2BOEX

Catalytic domain of endo-1,4-glucanase cel6a mutant y73s from thermobifida fusca
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
285
structure length
281
Chain Sequence
DSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermobifida Fusca Endoglucanase Cel6A in Complex with Substrate and Inhibitor: The Role of Tyrosine Y73 in Substrate Ring Distortion.
pubmed doi rcsb
source organism Thermomonospora fusca
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E-2
total genus 108
structure length 281
sequence length 285
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 2boeX00
1UP0A 3VOGA 3VOJA 1HGWA 4I5UA 1OC5A 1GZ1A 1OCBA 4AU0A 3RPTA 1QK2A 2BOEX 2BOGX 1BVWA 3RU8X 4I5RA 4A05A 2BVWA 1TMLA 4B4FA 3VOFA 4AX7A 1DYSA 3A64A 4AX6A 1OCNA 3A9BA 2BOFX 1QK0A 4AVNA 4B4HA 1OC6A 1UP3A 1UP2A 2BODX 1HGYA 1CB2A 3VOHA 3VOIA 1OCJA 4AVOA 3ABXA 1QJWA 1OC7A 1UOZA
chains in the Genus database with same CATH superfamily
4KW2A 1FOBA 1G7VA 3K4AA 3UCDA 4ZO9A 3B8SA 1V4YA 4GABA 2ZZ7A 5HMDA 2XH0A 4HOXA 1ME8A 3PWAA 5EY5A 4AXKA 5F1UA 3K1DA 3AHXA 1M65A 2GSEA 4LUYA 4N6EA 1EA9C 4BA0A 1B5TA 3N2BA 1KRAC 3NSXA 2WHLA 1OC7A 1HUVA 3T08A 1N7KA 4X63A 3Q58A 4DAIA 3RPTA 5G4WA 2W27A 2PGWA 3QSRA 4QDPA 2WVVA 1PPIA 5A6KA 4MAVA 4OECA 3LENA 4C6CA 1JUEA 4OUEA 3A6OA 3HV8A 5L6UA 1GPWA 3HZ3A 1U33A 3BLOA 4GIYA 4L7ZA 4P5UA 2V0TA 2HK0A 3D46A 1BKHA 3MKCA 3IGUA 3SCVA 4LVAA 5DMYA 5A6LA 4H2HA 4C1LA 3A24A 2XTKA 3SDOA 3TN6A 1QAPA 1UR2A 4IT1A 3H4WA 1A4LA 4AAJA 3T2QA 4A2SA 3NOYA 1SM9A 1K9DA 1MW3A 3M0KA 3SSZA 4DUVA 3NL5A 2O9TA 3LCIA 5HUOA 4JN8A 3PULA 3V35A 2ZZ5A 5GJPA 3ZM8A 3HA1A 3MMWA 3IGHX 1J6PA 2BG5A 3A22A 3LV5A 1XM3A 4Y6GA 4CEUC 4Q8TA 3ITYA 2A3HA 1W5MA 5AN7A 3ZFHA 3E74A 3GDKA 1IEVA 2PLKA 1THFD 2WQDA 1VP5A 1WYIA 1YBQB 3FX4A 4HPGA 3UZJA 4HBKA 1AL8A 3SCOA 4F79A 1HP5A 1VPXA 4K38A 4AD5A 1W17A 2YCLB 3WQ5A 4P7LA 2PWFA 1ZPTA 3CV1A 4H6QA 1HJXA 3CUIA 4RZ4A 1ZAHA 2YL5A 2WCGA 3Q2DA 4JL1A 1NEYA 7TIMA 1D8WA 2XN1A 3UGVA 3WUFA 4B3KA 2PDBA 3EKLA 2YA0A 1ALDA 4YWIA 4G9PA 2DY3A 3PZQA 4O1CA 3FK4A 2Y62A 2QULA 3ARZA 2YXOA 5HAOA 4TX9A 3KRSA 1RJQA 1UWTA 2MANA 3I3DA 4DNHA 1MVYA 4H8NA 1REQB 4W8LA 3G6MA 5I23A 3EYPA 1WE5A 3OLDA 3TJLA 1WNOA 1UD4A 1UD5A 3O15A 1VRDA 3AROA 4XD5A 2WMGA 1EPVA 3IWPA 4DEFA 5LKYA 3T0CA 3OBEA 2EHHA 5JU6A 3GDBA 4IUGA 3WD1A 3LQLA 4KFOA 1VFMA 1FWSA 2JQXA 3KXQA 3PANA 3VVGA 1UWRA 2F6XA 3SGZA 3P6LA 2BNJA 1RR2A 4IG2B 1J5TA 1I60A 3H2AA 1QVBA 4R3UA 3O0KA 3QPEA 1VS1A 1RP9A 2QMJA 3KHJA 1JIBA 1M3UA 4GE8A 1K6AA 1V3LA 4RE3A 4FI4A 3H53A 3HMJG 3GXIA 1HJQA 3R12A 3PZIA 4MB1A 4WLCA 1X1OA 2DORA 2Z0IA 4L4MA 2NVDA 1XH2A 4J2PA 3AU2A 1XCFA 3AMLA 5AHEA 3MCOA 4F2TA 1S2TA 2FTYA 1SJBA 4US5D 2R8WA 3DENA 2P8CA 4GIRA 3GUWA 2CXEA 1ESWA 3GNOA 4K1GA 3BPWA 5CSUA 2PWEA 4UTHA 4HN4A 3SCWA 2RGMA 1DOSA 1R30A 3RM4A 2GJLA 1TV8A 4WIWA 5LXEA 4YU1A 3BV4A 2FMNA 1V3JA 2R1KA 4KFNA 2OQYA 3F5KA 2AL2A 3N2TA 4KPLA 2HVMA 5AFDA 4N0RA 4XISA 2PDUA 5ABGA 4Z2JA 3XIMA 5CPQA 3P7YA 3GAYA 1L2UA 4GMEA 3LLXA 1H63A 1TJPA 4LC8A 4EVZA 1OCQA 4M51A 1E6RA 3P93A 4GVIA 2HXTA 4G6CA 4WSHA 3O2LA 4AWUA 3AWNA 2EJ1A 1V6XA 3RIKA 2G5WA 4UTJA 2FFCA 5HR7A 1TB3A 4LW7A 4RDWA 3GDRA 4LC6A 1EX5A 3PZTA 4LUTA 3E2SA 5CBBA 2IQ0A 2QVNA 4ZFCA 4C1NB 3DXIA 3GNNA 1RY0A 4RDZA 4DY1A 3BXWA 4JTKA 4H01A 3MYOA 3MT1A 1CENA 1IHIA 1ECEA 5T9BG 2DZTA 2CBIA 1VPQA 2W6RA 2V3DA 3LHVA 1VEOA 4H9XA 1E4MM 2ESCA 2QCLA 1EUAA 2QDHA 3SCRA 4OUIA 4WHBA 4JNZA 4TIMA 1Z6KA 3BAJA 3GRIA 1ZALA 1B54A 5C71A 1TJ0A 3GB6A 1VB9A 1XQKA 4B2DD 5BOFA 3QV6A 1OY0A 4A21A 1FKXA 4A8IA 1IXNA 2A7RA 4XZWA 3GBEA 3MMDA 1I2QA 3VINA 1EWEA 1G9HA 3I7RA 1JUBA 1H61A 2V9DA 3PBGA 3QR1A 3KE0A 1F73A 1G7UA 1TZZA 2QEZA 3GWQA 3L4WA 2P0OA 1DWAM 3BG9A 3O6YX 1GHSA 5EMMA 4AWEA 1CEOA 4P8XA 3MI3A 5GVJA 1US0A 2PCEA 4D6IA 1ITUA 2W4XA 2OO6A 3S9YA 1EJUC 3LRLA 2D2GA 1R46A 4O15A 4ZSUA 3EMCA 1UPPA 3UR5A 3ITXA 3KCOA 1XR2A 3OB8A 4FAMA 3IS4A 4YCOA 3GG8A 2BOGX 1MDRA 1WKDA 5G1TA 2NQLA 3O07A 4NQ1A 3WUEA 5EBUA 4Z1AA 1DYSA 1JPIA 1NWRA 3GYCA 4K3ZA 4WQ6A 5H1WA 1H62A 3T44A 5BU9A 1Z42A 3SRFA 1VAHA 4V15A 1SSDA 4AFYA 3TWBA 3WFAA 3RAOA 1XIIA 3TE9A 1RUSA 4S3CA 1FWJC 1A0DA 5CGTA 4B9YA 3IVTA 3SUUA 4ATLA 1ITXA 1BXCA 3AXKA 4MFDA 3OZMA 1XCWA 1AJ2A 1I9CB 2YB4A 1MUMA 3GW0A 2BXVA 5FSDC 2OWWA 3QW3A 4LAZA 3W7KA 3HV9A 3NO1A 1BGGA 3BVJA 4AEEA 4H8UA 3TYEA 1QPKA 4N02A 2BHUA 3FNDA 5CCZA 1JYNA 4X2RA 4XZIA 4JHOA 4Q8UA 3WEZA 5C8BB 3FHQA 1EQPA 4KFPA 4IMGA 4PMYA 5FA5A 2WHJA 1UC4A 3PJWA 4TXEA 3BAWA 1XBYA 1YTKA 2J8GA 1W5PA 4UMAA 4CD6A 2OR2A 4GG9A 1EO5A 2FPTA 3W84A 5DRCA 3FSUA 3TNBA 3D47A 4W5ZA 2CLIA 1XPGA 3BAKA 3KOWA 3B9DA 1VIWA 2JF7A 3VOFA 3FGCA 3WIJA 5G2HA 2VELA 1H7XA 4MY8A 2D2OA 5DO8A 1W1YA 1Q6OA 4B2DA 3CWHA 1I6NA 3FA5A 1LLOA 1MXGA 2XH2A 3B8TA 4HZ8A 4RZBA 1HF6A 3S1XA 4AC1X 1J93A 4HZMA 3C86A 2E6AA 3ARSA 3NQDA 3VE9A 3M0ZA 5HK4A 3CPGA 3F4NA 1US3A 4ZE5A 4NP7A 1BXNA 1V6YA 4XSMA 1US2A 4U2YA 3WY1A 1P48A 1TR1A 1DP0A 3CHCA 3ZJ6A 5JH1A 3WD3A 2MUCA 3KP1A 3MMUA 3CNYA 4NAFA 4QEEA 2WCSA 3KTXA 5CPNA 3VABA 3VMPA 4KEMA 3H6OA 3BC9A 4JIQA 4QDWA 2C19A 1IT0A 1PBGA 4S3JA 1HN1A 2Z1VA 1XIMA 1AQHA 2GFTA 4HJFA 1ZBWA 2B7PA 3POHA 5C5YA 2YSWA 3M6YA 1DXFA 1POJA 3ATZA 5IHRA 4MJ2A 4BK9A 3THDA 5B7ZA 4CCZA 3L12A 1UKQA 3NDOA 3GU2A 5G1YA 3UY8A 1Q7MA 3BAYA 2KZHA 5AC6A 5ABFA 2NQJA 5C2XA 1TELA 3LBCA 4HNNA 4K8GA 3OVGA 3MYPA 3OIHA 3GZ3A 4E2BA 2G96A 3DYMA 3E1F1 2IQTA 5AHNA 5C2GA 2F6UA 3KBNA 1XC4A 4JN6A 3MDWA 4Z0SA 3WD2A 4H9UA 3G0UA 1Q6RA 1HKIA 4MUPA 5HJYA 3CV6A 3CZGA 3R8RA 3NDYA 4OOUA 2E9LA 4IFRA 1M7PA 2XINA 4UOZA 3STCA 4HT3A 4M80A 4URIA 4A3UA 2HNHA 4E3TA 3ISIX 1Q6LA 2FTWA 5DEZA 1DWGM 2WMIA 4IMDA 3UPWA 4CCDA 1QI2A 1UYQA 3FW6A 3F1QA 3I68A 5I7GA 1LBMA 4FLSA 4G8TA 1E55A 2XUCA 2E8ZA 3T4CA 4O8AA 3A4XA 4NYYA 3U5YA 1VLWA 3PTDA 5D2TA 4ORMA 4HNUA 1JRCA 3KBJA 3UXAA 1JCNA 4DX3A 3GX9A 1WBJA 1EQCA 4YVXA 3AHYA 3LSBA 1JZ6A 2GDUA 4IPIA 1H50A 4RDYA 1E40A 3WKZA 1V08A 2VFEA 1EX1A 3W9ZA 2R24A 4BY3A 4TVUA 1XIGA 2VD8A 3PN8A 1A5BA 3PC0A 1RSCA 3BE7A 5AYXA 2FJKA 1UW9A 2V5JA 1UUMA 1PAMA 4EANA 1Q6GA 2PGRA 1VEPA 4PB5A 1QK0A 2ZE0A 2YOCA 3QVQA 1I1XA 3QFWA 1S3TC 3CB8A 4MZYA 3RX4A 1MZRA 3M47A 1RLDA 3HPFA 2XIOA 3D5HA 2J4GA 4IQDA 5CBIA 1FH9A 1W5OA 1EBHA 1Q6FA 4HOWA 3WQCA 1TO3A 4UFLA 1P0EA 4KWVA 2PZNA 3TLLA 3JUGA 2OMAA 4E6MA 1AH4A 1KLZA 2R14A 5D9MA 3VZXA 4CD7A 3K4WA 1NJJA 1SO3A 3SUWA 4H41A 4H7VA 1QNRA 3OU8A 3BWWA 2CZDA 4H1ZA 2PE4A 3TAOA 2PRMA 1ISXA 2YKKA 3OLEA 1I75A 1D7KA 3BTNA 2JGYA 4RE0A 4AZBA 1V02A 3UZWA 3MC5A 1UKOA 5JBEA 2BMBA 4WGHA 4JICA 5BRBA 3R58A 2SFPA 1FWWA 3TW7A 1DEDA 2BVWA 3AHVA 4GZIA 1GVOA 1W32A 2GLKA 4PUEA 4MDOA 3N25A 1VC4A 1F8IA 3NXFA 3IANA 3WMSA 1KGXA 3JU2A 4M6PA 4LCSA 2YJQA 3QTPA 3LXCA 3LEPA 2ISWA 4DBDA 1I2PA 1XWYA 3QY8A 2IKIA 3M43A 5TF0A 4AZ6A 3L66A 4LNCA 5A8GA 4JTIA 1IZCA 1NELA 2VL4A 4TV6A 1EFZA 2A2IA 3I65A 4W7VA 4CEXC 1G5AA 1IXPA 1KFEA 2CBJA 4US6A 1PX8A 2CNCA 4B91A 2WAGA 5TNVA 3NM3A 4Z0JA 2YR1A 2VEIA 2FDSA 1BPLB 2EEXA 3I6RA 4Q6XA 3OVQA 4DN1A 3LY0A 2D1ZA 1R3YA 3W4RA 1VCGA 4GI4A 1JL8A 1EDQA 4AXNA 3R94A 4GJ1A 2DVUA 3VFCA 4P8WA 3E38A 1S5WA 1TIMA 3B3DA 2AOSA 4L4PA 2W63A 4KRTA 2VOMA 3FVDA 1OX5A 3M7WA 3E5PA 2VI0A 1RLCL 2F9RA 4FK9A 4C6FA 3S0CA 1OX4A 4F0LA 4UNKA 1W9BM 3HMCA 4DJED 4XKYB 1GQJA 1R47A 2J8FA 1GCYA 1FWEC 2ZZ1A 1B31A 3OW1A 2YGYA 1A3HA 4OOZA 3T2OA 1CXHA 2HQAA 4H9VA 3AMGA 3EXTA 1T6MA 3LI1A 1D3CA 1K9TA 3HQNA 1FUYA 3SUVA 4DWSC 5ABEA 2D3LA 4M0XA 5HBFA 3TN3A 4QAWA 3V4BA 3EAUA 3BQ6A 2ZX5A 1WDPA 2FPYA 1FCUA 2QVHA 4HNVA 4IMFA 4HD5A 2UBPC 3TEVA 1S2WA 2Y6ZA 3EWWA 1EEXA 3UJRA 3LDVA 2WPBA 2W61A 4D72A 3ZXWA 3WEMA 3SCQA 4KCVA 2VO5A 2WC3A 3TCSA 3IJQA 5DBTA 2VRQA 4MY1A 3HPAA 3W7DA 4MAZA 4ZOCA 3UZZA 2VGIA 4S3BA 1UA7A 4IFKB 2A7NA 3SAZA 1C3FA 1B1YA 3PZGA 2GDQA 4ZR8A 1ZJHA 1EZ2A 4NNBA 3C0LA 5I77A 2VZTA 3FJLA 3HN3A 3KBSA 3WN6A 2WM1A 2ZZ4A 4JYDA 4PMNA 1KM4A 1UHVA 2OO0A 1OK4A 2WSKA 4KWWA 5C2CA 4QIUA 4DLMA 4GKLA 4X0NA 4U3CA 3AMDA 4ATWA 3IRDA 3WF1A 4JEQA 3GU9A 1ML1A 2FH8A 4KF1A 1AG1O 4L5ZA 3SADA 2DJLA 1POKA 3S83A 1G94A 2P5NA 3VDGA 3WLNA 1W3HA 1TTPA 3K8KA 3FYOA 1E9ZB 3WUGA 4CNPA 3GBDA 1E1CB 3S4TA 1TA3B 4UR9A 3S5ZA 1EJTC 1IV8A 4N7QA 1Y5VA 4DYEA 4ZL1A 2PTWA 4C6KA 4PBEA 3IIVA 4R9XA 3WNPA 2WMHA 4JTRA 1ADOA 4LXFA 4FEZA 2GVLA 3H7VA 2UY3A 2VX7A 1E1FA 1VFSA 2QJNA 3T09A 1TV4A 1D3HA 2H6RA 3UNDA 1M7XA 1FWHC 4H9YA 4PCTA 4JHZA 1TQXA 4PCSA 4FR6A 3TJIA 2V5KA 3B9NA 5HR6A 2J9ZA 3C2YA 3L4ZA 2QUNA 1OF8A 3DHDA 1UZHA 4PTVA 1B2YA 1UR0A 1QK2A 4CD4A 4XUGA 4W4QA 3CAKA 3HU7A 3ZJKA 1R86A 1QI5A 4ZTXA 2FLIA 2WBGA 3RLGA 4MKNA 4AHPA 1UD2A 2WMIB 4N4PA 3QC3A 2OODA 4FNQA 3WMCA 5A94A 5EMUA 4PTWA 3ZR6A 5DF0A 4PRTA 3EDEA 4X0VA 3WK1A 3S5YA 1AK5A 1LOSA 4IHCA 1O95A 1CECA 1F3EA 4NG3A 1P7TA 4OGZA 2ZC8A 4DZAA 2QPSA 4U4MA 4IUOA 4MYAA 1MYRA 2VVSA 3WBAA 3AO0A 1XUUA 3C0QA 3KL5A 2IXUA 4NL1A 1XYMA 4KGLA 3PG8A 4DI9A 4LEQA 3R43A 3KM8A 1M6JA 2UZ9A 4EWJA 4GVGA 4QLLA 5BU6A 1SFLA 1EYEA 4GINA 4NJIA 5I03A 2PDCA 4PBFA 3GNXA 4ZB0A 2CWNA 2QQ6A 1S5TA 4IGHA 2G50A 3LS9A 1LOQA 2ZRWA 3MANA 3VDAA 1LWIA 1KBJA 4Q4RA 4JYFA 3LSCA 1XDMA 2ISFA 4NZ4A 2J88A 1PKYA 1FHDA 5FOOA 4G2DA 1K77A 4YNGA 3TAKA 1UR3M 3H2FA 1WAUA 2YFOA 3N6QA 1R9ZA 3G3MA 3UWYA 3AIBA 3BOXA 4NZJA 3C2FA 4CCEA 3SZ8A 3MBDA 4FALA 1F4AA 4ZQOA 4RK8A 4AU0A 4M3PA 3TW6A 4ZSTA 3QQWA 2VMFA 3GC2A 1MI3A 1X7FA 2AQVA 3W38A 2FZ9A 3N19B 3F5LA 4C6NA 3GXTA 3CPRA 7PTDA 2WNQA 3A4JA 4WRHA 3ABXA 3TCEA 3PPGA 1RPXA 3BO9A 3QMRA 1NFGA 2OZ3A 1HKWA 1A5KC 1YE6A 3P8IA 3TQKA 5GPRA 2X05A 2BHYA 4K8EA 2ZXQA 1HKKA 1W1ZA 1IEIA 2QV5A 1V3KA 3QR0A 3NQBA 1WDWA 4R53A 3M0YA 4FLQA 1VPYA 4IX0A 1HQTA 3C2RA 1E4LA 2POTA 5D38A 2VXNA 1FWDC 1XRSA 3HGJA 4DUWA 3A3WA 2CITA 2Z1SA 3THQA 4UFHA 3DFSA 2Z25A 4UFMA 2PRHA 1LWJA 3B8VA 2HSAA 1Q2RA 1BGAA 2WZTA 4A22A 3L4TA 2QR6A 1IGSA 1BG9A 1KR1A 1SO6A 4LT9A 1GWJA 1RBAA 2G3FA 4ZGYA 4JFWA 4DZIA 3JRKA 5MKGA 1QCWA 4Z42C 1E71M 2DUAA 5CSRA 1XUZA 1TPEA 3NQ7A 1R5YA 4YTTA 3RDKA 3FS2A 3H4XA 2UWFA 3O1NA 3TK7A 3PB2A 4L1XA 1B3ZA 1GVIA 4ZE4A 3W1PA 2JKEA 2JKAA 3GH5A 5ABFB 2E0PA 3AS3A 3WLJA 5E5CA 2XSAA 3SRHA 4RCXA 4AVNA 1OJXA 3WQWA 3UETA 2GJXA 1CNVA 3H2OA 4HTYA 1UWUA 2WWDA 3NWRA 3ZYZA 1FDJA 1UIPA 4HP5A 3M5XA 4DBSA 2AL1A 1OEPA 1W9PA 3G77A 3HJEA 5ENLA 4GZJA 4ML9A 2IKGA 2CHOA 4X2PA 1QBBA 4S23A 4CQAA 2CHNA 3ZLGA 3EKZA 5AZ1A 5DANA 3MSRA 4LRTA 4RV8A 2ZOXA 4WDTA 2UV8G 2YA2A 4DQWA 1PCKA 2RH9A 2QHAA 3IJIA 1DJIA 2GK1B 1R3SA 2WANA 4AQLA 3E0IA 1GZJA 5BOEA 2XM1A 3W24A 1WXJA 3VNMA 4H2CA 5FL0A 3RG6A 3AHTA 1DORA 2ZZ2A 1UWSA 1AQMA 2RUSA 5A8OA 5IFTA 2DZSA 4LV9A 3WF0A 3GTIA 1GQIA 1XIFA 4TMBA 2YL9A 3W53A 1MFVA 5AHLA 3Q94A 2CKSA 2DZUA 4L6HA 1OYAA 1XLJA 4GFSA 3IJ8A 3QHNA 1ZLPA 5FJPA 1AL7A 1KCLA 1UD8A 2J75A 3KDNA 1O5RA 2BVDA 1HVXA 2QCEA 5GJMA 4C90A 2G4FA 3V0UA 3AYSA 1TWDA 1C9DA 1V7AA 3IUDA 4GC3A 4OV9A 3ZT6A 3THCA 1K7EA 2ZYFA 4GGBA 4UNIA 3IUIA 4LBUA 1P1MA 1T5AA 3S5NA 3DX5A 4PEEA 1TRIA 4IJRA 1SZGA 4HTBA 2E68A 2RDTA 3WDQA 4LBSA 5JVLA 4F40A 1G4PA 3CQ0A 4JNYA 3CH0A 4HA3A 2C14A 3ME3A 3P0XA 1GZ1A 4NXSA 2YL8A 3CUGA 1OFQA 2VVNA 1SJAA 2QJJA 3U3HA 2BGQA 5C70A 4JIEA 1MFUA 3NQAA 4LF2A 2X1TA 4ACZB 1IE7C 1W1VA 1TSIA 2NVAA 3W2MA 3W7EA 4UFIA 4JTAA 3UT0A 5JIPA 1B4KA 2DDXA 1SUXA 4IIBA 3PTMA 3OG2A 3G1FA 1IIHA 3L5MA 4HHPA 3ZO9A 1W5QA 4H9ZA 5AZ0A 2PLMA 1DJZA 4IISA 5EYWA 5KTLA 4ZMGA 1SZRA 3APYA 2BGNE 3WDIA 4AYGA 3NQ8A 1XG3A 2AMXA 4PEKA 2JF6A 2E5CA 1XYZA 4Y9NA 2V5LA 3NQMA 4NY2A 4DJFC 3VC5A 4CD5A 1W9XA 2YYTA 4UNLA 4QS6A 2QMKA 4ZVJA 3DCPA 4PYSA 4LUIA 2DSUA 2UY5A 1JFHA 3U2CA 3VKCA 4M81A 1NWTA 3R0KA 1O94A 1FFRA 2B7OA 3DYPA 4JTTA 4D8LA 5IHSA 2VC6A 1EJXC 4XSLA 5A8PA 2B31A 4PCPA 1EOKA 1ONRA 3NQGA 1JZ7A 2PF0A 3RRAA 2QGYA 2VZSA 3PPFA 9XIAA 8RUCA 2QUMA 5FKYA 3WLHA 2R1LA 5CC5A 3N4AA 4MNLA 1XLGA 5BXPA 3FA4A 4QFUA 4LUSB 3WLKX 3P80A 1EC7A 3P0WA 3KS6A 3T0AA 2OX4A 4C5YA 3TA6A 1SMAA 3H22A 4PRWA 1OQFA 4BWLC 3NTYA 4Q22A 5E0CA 3VIIA 1BXBA 5F2MA 1XGEA 1S1RA 1QI3A 4UR7A 5A2AA 4TR9A 2HISA 3C2OA 1TJRA 5I02A 4I90A 1UKSA 5TIMA 4JIIX 4EKJA 2VFDA 5HXMA 1KNWA 1G6CA 3W1AA 1HO4A 1JG9A 2VFFA 2ZRXA 3TSMA 3LMYA 4Q4QA 1AH0A 5EKYA 5C0QA 3ZT5A 3EX4A 5AHFA 1RVGA 2OEKA 4ZQMA 3GE7A 2IPWA 1V6VA 4UUIA 3TYZA 1H0IA 3G1DA 3NA8A 3B8WA 2CLMA 3N4FA 6XIMA 3QFEA 4A8LA 1KO0A 4GFIA 3FYYA 2F2KA 5HATA 3T4WA 5F2IA 2EKCA 4E2VA 4C6LA 3RLUA 3TKFA 3QKEA 4UQEA 3AIRA 1UZ4A 1ODUA 3BOFA 3WLSA 4B90A 1EH9A 1DIDA 4BF9A 1OHLA 1JDAA 1RCOB 3TYDA 3DGBA 2BVTA 4BI6A 3TWAA 2DGAA 1YW1A 1AMKA 1W9UA 3R13A 4Y9OA 3S2CA 5EMLA 1GJWA 1FH7A 3EX3A 4NT0A 3AZSA 4GO8A 4RL3A 3GR4A 2J27A 1QATA 1BFNA 5FD0A 3G18A 1W2VA 4BZYA 2V3GA 1TPUA 1F61A 3CUFA 4POCA 1WA3A 2NZLA 3KWSA 3V5OA 3WG6A 4AMCA 2X1SA 3WCZA 1MNZA 3SCTA 1CTNA 3MI2A 4GVHA 2WWCA 4QCEA 1TE6A 3QY6A 1PTDA 3W29A 3T78A 1SW0A 1Q5MA 1MXDA 3EMZA 1W3NA 5EMYA 3VGGA 3GD6A 4ERGA 2FVMA 2ZVIA 3TDFA 4CCCA 4U33A 1KV8A 1KQZA 3INPA 2CLOA 2ZKMX 1W8SA 4BQ5A 5HA7A 1SSGA 4LEFA 3OIXA 2OQLA 2L5HA 3UF9A 2A1YA 1XH1A 1XF0A 4IIHA 3EWCA 1X6LA 1S5MA 2OEJA 4QBXA 2TMDA 1GOIA 4NJJA 3TYBA 3G1HA 2FGBA 3DHPA 4MWAE 1NP0A 4KETA 1KM2A 3GKAA 1UCWA 4HCDA 1LRNA 2J74A 3ARVA 4A2RA 1F6PA 3TYAA 4CN4A 4Q8NA 4D8AA 3GIPA 4C1NA 1DXIA 3OBKA 3MHGA 2QJGA 2BY2A 1WDQA 3CMGA 4R85A 4DVOA 3O0FA 3GC4A 4H04A 4NJGA 2CKRA 2PDYA 1R0MA 3N17A 3PZOA 1OADA 3E0FA 5A6JA 1RH9A 3KDOA 3CT7A 1ONEA 1UROA 5CXPA 1QASA 3ZWSA 4O0KA 1O6IA 1SJDA 4JTLA 2Y8KA 2ZZ3A 3T0TA 1NOUA 2CU0A 5IDZA 1KM1A 1JPKA 3BJTA 6CGTA 4NVTA 2QXWA 5TQLA 2AAMA 5K4ZA 2PD5A 4N2YA 4W9TA 4E0CA 1PTAA 3KVLA 3UR8A 4GLEA 3PNUA 1O1ZA 4WK9A 3BMWA 2QNEA 2NW0A 3VKJA 2BY0A 4LFYA 4HA1A 1X96A 1KKOA 4JNMA 3MSDA 4YMZA 1LBLA 3VXGA 5A3HA 4AISA 3URAA 3VGHA 2DZBA 2EF9A 3EA1A 2E77A 3L0GA 2QUTA 3L23A 4Y9AA 3UYIA 3CTLA 4X61A 1HGWA 3V5CA 1GK8A 3PB0A 5FEXA 4QITA 1JCYA 4E3VA 5LSMA 2A85A 3LB0A 2E8YA 3QY7A 5AC7A 1QTWA 3GNRA 1OCJA 4I8YA 4IICA 3E02A 3H2CA 3O7UA 3EPNA 3WYZA 4PL1A 3VKAA 4QROA 5C55A 2WVUA 4GCXA 4RNJA 1RBOB 2Q8LA 3UR7A 4AY7A 3DAQA 2XHYA 2HV5A 1V3IA 1GEQA 1QFEA 3W7HA 2HS6A 4GNKB 2FHCA 3QC0A 2ZQ0A 4V2XA 4UZUA 2XIMA 3LCHA 5DMLA 3FAWA 4HNCA 2ATMA 4F48A 3MI6A 1GVRA 4GPNA 4CVUA 4ZB5A 3RITA 2ZRUA 1QNSA 2OFJA 3VOIA 2VCBA 2ON3A 1I45A 3O6DA 1FWBC 1ONXA 5HJLA 4Z2HA 2P1FA 3B4YA 3N18A 2JFEX 2OX1A 3TFXA 1JDEA 2HE5A 2G37A 1H3GA 2VEFA 4ROQA 3FKKA 3B40A 2ZADA 1KM5A 1QDSA 4DB7A 4JIPA 2QCDA 4R34A 1UWAA 1H41A 1XGDA 3IJ9A 4QR6A 3ABQA 2D2JA 4NAFB 1M5WA 5BWFA 4QP0A 1Q8AA 4MUZA 2EAWA 3BCJA 2YCLA 1PXGA 3FEMA 2DFAA 1ONWA 1OVDA 2WSYA 4EXAA 3I6TA 4N9EA 2PWHA 1OF6A 1WV2A 5BOOA 2WSPA 3RMEA 3MP5A 3EOEA 3B0XA 1P0BA 2VJXA 2XIIA 3HQ1A 2GVEA 2ABBA 2YW4A 1PSCA 5JMUA 4LANA 1QT1A 3IK2A 1TKKA 1SVDA 4DJDA 2QPXA 4LYQA 4F2BA 2V2CA 3ZJ8A 1S2CA 2XIJA 3VC6A 1OINA 4AHOA 1E9IA 4H6RA 4AD2A 4X60A 1B3OA 4QNWA 2VEGA 3MB9A 4LOCA 1A5LC 2I14A 9RUBA 1GQKA 2NSOA 1VCVA 5LNWA 3A5VA 1RY8A 3VKKA 2GGGA 2XN2A 2NV1A 1QPOA 4N4QA 3F4DA 1YXCA 4NNCA 1JAKA 3TSDA 3UWQA 1HKJA 3K2GA 3CT2A 3WEOA 1DE5A 1M53A 4LCRA 3QW4B 2F6KA 1A47A 4UTWC 1T40A 3L4YA 5F4XA 1TJ2A 5LGZA 3C5QA 4FA3A 3PFRA 3QN3A 3EA2A 4EXQA 4JKLA 2VZOA 3LLFA 4A29A 4Z08A 4CN1A 4AYSA 4A3RA 3E6EA 4IOTA 2XH7A 4Y8EA 3L4XA 5C7VA 3EX2A 5AHMA 6REQB 2OG9A 3PJTA 4QJ3B 2Y7FA 5L9FA 5KITA 4QLKA 3GQYA 3ICJA 1QHOA 1QMLA 1M04A 3KVKA 2GJNA 4I6KA 2VRKA 1SZFA 1AUSL 1XI3A 3HPSA 1H1NA 3WL1A 3LK6A 3H24A 3DFHA 1GPFA 1C8YA 2YZRA 3PZUA 1Q7QA 2QCGA 3W73A 1TV2A 1DIKA 3VTRA 4OJYA 3VIGA 1GKPA 1ITCA 1Q6EA 3AXMA 3VGDA 3WQEA 3CZ8A 4QG9A 2PLCA 1KXHA 4GH3A 2X40A 5F7UA 2GQ8A 1LDCA 1UASA 2C1HA 2QUUA 2WJFA 3KCLA 1XL9A 3QF0A 1E70M 2DSKA 4JL2A 1F7BA 4PMRA 5BZAA 1V79A 1UBPC 5DMMA 4LYKA 2YDAA 1ZHAA 1ZJBA 1NDZA 3GIQA 3QQ0A 1PKMA 4WDXA 1IIGA 3WH9A 1M7OA 4B3LA 4PE8A 1OT2A 2PTZA 1QNOA 4RLIA 3REQA 1SZEA 2A3EA 3MP3A 2Y63A 1X98A 5H8MA 5M5DA 4RW3A 4UQDA 3CYJA 4HCHA 5LNVA 1KGUA 1WXZA 4W8AA 5LA1A 1NAL1 3HPZA 1JI2A 4EF9A 5I5RA 4HPNA 2VX6A 3T8QA 1W1IE 5IDIA 4J3VA 4OKDA 2Y88A 1E0TA 4C6DA 3S47A 1Q45A 4Z1YA 3CIWA 3K13A 3P14A 4I9AA 5LIXX 3MUXA 1HFBA 5M2FX 4LJ3A 1MQPA 5JIWA 4OU1A 2OPJA 3U2OA 3N2OA 2HE8A 4Z2IA 5FJJA 1Q8JA 4EPEC 3IPWA 1QOQA 1PS9A 4F0MA 3KP0A 1REQA 2PDWA 2NQ9A 4MIMA 2ACQA 5F2LA 1R9XA 3LPGA 3ZJ7A 1OGGA 1V7YA 1J79A 2PU0A 1XDJA 4AIOA 2CXGA 4RXFA 4GQGA 1CIUA 5H8UA 4JR5A 4W5UA 3N1AA 4FIRA 4M6VA 1FHUA 4PUUA 1D3GA 1VBJA 7REQA 4WJXA 3VNIA 2GJPA 3VNZA 1C92A 2YDQA 1LORA 5AYYA 1VFHA 4RE4A 2C0HA 3G1AA 4MOZA 2CFFA 3G6LA 4MKSA 3NZ1A 1LBFA 4OQVA 1CXIA 3RM8A 4AY8A 1QW7A 5REQA 3P81A 4AWTA 3K5XA 5J8LA 2EQDA 2CLHA 4PN2A 3NNTA 4TUFA 4LTSA 2ZE3A 4PBGA 3AXIA 3C52A 4PUNA 3KS5A 2X0SA 1RA5A 1CB2A 4GKTA 4WD0A 5PTDA 2NWRA 3A9IA 1RCXB 2OGJA 2IQDA 3UVAA 3MW7A 3O16A 1VJSA 1L8NA 3HB9A 4Y2WA 4MGGA 3CL8A 3L4UA 1VHNA 4Q8QA 4TQTA 4UTKA 3DG7A 4PFMA 1PUDA 1PHWA 4RR4A 1B0IA 4HJWA 5CG0A 1F76A 4GY0A 3MVIA 3WMBA 1TX0A 4IPJA 2V38A 1JVNA 3DFTA 4DJFA 2GOUA 2Q3OA 4A3YA 4WY0A 3TC6A 3XINA 4OFCA 1XS2A 1SU5A 4YVVA 3OYZA 5C9ZA 4XVDA 3S1UA 4LYRA 4GIEA 2D23A 2R9RA 4C7GA 3VCCA 5GQBA 1M68A 1NVMA 3PVFA 4KEUA 4E2DA 5G4EA 2NXGA 3ITTA 3G1RA 3MBFA 1K9EA 2OZ8A 4I7UA 4B92A 1XHGA 4HU3A 5EGRA 1DWHM 3AJXA 1RA0A 3PBVA 4RJEA 3RNDA 2MNRA 2QCMA 2NT1A 1IF2A 2A5HA 3QM3A 2G95A 1H60A 1WUEA 1QXLA 4JQ4A 5FF2A 2QAFA 5E6YA 2PDGA 3FA3A 3VGFA 3VYLA 4MG4A 2QDDA 2V2HA 4WR3A 1C9WA 4GA8A 3GKFA 4FR1A 5J04A 3NL6A 3QZAA 8A3HA 2BGSA 1CDGA 4DPQA 2FH6A 3MQTA 3LBOA 5CZKA 1E73M 2C15A 3IIOA 3HM7A 4F4RA 1WDSA 3DFOA 1OG0A 5AC4A 4Q4MA 4G7EA 1KRBC 3R10A 3L4VA 1IR1A 5G1MA 2RDUA 3W07A 4E38A 1FH8A 4CNSA 4ILSA 4BFAA 1KFCA 1G01A 3EWXA 3VOJA 3AYRA 1XSJA 1EP2A 3FVMA 5E1QA 2AQOA 3UERA 1UR9A 2LLEA 2XIBA 4GD0A 3W0KA 1PHQA 3CTTA 4XWUA 3TIMA 4K7YA 1PX3A 2YA1A 1EDGA 3HG3A 2XVPA 4O1DA 4FXFA 3CIXA 2JK2A 4O1FA 3ZR5A 3W1LA 2HBXA 3ITLA 1WPCA 4HQVA 2ALDA 1C91A 4HYRA 1H0GA 2UY4A 5XINA 3LA4A 3R79A 1RVKA 2Y5EA 1BQCA 5DLCA 4L56A 1WXYA 3E5BA 5CPSA 1K8XA 2YFNA 3ALGA 2GUYA 3JS3A 3LGGA 2CLFA 4HHHA 1DJQA 4J3TA 1XLHA 3DI1A 3GHUA 5I3GA 3HQOA 3PBWA 3O05A 4L1WA 2IS7A 3G5EA 4ZO6A 1EUNA 3GVVA 3XISA 2HNEA 1GG0A 3HURA 3FXYA 3PFMA 4OBSA 3TV8A 2OLSA 1OYCA 2TODA 1QHPA 4XO6A 3NPXA 1JGIA 3JR2A 4GY7A 1QWKA 2OJPA 3L2IA 3I7SA 1B4EA 4B3ZA 3B03A 4J2MA 1DJYA 4XTDA 3ABRA 3WX7A 1LQ2A 1J6OA 4I9TA 4DJDD 4HNOA 2GDVA 2UY2A 2Y24A 2I16A 5BMWA 5KETA 4JKMA 3TJ4A 4HU0A 3TSBA 1C8VA 1NFBA 2Q02A 4JTSA 4CU7A 1LYXA 4EPDC 3ZVHA 3SRKA 4HHMA 3ABOA 3O6CA 5CPOA 3LLDA 5HANA 1MRQA 4GUGA 2ZBTA 4GRSA 4JX6A 2EG7A 1ZSXA 4DXKA 2VUYA 4AHQA 3PZVA 4TX6A 3PWGA 3W1XA 3LG3A 1GKQA 5T9CE 3Q37A 4U5KA 3V0SA 1KRCC 4PUMA 3UVIA 1XIBA 3TQPA 3WLOA 1EGVA 4MB4A 3WLTA 1NSJA 2BOFX 1Q2SA 3UPBA 2FVLA 3SI9A 4AZCB 4N6FA 2XISA 3EDJA 3WNNA 3VD4A 3AALA 5F4SA 3IJDA 3ANVA 1Z69A 1YBQA 2EPMX 4XUYA 2ZA1A 3SURA 3WJZA 1XRTA 3B97A 1E43A 1FY6A 2AKZA 4KCUA 3B05A 3E2VA 1FWCC 3LU2A 1TV5A 4V27A 2E25A 3W83A 4J7RA 4MNKA 1M03A 1JCMP 4ZOBA 2D0GA 1YYAA 5A6AA 4C6QA 1YPXA 3GU1A 1L6WA 2QCFA 4E4FA 1CI1A 6TIMA 4M1BA 3PUGA 2QS8A 4S3EA 3N2MA 1P0DA 2REQB 1PIFA 5T8GA 2ZXDA 1RV8A 2V68A 2Z27A 3NPUA 2ISVA 4R88A 2HVNA 4W84A 3UR2A 4DJFD 4DZHA 1QRQA 3GAKA 4LB4A 5CC7A 2E67A 1DJNA 1F3TA 3LMZA 4ATDA 3ARXA 2GSHA 3BLEA 2PGEA 2DUXA 3B04A 3L2MA 1JYWA 4FLRA 4O1EA 3BURA 3CC1A 2C8NA 3QV7A 3AS2A 5FI8A 3FSTA 3W72A 1CWYA 3V16A 3S6TA 3ITVA 5I0DA 2QLYA 1H1ZA 5REQB 1BYAA 3DKJA 2OSYA 1D9EA 1OD8A 3W87A 4NAEB 1OFAA 4I7VA 4RXGA 4UTIA 3GFXA 4UTLA 2W5FA 2QCDB 4QXIA 2GJRA 2R1NA 2V5BA 2DW6A 1GJUA 4GO9A 1ZBCA 2Y89A 5AKQA 3W25A 2CZFA 2BXYA 1IXOA 1Y65A 3VKDA 2OWXA 4PTMA 3WBEA 4ONVA 3GIYA 3PUEA 5DT5A 3DKLA 4FIQA 5SWUA 1JR1A 1HKVA 1BLIA 3G0SA 1PKLA 1EIBA 2PUZA 3GLCA 3RLHA 1V3MA 1O5XA 5CZSA 4DWSA 3MCNA 2XVGA 2CLKA 3UG5A 1XICA 4M6QA 4YN5A 2FVKA 1JAEA 4V1XA 2BY3A 2ZIDA 2DZPA 3SB0A 1FXQA 2XYLA 4M7TA 5LA2A 1R3QA 4MNMA 5D02A 1QR7A 4UQAA 2H9AB 4GQRA 3K30A 3S5SA 5A5WA 4JTEA 1KM3A 5E70A 3VIOA 4DF0A 2ZUNA 3L21A 5C9WA 3Q4DA 1XYLA 3KL3A 3TQ0A 3RJYA 1SFTA 2C7FA 3O9NA 4MYXA 5C9RA 2ZXBA 1K8CA 1R2SA 3FKRA 4D6CA 2J78A 7CGTA 4S2BA 3WLMA 4DO4A 3DHUA 2D20A 2BVYA 1OGSA 3HGRA 3PAOA 2J62A 3NCOA 4IX2A 4Z2LA 1JYXA 2HDJA 1WX0A 3ZIZA 1RCQA 1ME7A 2AKMA 3G1VA 4PMJA 4E5TA 3LHWA 4CNOA 2DVXA 1MDLA 4D6HA 4HYWA 1E6SM 2WPGA 3F4VA 3MO4A 3UWZA 1TZ7A 5DCBA 1K9FA 1OK6A 5HWJA 3V5FA 3T8LA 4AF0A 3M41A 3PBMA 2PU1A 1XFBA 4XX6A 1CXKA 2QCCA 3H26A 3EWYA 4MJZA 5K9CA 4LVBA 1W3IA 3F03K 3M5ZA 3ANUA 4C7DA 2JIEA 3NEVA 4XTIA 1TTJA 5MF5A 4IL2A 3DUGA 2GGHA 4ZA0A 4JTFA 1ICSA 2VEPA 4IIGA 2WSRA 2ZX8A 3RN6A 1U1UA 4GQBA 3IARA 2NQ5A 3TFCA 3OODA 3B9EA 3WZ0E 2WBKA 2NV2A 1O60A 4Q3MA 3SUSA 2VWTA 2CEQA 4WEVX 1LG2A 1XLIA 3UWUA 3EXRA 4DNMA 1E0XA 4MHBA 4C6PA 1LG1A 4US5A 3OHIA 4UTMA 5CLWA 2PA6A 3F2CA 1XKJA 5F1VA 1UOZA 1GQNA 3AYTA 1OC5A 5E09A 3UG4A 4RNIA 2E1DA 5FIPA 3PY2A 3H7RA 3F4CA 5CC3A 2Z2AA 4GNJA 1ZCCA 3E0LA 2GL5A 2QF8A 4PR4A 2CW6A 1RJRA 3W1MA 5BYWA 2RJHA 1SFSA 4Y96A 2ATSA 2IPFA 1HP4A 3BSGA 1K3UA 4L9XA 1QPRA 1X8CA 2XU2A 4U31A 4ZO7A 3MPGA 1JXKA 3S2LA 2PAJA 4CNNA 1CLKA 1V0NA 3S2NA 4AW7A 1H11A 1V5XA 2BFGA 5CZJA 5D05A 4WDUA 3LRKA 1VFUA 3GG0A 4I7WA 2OU4A 2GPTA 4W7WA 2R94A 2YPIA 1BF2A 3R11A 1DL3A 1E9LA 4L80A 4H83A 1IWPA 4XIAA 3BW4A 1UR8A 1JD7A 4CQ9A 1TYGA 2OYKA 3CO8A 4IH3A 3UWWA 3DU0A 3B8IA 3TZFA 4P7RA 4KWUA 1OZQA 1TCMA 2PDKA 2I1OA 3N2CA 2VKZG 4F0KA 2VCCA 4R7JA 4H7ZA 2Y1HA 4FO4A 4LF1A 1TVNA 1W3KA 3V18A 1XSKA 1FWRA 2P10A 1NQKA 3A47A 3CZEA 2P53A 3PK7A 3UXIA 4FMVA 3ZOAA 3LERA 5RUBA 5CPMA 1DJXA 1XLMA 1A5UA 3WMLA 3STGA 1J0YA 3SECA 1MXSA 1KLYA 4DYJA 3GC5A 3T0DA 3F7JA 5LXXA 5AOUA 3LHTA 1JCLA 4YTSA 3CZKA 1TJ1A 3GDTA 2A3LA 2HZGA 4PTXA 3LTYA 2P0IA 3KUMA 5FACA 3E3HA 4MWAB 1S46A 1KBBA 3T07A 3GH7A 3UJ2A 2CLEA 1TWSA 1BQGA 1HIZA 1Z7AA 4WOQA 3FJ6A 4OZOA 3N34A 1DVJA 1YKWA 4IZGA 2C18A 3IJ7A 2J24A 3PF3A 3DGRA 3QOKA 1F5ZA 1PO9A 1CGYA 5F2GA 2E6YA 2AMGA 2PMQA 2VQUA 4UMBA 4PCNA 3WLIA 3H2EA 4IQEA 1FWTA 1W0MA 3PUOA 1T8QA 1J5SA 3WQOA 1UB3A 3M44A 1MEHA 2PWVA 4GIAA 3R0UA 1AA1B 3F5JA 3DH7A 4WY0B 4UC5A 3USBA 1AJ0A 2X09A 1V02E 5D9PA 4WDWA 1VENA 2PP0A 1EL3A 3WDPP 3WFLA 1XLCA 5M17A 4TOQA 3CM4A 1G67A 4J35A 1CBGA 3RR1A 4IWWA 1RZMA 3UXKA 1JCTA 4IIEA 5BXRA 1XCXA 2V5DA 4FSAA 3AIUA 2GGEA 3SCUA 3W6MA 4F2UA 1V0KA 1PJ9A 3WJYA 3NG3A 1RHCA 3W82A 3ES7A 2XWDA 4DBWA 2EJAA 1LROA 3IAQA 3AQUA 2QT3A 2PB1A 4IMEA 1B3VA 2GUUA 1CPUA 4C6BA 4PFHA 3HG2A 4DZ5A 1BHGA 3R8HA 1VF8A 2RKXA 3W2LA 1L2QA 1QJWA 2VC7A 2Z7GA 3VPLA 3VDCA 1VFOA 2DT0A 4M29A 4NUWA 2IKHA 3GFZA 1OG6A 4FF5A 4M5PA 2J13A 2X30A 1CLVA 2IW0A 4GX9A 3BSMA 3EEGA 4NIRA 3P3BA 2PTDA 3JZEA 4PRRA 5A2CA 3CJPA 2YCIX 4GWEA 4HK5A 2YLAA 2GQ9A 4PUJA 1SYTA 4DF1A 4WKHA 3FFSA 2BASA 4WOZA 3MMTA 3U7VA 3T42A 3DC8A 1J01A 5D03A 3QZ6A 2H3BA 3QEZA 2G3MA 3HTWA 1EHAA 4NU7A 3GSMA 2BSLA 4NZ3A 4C6EA 1KTCA 5HINA 3NGFA 1PKNA 1GJPA 2GZXA 5FF3A 3VIJA 4GYPA 4DAFA 2D0FA 3EWZA 3B8UA 3LQGA 3WNLA 2E28A 1UZ1A 4CQCA 1GQLA 2ONEA 1RPKA 2PDIA 3P8JA 4KEZA 3V0TA 3CHEA 3W7QA 3OTRA 2FFIA 1UR1A 4LH8A 5A95A 2IUZA 2ACUA 5T91A 3GZAA 3AIEA 4AD0A 4B9ZA 3BZGA 1S38A 1KXQA 4M8UA 3P62A 2P3EA 2QCHA 8CGTA 1P4CA 4NKCA 2W3ZA 3C3NA 4Q4KA 4JGDA 1BTMA 1QU4A 4ZBCA 5E0FA 1R87A 5FAJA 5M03A 1VR6A 3MS8A 4F66A 4ZODA 4XKMA 3WH6A 1VH7A 3L0KA 1Q13A 2Z7KA 1B3YA 1W54A 4QTGA 2PWDA 1U2YA 1CXEA 1LL6A 4MVAA 1VJIA 3REQB 3LGDA 1XQLA 1H2JA 3UP8A 2XDFA 1KBKA 3GR7A 1HX0A 4XZ9A 2Q8ZA 2X1IA 2FDMA 3PSWA 2TRSA 4A05A 4H19A 5A2BA 1UQYA 1EP1A 2NUYA 1QW9A 4UIOA 1JCJA 3AMKA 1ISYA 5D2VA 2WHMA 3ABSA 1XLBA 3BJFA 4FNTA 3U2ZA 3TC7A 4JQ3A 3MO7A 4Z2KA 1TCDA 2CHRA 4JEJA 5HNTA 3RUBL 3FJ4A 1D2KA 4GBUA 2FGZA 4B5WA 3PPCA 2WMJA 4A3HA 4L65A 4GQQA 4QG8A 3QH2A 4QHRA 3R7MA 1UJQA 3BV7A 1XBXA 2PC8A 4W88A 3RF9A 4GJIA 3AIWA 3P5ZA 1NWUA 3T1GA 4K7VA 3U8GA 1ZAJA 7REQB 5A6SA 2I56A 1EC8A 4HMCA 3TNOA 4ES4A 5FF7A 1AODA 3FCPA 1CGVA 3IUHA 3R25A 3AUOA 1GVQA 3G22A 5EFFA 1OFPA 3VNDA 4E4UA 4K6AA 4ZQRA 7ENLA 4REQB 3C8FA 1DWJM 1KCKA 3EOOA 4F0HA 3WK2A 5I79A 3R4IA 1CZ1A 4WY0F 2Z2UA 1EA0A 4JQ1A 2G3JA 1GVFA 2OGYA 3IK4A 3S1VA 4Q4PA 3UZXA 2C3ZA 3NZPA 3KWXA 1S2VA 1S1PA 4W7UA 4N9CA 1CCWB 3ARWA 3NPWA 3NEHA 3M0HA 3SN1A 1UG6A 2GUBA 3SFKA 1MW1A 3MSGA 5DELA 3VOGA 3NQ2A 4NJKA 3KZPA 1H1YA 4L4OA 4MDPA 4KRUA 4H6EA 3VILA 5ECVA 2D22A 4R33A 1DTUA 5FSEC 3BARA 2W91A 5KEZA 2DZVA 2Y70A 3AZRA 4P61A 4PULA 4J3SA 5D8WA 1EKOA 4WVXA 2I5IA 4A3QA 3NQVA 1FBAA 3TXZA 4S38A 1K8ZA 5DXXA 1EDTA 4AY1A 3G0XA 1KFJA 3NOEA 3OA5A 4I3GA 4DM1A 4PZVA 3O06A 3UWVA 3S9ZA 1ME9A 5LIKX 1BG4A 3LCLA 3OZPA 1BYBA 2IKJA 3M0JA 2YL6A 3L7RA 3DEQA 4LCQA 5KZDA 2NWSA 3SQMA 2YCKX 2PSNA 1DXEA 1OFRA 4ICCX 3HJZA 1R8LA 1XC6A 2J8TA 4E8DA 4S3DA 3J7HA 3I7QA 4RKAA 1A5MC 4QE4A 4I5XA 2NLIA 2AQWA 4Y7EA 4U2ZA 4FPSA 3E9AA 3EX1A 3TROA 1LLZA 4OT7A 3RILA 1B57A 4ORIA 2Z4GA 1LLWA 1K4GA 1LQAA 2YBVA 5DX7A 4LYPA 1WKFA 1YX1A 3P82A 2EPHA 3WF4A 4B5SA 5G5IA 4JCLA 5TBOA 1GYMA 3N2XA 1LM1A 3CBWA 1QNVA 4RDVA 1OFOA 2E40A 1IEWA 3QQ1A 3R5EA 3BOLA 1WZLA 3AMCA 1MEWA 3ZVHB 1I8JA 4IP5A 1XISA 1K02A 2DSZA 4XK2A 1Q4NX 4GX8A 4GJJA 1W1PA 2F7FA 5AB3A 1NDYA 1W56A 1H49A 1OFDA 5KZ6A 3SJNA 4FLOA 1R7AA 3VE7A 3WFZA 1X7IA 1UUOA 1OFBA 2TPSA 4D2JA 2Y8UA 3LTSA 4B5VA 4ZENA 4H4IA 4CQBA 3FDKA 5KMYA 1R6WA 3IIXA 3GYEA 1KA9F 1Y0EA 2ZUMA 3N3MA 1BKSA 3PJXA 1JXJA 4LALA 3OA3A 4IPNB 5FEZA 1F4HA 3PM6A 5E9XA 4MPQA 3BL3A 4L9YA 1J8VA 4C6IA 1T96A 4YYCA 2VFHA 2VX4A 4I9JA 3DYOA 3TMLA 3ELFA 3NZQA 1KB3A 5G2WA 2ZTJA 1A5CA 2O9RA 2GGJA 4N9DA 1DWIM 2CBUA 2D69A 4KIRA 1Z3NA 4CD8A 3KL0A 2VEMA 3USZA 2DSWA 2QV4A 1KM0A 2H9AA 4F0SA 4LAKA 3NM1A 4OWGA 3WJXA 4DXVA 2PLJA 3W81A 1OC6A 1PVNA 3LCFA 4QCFA 1DWFM 3QLDA 4JFVA 1PEZA 3E96A 3STEA 4CNUA 4J40A 2O92A 4J5NA 4P7NA 4DWSB 2VYOA 3QSTA 1XRVA 5LIUX 2VRJA 1WP6A 4M56A 3VUSA 3B4UA 1EBGA 2B7QA 3CQJA 4G7EB 1DIEA 3U57A 4W85A 1WB0A 1WKEA 4M24A 3U4AA 4K36A 3WNKA 2O9OA 3VCNA 4B5XA 1TREA 2HBVA 4P2VA 3ID7A 4I5RA 1ZAIA 1EJWC 4EP8C 3C4UA 1UMLA 4C6MA 4Y8FA 3L65A 2OSWA 1O7AA 3THUA 5G4HC 3KBMA 1EC9A 3DFPA 1JPMA 3H70A 4YWSA 2ZWYA 3VZZA 5MHBA 1VBGA 3DZ1A 5I06A 3W74A 1ZJAA 4PCFA 1GEHA 2G0WA 1O12A 3BDKA 1L6SA 1UP3A 4JDBA 1KC7A 1TV7A 3RJXA 2WKJA 3BLFA 1ZP4A 4GCAA 3LRMA 4FXJA 3M0LA 4CLMA 1HNYA 3B0YA 1P6BA 2Y85A 3NL2A 3PP7A 5CJ5A 1XD0A 3WF2A 4K1WA 3C8NA 1PIGA 4BEUA 3TN5A 3QGKC 4LAMA 2BB0A 4MLJA 1HZYA 1W2PA 2F84A 3MTWA 3KCJA 4JDYA 5DY3A 5C9UA 4JZ5A 3E0VA 4MFEA 2ZTKA 3NL3A 4IMAA 3VD3A 4F8XA 1TMLA 2JEQA 3F4WA 1MSSA 2C1GA 1DV7A 3TJXA 3NO3A 4YTQA 1XRFA 3VM7A 1CXFA 1V0MA 3I3EA 4DLFA 2PF8A 2R91A 4D1JA 4JTCA 1T7LA 3AXHA 4A8RA 4HIBA 1Q4WA 4PB3A 3BICA 1WUFA 3UCCA 4O16A 3FXGA 5I3KA 5CBJA 1FWAC 4I9MA 4IPPA 2X41A 5HMFA 4NJHA 3TH6A 1NY1A 1NDVA 3TX9A 1C8QA 2VZUA 4K68A 1VFFA 4XBJA 1W91A 3W2KA 5ABTA 5TAOA 3M64A 4XZLX 5CEWA 1TUFA 4ZFMA 3LI0A 5AECA 4HPHA 2XFWA 4R5EA 1HO1A 3GVQA 5DXYA 1EIXA 5D30A 3ZQ9A 4XBSA 1M7JA 3VIKA 1Y5WA 1TPH1 5D2YA 1P43A 3IV3A 2FQIA 4JQ2A 4IM4A 1N55A 1VD6A 1LTDA 3OEXA 4MKVA 4R9OA 3OLGA 3VK5A 1HL2A 4IMCA 3NYZA 3ITOA 2V6AA 1MEIA 4JFTA 3WH7A 6REQA 1KXVA 3HG5A 1HJWA 1BAGA 2V81A 3AZTA 4WX2A 4TTUA 2DVTA 3MJYA 1WQ5A 2GYIA 3PG9A 3UW6A 4QSFA 1XYFA 1J0ZA 5B80A 4MZ1A 5IRPA 4KS0A 1A3WA 3L5LA 1G69A 3ERPA 1IXQA 1TZ9A 1X97A 5GNXA 4CUCA 2ODOA 3SCSA 1FCQA 4WSKA 1VRXA 3RYSA 4YXGA 4L1GA 1E9YB 3MV01 3TQVA 3URBA 3ARQA 2REQA 2CBVA 4JN7A 4O54A 1Z8AA 4KH2A 3ZSSA 1FXPA 1OM0A 4DXXA 6ALDA 4JX4A 3TTOA 3TYCA 4GI9A 2C1IA 5I3IA 1XBVA 2NUWA 1O66A 4LUSA 3DERA 1I2OA 1E0WA 2EO7A 1KFWA 1TR9A 2D3NA 2P50A 4J3WA 2DUZA 3CV7A 4QJ4B 5U7SA 3NZGA 1ZB5A 2X7WA 1SZNA 4CQ8A 2WNWA 3EPMA 4PSPA 3CYVA 3QLLA 2X0YA 1FWFC 1U5HA 3OGVA 3IAPA 5A8NA 4P8UA 2CWXA 2A3CA 4E2OA 1YRRA 3GH4A 4X9YA 4Q8WA 3O63A 2XN0A 5HPOA 1GGOA 1E5NA 2CESA 2PWUA 4P7OA 1XLFA 5HQEA 3T9PA 5A1AA 4XV0A 1XPYA 2Z26A 1J10A 5H8PA 1WCGA 2CLPA 4AG0A 3AI0A 5DRIA 4MM1A 1UOKA 1B90A 2PPGA 3M7SA 3VFLA 3URNA 3CAVA 3VIHA 5I07A 5BW6A 1L0PA 3P84A 1LOLA 1O5QA 3KVJA 1VJZA 3OGRA 2WV8A 3URQA 3EB2A 3GY1A 1A80A 2GVJA 3B06A 4WJ8A 5GJNA 2XSBA 3VMNA 3WDJA 4BF7A 4LUJA 1ISWA 1J0JA 4XQ6A 1YXDA 2Z6IA 4AZ7A 2NQZA 2BODX 2WZHA 5DCDA 4O0QA 1EJVC 1U5JA 3QKZA 3R89A 4QS5A 4WZHA 2OCZA 4NYUA 4EXBA 2Q01A 1FA2A 3SQSA 1TWZA 4O1AA 2YCJA 2XGBA 1EWDA 1WBHA 1TPC1 3WJSA 2DJXA 2ZXAA 4KKXA 2PDNA 4LAOA 4PGLA 3RMJA 5CZ0A 1G4TA 1PDYA 3NPVA 3UZ5A 4EPBC 3G3DA 1JF5A 4LAUA 5FJIA 4BQ3A 4E4PA 5HQMA 3DN5A 2DQXA 5KSWA 3MWAA 3W26A 4D71A 1TVPA 4DM2A 3A4AA 3KRBA 1P7TB 3M16A 4LVDA 4GACA 2NQHA 3LTPA 4GISA 2V8ZA 4NRRA 3VI2A 3LD5A 1FCBA 2NX1A 3N14A 2HS8A 3V36A 1LQ0A 1TPVA 5HMSA 2P8BA 5D2XA 1JCXA 1ZZMA 1HJSA 1PCWA 3KLKA 3MJMA 4GVFA 3QHOA 4YVPA 1Y5XA 4JYEA 3S6OA 4HCLA 4W93A 4ASTA 1P6WA 3CWOX 5CSYA 3APTA 4D1IA 2Q71A 5D32A 2P3ZA 1KD0A 1L9WA 2I7GA 4Z1BA 3CIVA 5A6TC 2A6NA 2J9YA 3GDLA 2Y5JA 5LYRA 2DIEA 2PDMA 2C71A 1E6QM 1QNQA 4GBDA 1KKRA 4V1YA 5FCZA 2O56A 1OGBA 4XO7A 1H5VA 3NR0A 3LHYA 4GGHA 1EF2A 1ADDA 4TV5A 2HPMA 2E1WA 1A49A 2WMFA 3UXDA 3WQ8A 1R3RA 3YPIA 3SR7A 1OSEA 1TTQA 1Z9AA 4Q4SA 4OBRA 1VCFA 1M41A 1BSLA 5E0KA 3CLMA 5HWMA 1DHKA 4M6UA 3WH8A 5FL1A 3V1PA 4J1OA 2A6LA 1TG7A 3VO0A 4NX5A 1KFLA 2F61A 1NOFA 3NQ6A 1XLDA 3AXXA 1QNPA 4DF2A 4DO6A 4JY9A 2XFRA 3SY5A 3BGAA 4KIEA 1Z89A 3HO8A 2PCQA 1LRTA 4HPJA 3RXZA 3FHAA 3QXBA 4AZIA 2PDLA 3W1TA 4HSHA 2GSJA 1O68A 3CL6A 3B8DA 1BSIA 3RX2A 2PDFA 2CC0A 3OLIA 2V30A 1F6YA 3UGRA 3DG3A 3GVWA 1HJVA 1YQ2A 3NQEA 4IQLA 3SCNA 1LUCA 3F2DA 1YNQA 3EWBX 1E4IA 2W0UA 1UD6A 2X7VA 1JF6A 1GTEA 1D7FA 2NX9A 1J11A 4YL2A 3BUVA 4WXZA 2VUNA 4NF7A 3U7BA 1CYGA 4GUFA 3QV8A 5H2ZA 3TR9A 4IP4A 4F9DA 2J7GA 3NVDA 1I1WA 4J3UA 2PZ0A 5JBFA 2QJHA 1K6WA 4RNFA 4GXPA 2X2GA 4WUIA 1AZ1A 1BWKA 5EMJA 1ZUAX 2FKPA 4AZHA 4K39A 1R38A 3THAA 2DT3A 4IGSA 3BMXA 1NWSA 4NZFA 4LU0A 1R3WA 1WZMA 3T55A 1SW3A 2FZ8A 2DH3A 1DHPA 1ZENA 5CAKA 3NSMA 3WQGA 4LY8A 2V2DA 2B4GA 3G24A 2WJZA 2YDRA 1O5KA 3B9OA 2CZVA 3MDUA 4UOJA 3KBVA 3N6HA 1TFVA 3GTHA 4B4HA 1TPB1 3Q65A 1H7RA 1M9HA 1JJKA 2BDQA 3U6WA 4JTUA 3NO5A 4N9BA 6ENLA 4EX4A 2JE8A 3CO4A 3KOZA 3D0CA 3GVGA 1F8MA 3GW3A 4RPPA 4L4LA 1VBUA 2GWNA 3W1RA 2WMKA 1J2BA 1E6XM 3ZSTA 2A3BA 1UD3A 3TTYA 1NM9A 3W86A 4UQBA 3NXLA 1KCZA 1Q6QA 5FJUA 1J9YA 4RE2A 1AQFA 2WVSA 5HUPA 2H3DA 4JTQA 3P67A 4NASA 3UNTA 4HA4A 4W8BA 1I2RA 3ZT7A 1R7OA 3CUHA 1BYDA 5H91A 1RXOB 2OYMA 1IWBA 4MJ4A 1OFEA 2OQHA 4HNTA 5KZMA 4I6VA 2Y7DA 5AVNA 1MZHA 1ZGDA 1XDLA 1ZS2A 3OG3A 1SGJA 4EOUA 9CGTA 3UA3A 1JUKA 3VMOA 4KMQA 3KLLA 1LWHA 3PR2A 2A21A 5AC8A 1HG3A 4MSSA 5MKGB 1YNPA 1CB7B 3QGVA 4LBRA 2A3AA 1JULA 1UP2A 3SQLA 3VIMA 2ZWZA 1X1ZA 4PMOA 4AZ5A 3GXFA 4MY9A 1GTHA 4O12A 2R1MA 5FEWA 5D9OA 5BWAA 3AAMA 3N3TA 3EZ4A 4QRNA 3UEQA 2ALRA 2WSQA 1GONA 3W02A 4AIEA 3OJGA 4AUBA 3EOUA 2A7PA 2G97A 3PBUA 2TAAA 4PC8A 1EJSC 4M1RA 3BLPX 3MHFA 4FOKA 3CUZA 2Y8VA 1KFBA 1E15A 2CZ5A 3I4KA 1HKMA 1WDDA 4H9MA 2G8ZA 4HVXA 4FNSA 3BLDA 3WQDA 1Y7VA 3WBYA 2J79A 1XW8A 4KRZA 5DBUA 3LX9A 4O13A 1N8FA 2HJPA 1E51A 3D3AA 3LCGA 3GHRA 4ZEPA 3N4EA 4LVFA 2OZTA 1A4MA 1Y8BA 1OB0A 5CH9A 2QF7A 1ODZA 2WKGA 3NIYA 2WO5A 3AYVA 4NI3A 5GNYA 3RO8A 3RM9A 4JPGA 2XVLA 3AICA 3IIPA 2ZDSA 4ZQNA 2INZA 1W9DM 1GOXA 4XAFA 2W92A 1FP8A 4LV4A 4KWOA 2ADAA 1L6GA 1LT7A 4JKKA 3WD4A 3UG8A 1FTXA 1NTHA 3VDHA 1GZGA 3KEHA 1PZ3A 4EIVA 1BEUA 3ATYA 1YMYA 2VFIA 1NU5A 1QO2A 3AS0A 4JAWA 1VHCA 4NSBA 5GNZA 4EAMA 2XVNA 4WF7A 2X16A 2FZMA 1GUVA 3RR4A 1UKPA 4D6GA 5CG7A 4GYJA 4IXXA 3U9IA 2I9EA 1UWQA 1IT7A 4YHGA 1XBZA 3DFQA 3UU0A 1HTIA 1GT8A 1WZKA 3VM5A 4PMUA 1VEMA 1QBAA 3HGSA 4RX0A 2J7EA 5KZEA 2WQPA 5FJRA 2X2YA 4HZ7A 1Q66A 3AS1A 4NRSA 1IGWA 4IPLA 4R27A 2HTMA 3NAVA 2PODA 4OIFA 2GQAA 3M0IA 1GKRA 3RHGA 1QOPA 4A35A 3MA8A 3WLPA 3GR8A 4L6DA 1FDYA 1GOKA 4AH7A 5I24A 1A50A 1ECQA 1OD0A 1BVNP 2ASHA 1JYVA 4YIWA 3K8MA 1H7PA 6XIAA 4O19A 4L64A 2WLZA 2E09A 3P2VA 3B0VC 3M4HA 3IJ6A 1MMFA 2ZX7A 1TQJA 3NSNA 4GYKA 5EB8A 3LV6A 1HL8A 3WLLA 1F6KA 5CJNA 2HVOA 1HL9A 3VNKA 1Q7ZA 2Y61A 3ES8A 5BCAA 1YIXA 4UOQA 2F38A 2KX9A 3GXPA 2DZAA 4FX7A 1XLEA 4RZ6A 3IVSA 3TMQA 3W7OA 1U83A 1BD0A 2PWGA 8XIAA 3WQPA 5HQLA 4WSJA 5JH2A 1RP8A 1A5SA 1JNEA 3CK5A 2OTDA 1F2JA 2J9XA 2V3FA 3FEQA 3RRXA 1TPWA 1VFLA 3EOLA 4BS0A 1XIEA 1XIDA 3JZUA 2WJEA 3I10A 3FV9A 2HMCA 2AGTA 4MB5A 4D8ZA 2OZ0A 1AW1A 2J77A 3A21A 4FOUA 2FZNA 3H55A 3NURA 4K2SA 4BEQA 2PTXA 4MWAD 1F3WA 1AVAA 4I5UA 2VC5A 1J4EA 4XB3A 5K9XA 4KESA 2NXHA 3W7GA 5AVHA 3HQPA 3JVAA 6TAAA 2EPNA 4GY1A 3RPDA 3DI0A 1OABA 1ZP3A 4QGCA 1FWGC 3GVRA 1SO4A 2GJXB 3GG1A 4OV4A 1XSIA 3M5YA 3CQIA 1OCBA 2C16A 4GQ0A 4J9JA 3W1NA 2PDQA 3A3HA 3A13A 2OYLA 3NJ3A 4HK7A 2BBFA 2B0MA 2J7FA 1Q6CA 2VT0A 5EMKA 1P1XA 4X9SA 4GXMA 4HHLA 3VU2A 2ZC1A 3EDKA 5CPTA 2VTFA 5D37A 4ML4A 2H90A 3QJAA 3WH5A 1CT5A 5AYZA 3WQVA 3HFTA 3LYEA 3VAVA 1ZCOA 2PS2A 2KAUC 3W37A 3TONA 3BQ5A 1UJPA 2CERA 3FDGA 4Q7NA 3TU9A 1TE1A 2CPUA 3L0NA 3N9RA 4AWSA 4YTUA 1C93A 3I4EA 3QYQA 4O57A 2W9MA 3ZLFA 5XIMA 4IGMA 1UC5A 3MZNA 4G1KA 4AIBA 3NQFA 2J7HA 3VCRA 3KRUA 3BJSA 1I0BA 3LXBA 5T26A 3A12A 5ABHA 2Y5SA 5EA9A 2VZVA 3NVTA 3BLIA 3RX3A 5HOSA 1YTEA 1NIUA 3LZ3A 1DIOA 2CYGA 2OT0A 1F3XA 1F9CA 3KOYA 4NX0A 1QUMA 1GORA 1YPIA 2Z2BA 1EXPA 1K1DA 4Y90A 1TUXA 1HT6A 5E6ZA 4HB7A 5BRQA 2FHBA 2J6XA 3LXAA 4MZ8A 1V3HA 1RQHA 4XBKA 3WDRA 5DQPA 4JHMA 4TO8A 3IEBA 1KGWA 2QGHA 4ZOEA 2WKLA 3SIMA 4HSNA 4DBUA 4O18A 1TA3A 3C2VA 4EE9A 4FHAA 4A6GA 1KTBA 1EEPA 2BLEA 2BP1A 4J27A 1EOMA 1VYRA 1BTCA 3MKVA 4H6KA 1S2AA 3G8EA 3CHDA 3CLWA 3LUTA 4PUWA 2F8QA 1EXBA 3WO8A 3IJLA 1EB3A 2J7BA 3JW7A 3UESA 3HPXA 5HNUA 2IPJA 3TTSA 4C7FA 3LCWA 3N29A 3QMTA 3OBAA 2HWGA 3WUBA 3HGOA 2ZA2A 5JXQA 2Z1BA 4C5ZA 4UMCA 1CLXA 1C7TA 2YDSA 3DIPA 3VZYA 4O17A 4QDMA 1TWIA 1O1HA 4IQJA 2PC4A 1A5AA 3KOFA 5I00A 2VFGA 3C61A 3QOMA 1TTIA 3R2GA 2DP3A 1G4EA 4YHEA 3W1UA 1JZ8A 2PP1A 5AYBA 1NF7A 3BW3A 3MUCA 3VD9A 5EBAA 4O11A 4CQDA 4A8NA 1A0CA 5M3WA 3SN0A 3SEPA 3C56A 3LCXA 5K3VA 2C79A 3BCFA 4PL2A 4O0ZA 3FOKA 3S1WA 3S46A 1TIWA 2Z24A 2WCAA 4UB9A 2FGLA 3BSHA 3H12A 2X8RA 4IXHA 1UP0A 1PZ2A 5FF0A 3T0BA 4GUIA 2FMOA 2DZXA 5EL1A 3WNMA 1J12A 1JQXA 4GI8A 3B0PA 3CQKA 1U1JA 2ZRYA 3EWUA 2WYSA 1W3TA 3ZS4A 2CLLA 2Z1KA 2WW5A 4UTTA 3W88A 3P5YA 4DRSA 4KERA 4WXYA 1OYBA 3SBFA 4LUTB 1PL9A 2ZUUA 4BQ4A 2GK1A 4YPJA 5XIAA 5HULA 1W8GA 1Z44A 2W62A 3MP4A 4TMCA 4W87A 4BI5A 3WLQA 1UMYA 4JS3A 1PWMA 3K8LA 1J0IA 2PRLA 2WVTA 2EG6A 1CGWA 1JNDA 4F9JA 1SR0A 2PBOA 2YYUA 3W2UA 4JTGA 2W66A 2FB2A 1L6YA 3UG3A 2ANUA 1ZNNA 1GW1A 2E9MA 3GM8A 4CU6A 1KBLA 2Z1XA 3GTNA 4HU4A 3CQHA 2DEPA 4UQ9A 1MW0A 5JUVA 1RD5A 4Z1CA 1S5VA 2XWEA 4HMDA 4AIUA 2OB3A 3ZWTA 1W1TA 3OQEA 2ZRZA 2OXNA 1JDDA 3AU6A 4KBXA 5U4NA 1UR4A 2ACRA 2OVLA 2WNNA 1S2UA 4DI8A 4XZHA 5I3DA 2HEJA 4F0RA 2QJMA 3CHVA 3OVPA 5D2WA 4ERAA 1IT8A 3G1SA 4MWAC 4UTFA 2PDPA 2BWGA 1E1EA 4WKAA 2Q8XA 1LL4A 1D8CA 4MB3A 5BXTA 2DW7A 5FESA 3RFAA 1HGYA 1WOBA 4FZIA 3W22A 4PUDA 3WLRA 1YXYA 4HYVA 3MHUA 3S8HA 2C91A 1W1B1 3W75A 1YDVA 3ZMRA 3ARUA 3TW9A 1T0OA 4FNRA 4DBEA 2EBNA 4G7FA 4B5NA 1ZBKA 3IV8A 2TYSA 5CC6A 3SW6A 4H8HA 4FB7A 1L8PA 5HNNA 3WBWA 2IPGA 4FNUA 3AISA 4MNJA 3V1HA 3TTEA 1P5BA 1LUCB 1LRQA 4UWMA 1XH0A 3UCQA 1W5NA 3U5UA 2PEVA 4IF2A 3E2QA 3MKKA 1N2VA 1V51A 5CGMA 2PD9A 2JIWA 1EZWA 5FEPA 9XIMA 2NV9A 3MZ2A 1HW6A 2FYMA 2ZUVA 3KFTA 5K4XA 3GDMA 1RD6A 2DU2A 1CGTA 2FIQA 4H7CA 1UPMB 3TP4A 2GQ3A 4ZO8A 4C91A 4PTDA 4PSRA 5DMNA 3VUPA 4BKNA 1JEZA 3MUY1 3HFYA 2YXXA 1WKYA 3ITGA 4OTKA 1JD9A 5HMEA 3TYUA 1ADSA 2D73A 3ECQA 2ICSA 1E6PA 2FZDA 1DKWA 4V28A 2H8ZA 3U4FA 2HCVA 2O4QA 1LL7A 3NQCA 1E1CA 3UYCA 2J7CA 2WXDM 4NILA 1DJGA 3R8GA 1VBHA 3G8RA 4KT2A 3WQFA 1A3XA 1XLLA 1M01A 2YZ5A 4L61A 3KTSA 5FF4A 1AD1A 3ARPA 3W2NA 5HDRA 1VYPX 1YDNA 2VHLA 4LSBA 3COTA 1V77A 4JIRA 1GHRA 1OIFA 4CNTA 1XYAA 1RQBA 2V5CA 2A0NA 3SO7A 1U22A 4UFJA 2ZCGA 4IFOA 4LB3A 4E8CA 1XYBA 2PBGA 4DO7A 1JZ3A 4FX6M 3CAWA 2J7DA 1JQVA 5A6MA 3UFYA 1ELSA 2H8XA 3IIZA 1BWLA 1R9YA 4PA8A 2CCRA 4UBPC 2YW3A 4TU1A 3BLKA 3W85A 4DHGA 3OZYA 4ADUA 2R82A 1S5NA 2WK2A 3UPMA 4IIFA 1HJUA 3PS7A 2YBTA 3W7LA 2HRWA 4C65A 1GOMA 2WC4A 4YYFA 2RHGA 3RO6A 3KBWA 1C90A 1YTDA 2YCEA 1EHNA 3W2JA 5EPDA 1IEQA 4R7WA 1FRBA 2VGGA 2BX7A 1NOWA 5LNSA 3CS2A 1C29A 1XFCA 3NZRA 1AW2A 1ZBVA 1SMDA 3WELA 1VFTA 4PMQA 4NI8A 3FYPA 1G4SA 4EPKA 3CXOA 1DJWA 4LS2A 1NFPA 2YXGA 4QEHA 3GS6A 1XV8A 4B15A 2EPKX 1KW1A 1J96A 4XD4A 4QG6A 2C13A 4KGJA 5C9XA 5CAHA 3T40A 1S39A 2A79A 4PMVA 4K8HA 2PP3A 3LBMA 2OLHA 3R6IA 4Z2GA 3R0DA 4TX8A 1K4HA 1J0HA 5BNKA 3W7NA 3W00A 1ICQA 3L68A 3CASA 3G2GA 1EF3A 2FZBA 2WZIA 1QI4A 2QDEA 2I9UA 1VBRA 3CUXA 3UJEA 4C6OA 2GVYA 2NSXA 2VP8A 4Q32A 1EGZA 4MADA 1EPXA 3GXMA 3PAJA 5K7JA 4ECLA 1TPDA 4C6JA 4UXDA 4QJ1A 2O7SA 1OX4B 4RZ5A 4LPCA 2ZRVA 3AUJA 1DE6A 1TRDA 3DHFA 1X38A 2JALA 2ZZ6A 2HPIA 5IXEA 4MMWA 1T99A 2J47A 3ZR4A 3RGTA 3MV11 3UD6A 1TPFA 4ZCWA 4JOMA 4LQ1A 1XXXA 1MQRA 1XINA 2QPUA 3CWNA 4IJBA 3W3OA 5C6MA 1IZKA 1YADA 1A5NC 2EPLX 3DBPA 3SY1A 7TAAA 7XIMA 1IQ8A 3CZJA 4RNHA 2V82A 3NYDA 1TV3A 1BVWA 3RCMA 1XYCA 1ZU8A 4Y9PA 2VGFA 3CHFA 3TOYA 1KWGA 1X6NA 3LPPA 4J28A 3FJNA 4PTNA 2VEKA 1GYNA 3M0VA 2Y4SA 2DV0A 5LIWX 4LGXA 1LCOA 2BOEX 4E8GA 3ONCA 3CMFA 4H9TA 3O6AA 2D0HA 3MUAA 4D9PA 4ZOAA 1J18A 2AAAA 4AVOA 2OKTA 4H3DA 3UZYA 3BG3A 3ABZA 3MCMA 4DUXA 3DFNA 3PWIA 3KVMA 3H7UA 4RPQA 4ZQCA 3P74A 2VDGA 2G41A 2BHZA 4LVGA 5JBDA 4HMEA 3VIFA 5KINA 1PDZA 4KQNA 5I3HA 3RPMA 1J2WA 1BRLA 1N82A 3KAOA 1TWWA 4QE1A 4AMAA 1AD4A 5ECUA 1JDFA 3EXSA 4MWAA 3WNOA 3SGUA 3BW2A 3TOPA 3CAQA 1ISZA 1MO0A 3CZLA 4LNYA 5IBXA 2RGLA 4FOJA 3CEUA 3EBVA 4MJMA 2Z28A 1W31A 4GYPC 1QOXA 3VX1A 1FFQA 4CU8A 2Q09A 4WJEA 5TD4A 3TUUA 3QPYA 3LN3A 2CETA 4X3ZA 2VC9A 3T81A 1UZDA 1MUWA 2FTPA 3LNPA 2NT0A 4CGTA 3S6DA 3W6LA 1RQEA 4CN6A 3GHSA 4UTUA 4AF0B 2DIKA 2VM8A 2B7NA 4QSHA 5I2UA 3A3XA 4JXCA 5LHFA 1SO5A 2WNZA 4YS1A 3HG4A 5FJOA 4JD4A 1GW9A 3S2JA 2P76A 1WDRA 4FXRA 2EGZA 5CSSA 4DJEC 4A4AA 1K7FA 3GTXA 4BQ2A 4S2CA 5BMXA 3EGJA 4HU8A 3Q67A 3AC0A 4AVFA 3PJUA 1OIMA 4H00A 1XKYA 2INEA 3K46A 3OZOA 1OBAA 1Q85A 2O4MA 3EWDA 3UWEA 1E5JA 1PV8A 2WC7A 2XG9A 3LNMA 4FXSA 4PMXA 3BG5A 1V03A 4AEOA 3PTKA 1B9BA 5A6BA 2BZNA 5M1TA 4V33A 3NUKA 1L6FA 2DPEA 1H7OA 3IGXA 4UFKA 4LWWA 2X1RA 4FS9A 2EXOA 1Q3NA 1OX6A 2Z29A 2EG8A 2ISSA 3NGJA 1MRAA 1RK5A 1J0KA 2VR5A 4BWLA 2FPVA 4XAGA 4EK7A 3E12A 3STPA 4GK8A 3EPOA 3MY9A 1AZ2A 3UXLA 4MPKA 2GWGA 4REQA 1YNYA 2DZWA 3LOTA 4EWND 5HWNA 4DWDA 5BROA 1KCXA 3VX0A 4IGNA 4HSOA 1P0KA 4J3XA 2XJ7A 3U48A 3VOCA 4S3FA 4NZ5A 2QDGA 4Q8OA 3U0HA 5B7YA 3L67A 2EKGA 3NFUA 8TIMA 1FP9A 4WCJA 3EB4A 3CL7A 3DECA 3U2EA 3TZNA 5C7HA 4OVXA 4O14A 1E6NA 1SQ7A 4QLJA 4PB4A 4XD3A 3HIJA 4ZZ9A 5IFPA 1KXTA 2NX3A 3GK0A 4J4KA 3B9AA 1E4NA 1XIJA 1JZ2A 1CGXA 1SFJA 1V6TA 4UCFA 3TR2A 2E9BA 1XJBA 1W6TA 4HZ6A 1V8EA 3SN4A 1PWLA 1GVYA 3CMJA 1FX6A 3TA9A 1U1HA 4ACZA 1GYLA 4F3HA 1XIHA 5CGQA 3LM7A 3W76A 4JFUA 4NXKA 3UJFA 4QX4A 1S3HA 2A4AA 1UUQA 3QR3A 4M19A 1H51A 1P0NA 4N42A 4IL0A 4QAIA 1FVPA 3W7MA 4BHYA 1Z41A 3UQNA 3CH9A 2I5GA 4BI7A 3C3UA 3OHMB 2WLYA 2HK1A 4PMDA 3G1YA 2XSXA 3EDFA 1KM6A 2PI6A 3SFWA 3CPUA 4D6FA 4W86A 3WK3A 3KOXA 1JPHA 2Y2WA 3ANYA 2NXIA 3EA3A 4JIHA 4DPPA 1OT1A 4ERIA 4Z1DA 1UBSA 1F07A 3A4WA 4AD3A 3M6DA 3AFBA 3GHTA 1KQYA 1PTGA 2ZVRA 2IXVA 3S5OA 1Z48A 1W1A1 1I2NA 4JX5A 5LZLA 4ROPA 3KZSA 3FLUA 1KWKA 3BGGA 3OGSA 5CKSA 4XZBA 3BGJA 2QIIA 2E5BA 3D6NA 3W23A 1VYSX 4ZQPA 3C2EA 1Q6DA 1EP3A 1NQ6A 2O7QA 2WZEA 4O53A 2JEPA 3T05A 1GOQA 3OOQA 3EKGA 4L6OA 4P8VA 4PMZA 7A3HA 3ARTA 2PDHA 3D3FA 2DT1A 3OQ8A 3H2NA 1H09A 1ICPA 4S3KA 4I8DA 1XGZA 1RK6A 3F2BA 1V0LA 3DDMA 6A3HA 3EMQA 4XKYA 3TLQA 3IGSA 4DJDC 5I6SA 2XZ9A 4U3AA 1YE4A 1FWIC 2INFA 1PYFA 3SSJA 3ORWA 1R2TA 2Y0FA 2NUXA 1U5VA 1E3XA 4GI6A 2BV9A 3CU2A 2F2HA 4B16A 1ENUA 3LPFA 3RU6A 1OWQA 1W3LA 3QHMA 4RV3A 2PDXA 2J25A 3WSUA 4LRSA 3OVRA 2AL2B 4HGXA 2WHKA 3II1A 4TTGA 1PX4A 5D4YA 3BCDA 2ZUTA 1EYWA 4QM1A 4S3AA 1DQWA 5CPLA 4XAYA 2E4TA 3LGEA 4D6JA 1KTNA 4H8VA 3KRZA 3S3GA 3GNPA 1GVSA 5I3FA 4Q8PA 3TTQA 4UTWA 3QRHA 2G3IA 2VCAA 3I6EA 3B0UX 3RCYA 1EJRC 1IZJA 3BMVA 2G3NA 3M0XA 2YBUA 2XVKA 2ZUWA 2X42A 1ITQA 4HA0A 3E2RA 5H6HA 3W7RA 1XX1A 3S1GA 1B3WA 3OP2A 3A5FA 5DCEA 3IRSA 2QCNA 1U30A 4JFSA 5IBXC 3SRDA 3S9IA 1JZ4A 1PYMA 2X1UA 4GOAA 5LA0A 3C0JA 1H7WA 3L2LA 3N04A 4W89A 1QW8A 1R3VA 1E0UA 4J3ZA 4GUHA 3WL0A 4G1NA 2R1PA 3WQ4A 4LX4A 3PBYA 3W7PA 2Z6JA 3C6CA 1B30A 2WJDA 3VD5A 3ITCA 3DFYA 3PPHA 5AHIA 1ISVA 4AX7A 4QISA 3RK8A 4Q7BA 1BVZA 1F05A 5BRPA 4ALDA 4UTTC 2ZFAA 3GXDA 2VR2A 1ZQ5A 3KTCA 1NARA 2GOKA 2X0HA 2ZUSA 3MVTA 4CKQA 4YLWA 3W28A 4BR1A 6PTDA 2EPOA 1GOWA 1V93A 1SPQA 4DJEA 2OSXA 5HJXA 4JCMA 3K1GA 2DH2A 4IJCA 4LS1A 3IVUA 1CX9A 2DSVA 4G5DA 4JTJA 1RAKA 4ACYA 3EOSA 3E49A 5E93A 1CW2A 1A5OC 3PNZA 4FF7A 3S2MA 1DQUA 4GZ7A 3CUJA 4ZTYA 3VA8A 2OOGA 4EF8A 2OKOA 4JTHA 4HPXA 2BS9A 1BYCA 4PUKA 2VDIA 4O10A 1N8IA 3PZNA 1FHLA 4Q7IA 2DT2A 5AY7A 3T7VA 2E6DA 2B81A 3DOPA 1EGMA 4O1BA 2JBMA 2Y7GA 4D6EA 4Z17A 4OHQA 2VGBA 2C6QA 3PZ9A 1RALA 5F4WA 3SIZA 3N12A 4WGXA 2PTYA 3STFA 1ZJIA 4XIMA 3LPOA 3BZJA 5C54A 4XAPA 3DESA 4PH6A 1AJZA 1UWIA 2XGZA 3W7IA 1FWNA 1TX2A 3FY1A 2OELA 2Y7EA 3M46A 1MWOA 1W9VA 3SJ3A 2O55A 4HNLA 2XPKA 3MUZ1 3WF3A 3LM3A 1GOOA 4DYKA 4NZCA 1VKFA 3VDBA 1CGUA 3L9CA 1UA3A 4IG2A 4Q6JA 1NP2A 3FGCB 3VOHA 2XZ7A 2PFHA 3PZMA 3ENLA 4ENLA 5CJMA 2O9PA 1MUCA 5LNUA 1LP6A 5I78A 2XFYA 3AWOA 3KW3A 3ZVIA 4DUOA 2WOQA 3A9BA 1JDCA 4GNVA 2RDXA 1DQXA 3V3WA 4NNAA 3ARYA 3G1XA 2Q6ZA 2BY1A 4FP1A 1KRMA 1YHTA 2ZX6A 2ACSA 4AZCA 4ADTA 1XD1A 3KHDA 4MLRA 4KCTA 3M0MA 3W71A 2GGIA 5A6BD 4B4FA 5I3JA 2E3ZA 3EB3A 4AC7C 2XGIA 2WZMA 1I4NA 3W7CA 1UKTA 4EACA 4ZXLA 1AW5A 1Q63A 2FJUB 2AGKA 5FJTA 3N9KA 4YJ5A 2PDJA 3W27A 1KV5A 5DT7A 4ICNA 1W37A 1AMYA 1QI0A 4KWSA