 3NXFA 3SCNA 4URIA 3VE9A 1YNYA 3STCA 1Z32X 3DZ1A 1KD0A 1ML1A 2WJFA 1DQXA 4CD7A 1FRBA 4IWWA 4GBUA 3NPUA 4AF0B 3VIIA 4WK9A 1EC8A 3BW3A 1MQRA 3DECA 4JDYA 2Z27A 2HXTA 2FHBA 2CLMA 1QI0A 3QY8A 3H7VA 4LGXA 4KBXA 1K4GA 3EA2A 3AICA 2OEJA 1TVPA 4LAMA 2D73A 2W9MA 4MNKA 1AMYA 2CLHA 5HQEA 4DM1A 3WBEA 1MQPA 1TELA 1MEIA 1WZAA 4Z2KA 4GWEA 1WP6A 4CU7A 4D6CA 1F3TA 3R0UA 1JQXA 1S39A 1GZ1A 3WF1A 1UZHA 2YBUA 5C6MA 2Y8KA 3S2JA 1PUDA 4OFCA 4H4IA 2A7PA 3WELA 3VDHA 3Q2DA 4GUIA 2DPEA 1SFLA 1TTJA 2A5HA 2Z29A 3CM4A 2OO6A 1CXKA 1MNSA 3SCPA 1Q6FA 3OU8A 3W3OA 1J79A 1LRTA 3K4WA 5GJNA 7CGTA 1MWOA 5HWMA 4HQVA 1KRAC 1XLAA 1E9LA 3CASA 2YBVA 2NQLA 5EA9A 4ASTA 3RYSA 3SQSA 2PWEA 5CSYA 4X60A 3M0LA 3BG3A 3LBOA 3AXXA 1IEWA 1G4EA 1CYGA 3G1XA 1XBZA 3BCJA 4GNJA 4H2HA 1W91A 3TLQA 1F7BA 3MHGA 2QCDA 3G0SA 3HFYA 3FDKA 4UNLA 2O9TA 1AODA 3NQ6A 1JPMA 1EL3A 8CGTA 3DDMA 3GDRA 1P0DA 1XLFA 2G3MA 3MANA 3FV9A 4JQAA 3PN8A 1F4HA 3T8LA 4H9XA 3BCDA 3VKDA 3WKZA 3F2CA 4WRHA 2HE8A 4Q3MA 3UPWA 1QPKA 5I3FA 4AD1A 1ODZA 4CU6A 1CIUA 1KFJA 3RXZA 1RUSA 3W7MA 3S9ZA 1P7TA 4DRSA 1J8VA 5I78A 4LCRA 1CGUA 2NUWA 1MW1A 4AYSA 3EWXA 4HA0A 2CLOA 2XVPA 1OYBA 1J6PA 2TYSA 3GIYA 4RJEA 3UXKA 1XIJA 4GACA 3T0CA 4NX5A 3A4XA 3KLKA 1TV3A 4UR9A 3H2OA 5BMWA 1W9DM 4WJEA 3ZWTA 2EBNA 5D2VA 2QCHA 1E1CA 4QLLA 2BTMA 3BTNA 4NQ1A 1TG7A 1IGWA 1GVFA 2RDWA 4FOKA 1EO7A 4XB3A 1IHIA 5D33A 3QW4B 5AHFA 3EKLA 4KIEA 4OBTA 3UY8A 4D6DA 3SJ3A 1VEMA 1E3ZA 4BI7A 4DWSA 1GPFA 5KZEA 1UC5A 2EPNA 1EB3A 3JVAA 1US2A 2WNQA 3OHIA 4W85A 1XLCA 1W1B1 3II1A 4AC1X 4UIOA 3TQVA 2C79A 4AEOA 2PAJA 4QTGA 2GFTA 3GAYA 3ZJ7A 1M7XA 3UJSA 2I5IA 1EFZA 3S1WA 4PMUA 3AZSA 1KGWA 4J5NA 1AJZA 1LTDA 3QR3A 1SO6A 3USZA 4U10A 4S3BA 3HPAA 3F2DA 2VP8A 4Q32A 1AQ0A 2QR6A 3ZIZA 4CVWA 4GYJA 3SRFA 3ICJA 3NFUA 4KQNA 3QGAC 3TJLA 3W53A 1CENA 1OK6A 2INFA 4IL2A 1XIHA 3T08A 3M7SA 1V08A 4IPPA 4BEQA 5E0FA 4O12A 1Q6QA 4R7WA 5HANA 3VGBA 4CN1A 2VD8A 1BAGA 3G6LA 4BI6A 2FVMA 1EJ7L 3N3TA 1RCQA 3LNMA 2E09A 3VI2A 4QIUA 3Q94A 2A85A 2PZNA 2VRQA 5G5IA 2CIPA 2F8QA 5CZSA 4YWIA 4O54A 1UD6A 4Q4MA 1ICPA 3AS2A 2C6QA 3S2LA 3VFCA 4DF0A 5BWFA 2HPIA 2WV8A 3VUPA 2QLYA 3VILA 2V38A 2ZA3A 2IXUA 5DANA 1TX0A 3EB2A 1FWIC 1U5HA 4HK7A 5J5RA 2I56A 5JH1A 3N2OA 4F0SA 3GTNA 5HWJA 4MADA 4TX8A 4DO5A 1FBAA 5GJMA 2DP3A 3QKZA 4CD6A 1U5JA 3G1AA 2FGBA 1HJQA 1W1ZA 4GJJA 4NNCA 4PRWA 2YOCA 3W1LA 2J25A 4GIRA 4NIRA 4DJEA 6TAAA 2ZRZA 4E8GA 4G9PA 2FTWA 3MW7A 1PZ0A 1G5AA 1PTDA 4CQDA 4UMBA 4LXFA 2BXVA 2OR2A 1QOPA 3B9NA 2WC7A 4WUIA 3EX2A 3E2VA 3N11A 5FAGA 6CGTA 3OP2A 2NWRA 3CV6A 1FDYA 1G69A 4JD4A 2JK2A 2QV5A 2YL8A 1PB0A 2RUSA 5EL1A 5JUVA 4ZSTA 1RJPA 2EXOA 4JFTA 1TPEA 1H1NA 1M7JA 5G4EA 2BGSA 1OBAA 4GVGA 4NL1A 3APYA 1A4LA 3L2IA 2GQ8A 1DTUA 4FI4A 3M0XA 4XX6A 4H41A 1EIXA 2HBXA 1B1YA 1IV8A 4KFPA 1ONWA 1TWIA 3Q65A 4BWLC 1A3HA 1H11A 2MANA 4AYGA 2G3NA 1FWSA 1E6QM 1WXZA 2OPJA 1F8IA 3M0ZA 3F5KA 3U7BA 1SUXA 3N73A 2G0WA 4L64A 4O17A 4JL1A 3GDTA 1P1XA 3ITGA 4IP7A 1NY1A 1VEPA 3VDAA 1YTEA 3A23A 4H7ZA 5T91A 1Z69A 1KKOA 3OBAA 3BQ5A 4OOUA 3SUTA 2X7VA 1BTMA 2P88A 4MY8A 1GEQA 4QLKA 4HTBA 3R7MA 1E4NA 1CT5A 4B16A 2FZBA 2XWDA 3CT7A 4JEQA 1UR9A 2ISVA 3WDQA 4IL0A 1WYIA 2GUBA 4K38A 5FF0A 3IWPA 3R58A 1WDRA 2CLIA 1DOSA 2QIIA 4J3TA 4OQVA 4A3HA 2V5DA 1DWFM 3EOOA 1WKFA 2GVLA 3FOKA 2JALA 2NLIA 1KCKA 3KUMA 1O1HA 1E6RA 4AD4A 4WDTA 2FYMA 3UZJA 4G8TA 2DSUA 1ELSA 4HN8A 3OPSA 4DY1A 2YA2A 3W82A 5AYXA 2A0NA 4R34A 1XLIA 1YX1A 3P67A 1XYAA 1WKDA 2JE8A 3DFHA 3VKKA 2RGMA 1XRSA 4H7CA 2AGKA 3WMSA 3EWYA 3QY7A 2ICSA 1XRVA 3GDBA 4WSJA 3R0DA 4MTVA 1KRMA 1OT2A 1Q66A 4ICCX 3KDOA 4TIMA 3RDKA 1H09A 3OA3A 1HIZA 3VZZA 2QCLA 4DYJA 3QSRA 3SURA 4AEFA 2UWFA 1K8XA 3PUDA 4F48A 3GNPA 2Y70A 1HJWA 1VCVA 2PF8A 3GW3A 3HPSA 4XVEA 2NW0A 3TYAA 1TRDA 2B7PA 3FNDA 3AMKA 3TQ0A 5CAKA 1U30A 5T9CE 4Q8WA 4UR7A 1LJYA 3H7UA 1GTEA 5A95A 2WNWA 1FY6A 5G4HC 1W1TA 4M19A 1TVNA 2PCEA 3NL2A 2OJPA 4UQBA 4HD5A 5TBOA 2BXZA 5H6HA 4F0MA 3VM5A 5HK4A 2GWGA 1BGGA 3EXTA 1XYBA 4LUSB 4IICA 1HQTA 3REQA 2F2HA 4Q6XA 4GYKA 1XYZA 4YLWA 3F03K 3VPLA 2ZRUA 4Z2LA 3P84A 1OIFA 1XG4A 3RIKA 4V28A 4E2DA 1FH8A 4GJIA 4TVDA 4DPQA 3IJ9A 3M6DA 3O8AA 1TKKA 2I1OA 2QNEA 3PSVA 3O63A 4AVOA 3QC0A 1VIWA 1K8ZA 1ZTVA 1DHPA 1F5ZA 3WQDA 5KINA 3H55A 3R11A 3EX3A 4P7OA 2QCMA 1LWIA 1N8WA 3TLLA 4Z42C 1VR6A 2P3ZA 2QAPA 4W8LA 2W63A 1GVRA 1OINA 2WHMA 3EWBX 3VIJA 4ATWA 1L6FA 1DIKA 5GVJA 4N2YA 4L1GA 4XSMA 4A2RA 2E9BA 1BWVA 5AVHA 5CPOA 2WSQA 1XBVA 1A53A 3WLPA 3WZ0E 3WLIA 3AS3A 3R4IA 5M17A 4WKFA 2X0HA 1UPPA 4GA8A 4XK2A 4PMZA 4WGXA 2VC7A 4QXIA 3UESA 1AD1A 1HF6A 4YYCA 3GS6A 4KT2A 2WVSA 4CQ9A 4JFVA 1UWUA 4MFDA 1ZRQA 1K7EA 3GU9A 1RP8A 2W61A 4BEUA 2WQPA 1W8GA 1A5SA 3TYDA 1W54A 5HNUA 2NQ5A 1E6PA 1TV2A 4U33A 5I3KA 3H21A 1JCLA 5LIYX 1E4IA 1Y0EA 3H2AA 3U7VA 4JCLA 3ITXA 1ME8A 1JUBA 2P8CA 1HUVA 4DELA 2KZHA 3LTSA 3RM8A 2Z6IA 2QJMA 5HMEA 3T2PA 3KOYA 2VUNA 1A5AA 3EXRA 4MIMA 3T0DA 2AQVA 4J28A 3BG9A 5GNYA 1LDCA 1RLDA 1LBMA 4PUDA 1S2CA 5EPDA 2HE5A 2G97A 4JY8A 1LOLA 4H9MA 1UIOA 4DNHA 3BOXA 2YW4A 2FGLA 3MMDA 2R1PA 1K4HA 2WXDM 4NZJA 9XIAA 3G3MA 4WY0B 2ZOXA 2KX9A 3EX4A 4TTGA 3W1NA 1PCWA 3GVGA 1HP5A 5LHFA 4TV6A 3PAJA 4FIQA 2X09A 3ITLA 1UD4A 3O7UA 2FZ9A 2J27A 1KM2A 1HKVA 1AH3A 4QJ1A 3SCVA 4ADSA 4GRSA 2PBGA 3WD1A 1DJXA 1DQUA 1B3YA 1MXGA 1V7AA 2W6RA 3SUSA 3FLUA 2GJNA 2W91A 3N4FA 4TX6A 1VJSA 3IIZA 3EA3A 3C5QA 1CX9A 2CKSA 3I7QA 2DZXA 4QE1A 3OIHA 3WQGA 1V3IA 1VS1A 1XIDA 4EWND 1WX0A 2EPMX 3GHUA 4PTXA 3DG3A 2TMDA 3LMZA 4V33A 3KBVA 5F2MA 4XTIA 2D24A 1YXCA 1ODUA 1VJZA 5KEZA 3PG8A 1V77A 1KTCA 4RZ5A 1B57A 1XS2A 3W28A 3AROA 3QOKA 4JN6A 4Q7NA 3ABRA 1KR1A 3PF3A 1B31A 3T4CA 5REQA 5FD0A 2PZ0A 4ATDA 2X2GA 5HNTA 2TRSA 1WUEA 3GC5A 4WF7A 4KEMA 5BOFA 1UCWA 4AHQA 3A4AA 1EF3A 4L5ZA 4YXGA 2GJXA 4Q8TA 1AD4A 4IQLA 5H91A 2BHZA 3TUUA 3V0UA 1DP0A 2E7FA 3QYSA 4H7VA 5JQ9A 4JNMA 4B4FA 2PRMA 2F2KA 4XSLA 4V1XA 1DL3A 1OFDA 2WO5A 2DU2A 4W88A 2I16A 2J9ZA 3O9NA 2D2OA 1I0BA 5FSEC 3GDLA 5C2XA 1ENUA 4GVFA 3SZ8A 3VD4A 1Z48A 2OEKA 4K1GA 1J5TA 3DFOA 2GQ9A 2QGHA 1UKSA 3GG8A 4PGLA 2NX9A 3IAQA 3GIPA 4GVIA 3C52A 1UROA 4Z1CA 1WB0A 2CPUA 1O5QA 3UWZA 3EDJA 3PANA 3ITCA 2HV5A 2QCFA 1K8CA 3NGJA 3M16A 5DBUA 1CCWB 3MJYA 4GZEA 4K8HA 4EPEC 4B3KA 1UBPC 1HVQA 4JIEA 2WC3A 1O68A 2Z6JA 3EKZA 1Y7VA 1R9YA 1E6SM 5C9RA 4PR4A 4HHLA 3BZJA 4D6EA 4LAZA 1H51A 2NV1A 1KCLA 3CPRA 4GZIA 4A8RA 3C2EA 4Z0SA 1RLCL 3C2VA 1UMYA 3NPWA 3AS0A 1RBAA 5D4YA 5FAJA 4P8XA 4HK6A 4DLFA 5A8NA 4JQ1A 4D2JA 4C1NB 2W3ZA 4HK5A 4P8UA 1I2OA 3AC0A 3QF0A 1DV7A 3I6EA 4Q8NA 1MW2A 4MDOA 4H8NA 3FKKA 4MJMA 2JQXA 4ACYA 3HGSA 3V36A 4K1WA 3WF3A 3I4KA 3GXTA 4IXHA 5CZKA 2F84A 4B5VA 2V67A 3ZVIA 2ZVIA 1H0GA 1TTQA 3OIXA 3DKLA 3NO3A 1ZJIA 1G0CA 2A4AA 1VHCA 4FF7A 1Q6LA 4GNVA 3W7GA 2EKCA 2WLZA 4LANA 5M03A 1KXHA 3GH7A 5I79A 3CAVA 4MMWA 2QDDA 2GGHA 3QYQA 4RE0A 1WDQA 3O6AA 3LLFA 3GK0A 1YE6A 1E9IA 2R91A 3TEVA 4JAWA 3C61A 2VQTA 3UYIA 3Q37A 2QAFA 3VNLA 1RQBA 5BRBA 1ZHAA 4M0XA 1K3UA 2ZE3A 3C86A 3L4UA 3IV3A 4KPLA 3T4WA 3T78A 1DJGA 1CZ1A 1N7KA 1SO5A 1I60A 1VGAA 1KRBC 3W1RA 4DYEA 5EY5A 3W7NA 4N4QA 3CEUA 4BF5A 1JDFA 3L67A 4RLIA 1UWAA 3TAKA 1TSIA 3CWNA 3ISIX 5DEZA 1UP2A 2ALDA 4AF0A 4ROPA 2VC9A 1GVYA 4ZTYA 5HUPA 5CC6A 1HJSA 2NT0A 4PSPA 2Y4SA 3RM9A 2PFHA 3A3WA 1BVWA 3IAPA 3TW6A 5KZ6A 4I8DA 4NNBA 5D32A 2XISA 3UXLA 1NSJA 3N9KA 1ADDA 2OGJA 3T2OA 4DUOA 2GGGA 2FDSA 2ISSA 4L9XA 1F2JA 2Z1XA 3CUHA 3I6RA 2YX0A 1PS9A 4MLJA 3S5OA 2QDEA 4N02A 3B0PA 3PP7A 3ZR5A 1TV8A 3WDRA 2C1IA 2VEIA 1NU5A 3AYSA 4LRSA 2QF8A 2GDVA 5K9DA 4QSFA 5M2FX 3FK4A 1I2RA 4LAOA 1EKOA 3A22A 1G67A 5MHBA 3SSJA 4IUOA 1V6UA 4AC7C 4ZQOA 1V0KA 4CCDA 3LXCA 1MW3A 2DGAA 3ZS4A 3MJMA 3W75A 1J96A 1THFD 1KFBA 2XGIA 5KMYA 3QR0A 3S5NA 1J12A 5L9FA 4J1OA 3R25A 1ZAHA 1X1ZA 2CU0A 3GC2A 4LS1A 3S9IA 5A6LA 3T05A 2QEZA 1Q6EA 3TX9A 4W84A 1NOUA 4DLMA 3L7RA 4KIRA 1NWRA 3N2MA 3FJLA 3H23A 3WFAA 3UU0A 3KE0A 1R2TA 1I1XA 2L5HA 5G1YA 4PCFA 2C8NA 2J7BA 1HJUA 1TA3A 4CU8A 1KBBA 3GSMA 1BVNP 4JTEA 1D3CA 4UFLA 4E8DA 1X39A 3A5VA 3OO2A 1DXIA 3UGVA 1VPXA 4AX6A 3L2MA 2JF6A 1SSGA 3S2MA 3NCOA 3VCNA 3YPIA 3LEPA 1KBKA 4XTDA 2YB1A 4IPLA 3NPXA 1UUQA 4PODA 3LNPA 3RN6A 5DY2A 4MJ4A 3TR2A 3W87A 1LQAA 1EZ2A 1K8YA 5E1QA 1IGSA 4WSKA 2VEFA 1PTAA 4RL3A 2PDBA 3VE7A 1SFJA 4DJFD 1OGSA 2O9RA 4UR8A 3E0WA 2DUZA 4IP5A 1VEOA 1A5UA 1NIUA 3T9PA 3FYOA 2FPYA 2JF7A 3ITYA 3VOIA 3HQNA 1BF2A 2DT3A 1GVOA 4MOZA 2R94A 1O6IA 4HPHA 1W3TA 2X1UA 2CC0A 1KGUA 1DVJA 1E40A 5ECUA 2YYUA 3E96A 4C6CA 4YYFA 3W22A 1XLLA 5LIWX 1P0EA 4HCHA 4ZTXA 3LXAA 5E0CA 3B0VC 3WJXA 4FLOA 1W9PA 5FEXA 4O28A 3FY1A 2ATSA 1EOKA 3ZJ6A 2XVLA 2ACRA 2VC5A 3B9AA 3RK8A 4DX3A 3EOLA 4NKCA 5D9OA 2VX5A 5EGRA 3S83A 3NVDA 1E73M 1BVZA 3MWCA 1V8EA 5HQLA 4Z0JA 4JZ5A 1QI3A 1TPC1 3M5YA 5FJPA 3AMDA 5U4NA 4R85A 2Y5JA 1R3QA 2PLKA 2V5BA 3L4WA 3WQCA 3T0AA 1UMLA 4B5NA 4AMCA 4Z1AA 1AFSA 1KTBA 4UWMA 3THCA 3UZ5A 4GO9A 3HIJA 4D8AA 4JQ4A 2CLPA 1R3RA 2ZBTA 2XZ9A 2ZZ4A 3A47A 4RUBA 2D2JA 3EEGA 1IWBA 1OFBA 5DO8A 4RR4A 2EG7A 4Y90A 4AHPA 4BQ4A 4ICMA 3P81A 4ML9A 4LUTB 1E51A 3N34A 4HU8A 3R5EA 3EWUA 4B90A 1BHGA 1JF5A 2PDQA 1JPHA 3FXYA 1JFXA 4GQBA 1MRAA 3CPUA 4XUYA 2VZOA 3NPVA 2ZVRA 3W37A 2Z1BA 3M4HA 3P3BA 4AXKA 5K3VA 4LVGA 4W8AA 3EKGA 2NV2A 5D9PA 1BLIA 2O55A 3TR9A 3NA8A 4B2DA 3E12A 3PWGA 1H5YA 1XRTA 2VFDA 3TW7A 2GSEA 2P50A 1ZSXA 5A6JA 2Y7FA 1XLJA 1SZRA 3AIWA 3WUBA 3W27A 1CW2A 1XR2A 3SI9A 2BVYA 2DH3A 4JKKA 3K13A 3CL7A 1UQZA 3LA4A 2ZWZA 3HPZA 3CNYA 3LXBA 2BBFA 3UXAA 3SQLA 3BJTA 2O0TA 4ZQMA 1E4LA 2O7QA 3CL8A 5D38A 3NAVA 2EPHA 1FWGC 1TCDA 4WZHA 1GWJA 1FCVA 1W32A 1BEUA 1QUMA 4L6DA 5C9UA 3GD6A 2V2HA 3AMLA 1L6YA 4QR6A 1RD6A 3CQ0A 4XBSA 5HMDA 3WJYA 3KLLA 1LCOA 1EBGA 4ZFCA 3LHTA 4KGLA 1QNRA 2ESCA 3ARZA 3CWHA 4RXGA 1UOZA 2Z25A 4W5ZA 1PZ1A 2WMKA 3LHZA 2IPJA 1E0WA 3G8RA 2J66A 1PZ2A 4ZL1A 3TJIA 4M6PA 3NGFA 2FHCA 1KW1A 3ALGA 3IV8A 2P76A 2PWHA 2G4FA 1OG6A 2CXGA 2A3HA 4UFMA 2C18A 1J01A 1LQ0A 3W07A 4B5WA 3S8HA 1HJXA 4DF1A 3RILA 4A22A 2PWGA 4DBWA 3FCPA 3WJWA 1XX1A 2LLEA 3LCWA 2IUZA 2UY5A 1UZDA 2GJRA 3LLXA 3POHA 4A29A 4KEZA 1JCMP 1R85A 4US6A 4MAZA 1EO5A 3KL5A 2QQ6A 4Q6JA 3F1QA 2VOMA 1UWSA 4ES4A 1EP3A 4FLSA 5H8PA 4PUWA 3GAKA 1EGMA 8XIAA 1V6YA 3CTTA 5I24A 4YS1A 2E28A 4U4MA 1NP2A 3EWCA 4Y9AA 2PMQA 3IARA 3N17A 3TK7A 1TE1A 3MA8A 4W7UA 3OOQA 4LBUA 3IACA 3M7WA 1JG9A 1PBGA 3DGBA 4R27A 3MP4A 3RX4A 2C16A 1TMHA 1ZB5A 4IXXA 1S1RA 3FJ4A 1CEOA 2WZHA 3KTXA 1V6TA 1UIPA 1X8CA 3GTXA 2C0AA 4C6EA 1AMKA 4B5SA 5LNWA 5FJJA 3GYEA 5EYWA 3VYLA 4X0NA 1UWIA 4YHEA 1ZLPA 2ABAA 1RK5A 3SDOA 3GHTA 2ZXAA 1ZBCA 4DNMA 1PKMA 1BWLA 1P0BA 2VGFA 4XO7A 4E8CA 3MMWA 3S5ZA 3TYEA 2HJPA 3ZR6A 4LW7A 3ARVA 2H8ZA 3QQWA 1EJVC 1UB3A 1VFUA 4NAEA 4LWWA 1D3HA 2CKRA 5AYZA 4YNGA 3KZSA 5H1WA 3G8EA 4IH3A 2DQWA 3WD4A 3TCEA 2FQIA 5BCAA 2EHHA 2CBVA 1U1UA 1ZAJA 3DENA 2VWSA 1X38A 1WAUA 3I7RA 1O60A 3B40A 4F4RA 3QLLA 3PPCA 3WNLA 4PB4A 1KB3A 5BXSA 3LM3A 2R1KA 1NELA 2OLAA 4MZ1A 4UOZA 4GH1A 4E3TA 1JUKA 4DPPA 2O7SA 2C7FA 5FEZA 1OEPA 2FB3A 1TV7A 2NSOA 3PB0A 4IMEA 5A8OA 3QXBA 4BKNA 1NAL1 1ZU8A 1J10A 2Y24A 3IK2A 1BYBA 4Z1YA 3BH4A 3VIOA 1V5XA 1PJ9A 1OF6A 4W5UA 1RJQA 4LUSA 5AZ0A 4IG2B 3ZT7A 5ECVA 5M5DA 3I65A 1CXHA 3NDZA 2OZ3A 4KCWA 4C5ZA 1CPUA 2YSWA 4FNRA 2HDJA 5PTDA 4IGMA 4UTKA 1UR2A 3AZRA 3AIRA 4NZ1A 4Z2IA 3ANVA 2VEGA 1QXLA 5FJRA 2WMFA 3VZXA 2WWDA 4MWAD 5C7HA 1G7VA 2G3IA 2Y0FA 3V3WA 5IFTA 3ARXA 1M68A 3GG1A 2QCDB 3N4AA 2OODA 1N55A 4UOJA 1TTIA 5AB3A 1H3GA 3V7PA 4BS0A 4S3EA 1JDCA 3U57A 4JTAA 1W5MA 1EP1A 4FIRA 2FZNA 3KW3A 3V5FA 5EMMA 1FCQA 1FXPA 1PPIA 4X3ZA 1TPWA 4UNKA 3B8IA 2AL1A 2OYLA 2YYTA 4EPBC 4A6GA 3A3HA 1ME9A 3DKJA 3NQVA 2ZX7A 3PB2A 2WW5A 4GFSA 4XD5A 1LQ2A 1J0IA 2QW5A 1GG0A 5F2GA 3FDGA 3GYCA 4PBFA 1XLEA 3FEQA 3QZAA 4MWAC 4UQEA 2XH4A 4J9JA 3H2MA 5B7ZA 1QBBA 4KWSA 1EJWC 5AHEA 3EXSA 3HGJA 1R38A 2O4MA 2YW3A 2DIKA 3WIJA 4QHRA 3JU2A 4ACZB 1VC4A 3VKBA 1B30A 1V4YA 1ISZA 2VDIA 3TW9A 1H63A 3HQ1A 1FWEC 5IHRA 1LZOA 1MDRA 1WBHA 1VFSA 3P93A 1R0MA 2CWNA 2EKGA 3TFCA 2VFFA 1T6MA 4ZB2A 1EYWA 1XPGA 4JFWA 2VMFA 2VI0A 4I7UA 1R2RA 1Y5VA 3AHZA 4L4LA 1ZAIA 1QK2A 3SADA 3RX2A 2B81A 5I7GA 5F4WA 2G3JA 4MAVA 5CJ5A 4JHMA 4QNEA 1DWAM 4C6DA 3GM8A 1FKXA 2XM2A 4QROA 4BQ2A 1EA9C 3GLCA 5AC8A 2E3ZA 4FB7A 1U1HA 4BF9A 4LOCA 4IFOA 1SJAA 1BXCA 4R33A 4XBJA 3ZLFA 4HYVA 2PWDA 3GDKA 3LOTA 4WY0A 2GOKA 2XGBA 5HNNA 1V7YA 3E6EA 5HPCA 3NZQA 4PUUA 3KP0A 1TMQA 3SN4A 2XSAA 4GIYA 4KWOA 1YNPA 5C71A 1C8VA 3W2MA 1E6XM 3LG3A 1GOMA 1KKRA 1XCFA 4G1KA 4N0RA 4ZO6A 3B9DA 3OG2A 3NM1A 5GQBA 3ZVHB 3RJXA 3M9YA 3DBNA 1PTGA 4WDUA 1FCUA 1HVXA 2PDKA 3UJ2A 1UUOA 3ATYA 3OTRA 2FHFA 3PJWA 3ZWSA 4LX4A 4XKMA 4Q8QA 4TV5A 1ECEA 3KBMA 1I75A 3LB0A 1UR3M 4IIDA 4KCUA 3NEVA 2WOQA 5M3WA 4HNNA 2XFYA 3E0LA 4WEVX 3WYZA 5LA0A 5I5RA 1I2QA 4JX5A 2HCVA 4S3AA 1GKRA 3BLIA 1M5WA 2WNNA 1GJWA 3AYTA 4JTGA 5HQMA 4G7FA 5E09A 1AQHA 1O66A 1W9XA 3BW2A 1B4KA 1UR4A 1UKOA 2VVNA 3OLIA 3V1HA 4H9ZA 3WH9A 2V2DA 3BCFA 1A80A 3WFLA 3IRDA 4IQJA 3N6HA 4ZQRA 4PUJA 1TB3A 3MSYA 1LL7A 1WNOA 4WCJA 3L0NA 3GVQA 4AY7A 3DYPA 1ADSA 3DFYA 4Y8FA 1T96A 5ABEA 1WKEA 3M0JA 5BU9A 3W7QA 1NQKA 4JCMA 2OZ8A 1J0JA 3BC9A 3S1VA 3N2XA 3GE7A 1G7UA 2VX7A 4D8LA 5AC7A 3WLHA 5XINA 2VC6A 4A35A 5DN1A 3W1UA 2I9UA 2Y61A 3C8FA 3NG3A 4RDZA 2PDNA 4N9DA 2VFGA 3T6CA 5JBDA 1MNZA 2PDLA 1T99A 2V68A 3BANA 4Z2HA 1L6GA 4LEQA 4HA4A 1GONA 1E55A 1VBJA 2Z2AA 3PNZA 2Q6ZA 3W88A 4NHVA 1R9ZA 4OGZA 3AI0A 3VGGA 4OV9A 1FX6A 1QNSA 4J4KA 2WJZA 1XDJA 4CKQA 4BJHA 1RBLA 1LM1A 3IK4A 3CUJA 1V6XA 2X0YA 2JIWA 2NZLA 3D47A 2ASHA 4WDXA 4GK8A 4PUKA 1P5BA 1PYMA 3EX1A 2E40A 5DFAA 4CQ8A 3PM6A 5C70A 2JGYA 3B4YA 3LTPA 4PMNA 4W7VA 2GPTA 3IIXA 4H9VA 2DIEA 4GO8A 3STGA 4ERIA 2V3FA 1C29A 4AQLA 2PU0A 1DJHA 3PZ9A 1WBJA 4GI9A 3HA1A 3B97A 1JAKA 1K9TA 4Z08A 1JCYA 1EJTC 2ZUNA 1DBTA 4FPSA 5A6TC 4B15A 2OVLA 3TE9A 5BU6A 1XIIA 5FSDC 1WDWA 4PB5A 3SCRA 1W1YA 2ZUVA 1JIBA 4MFEA 3TC7A 4G7EA 4YPJA 3GXIA 3M46A 1ZBKA 1FHDA 1LP6A 3GKAA 4LH8A 4A8IA 4KFNA 1HL2A 4BCEA 4ZSUA 4IMFA 1I45A 4JTCA 1FA2A 3WENA 1F73A 1PKYA 4R9OA 4G56A 1B5TA 4FR1A 3W7IA 2F6KA 4CUCA 4K8EA 3C2OA 3GZAA 2E5CA 3DX5A 8A3HA 3GXFA 3W26A 4FA3A 1LBLA 2NXIA 2IKJA 4HJFA 1S5VA 4QDMA 4HCLA 5CGMA 1JYWA 4ZE5A 1LRNA 3MSRA 1YDNA 1SYTA 3S1GA 2P10A 3KWSA 4H83A 3EOEA 1R3TA 4U5IA 4GY0A 4BR1A 4DQWA 4U5KA 3CUGA 3H2EA 1UC4A 3CUXA 1FTXA 1GQIA 3T81A 1TR1A 4O1CA 2ACSA 1ISYA 1JPKA 1Q8AA 2F6XA 3CQIA 3PWAA 2FTPA 2GDUA 4DUWA 4JKLA 2XIIA 1DWIM 1OZMA 3BZGA 1LT7A 1AQFA 3WLJA 3VX1A 3KRZA 1X7FA 1TQXA 3B9OA 1UH4A 4R53A 3GTFA 1JI1A 4ZB0A 2R6OA 2ZDSA 1GVSA 2E9MA 3BLFA 4C6KA 3NQ8A 2J79A 3BE7A 5AFDA 4XZBA 4PSRA 4EPDC 2BS9A 3DI0A 2E6YA 3N14A 3WK2A 4CN6A 3B3DA 1OZQA 5C7VA 5K2ZA 3R8HA 2D2GA 3UEQA 1ZJHA 3PUEA 4X2PA 4M5PA 1GOXA 1UYQA 3LHUA 2QUUA 4NY2A 4J3UA 3UA4A 5C2CA 3GW0A 2YBTA 1GTHA 4DXVA 4ZBCA 3MCOA 4WLCA 2VUYA 5AYYA 4UQAA 4F0KA 3D6NA 2HNEA 1E70M 3N04A 5HINA 4Q33A 4AZHA 3UZXA 1X7IA 3UWYA 2ZE0A 4Q7IA 4M82A 2VGIA 4K7YA 3CQHA 3LQLA 4EXAA 4DAIA 4LCSA 1R9XA 2JIEA 3VD3A 5FI8A 3C0QA 5TF0A 1XM3A 1IXQA 2OX1A 1PVNA 2FFCA 2EG8A 3WQWA 3WLTA 2H9AB 4HNVA 4UTTC 1QI2A 2Z1KA 2HBVA 1TJ2A 1TWSA 2W66A 2VHLA 3T7VA 4C60A 1VFTA 3L4VA 2PC8A 3GHSA 5I00A 3CZJA 4K2SA 1QWKA 1RVKA 1DYSA 1VBGA 2O4QA 4HTYA 2O56A 3O07A 3RO8A 4L56A 3W01A 2CBIA 1P6WA 2V0TA 3ZJKA 3MO4A 2XFWA 4PC8A 2R1LA 2Z7KA 4GZ7A 5GNZA 4DJDD 4QRNA 3TP4A 4FZIA 3M44A 3BLDA 2IPFA 3HFTA 3LZ5A 3WNMA 2BSLA 4E2VA 5B7YA 3ARSA 3WG6A 3AXMA 1J0ZA 3THQA 2QPUA 2DZPA 1CGTA 2X30A 4GI6A 4JIRA 4GUJA 4HNLA 3RPMA 5FL0A 3LY0A 2E67A 4W93A 4UTUA 3S5SA 1K70A 3SY1A 3BUVA 5A6BD 2DZBA 4K6AA 4B9ZA 1B3OA 1OB0A 3I68A 4QCFA 3MTWA 4C6OA 3IRSA 2PDCA 2VEMA 3NQMA 3TH6A 1XSKA 5TAOA 4TQTA 3USBA 3K4AA 1HW6A 3EPNA 3M6YA 5DMNA 1P4CA 4P7NA 4EVZA 3LPPA 2CZFA 2ZRVA 4F8XA 3BWWA 4PCNA 4O19A 2Z4GA 3AYRA 2QKFA 4G5DA 3W83A 1EOMA 2QMKA 1NVMA 5C5YA 4DXKA 4UQDA 2GVEA 1DTNA 4HPNA 1JCNA 2VRJA 1UQYA 4F79A 2CXEA 2A3BA 3LGEA 2VFHA 4TMCA 3R8GA 3SGUA 3CJPA 3QOMA 2A7RA 1R8LA 3QMSA 1JR1A 3SN0A 1Y65A 4L4MA 2HVNA 3D0CA 1ZBWA 3ABQA 3OHMB 2NSXA 4ENLA 2WHJA 3OEXA 2PRLA 5U7SA 4HSNA 5BZAA 1Z42A 4AX7A 1X6UA 1XLDA 1JQVA 1LROA 5CXPA 4OHQA 4JX4A 4EACA 3S6OA 1NQ6A 2AMGA 4LUTA 2MUCA 5DCDA 4EXBA 1XICA 1RVGA 1TZ9A 1LWHA 3ONBA 3MBFA 4NYYA 5IM51 4LU0A 3WDPP 4H8VA 4X22A 5JU6A 3FVMA 4E38A 4QJ5B 1I6NA 3VKCA 2AAAA 4GOAA 3WDHA 3EYPA 1FQ0A 3SFKA 1QJWA 2Z1WA 1H7NA 2J8GA 1T41A 2VENA 2YB4A 3TWBA 3RNDA 4PMRA 1MFVA 3WLQA 2J8FA 1C8XA 2WKLA 3RHGA 3FX4A 4CNSA 1HO1A 2O92A 3CAKA 4YWSA 3SFWA 2VWTA 4I9TA 3DHDA 3DBPA 4GI8A 3W7OA 2BVTA 2A2IA 4RZBA 3WBAA 1VYRA 1S46A 3F7JA 2Y5EA 3KS5A 4U3CA 2PLCA 4L1XA 4XG1A 2Y2WA 2QJNA 2E4TA 4DBDA 2XVGA 2X0SA 2I5QA 4LVDA 1Z89A 2QPSA 1V02E 4S3KA 3H8AA 4EF9A 5HR6A 3KM8A 4JYFA 3TOYA 2R8WA 5D02A 4ZOAA 3BAJA 1V51A 3INPA 1TZ7A 2Q01A 5H2ZA 3CC1A 4ZODA 2E5DA 5HA7A 4AWUA 4UMCA 3PWIA 1OX4B 1VPYA 3SQMA 1ONXA 1H50A 1RBOB 5LHEA 2V63A 4PL2A 5FACA 2C91A 1VB9A 2GK1B 3CBWA 2Y85A 3PG9A 3S47A 4LC6A 1HL8A 4AD2A 4PFHA 3W7CA 3CHCA 5FEPA 3DG7A 1WOBA 1VAHA 4OIFA 2Y62A 3GFZA 4EANA 4C6BA 1DKWA 1UWRA 2YJQA 1LG2A 3PBYA 1EPVA 4RV8A 1WQ5A 4PCTA 1UD8A 3E2RA 2DZVA 2VEPA 4E6MA 3GY1A 2E5BA 3VNMA 1UHVA 4H00A 3WEMA 2OLSA 5DY3A 4O8RA 4EAYA 4QEHA 2ZKMX 3CS2A 3TTSA 4IIGA 3TTYA 2XIQA 1OWQA 3DYOA 5IXEA 3B8TA 4NJIA 4NXKA 4XZNX 4IX0A 4NZFA 4N4PA 1IQ8A 2V5CA 4NASA 5LGZA 3PVFA 3WX7A 4H6QA 4J7RA 5CBBA 1TJRA 3NL6A 2RKXA 1YRRA 2Q71A 1X1OA 4US5D 5CEWA 4G6CA 3RLGA 5I09A 1V79A 3EZ4A 4DZAA 1ZJAA 4KRUA 1Q5MA 1EUAA 4DHGA 4XZMX 1PYFA 3C3NA 5CC5A 4KW2A 3M0KA 3EGJA 2BOGX 4S1FA 3SCSA 3LCLA 3MCMA 4KKXA 4LUJA 2HK1A 4JTIA 4GZJA 3MZ2A 3HMJG 5E9XA 3DOPA 3TV8A 5KITA 1BSLA 1O5RA 1ZJBA 1YXYA 3ZT5A 1Q45A 4J35A 3GTIA 1I2NA 1MDLA 1US0A 1VQTA 3ANUA 2QJJA 1ECQA 5HJYA 1OIMA 1GHRA 4LV4A 2J88A 1DE5A 4IJCA 4I3GA 1W0MA 5MF5A 5DMMA 4GY7A 4S2BA 1QNVA 3L0KA 3GVVA 4Q7BA 4ADUA 4RE2A 5CPNA 5CPTA 1TVLA 1AVAA 3UT0A 3QV9A 3FSTA 2UY2A 3PBUA 4JTKA 1E0VA 2FPVA 3UWEA 1W3JA 3UNTA 4JNYA 3ZMRA 1R2SA 2NVDA 2F9RA 2HTMA 3FGCA 2CZEA 2Z7GA 4XD4A 4L7ZA 3A9IA 5K9CA 1IEXA 4UUIA 5CC7A 4AW7A 3MPGA 2TSYA 3HBLA 3S1UA 1QHZA 3IVUA 1SFTA 3ATZA 3CLMA 1DJNA 4TMBA 2UZ9A 2ZWYA 1Q6CA 1SO4A 3W9ZA 1QFEA 4GLEA 5IBXA 4I6KA 5JH2A 3G22A 2BMBA 2UV8G 5HDRA 3UYCA 5HJLA 3R43A 2B7OA 3F4VA 1EHNA 3HG2A 4LVAA 4HZMA 1H7RA 2V5LA 5K7JA 4Q8UA 4X2RA 1ZY9A 1XINA 3HJZA 3WD3A 2OQLA 1UBSA 2REQA 3R89A 3TC6A 1HO4A 2WB5A 3WMBA 3GU2A 3KWXA 2ZX9A 2OGYA 3SBFA 1SGJA 2Y88A 4MPKA 3LENA 4S38A 1DJIA 3NZPA 1KNWA 4B5TA 3KP1A 4IG2A 4OV4A 2OWWA 3R6IA 3L4TA 3AHTA 1U22A 3MUZ1 3WJZA 3V0TA 1MZHA 3G24A 3NQEA 5G4WA 3VNKA 2H8XA 4FK9A 3VFLA 4LS0A 4K36A 2NWSA 1B0IA 2H3DA 1E0TA 4IF2A 4PMVA 1JYVA 3W24A 3JR2A 3XIMA 1P6CA 4ICNA 4XAYA 3BO9A 1HXJA 4D1JA 2A79A 4CNPA 1NDWA 4JTDA 1F6YA 2OO0A 3CO8A 3WL0A 3STEA 5E6YA 2OSXA 4GH3A 4G1NA 1TA3B