2BOPA

Crystal structure at 1.7 angstroms of the bovine papillomavirus-1 e2 dna-binding domain bound to its dna target
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*CP*GP*AP*CP*GP*TP*CP*GP*GP*TP*CP*G
publication title Crystal structure at 1.7 A of the bovine papillomavirus-1 E2 DNA-binding domain bound to its DNA target.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Transcription/dna
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1994-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bopA00
4TLQA 1FHTA 2AYEA 2EVZA 1Q82T 2DNQA 1KQSR 5BJRA 2CQBA 2OIHA 3CTRA 1FXLA 2UP1A 3VAMA 2N7CA 3I56S 3BEGB 2J8AA 1WF0A 3FEXB 2DITA 5DETA 2MQPA 2CPYA 2CPZA 2OJ3A 1PGZA 3US5A 1D9AA 2MZRA 5IFMA 2GO9A 2XSFA 2U1AA 1N54B 3G96A 1HL6A 2XS7A 5MLCV 1L3KA 2LMIA 1DHMA 5GMKa 2VONA 4QU6A 2DNYA 4W92B 1QVGR 1JJ4A 3NNCA 4U67Q 2KVIA 3S6EA 1X4AA 2OTJS 1VQOS 1YJ9S 2MQNA 3CCSS 2RS2A 2LQ5A 3VAFA 2MHNA 2M88A 3UE2A 1FJEB 3FEYB 4ZKAA 2MMYA 4IUFA 2M52A 3S7RA 3VF0B 2CPHA 2HGNA 2MQOA 3DLLQ 2CQ3A 2RRAA 2RQCA 4V19X 4CH0S 2MZTA 3G4SS 4UY8T 1DZ5A 1X4BA 1U1NA 1U1LA 2NLWA 2DNRA 1U1PA 3HHNB 2KYXA 2LA4A 2LEAA 1R8HA 1K73T 1X4EA 2CQ1A 2DISA 2HGLA 2HGMA 4WIIA 2LECA 2G4BA 5IM0A 3CCLS 4RU2A 3DXBA 2PEHA 1VQ7S 3N9UC 1S79A 3VAHA 2DIVA 4IOAQ 2LXIA 4LMZA 4P6QA 2KHCA 3G6ES 4TU9A 2X1GA 1SXLA 1R8PA 1VC5A 4WKRA 2L08A 2L9WA 2KN4A 2JWNA 4WFBQ 4BS2A 2KT5A 2CQ4A 2CPJA 1M1KT 4PKDB 4TU8A 3JB9k 2QA4S 5H1SV 2DGQA 2MKHA 4UQTA 2RS8A 1RKJA 1WHXA 2MKIA 3I55S 2I38A 1QVFR 1D8ZA 2MZJA 4J5OA 4F25A 2RRBA 3SDEA 1OPIA 2MKSA 2PE8A 1M90T 2JRSA 5GAEU 2HYIB 1G2EA 2DH7A 2MZ1A 2JVRA 1S72S 3P5TL 2DGXA 3MD3A 4Z2XA 2HZCA 3IWNC 3CC7S 2KI2A 3NNAA 2B0GA 2KM8C 1XN9A 3RW7A 2RQ4A 2YTCA 1VQ4S 3P49B 2V94A 1VQ8S 3CMES 2KXNB 2X1AA 5HL7Q 1UAWA 2E5JA 1U1MA 2CQ0A 3NNHA 3S8SA 2MJNA 2ZJPQ 1M5VC 3TO8A 5CYJA 1X5TA 3D2WA 4OZ0A 2CQGA 2EK1A 4QPTA 3Q2SC 5DM7Q 1YIJS 2E5GA 4WF9Q 1WG4A 2F9JA 3J7ZT 2QEXS 1P27B 2RNEA 1VC0A 2DGTA 1W2BR 2LKZA 3R1LA 2J0SD 1WF1A 3HI9A 1VBYA 3ULHA 4F02A 2ADBA 3U1MA 4OZ1A 1X5OA 1HD0A 3CMAS 1UP1A 4LIRA 2JVOA 3THPA 4EGLA 1WI8A 2CQCA 2MY8A 2M0GB 2X1BA 2KFYA 3H2VE 1H2UX 2DNLA 2XNQA 3MURP 1H2TZ 2Q79A 3BS9A 4TU7A 2HVZA 3MDFA 5ITHA 5DM6Q 1WHWA 1VBXA 2FPHX 1VC6A 1UFWA 5EN1A 3CC4S 3B4DA 2DGWA 4A8XA 5LXYA 1KC8T 2MYFA 2DNGA 3NS6A 1WWHA 4WCEQ 3EGZA 2F3JA 1ZZNA 2A3JA 3OW2R 1URNA 5LJ5Y 2CQIA 2E5HA 3UCZP 2MY7A 5DDOC 2DNHA 2D9OA 2DHAA 3CPWR 1OO0B 2YH1A 1ZZFA 3LQVA 1Q86T 1NJIT 5CXTA 3B4MA 2XS5A 5LSOA 2KM8B 1U6BA 2K8GA 3MUTP 2LEBA 3BO3A 1WELA 2M9KA 1X5SA 3EX7B 1X5PA 2L41A 3UD4P 2ADCA 3CC2S 2O3DA 3UCUP 2DNKA 1YI2S 2KXFA 3CCQS 1U1RA 1H6KX 1N88A 3MI7X 4YOEA 5D78A 3G8TA 2FC9A 2KG0A 4YUDA 2DH9A 1OWXA 2MJUA 3R1HA 1VQLS 4Y00A 2DGOA 1X4FA 2FHOB 1VQPS 2CPFA 4FXWA 4IOCQ 3THTA 2ERRA 4IO9Q 2E44A 5HO4A 2CPEA 5GAGU 2RU3A 2MKJA 1SJ4P 3VAIA 2EK6A 3CUNA 1U1KA 3BO2A 2AYMA 1VQ5S 1Q81T 5CA5A 2AD9A 1WG5A 2MB0B 1N8RT 2DNPA 2CPDA 2CQPA 3CXCR 1ZH5A 1NO8A 1U1OA 2WBRA 2CQDA 1KOOA 2DGVA 2N3OA 2DO4A 5GAHU 2M8HA 3R27A 2VOOA 2MPUA 3MXHP 3TYTA 2MKCA 1O0PA 1WEXA 4YB1P 3Q2TC 2XNRA 1JMTA 1U1QA 4Y0FA 1VQ6S 1X0FA 2D3OR 2CPIA 3MUMP 2J76E 3PIOQ 1YTYA 2KG1A 4WFAQ 2XB2D 4PR6A 1FJ7A 2G0CA 2NZ4A 3CCES 1VQNS 1K9MT 2LYVA 2M4MA 4PRFA 2N3LA 1M5OC 1B7FA 2GHPA 3CCMS 5GADU 2DB1A 2G1DA 4QQBA 2DGSA 2MQMA 1WTBA 2KH9A 1BY9A 1YHQS 1YWXA 3TP2A 2OSRA 1HA1A 4WFNQ 3NMRA 4C4WA 3UCGA 4CH1A 2MGZB 2LCWA 4C0OC 2DGUA 2KXHA 2MZQA 3CCUS 2FC8A 1X4CA 1WG1A 2KRRA 2MQQA 2AYBA 2DNOA 5DDQC 3VAGA 1FO1A 1H2VZ 3LPYA 2RT3A 2LA6A 1VQMS 4CQ1A 3S01A 5IM0B 2MSTA 1WI6A 3VALA 5JVGQ 1WEZA 1N52B 3CD6S 2FY1A 3UD3P 3ZZYA 5DDPC 3G71S 3UWTA 5IQQA 2X1FA 1SJFA 4W90B 3J7YU 2M8DB 1WEYA 1RK8A 1UW4A 2RVJA 3V4MA 1VBZA 1QM9A 2M7SA 4ED5A 2KU7A 3MD1A 2JX2A 1DRZA 4LJMA 3P3DA 2MSSA 1FNXH 5GVQA 1X4GA 1FJCA 2RUGA 1YJNS 1YJWS 2BZ2A 2BOPA 1FT8A 2MGZA 2M2BA 2AYGA 3SDEB 1SJ3P 3IRWP 1WHYA 3SMZA 3MUVP 2ZJRQ 1YITS 5LSLA 2I2YA 2LXUA 3G9CA 3P6YC 2CJKA 1AUDA 3BO4A 2CQ2A 2OTLS 2MXYA 2OSQA 1X4DA 1VQ9S 1A9NB 1KOHA 4ERDA 2KRBA 1PO6A 3L3CA 5FJ4A 2DHGA 2VOPA 3H2UB 1A7GE 1SJRA 4C7QA 4QU7A 3G8SA 2MKKA 2J0QD 5D77A 2U2FA 1WF2A 2QFJA 1JJHA 3CF5Q 1HD1A 2YWKA 3CCVS 5LJ3Y 2D9PA 3VAKA 2DH8A 1X4HA 1SJQA 2YH0A 2VODA 3ZZZA 3CCJS 3U1LA 5DDRC 1IQTA 2DNNA 2MQLA 2DHSA 3CULA 1OIAA 2DO0A 2SXLA 1M5KC 1F9FA 3CCRS 3VAJA 3RW6A 2MZSA 4CIOA 5JVHQ 1M5PC 1U6FA 2F9DA 2XS2A 3K0JA 1VQKS 3MOJB 4M5DB 1Q7YT 1NU4A 1P1TA 3SXLA 2DK2A 1JJ2R 3NS5A 1DBDA 2ZJQQ 2DHXA 2DIUA 2M70A 4F26A 2DNMA 1CVJA 1KD1T 1U2FA 4FXVA 1WHVA 2YKAA 2N82B 2K3KA 1K8AT 2E5IA 3PIPQ 3EGNA 5LXRA 2CQHA 2CPXA 2DNZA
chains in the Genus database with same CATH superfamily
4CLLA 4I68A 1ROFA 2YX4A 1F3FA 3VAMA 4YFUA 3BN4A 3OTBA 2J8AA 4KKOA 3BREA 2R2RA 2CPYA 2DXDA 1S97A 1GAOA 3DLGA 2UU9F 3TAMB 4P2FA 2VBWA 4KGZB 3JSBA 3QT5A 1SI9A 1SB6A 3SSQA 1WC4A 2PA3A 4K4SA 2F4VJ 2R7QA 4H4OB 4WK3A 4RNNA 1RLDA 3EJMA 4CT9A 1LK5A 2LQBA 3NS7B 4OJHA 2QA1A 4CH7A 3KG1A 5A8KA 2ZBRA 1WC1A 2R2UA 1GX5A 2QL7B 1IKWA 4LRCA 1U1PA 5KFLA 2CFXA 2EC0A 5HMYA 1S57A 2QGFB 1HQEB 3MGJA 3PX6A 2V2ZA 2PEHA 2N4CA 2XYPB 4P72A 4HDHA 3PACA 3OSPA 4K8RA 5CABA 3CSKA 4P52A 3H90A 1V3SA 3LA0A 2L9WA 3MM9B 2XMWA 4Q8FA 3T6JA 4TU8A 1FEHA 3R3TA 2W7OA 4PUOA 1RKIA 4DQQA 2IMOA 3AD7C 2RS8A 4I2QB 2VL1A 2QMUB 4A8OA 3K8VA 4B3SJ 1VRTA 1SVDA 4DL6A 2DR7A 4BWJA 3NNAA 1Y3KA 4LF2A 1UAWA 1YVFA 4JYAF 2RUSA 3FZ2A 3S8SA 5D4OA 3TO8A 4FPIA 2CQGA 4DL2A 2VFVA 2E9TA 3UD5A 1YIJS 5D3GA 3NGSA 3M9NB 2AIRB 4K2XA 2Q43A 2DGTA 1KP6A 2JLEA 5E7OB 2BJ8A 2J0SD 5KG2A 2W4PA 2B6AA 1X5OA 3W8GA 3EVOA 3CMAS 1U0HA 2M0GB 3CJRA 4N41A 4M95A 2B9YA 1DLOA 3EM1A 4EO8A 2GVZB 4ZPTR 2QN6B 4K4TA 5DDOC 5CH7B 2D9OA 2UV8G 4X64F 3KJVB 4A8KA 4ZLNA 5LSOA 2LEBA 5LOQA 4Q7AA 3ENWA 1X5SA 3EX7B 5KT7A 3MMAB 1FFGB 3DM2B 5DQGA 3TWZA 2AX1A 1Y5LB 2DR5A 2DNKA 2OPRA 4B3MF 2KG0A 2DH9A 3A3NB 4USTA 3ZZOA 4RW8A 2W4DA 3DRPA 2N4DA 1FRMA 5FIIA 4J9PA 1NO8A 4S0MA 2CQDA 1TL3B 3IP0A 2AHOB 2YPZA 4ZPVR 1O0PA 2XNRA 4NOHA 1HPZB 3QWPA 1T3OA 1EJ7L 2HS4A 1MWZA 5F8GA 4QIVA 2HBRB 1WC0A 2LYVA 4PRFA 2EKNA 1B7FA 2UXBF 1RA6A 4I1TA 3E3XA 2IC3B 3ILIA 1Y5IB 4M5HA 1LWCB 5KTQA 2DGUA 2MZQA 2KRRA 4HVZA 3MAAB 4AQYF 5JVGQ 4NEYA 1EP4B 3W7BA 2CJ9A 3OFEA 3RUBL 3I0SA 3KLEB 2AWZA 3MOZA 3CO9A 2B4UA 3B54A 2EFGA 1RT3A 4G1IA 2JLFA 2VIHA 3JSMA 2EKYA 2I0XA 1F2GA 4M5GA 2CQ2A 3DLEB 1MMNA 3PZPA 2LU1A 4C9DA 1KVIA 4B9NA 2C3OA 4DPTA 5CYMB 3UDEA 2YWKA 3EPGA 3DGPB 2M5YA 2VODA 3ZZZA 3QFWA 1IQTA 2DO0A 2FVCA 2IYIA 1RHJB 1ZS6A 1ZM4A 5RUBA 1VQKS 4C8LA 1CS4B 2AKWB 5F8MA 3HVRA 1TAUA 3HKZD 4X65J 1S76D 4RBUA 2K3KA 4WFZA 4U6PA 5KAKA 3R5JB 5KT4A 1HNWJ 1NDKA 1Q8IA 4LRAA 3M7VA 3PW5A 1UZDA 4JI1J 4M63A 2R7RA 4M8LA 1EARA 2PEBA 2FJEB 3UQSA 3CWJA 4IYQA 4USHA 5B0DA 2PI4A 3CNQP 1LW0B 1W26A 2APOA 4PPDA 1YJ9S 3V81A 1P8GA 1YBUA 3VAFA 2XMTA 4ZKAA 1N32J 1I94J 3I4HX 5A0YB 1IBLJ 1VIXA 4PUOB 1GT8A 1BUXA 2UV8A 3KNGA 2HGLA 4CWBA 3GR1A 2G4BA 2IVMA 3W5YA 3DLHA 3VGSA 3G86A 1FI4A 1P6TA 2B4PA 3BV8A 5IS2A 3VAHA 3CJ3A 2W9CA 4XDDA 1HNVA 1PSDA 4WFBQ 2K06A 3RG6A 4ED8A 4LBPA 5KG6A 1KNZA 5DLGA 3I55S 2I38A 3P8BB 4ZCMA 4K50A 3GMGA 2IAJA 2HYIB 2DH7A 4OQJA 2BJ9A 1GNKA 1S72S 3GJRB 5ETRA 2VC1A 2H54B 4V19J 5KFFA 3I0RA 5D0RA 3M6XA 1Q16B 3RW7A 2DR6A 2HWTA 3SEOA 4DX7A 2MJNA 1VMBA 4PXEA 1EAYC 1C2PA 4C8ZA 2RJZA 2XG8A 3OL7A 3CJ8A 3I5BA 4OZ3A 4YHHJ 3W60A 4OZ1A 2XSJA 1N4LA 2CYYA 3THPA 4NYOA 1WDTA 4EBEA 5C2CA 2KFYA 1R27B 2XNQA 2GIRA 3CT9A 3FCWA 1QE1A 3BB5A 1U6ZA 3OT9A 2FUG9 1VC6A 4RW9B 3B4DA 3DRPB 2MLZA 4A4JA 3ENAA 3OLBA 4ZVQB 1IM4A 4USMA 3C14B 1K44A 4HACB 5HBMB 3PW2A 3BGLA 1B0PA 5KFEA 5KG1A 4DQRA 3PO5A 2HHXA 2O3DA 1YI2S 3DI6B 2V2QA 2K1RA 2GQQA 5BYQA 1N88A 4OHYA 3CJKB 1TFYA 5AXMA 3N79A 5HO4A 1H0HB 2RU3A 4MK9A 3ICLA 2MB0B 1LOUA 5HLFA 3FCVA 3NL0A 2G13A 2MTLA 2M8HA 2KJVA 3A8EA 1YKWA 4Y65A 4LF8F 2PN6A 2HFVA 3C15A 1G3OA 2MPUA 3BYRA 2E5LF 4IR9A 3QMQA 3SCKE 4Y0FA 1VQ6S 2W2OP 2WBMA 5KFKA 3J81Y 1BQXA 2HBQB 3C8YA 1FA0A 4ZPBA 2NZ4A 1BMQB 1PJ7A 3I0SB 1TV6A 1N33J 1SV5B 1JLFB 3BYPA 4JV5F 4ENOA 4C0OC 2UUWA 3AHPA 2XM3A 5L1IA 1HWUA 4L76A 4RW7B 5LSRA 2IM1A 4OYBA 4UTGA 3SV3A 2ZH2A 2FTRA 1XWLA 3UD3P 1RTZA 2XMMA 2M8DB 1OJ4A 1HNZF 2HVDA 3HZEA 4KBIA 3TW0A 4P10A 2RVJA 7FD1A 3MCNA 2BANA 2XQCA 1F1BB 4EZ9A 4HHHA 4K5RA 4UOGA 2ASJA 2XC9A 3SDEB 4WXOA 2V8GA 2EFQA 2IFXA 1NH7A 4IG0B 3SFGA 2CXEA 5IV4A 2OPSA 1OY6A 3ZZRA 5KOWA 3OPKA 3PR4A 1CPZA 2WSCC 4A8WA 1NKBA 4JV0A 4JYAJ 3W66A 3H40A 3CCRS 1OQ6A 2XS2A 3MOJB 1IBCB 4YS2A 1R43A 5CD4H 3BGRB 1PBUA 2UUCF 3E01B 1K8AT 1S9EA 2QYGA 3PIPQ 3V81B 1REGX 1YZ6A 2QFIA 4KHMA 2C2EA 4QOTA 3J80Y 3C46A 3GZ7A 2H5EA 1VOMA 4LFAF 1U25A 3UW1A 8ATCB 5IFMA 2V4JA 4XO0A 4ED6A 2NXEA 4Q45A 1L3KA 2LVWA 2VKRA 4QU6A 3K5PA 1N56A 2W4CA 2IA6A 4FS1A 4U67Q 1UJ6A 1YZ7A 1I6JA 1FXRA 3JXOA 1LWXA 1S6QA 1HNVB 1LW2A 1ZTWA 1BD6A 2ZDPA 4B3MJ 3M32B 2C2KB 1ZPVA 2MZTA 4J37A 4L74A 1NAQA 2L48A 2NLWA 1S0MA 4XPCA 3UVJB 3GCWP 2BR0A 3MAHA 3H42A 2KTQA 2VV5A 2AGPA 4ATNA 5HVHA 3KTQA 2EG1A 3HD2A 3HJVA 3PJXA 3HJFA 4MMOA 3MPDA 5KFWA 1QY7A 1U2CA 3OXGA 4BS2A 4X2BA 4UF4A 3PY8A 5J1PA 4B3RF 4MKAA 4KFBB 1ZTTA 2MKSA 2UXBJ 2JRSA 2BE2A 1LWEA 2ZZNA 4Z2XA 2VFSA 3GIJA 1VJQA 1IKVA 2GO8A 3V6DA 4B3TF 3GR0A 2A0FB 2E5JA 4HKQA 2JHEA 2HURA 3LPEA 3D7SB 3R2CJ 3MFHA 2C28A 2KFZA 1L5UA 1WG4A 2F9JA 1TTHB 4AQYJ 2QEXS 1RI7A 2ALZA 5GADI 4OI6A 4B9MA 3ITHA 2Z57B 4DZ6A 2R7OA 3W61A 4B08A 3MTKA 1KONA 4ZVFA 3MPYA 2F4FA 4CT8A 3H25A 4TU7A 3ETOA 3LALA 2D74B 1HARA 2JEGA 2AZ1A 2CIMA 1UFWA 5EN1A 2B4OA 5HROA 2ZITA 1I5OB 2GS8A 2HNZA 4PG5A 2DNGA 5AE1A 3RU0A 3UR3C 3NS6A 3HULA 1JWWA 4OI2A 3BR9A 5EHHA 3KDOA 2CZ9A 2MY7A 1UJ5A 3HHLA 2PDAA 3LQVA 2ZZMA 4JI0F 4EU0A 5IXUA 2AGOA 4PEOA 4KH1B 2R8JA 4NCGA 1X4FA 2FHOB 4JP8A 3JTNA 1PYOB 3FC9A 2VG5A 1SJ4P 3QAUA 2AYMA 3SZ2A 2HHQA 4NLGA 1YRUA 4FYYB 3F0NA 1NDCA 4NI2A 2VQEJ 1C1BA 1U8WA 2J0WA 4DCJB 4DX5A 3Q2TC 1QLNA 1RWUA 1U1QA 3MM6B 3DC2A 3M8QB 1T9YA 4JI3F 4LF4F 4RW6B 3MF5A 4NLOA 1KEKA 3MM7A 2I6WA 5AT1B 2WZ1A 1HA1A 1S6PB 3VV2B 2LCWA 3DDNA 3M9OB 2IIHA 2IRUA 4DSEA 2DKOB 4LFCF 3ZZUA 3DOMA 3VQSA 2OPSB 1IBKF 2FY1A 1S12A 3DRSA 3QATA 3J7YU 3QAEA 2VB6A 1CJUB 5J2PA 1IKXB 1H73A 5CAAA 3IMQJ 2EBEA 4DHVA 1UEVA 4RPFA 2AZ3A 3OUYB 4DS4A 1YBAA 2CNKB 1S0NA 1FT8A 2Q6BA 4IFVA 3M6WA 1YITS 5F8LA 2LXUA 3KUHA 3JSYA 2NCKL 1T05B 3AY0A 4OX6A 2ROGA 4DQSA 5L9XA 1S1WB 1VRUA 1RT4A 4LSLB 3CF5Q 1RWWB 4M5IA 4OX9F 5LJ3Y 4RNMA 1FE4A 5ETKA 2FHKA 4EYIB 1NU4A 4P7VA 5L1LA 5DGBA 1SCJB 3UO0A 4F26A 3BF4A 3ET6B 2RKIB 3BGFA 1EIYB 4DFPA 2YKAA 2YNGA 5MAOA 3D4JA 4UW2A 1VK8A 1P1LA 4DUYF 4KAIA 3Q8QB 3MMCB 2H48B 5B0AA 2DITA 4DPYA 4CM0A 3A4TA 1S1XA 3AQOA 1ZM3A 1CLFA 1PGZA 2FJDB 1RDRA 4OJGA 2WONA 1I51B 3GONA 2DY9A 1SKSA 3NGDA 3V6KA 1EETA 1WC5A 1X4AA 2CUYA 4QWCA 1K47A 1VR6A 1WC6A 2J9CA 5J1NA 3ADAC 1S5ZA 3QJLA 2KJWA 1YDLA 1DZ5A 1X4BA 2YWHA 3RAXA 2BE2B 4LFBF 4C97A 3V6DB 3TA2A 2CJQA 2B5JB 2WK4A 1MN7A 4LF8J 4QYZK 2ZZTA 4ID5B 2CDQA 3N6MA 3FBBA 4AD6A 3CCTA 3ZFVA 3OTDA 2KT5A 4PKDB 4PQUA 4X4VA 3GP9A 1QSSA 2GMLA 1WHXA 2AEJA 1JLAB 2PE8A 1G2EA 5KOXA 1JLGB 3FDSA 1R8BA 3NG8A 3M2UA 3K2YA 1Y3JA 4JV5J 2CVIA 5H9EK 1T11A 2EI5A 3NNHA 4DLEA 3AXKA 2POKA 2B7BB 4ZIVA 3GG1A 1S10A 1WOSA 1Z2ZA 4WXWA 3D2WA 4PZVA 3C6UB 3DRRA 2O66A 3MEEB 4B3OA 2ZNYA 1KKHA 2ZBQA 3PG9A 1WF1A 4DR6F 4QW9A 1HNZJ 3IGNA 2JVOA 3CD5A 4I64A 5LMNF 2COLA 2RSQA 3EE3A 2MY8A 3F44A 1X9MA 3ZC4A 1AA1B 2AEMA 1VJWA 3QGIA 3L7UA 4EWTA 5AXNA 2XGQA 1G4CA 2R7SA 3LF0A 2DRDA 1DTQA 2VKZG 1UFKA 3QGHA 2CJYB 2BYCA 2CQIA 2HVEA 4UT4A 3JSRA 2Y1IA 1PCAA 3FVYA 1TKXB 4ZN3A 1RU2A 3PX4A 1X5PA 3MAQA 2XY6A 3NGTA 1XK8A 3EVWA 3HK2A 1OWXA 4Y00A 1D0EA 2FLLA 2LQJA 4ZVEA 5L9NA 2WVDA 3UDVA 3QRPA 1U1KA 3L9ZA 5L1KA 2UUCJ 4KV8B 3J81U 4X4QA 1C0UA 2XHCA 3RR7A 3A12A 4GVLA 1YLXA 3POTB 4DBQA 4DL4A 2HFSA 4QYZJ 1CEZA 4LFAJ 1NK5A 3U02A 4ZVGA 4OZNA 4WFAQ 4DN9A 2G0CA 3EMTA 1PC4A 4KPCA 3TQEA 3QQCD 2IJFA 1MWQA 3GJQB 3MPWA 4NA1A 3CCMS 1RAFB 2G1DA 4HL9A 4QQBA 1N5YA 1BY9A 4IH5A 4C4WA 4DSKA 1Y11A 2KXHA 2MEWA 5M2RA 2XCAA 5H9EJ 1H2VZ 1PJ6A 1IM6A 5ETNA 1LK7A 2BJ3A 1KHVA 3LAMA 3MM8B 2BJEA 4NEZA 3KLIB 4QPXA 2YX1A 1DARA 3LP2B 3IR7B 1UTAA 1TUGB 4DN0A 2M7SA 5T14A 4HR2A 1TL7B 3QNWB 1PKUA 3AA8A 2BZ2A 3D0IE 2MGZA 3IRWP 4DL5A 1AXQA 2C2MB 3CVKA 3ILLA 1CULB 4B3RJ 1SBRA 5FJ4A 2A6OA 1RT6B 3IN5A 4QU7A 1HD1A 2DH8A 4B3TJ 1SJQA 1T9UA 1TK8A 4RJVA 2WONB 1CQMA 3CDUA 1U6FA 3NY0A 3QYYA 1RAJA 1P1TA 3SXLA 1HR0F 4DG1A 1UKUA 3J80U 5F8NA 1UWBB 4FXVA 4K4UA 3M05A 1TMMA 1FTCA 1X9SA 1O5JA 1ZBTA 2DNZA 4N56A 2CADA 4H4MB 2AYEA 3HD1A 1ZM2A 3IWXA 2XGPA 2QYCA 5B7WA 5KG5A 3BEGB 4MTPA 4ZCLA 3PYEA 5F3ZA 1T03A 4LF7F 4N47A 1TKZB 3T5HA 3PO4A 2GGPB 3TA1A 1X60A 2W01A 4F4KA 4ICLA 4ZLLA 3M8PA 4YB6A 4DEZA 5KT2A 4PG8A 4DMZA 2GIFA 1V3ZA 1NKEA 3C6TA 1SL0A 3BQ2A 4JI0J 4YB7A 5J1EA 3FEYB 2J6SA 1NK7A 5HATA 2M52A 3S7RA 3TX0A 4PQUB 1S1UB 5AXKA 3CJQA 2ACMA 1LKZA 1A0OB 2HHHF 4LR7A 2VQFF 3M8ZA 1C0TB 5I42A 3I5AA 3UDLA 3BSCA 2UVUA 1YG0A 3GWCA 5J2QA 2WVBA 2DXEA 4OYZA 4DV5J 3BSNA 4TQRA 4WU2A 1R8PA 1AYEA 4RL1A 4DLGA 1AROP 4JI3J 5D4NA 5H1SV 3K7RA 1PC5A 2FVSA 5F8JA 4KE5A 2NREA 4LF4J 3FKBA 1RTJB 3FFIA 1JIHA 2JVRA 4NZ7A 2JDJA 2VG6B 3MPUB 2B9XA 1XNRF 3P49B 2DR8A 3FQLA 1U1MA 5HVGA 1X9WA 2JEFA 3WC0A 5CYJA 1OSCA 4LFCJ 2E5GA 5D8HB 4EZ6A 3AODA 1J5OA 4LIRA 4IFYB 2CQCA 2KVQE 2X1BA 1HKAA 2HK2A 2JLGA 5C5JA 5DM6Q 3O6QA 4CLZA 3GFZA 1S6OA 3C16A 4M1KA 3Q8PB 3KHLA 1XR5A 4WFYA 3OW2R 1JLBB 3MCSA 5IT9Y 3PHEA 2YH1A 4AUKA 4L3NA 2YWFA 5ETOA 1PBAA 2MLXA 3UN3A 1Q7LB 4OX9J 3UD4P 2PMWA 3W9HA 3DHXA 2YBVA 1MROA 1TUVA 3HSDA 4KO0A 2J8SA 4O0IA 1YJ7A 3VCDA 1RISA 4C0BA 4PG4A 4G1QA 2BUNA 2R4FA 5J2MB 1U1OA 3NEKA 2L3MA 2R7TA 2DO4A 3R27A 5DG8A 1U26A 3KHHA 3ELHA 3RAMA 1KTQA 4DUYJ 4M94A 4ZLPA 3VHQA 3ISNC 2OEKA 5F3TA 4PR6A 4NXMF 1XMBA 4OX7A 4FS2A 4ETXA 2A2CA 2XI3A 4FXDA 4I6YA 1JLCA 2GHPA 1UJ4A 3IC1A 3LGMA 3KFWX 3OR1A 8RUCA 2H3EB 1R89A 5ETLA 4N77A 2J9DE 4CH1A 2MGZB 2FC8A 1WG1A 2WSFC 3OXFA 5DDQC 1N34F 3LPYA 3R5GA 4CCHA 1IR1A 1R8AA 1WI6A 4MFBA 2OHDA 2ILZA 2F8HA 3MHYA 1SUQB 3ZZYA 4ES2A 4LFBJ 4AXJA 2W2PP 1QM9A 4NLUA 2JX2A 3RAQA 2V8VA 1FJCA 3MECA 1BQNB 4OI4A 2DJWA 4QIWD 1RTHA 3EDQB 1DQ9A 1SJ3P 5EUHA 3RRGA 2LFVA 3G9CA 2DCLA 1SC4B 2W25A 4NYZA 5D0GA 3H5SA 2OSQA 4QIEA 2IYGA 2ZH6A 1VQ9S 1REVA 5I3UA 3IAM9 1R31A 3G6YA 5E5NA 5FLXY 2ZBPA 3TUJC 1AUSL 2QFJA 1QTMA 1CJKA 5JJBA 3D0GE 3W5XA 4A46A 1X4HA 2C2OB 4DU7A 5DDRC 4C8MA 3OR2A 2DHSA 4Y2KA 3EYZA 2FZKB 4L6V3 1DTTA 4UQGA 4CM2A 4LVOP 4PG6A 2D3O1 2JZ5A 3M8PB 4F0KA 5HP1B 1JXLA 2E1MC 1W25A 1U2FA 4DR6J 3ISND 2N7YA 5HQMA 5LMNJ 1LEOA 3GV8B 2IBOA 2CPXA 2IM2A 4GVBA 1FHTA 2EVZA 2DNQA 4HTIA 1NHVA 1KFSA 5B0BA 1BQMA 5HN0A 4RBTA 2O1PA 5CCMA 1TKTA 3OTCA 2H9ZA 4NCAA 5E3PA 5CQGA 3CIMA 1RADB 1IJEB 2CKWA 1ELOA 3G82A 3IRXA 4W98A 5GMKa 1WTFA 5K20B 1K1SA 4OLPA 2BJ7A 3MZIA 2OTJS 2XMJA 1VQOS 4J9VA 2RQKA 3CD7A 1FJEB 1FRXA 1R0AA 2CPHA 3RBXA 4CH0S 4RW4B 4PYDA 5K8NA 1FD2A 2Y0SD 1HNIA 2VHGA 2ZBIA 1RT7A 4TY8A 3LP0B 1VQSA 4ECRA 2PFFB 2X1GA 4EBCA 2L08A 1J5OB 3KOAA 2BJDA 3DCAA 5J2NB 2LLZA 4NZ6A 2PO4A 2DGXA 3DU5A 4LSNA 3BZQA 3DYAA 4J9RA 2WW4A 5A6PA 2CQ0A 4UUWA 4NXNF 3T19A 2EPIA 2EK1A 1ZA2B 3W65A 4PWDA 1HWIA 4CP5A 1VBKA 3M2RB 4DDFA 4JV1A 3GSIA 2CG8A 3U1MA 1UVLA 3ZTSA 3NOCA 2C3MA 4O44A 4USJC 3AOBA 3EICA 1R0BG 4P74A 3QFHA 1VBXA 1PYSB 3VTIA 1C1CB 3PKYA 4KO0B 2MYFA 4JI4F 4I2PB 2F3JA 5G0RA 4GO5X 1NBEB 5HJXA 4YEAA 1MU2A 5D0HA 2QO3A 3DLJA 4ZPWR 4DFKA 5KG0A 1M0SA 1CBKA 3LTOA 3A1YG 1D3WA 2ADCA 3CC2S 1CQNA 3SV4A 1T3NA 5DG7A 4J9UE 1QSLA 3CCQS 1H6KX 1XNQF 3GTYX 2FC9A 1FRJA 1HBUB 2JOQA 2CPFA 4YB5A 3OXLA 5A8WA 3RGIA 5KT3A 1VS3A 1N5VA 3L95X 4JI8F 1HQUA 1NHUA 4GRSA 1B4SA 3CXCR 4F0MA 4RBVA 2YVSA 3GYXB 1KQKA 3N01A 5HSPA 3W2VA 5L46A 3AFGA 1TUWA 1ZAWA 2Y9HA 1S48A 3QBCA 2VA2A 1UA0A 4OX8A 4LF7J 2D3OR 1N36F 4NE9C 2KG1A 4X62F 2GA7A 7FDRA 4A8FA 1FXDA 2HQCA 1DQ8A 4MJKA 1K9MT 4BC7A 3R7NB 2OPPA 1NJWA 5GADU 3PYFA 4MT1A 2HVIA 1WTBA 3Q8YA 4WFNQ 3NMRA 1LXNA 2Z30B 4M5KA 5EWGA 3IBWA 4WP9A 2XWXA 4IG3B 3KG4A 1VQMS 5I3UB 2GCFA 4OYAA 1FVSA 2HHHJ 3CIZA 1HHTP 3CD6S 1KDNA 2HK3A 4DQPA 3UWTA 1WACA 1SJFA 3TZXA 2BE7D 3D28A 1CJKB 2HFZA 4I7FA 3V4MA 1S6UA 4ZK7M 3A8IA 2XMAA 5HK4A 3OR2B 1DRZA 4LJMA 4Q0BA 1S1TB 3DN9A 1VCTA 1FWKA 4RWXA 1DTTB 2UVVA 4AXIA 2Q1LA 1QAIA 3SMZA 1IBMF 1FJGF 4B17A 2X7IA 2ATLA 2AJFE 1XERA 5H9FK 2C2RA 1NDLA 3GJSB 3AD9C 1BQMB 2HS0A 4X4PA 1EX8A 2UVRA 3ENVA 3DLKB 1TKTB 1XNRJ 1N5QA 2FVRA 3UN5A 3FRZA 3DOKB 2W2MP 4QWEA 2VBYA 4Q5VA 1Y0HA 2Y1JA 4O3RA 3QSYB 2CDRB 1QAYA 2QJ3A 2YNFB 5B0FA 3GSDA 3IFEA 4Q2MA 4OZ2A 3NBPB 3PHTA 1BC6A 3Q24A 1NPPA 4U95A 4EMDA 2QX0A 2YKNB 2UP1A 3CMQA 1HYSB 3KKFA 4DPOA 3AD8C 1NJYA 3M8RA 1R8CA 2E1AA 1EHWA 2KT2A 1FX2A 1ACMB 2HNDA 3HHEA 3AB2B 2R3VA 1U7LA 2RS2A 1VRQC 4F4XA 5FDLB 3HCXA 2WVCA 3B6BA 1CJVA 1XC9A 3EZOA 1T8EA 2QLXA 3HHNB 2ZDOA 1X4EA 2C2ZB 1IQZA 2ZWPA 1E6YB 2YWWA 1U2RA 3EPIA 2ZKUA 4J9NA 2EC2A 4F4ZA 1VQ7S 3NAHA 1OYEA 1EZZB 4P6QA 2V69A 1RCXB 2XLJA 3VWSA 1Y7PA 2BKNA 4OYMA 1D1UA 3W2WA 1RT5B 4WP8A 3ZTPA 4NXMJ 3MCMA 2NUUG 4ZS6A 4RR5A 2HRYA 4JB8B 2AGQA 4C6AA 5IT4A 3UFCX 5H9FJ 1UWAA 5DLFA 4YMEA 3LGHA 2I8EA 4R0JA 4LF5F 2K2PA 2BM1A 2KM8C 3I9ZA 4DPXA 3QPIA 2OPQA 4UOCA 3CMES 1F6TA 2AV5A 2YNIA 4C3LA 4ZLJA 5A8RB 3T3FA 1W2IA 1N34J 3HXMA 4CO0A 4F0HA 3MEGA 2QE5A 3IBFB 1HNXF 1MU2B 2VF3A 3VGVA 2GAHC 3M1VA 4L75A 1D09B 3MTJA 4ECQA 1XMQF 4ECUA 2ZBCA 5IT9U 1YX2A 4Z7YA 4CYUA 4YR2A 2UXCF 4ZMMA 4LR9A 1V5IB 3QIPB 2CJAA 3EGZA 1HQUB 2VICA 1ZZNA 2A3JA 3WIUA 4ECXA 4DV7F 1KFDA 3ONQA 3CPWR 1F9HA 1RTIA 3E51A 2YKMB 4ILLA 5M2PA 3JQJA 4F3QA 1NSPA 2AJ1A 3O1LA 3MEDA 2FJVA 5C24A 2MKYA 5CD4A 2DTJA 4RX6A 2X3GA 2WTFA 5BXIA 3Q8SB 4DF8A 1YJTA 3CUNA 3KLHA 2GNKA 2GAGC 4NX9A 2XZWA 5B09A 1QAXA 1HBNB 3K58A 5KFVA 2J76E 4AYBD 1FJ7A 4QBUA 3NWRA 1VQNS 4C98A 3CCES 5E33A 1TP7A 5KFSA 2N3LA 4NCBA 3DXSX 3R7SB 1E6VA 3H20A 2WSEC 4NA2A 4LBHA 4A8SA 2HZAA 1SH3A 5CYQB 2Q6CA 2Z0GA 3HVTA 1RJJA 4K4WA 4KY3A 4J9QA 5IM0B 2HHUA 1YSJA 4BDPA 2I5JB 1NK6A 3I87A 2IBKA 4M5LA 2Q66A 2AJ2A 1VHFA 2VFUA 4MIAA 1FKOA 1Y10A 2EG2A 4R25A 2QG9B 1YJWS 5FLXU 2R2TA 3FSYA 2AYGA 3BKFA 3A8JA 4HHUA 3H4BA 2MQ8A 3T5KA 1A9NB 1KOHA 4J9LA 3QLHB 1L3UA 2ZHAA 1RCOB 4WE1A 4GKJF 1J2VA 1M5SA 1S77D 2SXLA 3D1QA 3DOLA 1M5KC 2QRRA 3CD0A 5K8MA 2OP5A 3KLFA 4NXNJ 1CG2A 4J9MA 4CTAA 2YNHB 5C42A 3NS5A 1FWLA 4DPUA 4Y2MA 5B08A 5KFUA 1GFWB 2R42A 3EGNA 2GJIA 2ZVSA 1DURA 4OV6A 2P9GA 3O2IA 2ZH3A 2HKEA 4NRUA 2FIUA 2ZUGA 3IG1B 1KQSR 3JQKA 2DPIA 1FE0A 3FEXB 1WNEA 5I3PA 5K14B 4JI4J 1IKYB 3PEHA 1RYRA 4M5NA 4I67A 3FMBA 3I9V9 4F50A 3M6VA 2R8IA 3KUEA 2DBBA 1L3SA 1RQ0A 1RACB 1S1VB 4BWMA 1SL1A 1FRKA 1N5TA 2E7WA 3DLLQ 1XNQJ 2ZNZA 3P45B 4X84A 2ZM6F 1VISA 2XCPA 5T7LB 1JNRB 1OMSA 2R9LA 2G2ZA 4O23A 3TUIC 4QW8A 1PYTA 3NCQA 4JI8J 3CJ2A 3AOAA 2HWHA 3T6BA 5BR8F 5A2QY 4ZA1A 3R9LA 2VASA 4YR0A 2V50A 2WVFA 1LWFA 3KUGA 3MEGB 4QYRA 1B64A 3H5XA 4XIUA 3I82A 1ZOTA 3U27A 1N36J 3RR8A 4TXSA 4ELUA 3FZBA 1KN6A 4F25A 3KLVA 1H3DA 3ZTQA 4CLTA 2LDYA 3HFZB 2HAFA 3CC7S 3K57A 1VQ4S 5L38A 2X1AA 2OH2A 3R2DJ 1RBOB 5DZ7A 2ZEJA 2W9AA 3TJ8A 1KR4A 4DFMA 1XBWA 1X5TA 4ANEA 4CLWA 4QPTA 1QUPA 1Q1KA 4OZJA 3M2VA 2OEJA 1VC0A 3VR1A 4NLXA 3M9MB 2GMHA 1VDHA 2H51B 3ULHA 3N28A 1T02A 3OBIA 1HD0A 3BBCA 1RHQB 4EGLA 1WI8A 2C3PA 3EWGA 2DNLA 5HJYA 4OV1A 1I1GA 1R6VA 1T94A 3KK2A 6FD1A 3TVYA 3M30B 2P9EA 1T0TV 1AZSB 4DR4F 1ZA1B 4USIA 4A8XA 4A47A 1IBMJ 2K7KA 1EQMA 4ZDNA 3KLHB 1VQYA 4NLWA 4YN3B 2BRKA 5KFIA 1GMWD 4HLBA 1TL1A 3KLGB 3DMJB 3JYTB 2ZH5A 3RRHA 2M9KA 1P9YA 4L73A 1GK8A 4WYWA 4FZVA 3R1HA 2J5AA 3MMJA 4L72B 2WB1D 4DV3F 5KFTA 4PQAA 2WOMA 5HAOA 4DOZA 4KKOB 2DGVA 1KVJA 3DLGB 4L3KA 2R8GA 1WEXA 3NWGA 3NMAA 3AOCA 3HLUA 3V5RA 4FF4A 4KIAA 4J90A 2GC8A 2V4RA 4DV1F 2BV3A 2V8DA 4HI2A 4V1Ak 1RU1A 1UMJA 4UY85 1FKOB 2NPFA 3PXGa 4LF6F 5DZ6A 5A8KB 1JLEA 5KFAA 1IKWB 1ZPWX 4TLRA 4U96A 5T41A 2MQQA 1Q78A 3EUNA 2DNOA 3A3PB 1RHMB 4WBFA 2E9ZA 2ROEA 3MR5A 2W8KA 4URGA 2G9OA 1ZAXA 3TEHB 2I1RA 4OYXA 4EBDA 2X1FA 4W90B 2B8QA 4C11A 3PR5B 1YJUA 2VBXA 1F2HA 2KU7A 5KT5A 1HLWA 3ZZPA 1WKKA 4X66F 3D9BA 3WX8A 4Y34A 3KLFB 4F8RA 3J7A1 2IPOB 2BJ1A 4CLUA 2B7CB 3PRDA 1CJTA 1FK9A 4PG7A 4ECYA 5D4PA 3VZIA 1VRTB 4HT7A 4O4GA 1AUDA 2RF2A 3BO4A 4DS5A 3B8HA 4CLSA 3W63A 2LEPA 1WF2A 1SC3B 1JJHA 5KG3A 5D3GB 2GV1A 2YH0A 3CCZA 2MQLA 2NUHA 4AT1B 2CZ4A 4JI6F 1JKHA 2B6AB 4JV2A 2VH7A 1TU0B 4BCAA 1ULRA 3JS9A 1JJ2R 1HNXJ 1U0HB 3H0PA 5E41A 4C8KA 2DIUA 3N6LA 3CEDA 1HMVA 3MMBA 1U09A 2FQQB 2HHVA 4BC9A 3OLAA 1PAUB 4DL0C 3KK1A 1DLOB 2NR0A 1RAHB 1B99A 3SQGA 1XMQJ 1YRXA 2OFGX 5L39A 3CTRA 3K17A 1WF0A 5DETA 2PT0A 5DGAA 1JLQA 3WDOA 4WZMA 3SCIE 1YBTA 2OFHX 3G96A 3ZZTA 4ED2A 1KLMA 2B43A 1VK3A 4DSJA 3Q86A 2OPRB 4DX6A 2QT7A 1OPZA 2NPIA 4TKTA 1HBOA 4CNYA 4ZCIA 4RW8B 1RBAA 2F8EX 1UVNA 1FDNA 3GV5B 2EW9A 3QO9A 2RQCA 4J91A 5KFBA 1UVIA 3TRGA 4DCOB 1TVRA 3OVBA 2GW8A 2PI5A 4ZJLA 1R8HA 3LGNA 3HM9A 2DISA 3IS9A 3K5OA 3PYGA 1SC6A 2EFNA 3WC2A 1N6QA 4JOUA 3DXBA 2F5GA 5KFJA 3N9UC 4M5JA 2RDIA 3UNGC 4IOAQ 2JH3A 2LXIA 4CLKA 3SYZA 3FRYA 1JXVA 4IQMA 4O3OA 3M2VB 8AT1B 4E8UA 2MKHA 2KDOA 1F5AA 3OFFA 1NSQA 3OFHA 2P8IA 3CJ4A 1RT1A 2Z2LA 5B0CA 4DV2F 4K4VA 1FRHA 1UETA 2CRLA 2KO1A 4B9VA 1VQ8S 2KXNB 3IXQA 4RUBA 4DI6A 2GMJA 3RBDA 3LAKA 3NCPA 4MKBA 1GTHA 3CGIA 3LANA 2UU9J 4OZ0A 3N6NA 5DM7Q 2IJRA 1VGYA 2HAIA 3SQOP 1P27B 4A8YA 2BW7A 3E2EA 2W2QP 3K5LA 4F02A 4TVAB 2AU0A 3HZGA 1RT3B 2GVDA 2V34A 3VGUA 3GV7B 3HPOA 3JSMB 2P2CB 1UA1A 3IR6B 1H38A 3AAWB 2Q79A 1RT2A 3BS9A 5ITHA 2DY1A 4DF4A 2B4VA 2DGWA 3PDNA 4LRBA 5LXYA 1X7VA 3GFYA 1WWHA 4NZ0A 4ZN1A 1VIOA 4KR0B 3PW0A 1NK8A 5CZVA 1FCAA 1OO0B 4UZBA 4R8UA 1GMVA 4QJVA 5IC6B 3TAMA 4K5SA 4ED7A 2BVZA 3FBFA 2KXFA 3TVZA 4I69A 3LOUA 3BBBA 4HEA9 1R0CB 1WKLA 3THTA 1YRTA 2NYHA 5EX0A 4O3PA 2CZVC 3BO2A 2ABYA 2ZOMA 4CLPA 1VQ5S 4ECVA 1Q81T 1N8RT 4XK8C 2WBRA 3C19A 1HIYA 4MIWA 1PJ5A 2R7XA 3ZO7A 1HQEA 1CC8A 4NASA 2CPIA 3PFOA 3BGOP 3D1HA 2UVWA 3ILOA 3TQ1A 1LV5A 4I4BA 2H65B 3A13A 3K89A 4TY9A 3MM9A 2HIQA 3GIMA 2YKOA 3M8YA 2DRAA 3UCGA 4FYDA 4I2QA 4K4XA 4P73A 2JL9A 2A10A 1CJTB 3B78A 1WJ9A 2DPJA 2B9EA 3F41A 2HQ3A 5DQIA 1XR6A 1VI7A 2ZM6J 1S4FA 4DXLA 1FEEA 2QLWA 3VALA 3QJPA 4X64J 5E3AA 4YQWA 5LT5A 1MNEA 5BR8J 2W9CB 1HFEL 2FGOA 3K5NA 1VYAA 2KFNA 2OI2A 2V2KA 2LQ9A 1Y5NB 1LFWA 2ZJRQ 2I2YA 3LW5C 3W1YC 2IAJB 1Z1ZA 1HMVB 3MMBB 2BKPA 3R6LB 2GVZA 3I0RB 1JX4A 4DR2F 1T9TA 3CDEA 1FERA 5AJ3F 4HH0A 2E7XA 4RUAA 1K0TA 5K8PA 3CCJS 2EXUA 5A76A 2DNNA 4GC7A 2MZSA 4CIOA 3OTEA 4U7CA 2XSJB 3MMAA 1NZ8A 4ES1A 4FYVB 2ASYA 1QE1B 2RH3A 1SIWB 2QSFA 3H2LA 2RHQB 2X3DA 4FKYA 2RDDA 1N48A 4RWWA 3I56S 4ZITA 1FF2A 1TVRB 2ILYA 3L09A 4IO1A 3VVUA 3IS9B 1M5HA 2U1AA 3L7OA 4IDKA 3EZ5A 1HPZA 1MG7A 2K1RB 4QR1A 4DR3F 1S7IA 4ID8A 2ATCB 2LQ5A 1SC1B 2ZH1A 3ZTRA 2MMYA 3RB6A 2DVIA 2RD5C 3W3SA 2HGNA 1KHWA 2IC3A 5A2QU 1H7XA 1LWCA 1U1NA 4XAKA 5HLFB 4DV3J 2Y0BB 3NP5A 2LA4A 2LEAA 3Q23A 1PILA 3KHGA 3C15B 4JBCA 3PM9A 1BWEA 3MAAA 2ZH4A 5GMEA 5I4MA 4C2MA 1EP4A 3TJAA 3T1YF 4FBUA 2KHCA 3KLEA 4TU9A 2H4YB 4UZCA 3T5JA 1TV6B 1SKUB 3JB9k 4RUCA 3SI8A 1FRIA 2DGQA 2NXNA 4DV1J 4OZLA 3O44A 2AP6A 1QVFR 1D8ZA 4ZJOA 1OPIA 4ZCKA 1M90T 3CB4A 3KJFB 4TYBA 3CDWA 3OL9A 3P5TL 4LF6J 2HZCA 3DLEA 4F4WA 2CJBA 2V94A 5HL7Q 4LBIA 2G0IA 2H1YA 5CYMA 3LWLA 2VBZA 2P5VA 3DGPA 4I56A 4WF9Q 3QJJA 4R8UB 4FPRA 3J7AN 3I32A 3O3LA 2DXFA 2BANB 2BBEA 1CS4A 1YJRA 2XWYA 3FQKA 5F9NA 4OYOA 4CI0B 3Q8VA 1N33F 3CJTA 3FBEA 4X66J 2YQ3A 3IAS9 4FDFA 2BQUA 4KGKA 3DRXA 1BLUA 2J9DA 3N0VA 1NHKL 4PCQA 4WJBA 2FJXA 2E5HA 1Q8BA 2R2SA 2KT3A 1NJIT 2XS5A 1U6BA 1WDDA 1LW0A 2OELA 2FZCB 5GMDA 2VC0A 2WCXA 2D1CA 2MJUA 1S0OA 1S9EB 4JI6J 2DGOA 2HQGA 4AL6A 2GQ2A 1NEEA 2ERRA 2E44A 5A0YA 4TQSA 2BXJA 3GCXP 4RZRA 3HSZA 4N76A 4R5PA 3S1TA 2FVQA 1RP5A 1FD8A 1CC7A 1ICEB 3M4XA 2V4JB 1RB0A 3T9ZA 1RHUB 1PG5B 1V5VA 4YB1P 4OHWA 1IXKA 4Y3CA 2C1EB 2E66A 2UUTA 1U47A 2DR9A 1S6QB 3HSGA 4X4TA 3SIPB 2DB1A 1LW2B 2DGSA 4XPEA 2XTJP 4MAKA 2OSRA 4CO5A 4KQZA 1X31C 3AA9A 1BE4A 1FO1A 1FWPA 3C3LA 2YY3A 4OLOA 2MSTA 1J5EF 2F7VA 4Y2AA 1NKCA 5HMWA 4ZPAA 1WEYA 3MD1A 2F1FA 3F56A 2RUGA 4G65A 2RB7A 2BOPA 2ZC4A 4F04B 4LF1A 2B8PA 1LWEB 4C8OA 3BDPA 1IKVB 4RW9A 2HRUA 1IWAA 2DHGA 1OSDA 5C25A 2HSEB 2J0QD 4DV2J 1O51A 3ETMA 2E5LJ 3CCVS 3C14A 3GIRA 1NK9A 3QRRA 1U0SA 4ANDA 4HACA 5HBMA 2IMWP 1OIAA 2NQPA 3ITHB 2WVEA 4IDKB 2WB4A 3OTOF 2YXLA 3TANA 3HP6A 3VZHA 2ZJQQ 3DI6A 2IA0A 3N5BA 1KD1T 3NRBA 3CO0P 3CJKA 5LXRA 2WRMA 3KWMA 4LIWA 5HROB 2HHWA 2HNZB 2AJQA 4FVMA 1Q82T 2CQBA 1N0UA 4XDCA 3GFHA 2HFUA 2GJ2A 2NS1B 2VFRA 4OL8A 3HHLB 2IVFB 2XSFA 4GMKA 1HL6A 2FDNA 2E29A 4ZIWA 2XMVA 4W92B 2XLKA 3NNCA 1RAEB 1YJVA 4NCGB 1AFJA 5L8RC 4OHXA 5C7PA 3MEKA 2IM0A 4LREA 3VF0B 2VG5B 1SV5A 2FLOA 1JLFA 4K4YA 4FP9A 2V68A 4HYKA 2CVEA 4HH1A 3AJ1A 4DWIA 4NI2B 4RW7A 2XZTB 1C1BB 3FNNA 5U47A 1R7IA 5E2QA 3IWLA 4ELVA 4OHVA 4P71A 3RB4A 2JFDA 3FK4A 2WW8A 1NCLA 3TA0A 4ZVOB 2GHWA 4WKRA 1OY9A 4XTTA 2CQ4A 4ZP7A 3MM7B 5EDWA 4G6VB 4PWWA 4LT6A 3SDEA 4JUZA 3T1AA 5GAHI 2XI2A 4X4SA 3KXDA 2GJFA 1APSA 2YX7A 1KSPA 3BQ1A 4IG0A 2FHJA 3DOMB 4OYPA 2G0JA 2VQEF 1NSKL 3DRSB 2R7VA 1GXTA 1IR2A 1RAIB 1UVKA 5J2PB 4ETZA 4CO2A 4FYXB 1W2BR 4LF9F 1JQGA 3R1LA 2JEIA 4HT5A 1VBYA 2FHJD 4IH6A 3KYLA 3V4IA 2BX6A 3D3BJ 3Q0AA 3Q8UA 1TL4A 3BGRA 3Q89A 4IFVB 5IQ6A 1H2TZ 1X8DA 3E01A 2A2DA 3HT0A 2VA3A 3JTPA 3CC4S 2QA2A 1EB0A 5F41A 1NUEA 3T9NA 5KFGA 5BYSA 1VRUB 5E3QA 1XR7A 3TI0A 2DEIA 1RT4B 4B02A 4H4KA 4R5PB 3R6GB 5KFMA 4E0DA 2ZWOA 2D3ZA 4DR2J 2HEKA 2ZC3A 2K8GA 4QWAA 5AJ3J 5HI7A 2L9NA 2LDIA 2XYHB 2OEMA 4DV6F 4TYAA 5D78A 3CDAA 4ED3A 1S9GA 2V9KA 2YNGB 4FVCA 1VQPS 3KHRA 4OJ1A 2AJ0A 3M32A 5LL6d 4DUZF 3FGVA 1WG5A 4Z7CA 2XLIA 2QA4G 2CQPA 5E3CA 1S1XB 2XHWA 3UVJA 2VOOA 4FYWB 4JI5F 4DSLA 3VQTA 2QLBB 4LSZB 1JMTA 4DJBA 3N5FA 3Q8RB 3RB0A 4CO1A 1RXOB 3K59A 1X0FA 1KQFB 1EETB 2F8MA 2EFOA 4QR0A 5KFOA 1NK0A 2RILA 3D6TB 4DR3J 1YWXA 4Y2CA 3GPAA 5IZHA 4KFBA 1VLOA 2QMWA 1YQHA 3CCUS 4NA3A 1NB2A 2AYBA 4NLVA 2LA6A 3S01A 2C2NA 2FVPA 2W8LA 5KT6A 5C25B 3PRVA 3RRKA 2J7KA 5ETVA 3PW7A 3DRYA 4C8NA 4RNOA 4F3OA 4B9LA 1H7WA 2HQDA 1FNXH 5GVQA 4K7QA 3PCOB 3T1YJ 3W9JA 4F4AA 2M3DA 1YJNS 4NYPA 4DQIA 4CRJA 1GTEA 1JB0C 3QT8A 3Q83A 3IR5B 2KB2A 4Q8EA 2IVYA 3R7BB 3M2UB 2LQ8A 2VOPA 3SCJE 3J7Z5 4DSFA 2UUBF 5D77A 1T9WA 1MMLA 4K0KF 4DL7A 3TNVA 3DRRB 4P75A 4B3OB 3KK3A 5G4DA 3U1LA 4GO7X 4B9UA 3AT1B 2VPXB 1F9FA 5HQ8A 2B3TB 2E1CA 3EGVA 1QUVA 4ZP8A 3FSXA 1K0VA 4DR5F 2M70A 2H5JB 4JI2F 1R3NA 2NYIA 3THVA 2P9CA 4DFJA 3R5AA 2CQHA 3DNCA 5BYRA 1B3TA 4DL3A 1DTQB 1Z4UA 2FJWA 2FJBB 2CPZA 2OJ3A 2RE1A 1MWYA 1IBKJ 4TN2A 3JTOA 4CDIA 2O67A 1N0VC 1HHSA 2OAUA 3MM6A 1HI8A 1UPPA 2DNYA 3M8QA 4EUVA 3W9IA 4RW6A 5HMXA 2C42A 1T7PA 1NXIA 2MHNA 1V3RA 1GXUA 4IUFA 2R7UA 3BH7B 1DQAA 1S6PA 3HFVA 3V2UC 1C0UB 5HANA 3IO1A 2Q3PA 1C4CA 1NB7A 2HGMA 5HMZA 2HRTA 5A6WA 2QMXA 1NRKA 2QC3A 2W7AA 3EXCX 3BBFA 1L3TA 3GLJA 4DV0F 1CJUA 2OKQA 1IKXA 1RWOB 4CLYA 1HI1A 3CW2C 1SQFA 3IBCB 1FKPA 4KHPF 3OUYA 1N5YB 1WSVA 4NWBA 3V4IB 2MZJA 3BSOA 2KKHA 1GH8A 4HTJA 2ZOGA 2UXDF 2HLTA 4WWSA 1TK5A 2YTCA 3WHIA 1T05A 2VJVA 2GX8A 5JMNA 4OI0A 1S1WA 3AJ2A 3D1OA 4ZVPB 4UUXA 3H4DA 1M5VC 4LSLA 3GYNA 3FSIA 1P9QC 4LUBA 4OI3A 3V6JA 2FJAB 4ZPCA 1J5EJ 5DJBA 4BLGA 2LKZA 1NJZA 1S99A 4C48A 2QTWA 2D7SA 4FF1A 4HDGA 5ETPA 3ET6A 2RKIA 1M1GA 3MURP 1SQGA 4Q43A 4ECWA 3HDSA 1SH0A 1S9GB 2HHSA 5KFHA 2GHVC 3WIVA 4RNFA 4WCEQ 1RLCL 3MMCA 1FX4A 3TVKA 3FMWA 4X4OA 2DHAA 2VD3A 3T5LA 1DAXA 3I6PA 4MIBA 1UVMA 3RTVA 2KM8B 3CE8A 5AXLA 1AT1B 5ADZA 2BQ3A 2L41A 1XJWB 4CO4A 4DG1B 1U1RA 5THWA 3MI7X 3UI3A 4Y2IA 1KVKA 3TUZC 4YUDA 3HHLC 2ASDA 4ANCA 3OTOJ 3BDEA 3TX8A 1XTZA 3NOGA 2MKJA 4LR8A 2VPZB 5CA5A 2AD9A 2F63A 2FLPA 1T03B 4EYHB 1MLAA 2C3UA 4DR1F 1HWLA 5E0OA 2B5JA 4ICLB 4AE5A 3PIOQ 4ID5A 2FY8A 2DT9A 3C6TB 2VZ9A 5J1EB 3PYDA 1UVJA 4GKKF 1LNQA 1WC3A 4RKUC 4F3MA 1JLAA 3HMJG 4Y28C 1TQLA 2KL8A 3WBZA 5I42B 4Y6IA 1MSWD 1JLGA 5DG9A 1UEUA 2RT3A 5J2QB 4OFZA 5DDPC 4NPOA 5IQQA 3C6UA 3MEEA 1RK8A 1SH2A 1VBZA 3KK3B 4MYUA 3GYGA 1X4GA 3MR7A 1JJCB 4W4MA 5AE3A 4DR7F 2E7VA 3IA0A 2ZD1A 2M2BA 3FFIB 4G1PA 1RABB 5F9LA 1U24A 3OQ2A 2VPYB 2IRXA 1O8BA 3R5BA 4U7UD 3HHLD 3NCRA 3H2UB 3U7JA 3G8SA 4EFAC 1FNOA 1M1HA 2YQ1A 4P7TA 1QJHA 3UN2A 3OL6A 2AF6A 1NPKA 1DY3A 1RWMB 1TKXA 2RDJA 4DV5F 3OFGA 2CNLB 5JVHQ 5HVFA 1KQGB 2XZDB 5DRKA 4DZDA 1S49A 1X0PA 5IC4B 1HHQA 4LF9J 2AQ4A 4EK2A 2PSZA 4D3GA 3GJTB 1UPMB 1WORA 3C16B 1TKDA 4KV8A 1URRA 3DHWC 3X3UA 4C8YA 4CO3A 2MQPA 3QZ7A 3GFXA 3US5A 2D69A 2PD1A 2GO9A 3OHBA 3POTA 1RSCA 2XS7A 4CNZA 3TAPA 3H8YA 1U02A 1JJ4A 4J9SA 1MROB 4OZ5A 1Q8LA 2RIJA 4OYWA 5F0WA 3CCSS 2D3UA 3F73A 3RYLA 2OUGA 1RE1B 1FKPB 4DV6J 2RRAA 3O8WA 1UCNA 4UY8T 3MCOA 4G1QB 1TZ0A 2Z58B 1U1LA 2DNRA 3D6HB 2QLJB 4DUZJ 4KGMA 1V6HA 4E98A 3CCLS 2LP4A 4RU2A 4YP3A 4LQ3A 1KLNA 3MM8A 3KLIA 2QSWA 3K8WA 3AH6A 1B0TA 3LP2A 3TAQA 4JI5J 2BACA 2PFDA 1UW9A 3MWBA 1SXLA 4Q44A 2NSCA 1SKWA 4JI7F 1HR0J 1JLCB 5GAGI 1TL7A 2NZCA 1Q4RA 2QA4S 3OR1B 4USKA 2CA9A 3OV7A 1RKJA 1TL5A 1TMJA 3PEJA 5GAEU 2H5IB 1CULA 2LXFA 4FN5A 2KI2A 2RQ4A 2GFFA 4DUTA 1RT6A 4MFBB 2OMOA 2PA8D 4ZHRA 4ED1A 4EO6A 5IWAF 3FJ2A 4ED0A 2AW0A 3PVXA 3SSRA 1ZAVA 2RNEA 2JC0A 4H54A 4AL7A 2XULA 2XO7A 2B56A 3MECB 3HI9A 2JFKA 2ROPA 1Q5VA 3OHAA 2ZOFA 3HF5A 1LQ9A 1RTHB 3H2VE 2YKQA 3MPVA 1UWBA 1QTNB 2HVZA 5KFDA 2V6AA 1WHWA 2FPHX 1REVB 3PV8A 4KRWA 3HVAA 1D9DA 2JJ4D 4H4MA 4NMLA 2VQFJ 3GG0A 4X4UA 2Z2YB 4O3QA 3UNYA 2W9BA 1TKZA 2Y8WA 1ZZFA 1Q86T 2UUBJ 2GGPA 2VU5A 3CJ0A 4NMXA 3BO3A 1WELA 4K0KJ 3IM9A 1NPRA 1F0XA 2Z8QA 5E3RA 1RWNB 3EVMA 2BW2A 4QR2A 3BKUA 3DKDA 2YWEA 5F8HA 1RZMA 1A6LA 4FXWA 3TZZA 3KNAA 3K5MA 2XBPA 2ZHBA 4IO9Q 2NXUA 4DR5J 3PJWA 4GVBB 1S1UA 3VAIA 4JI2J 2HPUA 2PGCA 3SBMA 3R5DA 4OJ3A 2DNPA 2HMIA 2CPDA 3R8YA 2C2DA 1GEHA 1C0TA 3TYTA 3D67A 3DU6A 1D9FA 3ZXWA 2V0NA 3G82B 3IRXB 1NMEB 3D6MB 3MUMP 2AMCB 1RAAB 3C66A 2HWIA 3QSIA 4YR3A 3QT6A 3KJQB 4PABA 2FYXA 1M5OC 1HBMA 1R0AB 3GU0A 1SPBP 5K5MA 1YHQS 4RUHA 1RTJA 2ZD1B 1KBRA 2OLWA 4FF3A 4IH7A 1X4CA 2Z56B 2V2VA 2RU9A 2VG6A 3VAGA 3B82A 4KHRA 1HNIB 4CQ1A 1UL3A 3NGKA 2GQCA 1RT7B 4TY8B 9ATCB 2HS3A 3G87A 3JAMY 2G1HA 3L7PA 4ED5A 1SQEA 3OJUA 1QDUB 4DV0J 1GMUA 1RTDA 4IFYA 2PC6A 2IJNA 5IV3A 4USVA 4H4KC 3BPDA 3BN7A 2HVHA 4KHPJ 3H59A 1EQ0A 2OTLS 4X4RA 4ILRA 4LSNB 1BXNA 4ERDA 1IN0A 2EBGA 3LP1A 1PO6A 5DO2A 1VFJA 4FNIA 3DYAB 5D6GA 1SJRA 2VG7A 4C7QA 2YKPA 2U2FA 4J7CA 2VPWB 1JLBA 2UXDJ 2A6MA 5SZTA 4F2RA 9RUBA 2QL5B 4PWDB 1WKJA 2RRNA 2R7WA 2J6UA 2NXJA 3RW6A 2KZZA 4OHZA 1M5PC 1NLKL 2D41A 4ILMA 4F4YA 1D8YA 4O44B 5AE2A 5K9FA 1CVJA 4J9KA 2ZKTA 3G8QA 2HNYA 2C22A 1RWKB 3NAIA 1QSYA 5B0EA 2P6TA 2OIHA 1FXLA 4HHJA 2UUAF 5G0RB 5J2MA 3P96A 3UR0A 1D9AA 2J7WA 2W1BA 1NM2A 2BQRA 3CJ5A 3H98A 2HG4A 4WKYA 3OVAA 1UEKA 1F9EB 2LMIA 1HWKA 2F65A 2VONA 3KMSA 2J9EA 3U1NA 2KVIA 3S6EA 4B9TA 4Z37A 2EFPA 1HW8A 4ZVUB 5A8WB 4X4NA 4NLDA 2CQ3A 1G7CB 4V19X 3AJDA 3DGVA 4MKVA 4RU9A 2ZH7A 4NLPA 3NLCA 3W2VB 4F36A 1YGYA 3I31A 2LECA 1G6BA 4WK1A 3TZWA 3BH6B 5FD1A 1SUQA 2RHSB 3NGRA 4ZHRB 4O4RA 4WPAA 4ZVHA 1TFWA 4DR1J 4KJIA 3MM5A 1IUJA 3HKWA 2OPPB 1EKRA 1ITPA 1RBLA 3M8SA 1BQNA 2KHDA 3ZTOA 4D3HA 4J5OA 4ZP6A 1F60B 3IWNC 3FUYA 3HO1A 4GKKJ 4OMFG 2EWHA 2ALYB 4KYZA 5CHCB 1I3OB 3KDNA 2NXCA 4ITSA 2W2NP 1H74A 1Y00A 1RUSA 1MN9A 4C3MA 1RA7A 1CSJA 4PYAA 1J27A 3Q2SC 2GIQA 4I7FB 1V9OA 2W9BB 5KFQA 3SSSA 1ZYQA 4QCLA 4Q0BB 1OS5A 3GIKA 3T1HF 1MMDA 4WP3A 2OMLA 1FDAA 5HP1A 1TELA 3A3OB 3G6XA 4DR7J 1T95A 2VJUA 4AFFA 3X1LB 3WZ0A 4IQXA 1NZAA 3QT7A 1Q5YA 1Q53A 5CCLA 2ZUAA 2HMIB 2R8KA 5LJ5Y 2JC1A 2BKOA 3C2PA 2UZAA 1JXEA 4ZJQA 3BM7A 5CXTA 1FVQA 3B4MA 4MKYA 4YY3F 2EFVA 2E1PA 1XEZA 2XMUA 3RBZA 4DV4F 1PIEA 4NLQA 2XYGB 2QV6A 4O3NA 4I6WA 3AXMA 4N5SA 2ASLA 3OD2A 3QIDA 4UOHA 1HBMB 2CPEA 3TJ9A 1FESA 2EK6A 3DLBA 4RW4A 2HW3A 3RB3A 2GZOA 3G6VA 2N3OA 3D3CJ 4NLYA 5GAHU 2L9DA 3MXHP 2V8HA 2MKCA 2VUGA 2R8HA 1Q8KA 3LP0A 2EEYA 4KGXB 5DS7A 5LMUF 3PRBA 4ZVRB 3LWMA 4YDDB 1BHNA 2HNDB 2XB2D 2CNOB 1WOPA 4P2SA 3MR2A 2M4MA 5HQLA 1F3VA 4ZP9A 4ECTA 4IOBA 3TP2A 1CJVB 2HFOA 1RTDB 5D4LA 1U49A 2DYAA 5J2NA 2BDPA 1IR0A 2B51A 2BOAA 2HLUA 4WFXA 4WZQA 4RLEA 1C4AA 3LP1B 1WEZA 2VG7B 2K7JA 1U4BA 2YWGA 2O5DA 2CAJA 2AEFA 1AFIA 3DDIA 4DPWA 3M2RA 1JNZB 3L4BC 2NSBA 3W2WB 2BRLA 4KT0C 1UZHA 4A8QA 1B7YB 3MUVP 5LSLA 4JI7J 4KTQA 2FGCA 3P6YC 2RAQA 3PW4A 4E2FB 1RWPB 1X4DA 2JSXA 1C1CA 2HNYB 5LM7E 3L3CA 2OPQB 6FDRA 2RQMA 2C3YA 4QWDA 4EEYA 2YNIB 4IKAA 1OQ3A 3PKMA 4PWUA 1Y4ZB 4I2PA 2OD6A 4USUA 2D9PA 2IDEA 1OYDA 3CULA 2DRBA 2DEJA 3VAJA 2P6SA 2V9WA 4KC5A 5IWAJ 4X62J 1RWXB 3M1VB 2XY5A 3GQCA 6AT1B 2DNMA 1WHVA 2N82B 1HBUA 1VHIA 3IM8A 1TR0A 5D0EA 4CYUB 4QIFA 4TLQA 1S0VA 1ZM9A 5CZXA 5BJRA 2OO4A 2N7CA 2FD2A 2KYZA 3WX4A 3T41A 4USWA 2MZRA 1RTIB 1N54B 2ZHOA 2HQFA 5MLCV 2FB0A 4M5DA 1SKRA 1QVGR 1XQIA 1KS2A 1GMWA 3MEDB 5C24B 2HQIA 1KWMA 2MQNA 2YQ0A 1XMOF 2ZE2A 4N7TA 3MM5B 3V6HA 3EXYA 4ECSA 2I9SA 1Y9OA 1FJGJ 3SCLE 2MQOA 2V5HG 1FDDA 3D68A 1IVZA 4MH8A 2J7UA 2JEJA 2KYXA 2HHTA 3G2XA 4C0HA 1FKAF 3MFIA 2Z4PA 4IG3A 4U9RA 2IHR1 2Z2MA 1B0VA 1HI0P 3HHKA 3PTWA 4Q2LA 3P5BP 3IGVA 4KH0B 1VC5A 4DU8A 4MK7A 2KN4A 2JWNA 1M1KT 1S1TA 5KFCA 2YPYA 1E6VB 3BR8A 4UQTA 1NDPA 2HBZB 3AQPA 2RRBA 5F8IA 2AJ4A 1FRLA 4G3IA 2MZ1A 4IR1A 3HVTB 1WOOA 5KFRA 1XN9A 3M6UA 3E8OA 1WUUA 4WU3A 4NL5A 4KSEB 3VGTA 3HFKA 4LQ9A 5IT0A 3A8KA 3H5UA 2ZJPQ 3W5ZA 5ETTA 2IRYA 3M8WA 3W62A 3DLKA 1L3VA 2ACYA 4AL5A 2LU2A 3DDKA 1GXLA 3DOKA 1HW9A 2HZVA 1FDBA 2PMHA 1DFDA 2ADBA 1UP1A 3ZNUA 2E9RX 5KG7A 2DCUB 2XMKA 2YNFA 1H2UX 3W64A 3MDFA 4P2XA 1N5SA 3NBPA 2DD8S 3Q22A 1NSAA 2BE9B 2F40A 3OJSA 2YKNA 4F7VA 3RBEA 4WE1B 1URNA 2G2YA 3UCZP 1HYSA 2WAQD 4WTOB 2DNHA 4KGVB 2PMZD 3DOLB 4MYTA 2F4VF 2MDAA 3ENQA 4CTAB 2IY5B 5C42B 2QL9B 4ZVTB 3H5YA 3PFEA 4URSA 4QWBA 4F2SA 4QZVB 4YOEA 1HQ2A 4P2MA 4EI2A 5FDLA 4IOCQ 1EKSA 4LF5J 1FTRA 1ZH5A 1BWVA 1T9XA 2H4WB 1KOOA 1SL2A 1E6YA 3QWUA 2UUAJ 4DX8H 1XIQA 1S9FA 4WIQA 5KG4A 4O0NA 4ZPDA 1YTYA 3OL8A 1RAOA 3OVSA 3R5CA 3D5MA 2HHPA 1DJ0A 1TAQA 4B3SF 5KFNA 4HI1A 2MQMA 1RT5A 5KFZA 2BA9A 2BEFA 2UXCJ 5EWFA 3JAMU 4DSIA 2W24A 3ISZA 2Z2ZA 3LO3A 4TNOA 4IRDA 4ELTA 4DV7J 4U8VA 5A8RA 1N52B 2X51A 1S59A 2ZFHA 3D0HE 4OYIA 3TOQA 1LWFB 4ALZA 1UW4A 2HBYB 1H72C 4CZCA 3BSAA 4ES3A 4PXCA 3BPSP 1SJ1A 2QZ8A 3AB4B 1U48A 4ZVSB 2XO6A 3GIIA 4PXBA 4FKXA 2MXYA 2IM3A 4KPYA 3PX0A 2A18A 1OY8A 1U8SA 3TUPA 1A7GE 2RMLA 3TR5A 3QIPA 3J81j 2BABA 4LVNP 2MKKA 4I6AA 3WQPA 1ZETA 3PNIA 2HIYA 3KG0A 5F0UA 5ETQA 1Q95G 2DHHA 2Y3YA 3UDCA 5I3QA 2O01C 3H7HB 2FZGB 2YKMA 4M5DB 1G1XA 4URQU 4NLTA 3MR6A 2DHXA 1WSRA 1QAJA 4PPZA 1R6YA 3KK2B 3NGUA 3T1HJ 2ZE2B 4FNHA 4UOFA 1QD1A 3BQ0A 1NH8A 4BBYA 1BGXT 4CLFA 1Q79A 1RHRB 1KRPA 3RZAA 5KFPA 4PXDA 1TL1B 1UFLA 1HBNA 1DHMA 1IWGA 4OIXA 4RO0A 2ZH9A 3EDRB 4BHQA 3OSNA 3BGUA 4P9SA 1LFPA 3GB0A 4YY3J 3LH2S 5KFXA 2AX0A 2M88A 3UE2A 3D66A 4DV4J 3FEZA 4WTYA 2XEXA 3G4SS 2WOMB 5JUMA 4IRCA 3GILA 1K73T 3HVWA 2CQ1A 5CYQA 5L1JA 5C2GA 4WIIA 4GKJJ 5IM0A 2CJXB 1RHKB 2VDHA 2I5JA 1S79A 2DIVA 4H4OA 3MR3A 3HT3A 4LMZA 4YDXA 3ILJA 3G6ES 4LRFA 3EZUA 3HSJA 3JQMA 3KJNB 3CCWA 1NJXA 4O3SA 5LMUJ 2CPJA 4NLSA 4ECZA 3QGGA 2MKIA 1JLEB 1AW0A 2Y1RI 4DCPB 4U8YA 3MD3A 5JXSA 4FBTA 2J0XA 1O6XA 2B0GA 4K2JA 1S4EA 3HHDA 3QLHA 3BJYA 3HX9A 5D15A 3PJ9A 3VVTA 2V4QA 3CJSA 4C11B 2V63A 5ETMA 3J7ZT 1LXJA 7AT1B 1K1QA 2K3IA 3I96A 1YK9A 4X65F 1IJFB 1W7WA 4OI1A 2YNHA 1HNWF 4GC6A 1FK9B 1B70B 4JI1F 4K4ZA 3SFUA 2JNJA 4RNHA 1Z2LA 3ZZ0A 4O4GB 2RF2B 2QIFA 4ER8A 1NNDA 3I5CA 2VDIA 4ZOSA 3R97A 1KC8T 2KZMA 1F5CA 3IG1A 3J7YI 4F67A 2WHOA 4R0EA 5K14A 2MHEA 5DQHA 1IKYA 4WYLA 2VFTA 3I4PA 2G2OA 4NLRA 2A1BA 3MUTP 3NXZA 3QZ8A 1JKHB 5M2UA 3FBCA 3FCHA 3UCUP 1N32F 1I94F 1IBLF 4QIGA 3QGPA 3G8TA 5EWEA 1VQLS 1S1VA 3KK1B 1TK0A 3QRQA 3D54A 3O5TB 5K8OA 1RAGB 4J9OA 5GAGU 2ZVIA 2BMBA 3SQGB 5SUHA 4N8NA 5T7LA 2FHMA 4PAAA 1H98A 4N8OA 3EGWB 2V8PA 4U7UK 1JK9B 3KJVA 1RWVB 1WD6A 1JLQB 3BKTA 2OD4A 1GQEA 3GE9A 4IRKA 3DM2A 1KLMB 2ZH8A 5GAEI 2E1RA 1RYSA 2HFNA 2CG4A 3UPFA 4A8MP 1HBOB 1U45A 2XY7A 2KH9A 4NRTA 3QO9B 1XMOJ 4MK8A 1TL3A 2PIIA 1PAEX 4DR4J 4A48A 2QLFB 5IOLA 5KFYA 1GX6A 1T9VA 4C3KA 1N6QB 5EX3A 2MLYA 4FF2A 1MW7A 1SIZA 4ED4A 3G71S 1FFWB 2AT1B 4YHHF 3NKYA 1FNMA 3P4UB 2V67A 1RGVA 2IDLA 2J6TA 2CNNB 3P3DA 2MSSA 1F5BA 3D6FB 2FLNA 1KTVA 3TZYA 3ZNJ1 2BM0A 1WHYA 1RT1B 1Q0NA 3N4WA 2CJKA 4B9SA 4M5MA 5ETSA 2W7PA 3TARA 3M30A 1AZSA 2KRBA 4K59A 3DFEA 5EGYA 1NK4A 4KB7A 1S7HA 3RJMB 4I0WA 1HWJA 3W8PA 3VAKA 5B0GA 3KMQA 1VLYA 3LUYA 2CWKA 3KLGA 3CDBA 3DMJA 3JYTA 3TEGA 2F9DA 3K0JA 1Q7YT 2CWXA 2GVDB 2DK2A 1DBDA 2Y1LB 4LRDA 2Y8YA 1RT2B 2E5IA 1FFSB 2OGUA 1AB8A 2B9WA
chains in the Genus database with same CATH topology
3SQGA 4H4MB 2AYEA 1ZM2A 3IWXA 1YRXA 4KV8A 2OFGX 1URRA 4I68A 5L39A 2XGPA 1ROFA 2YX4A 2QYCA 3CTRA 3DHWC 3VAMA 4YFUA 3BN4A 5B7WA 5KG5A 3OTBA 3BEGB 3X3UA 4MTPA 2J8AA 1WF0A 4KKOA 4ZCLA 4C8YA 4CO3A 3BREA 5DETA 2MQPA 2R2RA 2CPYA 3QZ7A 2PT0A 3GFXA 5F3ZA 1T03A 4LF7F 3US5A 1GAOA 1S97A 3DLGA 4N47A 1TKZB 5DGAA 2PD1A 1JLQA 3T5HA 2GO9A 3OHBA 3POTA 2UU9F 2GGPB 3PO4A 3WDOA 4WZMA 3SCIE 3TA1A 2OFHX 3TAMB 3G96A 2VBWA 2XS7A 3ZZTA 4CNZA 3JSBA 4F4KA 3TAPA 1SI9A 1SB6A 4ED2A 3SSQA 4ICLA 1KLMA 2B43A 1VK3A 2PA3A 3M8PA 3H8YA 4YB6A 4DEZA 5KT2A 4K4SA 4PG8A 1JJ4A 4DSJA 2OPRB 4DMZA 4J9SA 1MROB 2R7QA 4H4OB 4OZ5A 1Q8LA 2RIJA 4WK3A 4RNNA 1V3ZA 1NKEA 3C6TA 1SL0A 4CT9A 3BQ2A 1LK5A 5F0WA 2QT7A 1OPZA 4YB7A 3CCSS 2NPIA 5J1EA 2D3UA 4TKTA 2LQBA 1HBOA 4CNYA 4ZCIA 4OJHA 3FEYB 2QA1A 4RW8B 2J6SA 4CH7A 3RYLA 3F73A 2F8EX 3KG1A 1NK7A 2M52A 3S7RA 4PQUB 1UVNA 1FDNA 1FKPB 1S1UB 5A8KA 2RRAA 5AXKA 2EW9A 3O8WA 3QO9A 2RQCA 3GV5B 5KFBA 1UVIA 3TRGA 4UY8T 2R2UA 4G1QB 1GX5A 1TZ0A 1IKWA 1LKZA 1TVRA 2HHHF 1U1LA 1U1PA 2DNRA 2VQFF 3OVBA 2GW8A 2PI5A 1R8HA 3LGNA 3HM9A 1C0TB 2DISA 5KFLA 2CFXA 3I5AA 3IS9A 3UDLA 5I42A 2EC0A 3K5OA 3BSCA 5HMYA 2UVUA 4KGMA 1V6HA 1YG0A 4E98A 3CCLS 3GWCA 1SC6A 2EFNA 3WC2A 1N6QA 5J2QA 4RU2A 4YP3A 1HQEB 3MGJA 1KLNA 4LQ3A 3MM8A 3PX6A 4JOUA 3DXBA 2PEHA 2N4CA 2QSWA 3KLIA 3K8WA 5KFJA 3N9UC 3AH6A 1B0TA 2RDIA 3UNGC 3LP2A 3TAQA 4IOAQ 2BACA 2JH3A 3PACA 4HDHA 2LXIA 3SYZA 3BSNA 3OSPA 3FRYA 4IQMA 4TQRA 4WU2A 3CSKA 4O3OA 3M2VB 3MWBA 1SXLA 1R8PA 4Q44A 2NSCA 1V3SA 1SKWA 4JI7F 4DLGA 2L9WA 1JLCB 5GAGI 3MM9B 1AROP 2XMWA 4Q8FA 5D4NA 3T6JA 4E8UA 1FEHA 3R3TA 4TU8A 1Q4RA 2W7OA 5H1SV 2QA4S 3K7RA 3OR1B 4PUOA 2MKHA 1PC5A 1RKIA 2KDOA 4DQQA 2IMOA 4KE5A 2FVSA 1F5AA 3OV7A 2RS8A 2NREA 3OFFA 5F8JA 1RKJA 3OFHA 1RTJB 1TL5A 3FFIA 3CJ4A 4I2QB 2VL1A 1RT1A 1JIHA 2Z2LA 3PEJA 5GAEU 4A8OA 3K8VA 1VRTA 5B0CA 4DV2F 2JVRA 4K4VA 4NZ7A 1FRHA 4DL6A 2DR7A 2JDJA 2VG6B 2LXFA 4FN5A 2KI2A 4BWJA 3NNAA 1UETA 2RQ4A 2GFFA 1Y3KA 2B9XA 2CRLA 1XNRF 3P49B 2KO1A 4B9VA 1VQ8S 2DR8A 2KXNB 3IXQA 1RT6A 1UAWA 1YVFA 2GMJA 3FQLA 4MFBB 3RBDA 2OMOA 2PA8D 4ZHRA 1U1MA 1X9WA 4JYAF 3FZ2A 3LAKA 3S8SA 4ED1A 2JEFA 3NCPA 5D4OA 3TO8A 4MKBA 3WC0A 1GTHA 4EO6A 5CYJA 3FJ2A 3CGIA 5IWAF 3LANA 4ED0A 1OSCA 4OZ0A 2CQGA 4DL2A 2AW0A 2VFVA 2E9TA 3N6NA 3PVXA 5DM7Q 1YIJS 2E5GA 5D3GA 1VGYA 3SSRA 1ZAVA 2HAIA 3M9NB 4K2XA 1P27B 2RNEA 4A8YA 5D8HB 2Q43A 2JC0A 2DGTA 4EZ6A 2JLEA 4H54A 5E7OB 4AL7A 2J0SD 3E2EA 5KG2A 2XULA 2XO7A 2B56A 3MECB 3HI9A 1J5OA 3K5LA 4F02A 2JFKA 2B6AA 2ROPA 2W4PA 1X5OA 3CMAS 2AU0A 3HZGA 3OHAA 4LIRA 1RT3B 4IFYB 2ZOFA 2CQCA 1LQ9A 3HF5A 1RTHB 2M0GB 2X1BA 3GV7B 3HPOA 3H2VE 2YKQA 3JSMB 1UA1A 4N41A 3IR6B 1H38A 3MPVA 4M95A 2JLGA 3AAWB 2Q79A 1UWBA 1RT2A 3BS9A 2HVZA 5ITHA 5KFDA 5C5JA 2B9YA 1DLOA 4EO8A 5DM6Q 1WHWA 3O6QA 2FPHX 1REVB 3PV8A 4KRWA 4DF4A 2B4VA 2DGWA 3PDNA 3HVAA 1D9DA 2JJ4D 3GFZA 5LXYA 1S6OA 1X7VA 4H4MA 4NMLA 4ZPTR 4M1KA 3GFYA 1WWHA 3Q8PB 3GG0A 3KHLA 1XR5A 4WFYA 4NZ0A 4X4UA 3OW2R 1JLBB 1VIOA 4KR0B 3PW0A 1NK8A 3MCSA 4O3QA 5IT9Y 4K4TA 5DDOC 2W9BA 3PHEA 5CZVA 5CH7B 1TKZA 2D9OA 1FCAA 2UV8G 4X64F 1OO0B 4AUKA 1ZZFA 4R8UA 3KJVB 4A8KA 2YH1A 2GGPA 4L3NA 2YWFA 4QJVA 1Q86T 3CJ0A 3TAMA 5LSOA 2LEBA 4K5SA 3BO3A 4Q7AA 1WELA 3ENWA 1Q7LB 1X5SA 3EX7B 5KT7A 4ED7A 2BVZA 3MMAB 3DM2B 5DQGA 3UD4P 2AX1A 1Y5LB 1F0XA 2Z8QA 2DNKA 3DHXA 5E3RA 2DR5A 2KXFA 3TVZA 2BW2A 2OPRA 3LOUA 4I69A 4QR2A 4B3MF 1MROA 1TUVA 2KG0A 2DH9A 4HEA9 2YWEA 5F8HA 1A6LA 4FXWA 3ZZOA 3KNAA 3K5MA 4RW8A 2XBPA 1YRTA 3THTA 2ZHBA 2W4DA 2NXUA 3DRPA 4KO0A 4IO9Q 2N4DA 3PJWA 5EX0A 4O3PA 1S1UA 3VAIA 4O0IA 2CZVC 3BO2A 1FRMA 3VCDA 2ABYA 1RISA 2HPUA 2PGCA 2ZOMA 1VQ5S 4ECVA 4C0BA 1Q81T 4PG4A 5FIIA 3R5DA 4OJ3A 4J9PA 1N8RT 4XK8C 2DNPA 4G1QA 2BUNA 2CPDA 2HMIA 2R4FA 1NO8A 5J2MB 1U1OA 2WBRA 2CQDA 1TL3B 2L3MA 2C2DA 2R7TA 2DO4A 1C0TA 3R27A 5DG8A 1U26A 3KHHA 4ZPVR 3RAMA 3TYTA 1KTQA 4MIWA 1O0PA 3DU6A 1D9FA 2XNRA 4NOHA 1HPZB 2R7XA 2V0NA 3IRXB 1HQEA 4M94A 3QWPA 1CC8A 4ZLPA 2CPIA 3MUMP 1T3OA 3PFOA 3C66A 3ISNC 2HWIA 3D1HA 4YR3A 2UVWA 5F3TA 2HS4A 1MWZA 4PR6A 4NXMF 5F8GA 4QIVA 1XMBA 4OX7A 3TQ1A 4FS2A 1LV5A 4I4BA 4ETXA 2A2CA 2XI3A 4FXDA 2LYVA 4PRFA 4TY9A 1M5OC 4I6YA 1B7FA 2UXBF 1JLCA 1HBMA 1UJ4A 2GHPA 3MM9A 3IC1A 2HIQA 3GIMA 1RA6A 3KFWX 3LGMA 1R0AB 3OR1A 4I1TA 3E3XA 5K5MA 2IC3B 1R89A 1YHQS 2YKOA 1Y5IB 1RTJA 4RUHA 4N77A 2DRAA 3UCGA 1LWCB 2ZD1B 2J9DE 4CH1A 4FYDA 4I2QA 2MGZB 2OLWA 4K4XA 4FF3A 5KTQA 2DGUA 2MZQA 2JL9A 2FC8A 4IH7A 1X4CA 2A10A 1WG1A 2KRRA 2WSFC 3B78A 2DPJA 3OXFA 3F41A 2RU9A 5DDQC 1N34F 2VG6A 2HQ3A 5DQIA 3B82A 3LPYA 3VAGA 1XR6A 1VI7A 4KHRA 1HNIB 4CQ1A 1UL3A 3NGKA 4HVZA 4CCHA 1S4FA 2GQCA 1FEEA 1R8AA 1RT7B 1WI6A 2QLWA 4TY8B 3VALA 4AQYF 4MFBA 2ILZA 2F8HA 2HS3A 3MHYA 5JVGQ 1SUQB 3QJPA 1EP4B 3W7BA 2CJ9A 3ZZYA 4ES2A 3OFEA 4AXJA 5E3AA 3JAMY 4YQWA