2BOPA

Crystal structure at 1.7 angstroms of the bovine papillomavirus-1 e2 dna-binding domain bound to its dna target
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure at 1.7 A of the bovine papillomavirus-1 E2 DNA-binding domain bound to its DNA target.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*CP*GP*AP*CP*GP*TP*CP*GP*GP*TP*CP*G
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1994-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bopA00
1WWHA 2EK1A 1HA1A 5DETA 1YJ9S 1RKJA 2LMIA 2DNLA 2ZJQQ 5LSLA 3CCVS 2AYGA 1WF1A 2CQDA 1M5VC 1WEYA 1VQOS 1X0FA 2O3DA 2J0QD 2LEAA 2G4BA 1SJ3P 2XNQA 1D9AA 1U1LA 3VAMA 3H2VE 1KOHA 1N8RT 1WI6A 2YTCA 3CCQS 3CTRA 3BO3A 2VODA 2L08A 2RNEA 1URNA 2DGXA 2RS8A 3P49B 1N54B 2MKSA 2MKCA 4WIIA 3TP2A 2DIUA 3G8TA 1VQ6S 2OTJS 4W92B 2JVRA 1UFWA 2AYEA 2M4MA 3MUTP 2FPHX 1YI2S 3UCUP 2MKJA 1PGZA 2KXHA 1DZ5A 2MQMA 4LIRA 1M5KC 2X1AA 1SXLA 3MI7X 1U1RA 3ZZZA 4QU7A 2FC8A 2K3KA 1DBDA 1WHVA 3CF5Q 1X5PA 5EN1A 2LXIA 2QEXS 2CPZA 2DGSA 2G1DA 3UCGA 1KOOA 3FEYB 1M1KT 2K8GA 2DIVA 3BO4A 3MDFA 2KI2A 2XB2D 2RQ4A 3CPWR 2DNPA 2PEHA 4OZ0A 5GAEU 1ZZFA 4CIOA 3DXBA 1OPIA 1WF0A 4WFAQ 2DH8A 1R8HA 1UW4A 2HYIB 2OTLS 2KFYA 2LEBA 2MJUA 2U2FA 1YJNS 3S6EA 2MZQA 1VQNS 2DGUA 3BEGB 3Q2TC 5MLCV 2D9OA 3UWTA 1Q81T 1K9MT 2MQNA 2DHXA 3Q2SC 2MKHA 2RS2A 3G4SS 1OIAA 2KYXA 2DGTA 3CCLS 3J7ZT 2LCWA 1JJ4A 3RW6A 2RQCA 3VAGA 1SJRA 1VQ8S 1WEZA 5HO4A 2ZJPQ 2X1GA 2RT3A 1N88A 3R1LA 3NMRA 3PIPQ 2SXLA 1U6FA 2CQCA 4PKDB 3V4MA 3G6ES 2DNQA 1X4BA 4W90B 3SDEA 2DGWA 1FJCA 1U1OA 2U1AA 1UP1A 2KXFA 2N3LA 2N82B 2DNGA 3VALA 1B7FA 2M88A 3MOJB 5LXYA 2DNMA 2V94A 2KHCA 2CQ2A 3MUMP 1FO1A 3R1HA 1KC8T 2LXUA 3IRWP 2D3OR 1WELA 1FJEB 4UQTA 3B4DA 2DO4A 3MXHP 1VQ5S 3VF0B 2UP1A 4WFBQ 2DISA 2M9KA 4PR6A 4F02A 4YUDA 5GVQA 1X4HA 3S01A 3ZZYA 1K8AT 2Q79A 1RK8A 2OJ3A 5H1SV 1YTYA 2MSTA 4LJMA 5DDPC 5GAHU 2CQIA 3L3CA 3S7RA 5DDRC 2CQ1A 2XNRA 2KN4A 3VAHA 2RUGA 1VC0A 4WKRA 2ADBA 2E5IA 2WBRA 5FJ4A 3BO2A 4CH1A 1WTBA 1W2BR 2L41A 4WCEQ 4QQBA 1X5SA 1WHXA 2DNNA 1X4FA 1CVJA 2MYFA 2DH7A 2CPYA 5DM6Q 2CQBA 3CC4S 2HZCA 1X5OA 4LMZA 4PRFA 5DDQC 1X4DA 2DB1A 2MGZB 2L9WA 5BJRA 2MMYA 1O0PA 2KT5A 1SJQA 3CMAS 3HHNB 2MQPA 3CCSS 4C0OC 1HL6A 2MXYA 2CQ0A 4C4WA 2LECA 5ITHA 3B4MA 2MJNA 2XS2A 2MZJA 2M0GB 2N3OA 2DHSA 3NNHA 1PO6A 2F9JA 5LJ5Y 2E44A 1VQ7S 2CQGA 1QM9A 3P5TL 1X4EA 2HGLA 1WI8A 3CULA 3FEXB 2F3JA 3TYTA 1VQ4S 2B0GA 1U1QA 1M5PC 2AYBA 3DLLQ 4Z2XA 4Y00A 2MZTA 3THTA 3LPYA 2JRSA 4Y0FA 5IQQA 3PIOQ 1FXLA 2MB0B 4FXVA 3CXCR 3G9CA 1FJ7A 2KH9A 3CC7S 4ZKAA 2CQHA 2KXNB 2FY1A 2LA4A 3ULHA 3CMES 2LA6A 2RRBA 1S72S 3G71S 2A3JA 3MD1A 4FXWA 4BS2A 1AUDA 5HL7Q 1N52B 2MZ1A 1WG1A 2EVZA 1VBYA 2LKZA 3NNCA 4IOCQ 2PE8A 3MURP 1YITS 1FNXH 5LJ3Y 2J76E 1QVGR 3P6YC 2LYVA 3TO8A 2DK2A 1DRZA 2KM8C 1WEXA 3BS9A 2MZSA 4TU9A 1U1KA 3UD3P 4F25A 3J7YU 3VAFA 1VBXA 1L3KA 2GO9A 3VAKA 3THPA 3G96A 2E5GA 4A8XA 3N9UC 4ERDA 3US5A 3CCES 2RRAA 1YIJS 4IUFA 4UY8T 1NU4A 1VC6A 2XSFA 1UAWA 2CPDA 2X1BA 2G0CA 4OZ1A 2M7SA 2VOPA 3RW7A 1S79A 3IWNC 1VQLS 1HD0A 1ZZNA 1FT8A 5IM0A 2FC9A 4CQ1A 1OO0B 2HGMA 4WF9Q 2DO0A 1Q82T 1ZH5A 5LSOA 3SMZA 1IQTA 1WHWA 2X1FA 1X4AA 3HI9A 4U67Q 2DNZA 3R27A 5CYJA 3LQVA 3S8SA 2E5JA 3P3DA 1NJIT 2XS5A 1U1MA 1DHMA 2CPIA 1WG4A 1M5OC 2JWNA 4RU2A 5DM7Q 2F9DA 1KQSR 2MY8A 5JVHQ 1Q7YT 3EX7B 2BOPA 1VQ9S 2KRRA 3UE2A 1H2VZ 1JJ2R 2KRBA 3H2UB 1HD1A 2CPJA 5IM0B 2J8AA 5D77A 5GMKa 4TU7A 5CXTA 2YKAA 1F9FA 3U1MA 3CUNA 1R8PA 2MZRA 4C7QA 3I56S 2YH1A 3D2WA 2YH0A 3VAIA 1U1PA 1KD1T 4M5DB 2HVZA 2ERRA 5JVGQ 3UD4P 1VQKS 2QA4S 4QU6A 2M52A 2CJKA 3MUVP 3CD6S 2MHNA 2CPXA 5IFMA 2RU3A 1BY9A 3OW2R 4YOEA 3CCJS 1H2TZ 2KG0A 2EK6A 4TU8A 1G2EA 2MY7A 1A7GE 2MGZA 4QPTA 4CH0S 1JMTA 3JB9k 1U1NA 3NNAA 1D8ZA 4IO9Q 1X5TA 1P27B 2DGOA 4F26A 2I38A 2RVJA 5D78A 5GAGU 2M70A 4P6QA 2NLWA 2DNKA 3EGNA 4IOAQ 2KG1A 2DHAA 1SJ4P 2MKKA 1WG5A 3EGZA 2OIHA 1U2FA 1YHQS 1JJHA 2DGVA 3K0JA 5GADU 2CPFA 3CCUS 2CPHA 2CPEA 2CQ3A 2MKIA 2DH9A 1VBZA 1Q86T 4TLQA 2E5HA 3NS5A 2YWKA 2CQPA 2ADCA 3UCZP 2FHOB 2ZJRQ 2QFJA 1VC5A 3MD3A 1K73T 2LQ5A 1QVFR 1U6BA 2VOOA 1WHYA 1XN9A 2DHGA 2DNHA 2KU7A 1P1TA 2MSSA 2XS7A 1A9NB 5CA5A 2AYMA 1WF2A 2DNYA 5DDOC 2I2YA 4ED5A 4WFNQ 2DNOA 1H6KX 3SDEB 2MQOA 1FHTA 2J0SD 2OSRA 2HGNA 2JX2A 3G8SA 2MQLA 2DNRA 3U1LA 3NS6A 4V19X 2MQQA 2KM8B 1NO8A 2M8HA 1YJWS 1X4CA 1VQPS 3SXLA 2VONA 2AD9A 3I55S 2M8DB 3VAJA 2BZ2A 5LXRA 1SJFA 1YWXA 2CQ4A 4YB1P 2GHPA 2N7CA 2OSQA 3CCMS 4EGLA 4J5OA 2DGQA 1H2UX 2NZ4A 1X4GA 2JVOA 1VQMS 2MPUA 3CCRS 1M90T 2M2BA 2KVIA 1OWXA 2D9PA 3CC2S 2DITA
chains in the Genus database with same CATH superfamily
1WWHA 2DKOB 1HWLA 4ICLA 4JYAF 2FHJD 4NYZA 2ZJQQ 3LO3A 4ICLB 4USIA 1TL4A 4Q43A 2KYZA 3FMBA 5ETSA 5LSLA 2A2CA 4DSKA 3BN4A 3CJ4A 2MKYA 2YQ1A 1G6BA 3WIUA 1X0FA 1R0AB 3CJ3A 4NLOA 2RF2B 3KUGA 1FD8A 4ZS6A 2DR7A 3T1HJ 1OPZA 1SH2A 3HKZD 1AYEA 3A3PB 3P96A 5L1KA 2Y1LB 3OXGA 2DTJA 2FD2A 2UXCJ 1D9AA 1RCOB 3C15A 4DG1A 5BYSA 4CLWA 1U1LA 1FK9B 2V8VA 3EMTA 3Q8QB 3H2VE 5D4NA 1NDKA 5L8RC 3HVRA 3Q8SB 1WI6A 2VPZB 1MW7A 1RWVB 2RIJA 2WCXA 2YNIB 3C6UB 5K8PA 1FFWB 2ACYA 3I6PA 3PG9A 3TVYA 1Y5IB 1UVMA 4CT8A 4MK8A 3FSXA 4ZLLA 5KT7A 4ED7A 2DVIA 2EFNA 4BWJA 3S1TA 3T1YF 1YLXA 1HLWA 3LA0A 4L6V3 2FY8A 4USKA 4X66F 5AXKA 3AY0A 4LVOP 4ES3A 3RRHA 1PYOB 2JVRA 4ZDNA 4W92B 3JTOA 4YQWA 4YB7A 3QGGA 1NKBA 5FDLB 1KSPA 4JI5J 2FPHX 1YI2S 1RHUB 1N0VC 3QMQA 4GVBA 4RW8A 3U02A 4BBYA 2ZM6F 1PGZA 2R7TA 5H9FK 3CJSA 1AW0A 2MQMA 1RSCA 1M5KC 4GVLA 2CZ4A 2HIYA 3LP1A 3MFIA 3KJVB 1ZAVA 2FC8A 1SIWB 3JQJA 3LGNA 4F50A 5EDWA 3KJVA 3CF5Q 5EN1A 2IA6A 2LXIA 1FDNA 2VJVA 2LFVA 2YH1A 3G82A 4DR5J 2CPZA 3FEYB 2HFSA 1NUEA 2XCPA 1ZYQA 1TV6A 3MDFA 2KI2A 5G0RB 3O6QA 5B0GA 4QR0A 4M5DA 3R7BB 2V9WA 2H3EB 3CPWR 3W2VA 2VG7B 3CJTA 3D1HA 4ZVQB 3RB3A 1ZZFA 1BXNA 2FHKA 3D1QA 5GADI 2A1BA 3POTA 4HHJA 3R7SB 1UFLA 2D3UA 1S59A 1R27B 1R8HA 2DH8A 2C2OB 2VBXA 2YWGA 1RYRA 2OTLS 1RT7B 3G86A 1C4AA 2AIRB 2U2FA 3S6EA 2IFXA 2JH3A 2DGUA 1RT7A 3BEGB 3Q2TC 4FXDA 2P5VA 2D9OA 1UJ6A 5MLCV 2CJXB 1K47A 3E01A 2OD6A 4PG8A 2V8DA 4IFVA 4DV2J 5ADZA 3QGPA 4DZDA 2RS2A 3G4SS 1OIAA 1VI7A 3D5MA 1I94F 1DLOB 5IC4B 2HHSA 3EWGA 4PUOB 4ETZA 2LCWA 2O67A 3I32A 1B0PA 3LANA 5L39A 4DUZJ 1ZTWA 2BANA 3C66A 3M32B 3AAWB 1UJ5A 3KNAA 3EXYA 4NZ6A 1N34J 3ZNUA 3DRPB 3RYLA 5HO4A 3H25A 4X4NA 1NSAA 2GQQA 2W4PA 3H20A 4ZP8A 3VGSA 4Q44A 1TFWA 1RZMA 3PIPQ 3KUEA 2HS4A 1PSDA 2VC0A 2ZUGA 2WONB 5K20B 3IWXA 3G6ES 1NZAA 3R5BA 1X4BA 2ZH4A 3SDEA 2ZVIA 2FLPA 1FJCA 2XMUA 3UN2A 1U1OA 4DR4F 4ZIWA 1WC0A 2U1AA 3D7SB 4P2SA 3DOKA 2ZDOA 2VDIA 4HT5A 4R0EA 5F9NA 3F73A 2CJBA 2H48B 3DM2A 4O23A 3TAQA 4ZJQA 5RUBA 3K5OA 3MEEA 2QV6A 2H54B 1U47A 4A8MP 2CQ2A 2J9EA 4YP3A 1S9GA 1EQMA 2B4UA 1IKVA 3MM9B 5AJ3F 4M5HA 1KC8T 1KEKA 1RCXB 3DYAB 2I1RA 4ZP7A 3Q83A 2DD8S 3K8WA 4ZVGA 3RU0A 4EUVA 9ATCB 3B4DA 3JSRA 2I6WA 2DO4A 5A8KA 3OUYB 4NZ0A 1APSA 1WJ9A 2XYPB 1HMVA 1RTHA 3HT3A 1VRUB 4DPOA 2X51A 3OUYA 3HZEA 2ZM6J 3VF0B 3N01A 2M9KA 1VRUA 4F2RA 1T9XA 3KJFB 2QSFA 4G1IA 3HSDA 5C2GA 1S57A 2QMWA 2YX4A 5J1NA 1RT1A 1SV5B 2V67A 2RHSB 3EGWB 4KGKA 3G2XA 5I3PA 2C3YA 2C2MB 3B78A 2Q79A 2UUWA 4Y2MA 5KT2A 3KFWX 3PTWA 1F9EB 2A6MA 1WDTA 4XPEA 3QZ7A 3KG0A 3W65A 1T9UA 3L3CA 4ZVEA 5E5NA 2J9DA 2GS8A 2XNRA 2KN4A 3CD0A 3VAHA 4NLTA 4D3GA 1JLFB 3IR5B 3K5PA 3D6HB 1VC0A 1TU0B 4IQMA 2ADBA 4IG3B 4UOGA 2WBRA 3RBZA 5FJ4A 3BBBA 3BO2A 2J6TA 5FLXU 2ZNYA 1FK9A 3GLJA 4QQBA 2L48A 1WHXA 1VQYA 4WP8A 1UZDA 1X4FA 3OD2A 1ZM2A 4EK2A 2R3VA 4RX6A 3I5CA 2V50A 2IM3A 4QZVB 3TAMA 2HNZA 4ZVUB 1TQLA 3EJMA 3RZAA 1N5VA 4NLGA 2YQ3A 2CPYA 4C8LA 4JI4J 3ITHB 4PG5A 3F56A 4QYZJ 3K2YA 1FDAA 4PRFA 3PDNA 2UXDJ 2HIQA 2DB1A 2RSQA 2B7BB 5A2QU 1EP4A 2MGZB 4ZJOA 1SQGA 1IM4A 2AJ4A 1O0PA 2MMYA 3QFHA 4WU3A 4CO0A 4N56A 1SCJB 4RW8B 3OJUA 2WRMA 2ATCB 4UOFA 1Y10A 4USTA 3CT9A 4DX7A 1MWQA 1FVSA 3H5XA 4MKBA 3JSBA 1N56A 1XNQF 4LF6J 1PJ5A 1NNDA 3HHNB 5HQ8A 5D8HB 1I5OB 2ZEJA 1UVIA 4NA1A 5K8MA 3GE9A 4PWDB 2CKWA 2ZITA 4GO5X 1GX6A 1KBRA 1R43A 2IBKA 2MJNA 3L7PA 2XS2A 3QJPA 4N8NA 2JSXA 3M8YA 4G3IA 4K2JA 2HQ3A 2DHSA 3IR7B 2G0JA 4HLBA 2F9JA 4Q7AA 1HWKA 3VQTA 4ZLNA 2IJRA 3DCAA 4OYZA 4ELTA 4C11A 3GCXP 1WI8A 4DL7A 1FF2A 4WE1B 3AD8C 1ITPA 3MM5B 3TYTA 3V6DB 1VQ4S 3Q8PB 1SQFA 4K4VA 1WKLA 2E66A 2W1BA 4RL1A 1VR6A 2C3UA 3ILLA 4J9LA 1T7PA 4Z2XA 4LF8F 4Y00A 5HANA 1RU1A 2QGFB 5GAEI 2ZHAA 1D9DA 4YHHF 2W2NP 3IM8A 3NAIA 2DR9A 3PO5A 2CAJA 1DLOA 5IQQA 2BKPA 3FQKA 5IC6B 4JI8J 1U0HA 1FXLA 3CXCR 4P72A 4OI3A 1S6PB 1S1TB 2E1AA 2KH9A 4LF4J 1K44A 5L1LA 1RT6A 2CQHA 4KGMA 3PCOB 1TFYA 5C7PA 3H5SA 5J2NB 3ULHA 2FUG9 1RAEB 1RTJA 2IBOA 3RUBL 4B9MA 4HKQA 2D74B 2LA6A 1LWXA 1TKZA 3T3FA 1S72S 3BDPA 4G65A 4Y2KA 4W98A 4D3HA 1D1UA 3CD5A 2GAHC 2H4WB 4HHUA 4ZVPB 2LKZA 2UUBF 3MCNA 1YITS 1B70B 3SFUA 1CJTB 4L74A 5LJ3Y 2HSEB 2J76E 2GVZB 3DOLB 4MH8A 4X62J 1T94A 3TO8A 2J9CA 3GFZA 1DRZA 2DY9A 4TQRA 1RWWB 3PX6A 1Q79A 1SL2A 3P8BB 3D67A 4RLEA 2HHXA 2IVMA 3QFWA 4F25A 1XMQF 1L3SA 5IV3A 3EPGA 2GO9A 1P1LA 2W7AA 3NRBA 3V6HA 1HNXF 4X4SA 2BKOA 4ILRA 1SKSA 4WYLA 2C28A 4LSNB 2EWHA 3CCES 1YIJS 3MEGA 3NP5A 4DR3F 2WVCA 2CNOB 5HJYA 3OHAA 2G9OA 4GRSA 4UY8T 1TMMA 2XSFA 2PC6A 3I87A 5KG6A 3UVJA 3DHWC 2D3O1 2R8GA 4OHXA 3DLBA 3BB5A 3IO1A 2M7SA 2IAJA 3IRXB 3RW7A 4DR7F 5T41A 3D3CJ 4R8UA 3SSSA 1VIOA 4KC5A 4AD6A 5KTQA 3BM7A 3OTOJ 1VQLS 1CQMA 4CM2A 1HNZF 4DR6F 4IFYB 1K1SA 3GFXA 1JKHB 1RHJB 3QSYB 2FIUA 2WW4A 3NWGA 4F3QA 2HQIA 1EETB 2IMOA 3OTDA 1NXIA 3IS9A 4RO0A 5DO2A 2GC8A 2ZBPA 4EEYA 4DCOB 4EBCA 5IS2A 3W62A 4BDPA 1TK8A 3CO9A 1YK9A 4DU8A 4Y2IA 1LXNA 1N36F 1FX2A 4IG3A 2R8KA 1VK3A 4A8YA 4O0IA 2NR0A 3M8ZA 3W66A 4E2FB 1QTNB 4QPXA 5D0HA 1Q0NA 3SCIE 1U1MA 3C15B 4YY3F 1DHMA 2BW7A 3EM1A 2QN6B 3NWRA 4M5GA 4MT1A 3QRPA 4ZVHA 3TAMB 3B8HA 3N5BA 4USUA 1B0TA 3TX0A 3HDSA 3TUZC 3TANA 3DFEA 2MY8A 4JI8F 5JVHQ 1Q7YT 2HFUA 1IXKA 2XZTB 2YWHA 1E6VA 3HCXA 4OFZA 4MIAA 4DL4A 3HHDA 3HD2A 4FVCA 3R2CJ 4BWMA 2Y3YA 4J9VA 1WSRA 2G1HA 1JJ2R 2DYAA 3EE3A 3FQLA 4FYWB 1TL7A 2IA0A 4Q2MA 2N7YA 2CPJA 4P52A 5IM0B 2J8AA 2YKMA 2P8IA 1UCNA 1YX2A 4RPFA 4X65J 5HAOA 3THVA 5EX3A 2CJAA 1MSWD 4O44A 4MKVA 1DAXA 3TJ9A 2HFVA 4KFBA 4DJBA 3GIIA 3O44A 1RAAB 4M94A 2VPXB 4QOTA 4LFBJ 1FX4A 1R8PA 2BXJA 2IIHA 2OAUA 2QL9B 4C7QA 5DLGA 2HRTA 4ES1A 1BWVA 2VG6A 2FLOA 3EDRB 2IYGA 3N0VA 1G3OA 4CLZA 3I82A 3I56S 4LF4F 4Y6IA 4B3OB 1R8AA 5HMWA 2QLWA 3AH6A 1AFIA 3MM8B 5KT4A 1HQUB 2XMJA 3GILA 2HRUA 5MAOA 3E8OA 4M5DB 3SCKE 3MM8A 3J80Y 3KLHA 4HACA 1XMQJ 1VJWA 1S1WA 4JV0A 3KLHB 2M52A 5D15A 5GMEA 2MTLA 1KONA 1RAIB 3BGUA 3EDQB 3NOGA 4KBIA 4WPAA 5DS7A 2E1CA 3CD6S 2CPXA 5IFMA 4LSLA 2RU3A 2PD1A 3D0GE 3T1HF 2HHWA 2QYCA 3TOQA 3W61A 2KG0A 3IBCB 4KB7A 4MTPA 4WBFA 1GEHA 2POKA 4FN5A 2JNJA 1QDUB 2AZ3A 2OEJA 3IBWA 4JI0F 1GT8A 5CHCB 4C3LA 2FYXA 4TU8A 3M6VA 5K14A 3K59A 1RTIA 3N6LA 2WW8A 1ZM3A 1JLQA 5DZ7A 2XMAA 4OV1A 3WHIA 5HJXA 3FBCA 1U1NA 1BQNA 1D8ZA 2PMWA 3V6JA 4M5JA 4C8KA 4DUYF 4RW7A 4IO9Q 3TZXA 2DGOA 4S0MA 2YKNA 4OX9F 3TAPA 3AA8A 5F3ZA 2GIFA 2ZH7A 3TI0A 5I42B 1FEEA 2PI5A 3UN5A 1XNRF 1OMSA 4UZCA 3TEHB 1S0VA 2XMVA 3HZGA 2I0XA 2K7KA 4Q0BB 2R8IA 6AT1B 2C3OA 1ZS6A 5ETLA 1T03B 4YEAA 4DX5A 1S10A 2J7WA 4NA2A 3KHRA 3BPSP 1NDLA 2DHAA 1XEZA 2OLWA 5B0BA 1AB8A 2ZHBA 2GMJA 2ASDA 1SJ4P 1WG5A 1CJTA 2HBYB 4HYKA 1QUVA 2BVZA 1U2FA 4IDKB 3O3LA 4Y2AA 2O66A 4DV4J 3F41A 1T11A 1Y3JA 1YHQS 3DRYA 5KFYA 1Y9OA 3W63A 3KK3A 5I3UA 2NREA 4LF9J 1HPZA 1FXRA 1WNEA 2Z57B 1WACA 4LR7A 2HLTA 3LP0B 4DQQA 2MKIA 4CLFA 1VBZA 2Y1JA 2PA8D 1IN0A 1VOMA 3NEKA 1VS3A 5ETPA 4X84A 5C42B 1L5UA 1TAQA 3MWBA 2QMUB 3ZTRA 4ZPDA 3J80U 1S1UA 1DQ8A 2AEFA 4C9DA 2CZ9A 2QFJA 2Z2MA 1VC5A 3RB6A 2XBPA 2GGPA 2CZVC 2BJ1A 2IYIA 2AJFE 3ET6B 2KU7A 1P1TA 2MSSA 2XS7A 1A9NB 4KY3A 4AFFA 2OPSA 4JBCA 1X60A 1JKHA 1YBTA 1WF2A 2KHDA 4KYZA 2OP5A 2QYGA 3AQOA 4KE5A 2OPSB 3ZXWA 5DDOC 1OS5A 1S1VA 2AEMA 5KFHA 4QWAA 4WFNQ 1FHTA 1H6KX 4U6PA 3K58A 2J0SD 2OSRA 2FGCA 2V6AA 3CGIA 2IRUA 2W8KA 1R8CA 4LBIA 2JX2A 1VRTA 2CJYB 5SUHA 5C5JA 1Q8KA 2W2QP 3GIMA 3KHLA 5D3GB 2UVRA 1H3DA 2Y1RI 3KUHA 4J9SA 3MF5A 1B99A 5F0WA 1YJWS 2VQEF 5KFDA 3LGHA 1U24A 3EGVA 4YDXA 3F0NA 3NCRA 4LIWA 5E2QA 2CIMA 1UWAA 2XSJA 4KGXB 1RABB 4CYUA 2B9XA 2O01C 4YS2A 5A8WB 5LXRA 3UPFA 3R2DJ 1KRPA 2ZZTA 2E7WA 3A1YG 2OSQA 3ZC4A 2ZH2A 3CCMS 4DFMA 3IP0A 4J5OA 1IBCB 2VODA 4K0KJ 3HVTB 3AFGA 3I5BA 4LRFA 4JYAJ 2G0IA 1VQMS 2MPUA 3CCRS 4OX9J 2PI4A 4AL7A 1RXOB 1S4EA 5F8NA 3OR2A 2VQFF 3SI8A 5A8RB 4OJ1A 4B9TA 1TL5A 2WVEA 1M1GA 1GXTA 4NMXA 2CRLA 1OWXA 2D9PA 5A8RA 1KHWA 3DRRA 4DV3J 4ER8A 4USJC 4TY9A 2F8MA 3CC2S 3OTEA 2E5LJ 2J0WA 2JHEA 2Y0BB 2AV5A 2LMIA 4YB5A 4DFJA 1YJ9S 4O4GA 2K1RB 3W1YC 4AQYJ 4IRKA 1HARA 1NZ8A 2DCLA 2YNFB 2ZOMA 3G8QA 2JEIA 4DV4F 4QWCA 5AXLA 3LP1B 1WF1A 1UW9A 2DEJA 1M5VC 1VQOS 2HW3A 5KAKA 2G4BA 1MNEA 3OT9A 1QSLA 1SJ3P 2XULA 1BE4A 3C14B 4LFCF 2F4VF 2LLZA 5KG5A 3T1YJ 5G0RA 2QSWA 2YQ0A 2VA3A 1D09B 1WKKA 3C14A 2XWYA 3W2VB 1KOHA 2V8GA 4HH0A 1Q4RA 1RTDA 2H65B 3IGNA 1DURA 2XMMA 3CTRA 4CRJA 4OYWA 3T5HA 3RBEA 5M2RA 4C8NA 2ATLA 4DSLA 2HHVA 5HK4A 2DRAA 5KFOA 2DGXA 2WVFA 1HBOA 2DPIA 2AHOB 3FSYA 3N4WA 4WIIA 2UVVA 5K14B 2FLLA 2E9TA 1HBOB 4NLUA 3A3OB 4DHVA 3K8VA 3BBFA 3VQSA 4IQXA 1TZ0A 1FWLA 3D6MB 2OTJS 1RE1B 2QZ8A 3R6GB 4ID5B 4KR0B 4XPCA 1C4CA 5KFPA 1PYTA 3DGPA 1WSVA 4Y34A 4JI4F 3LALA 2RU9A 2ABYA 2KXHA 3C6TA 2YKNB 3EXCX 1DZ5A 4PZVA 4RUBA 3QJLA 1VMBA 3AJ1A 3MAAB 5LL6d 4PQUB 3E3XA 2X1AA 1SXLA 5B0CA 3ZZZA 5CQGA 2DBBA 2FTRA 1TMJA 5D4PA 2JLFA 1DBDA 3DRPA 2HMIB 4CLTA 3GSIA 1EJ7L 1O6XA 1U2RA 3KLEA 3MHYA 4OYOA 1BQXA 2EBEA 3OL8A 2KFNA 4G1QA 4PXEA 3UCGA 3M2UB 3UR3C 1M1KT 2WVDA 2DIVA 2X7IA 5DJBA 4LF6F 2VBWA 2WTFA 2OEMA 2PEHA 3UW1A 4K7QA 2OH2A 4BCAA 3RRGA 4ID8A 1FKPA 1UVNA 1UETA 1AROP 2FGOA 1NHKL 5CYQB 3KXDA 4ZP9A 2KJWA 4WFAQ 2VB6A 4GC6A 2KL8A 2UVWA 2HVIA 1WORA 4RW6B 3CO0P 3DXSX 1IQZA 2MJUA 1LFPA 2VBZA 3PNIA 4CO1A 5JJBA 4NXMJ 1S9GB 3UR0A 1Q81T 1RWKB 4LF2A 3UWTA 2I5JB 4FS2A 1K9MT 5B7WA 3PRVA 2FZGB 4OV6A 4UTGA 1BUXA 2KYXA 1S1UB 4DV3F 2DGTA 3HHEA 5KG4A 4NLDA 2HZAA 5KG1A 2HHHJ 4K4TA 4OYBA 2GIQA 1VIXA 2YX7A 3M8QA 1UKUA 3NCPA 4J90A 4ZIVA 3VAGA 4LF8J 1IVZA 4AQYF 2KB2A 1U48A 2FVPA 4TVAB 1WEZA 2H5IB 2IAJB 4DL5A 3NMRA 1QJHA 4U7UK 3TRGA 3M9NB 4H4MA 3UDLA 1H38A 2VKZG 1LEOA 3JTNA 2MHEA 4NI2A 4PKDB 4CLKA 5B08A 5J2MB 1N5YB 1F5AA 2D3ZA 4B9UA 3T9NA 2C2NA 4NI2B 3AOBA 4W90B 4ILMA 4OL8A 1P8GA 1LFWA 8RUCA 1EETA 2DGWA 1NEEA 3T6JA 4X4OA 4JI1F 3E51A 1S77D 2C2DA 2CWXA 3PY8A 3POTB 2N3LA 1T3OA 3BGOP 2J9DE 4LRBA 1R0CB 3VALA 1Q8IA 2M88A 3W8PA 3LW5C 1S49A 3UDEA 5LXYA 2DNMA 3OHBA 2UUCF 1B64A 2KHCA 2RQMA 2NPFA 1FO1A 2ZD1A 2YNGA 4X62F 4F67A 3R1HA 1CJUA 2LXUA 4QR2A 3IRWP 3HK2A 2ZD1B 1KHVA 5EWEA 1NJWA 1XIQA 2GQCA 2W2OP 3NGUA 2BW2A 2K3IA 3AD7C 4P7VA 3M8PA 3WX4A 4LFCJ 1RAGB 4NASA 4NXNJ 1UEUA 3RB0A 2UVUA 4K59A 2BJEA 3WX8A 3R5AA 2DISA 4DU7A 4WFBQ 2XLKA 5L9XA 2LU1A 3HXMA 3PW2A 2WVBA 4YUDA 1NHVA 5GVQA 4J9NA 2PGCA 1C1CA 3OVAA 3S01A 4DI6A 2AGQA 5D0GA 5KFVA 4DZ6A 4ELVA 2XM3A 1HBNB 5H1SV 2WONA 1F2GA 2MSTA 3OSNA 1JIHA 2Z30B 5DDPC 1ICEB 4F4YA 4KTQA 2E29A 1NDPA 3BGRB 2NSBA 4KFBB 5HSPA 2BQRA 4X4QA 2QO3A 1DTTB 4DR7J 2CQ1A 2Q43A 3W5ZA 4UZBA 1VLYA 4R5PB 1XWLA 1HNZJ 2RUGA 1SKUB 1F1BB 2CNNB 3WIVA 4RNOA 4KHMA 1NK5A 1RACB 3QATA 1WTBA 2WOMB 2L41A 3D9BA 1NJXA 2UU9J 3SIPB 1YRXA 4XAKA 3V2UC 4EO8A 1CVJA 2R7UA 3DDNA 2MYFA 4I4BA 5HROB 3OR1B 4NLXA 4CWBA 2W9CA 2MQ8A 5KFNA 3TZZA 4I68A 2DH7A 3JQMA 1YBAA 2HHHF 3CC4S 2K2PA 2HZCA 5HVFA 1UL3A 4RNFA 5KFJA 1X5OA 2Z2YB 3V6DA 3D4JA 4DSIA 4B3RF 4ZVFA 4RW4B 2E7XA 4Y65A 2NXJA 2OFHX 1NJYA 2JZ5A 3H4BA 1CJKB 2GJ2A 1V9OA 3DGPB 3VWSA 3ZTPA 4I0WA 1HQ2A 2QLJB 4N5SA 1IKWB 2JLGA 4KJIA 2ASYA 1HBMB 3MAAA 1X9MA 1RBAA 1YJTA 4OHVA 3GP9A 3MPVA 4OHWA 4FZVA 4LFAF 2H9ZA 1CS4A 3N5FA 3ICLA 3CMAS 4X2BA 2HQDA 1S97A 3IA0A 2ZE2B 4DL0C 4C0OC 4OJGA 3TWZA 2BYCA 2ZZMA 5F8MA 4C4WA 4NEYA 4X65F 2LECA 5ITHA 4YFUA 2RF2A 4DV5F 1Y00A 4CO5A 1I6JA 1C2PA 2UUCJ 4B08A 2M0GB 2N3OA 3RBDA 4F7VA 3GR0A 1U4BA 4IDKA 1PO6A 2HNDA 3NNHA 4DV6J 1P9QC 2YWWA 5KFMA 2LQ9A 2WBMA 2FJWA 2QTWA 2HNZB 4UQGA 3BSCA 4F36A 2FVQA 3ITHA 5E3CA 3KTQA 1L3VA 3MZIA 1M5PC 2BE2B 3LUYA 4OI6A 4ETXA 7FDRA 3DLLQ 1HNWJ 4DMZA 5BYQA 4DV0J 4WK1A 4N41A 1YJUA 3HP6A 4MYUA 3LPYA 2CVEA 2JRSA 4Y0FA 2CDRB 1LWFB 2ASLA 2QFIA 4OI1A 3DLKA 1HYSA 4ZKAA 2DRDA 3DRXA 3BSAA 4H4KA 3EICA 2KXNB 2UXBJ 1JLBB 2QL5B 2XZWA 2BJDA 4OZNA 4ZHRA 2LA4A 5A0YA 2BQ3A 3NMAA 2B51A 3CCWA 3BPDA 2DR8A 4CI0B 2JEJA 5C24B 1Z2LA 3G71S 3DLGB 3MD1A 3BYPA 1AUDA 5KG3A 5AT1B 1RA6A 4N47A 1WG1A 2EVZA 4ZPVR 5KG0A 2V63A 1RTZA 1VBYA 2PE8A 1EB0A 1HBUA 3IAS9 5KFIA 3U27A 3MURP 1KWMA 4L3KA 4URQU 2QA4G 1N48A 1LV5A 1HBUB 1FNXH 3H2LA 3PZPA 2UU9F 2GO8A 2MDAA 1TK0A 2R7SA 1Y4ZB 1UZHA 2KM8C 5L1IA 3TJAA 2BUNA 4ZVSB 3KLFA 3HMJG 3DLEB 2V68A 1UEVA 3GFYA 4K4XA 5D3GA 1H0HB 1N32J 2MZSA 1UWBB 4C6AA 4TU9A 1U1KA 4NLQA 3MR6A 2ZBRA 1X9SA 2BV3A 3VGUA 4DQPA 2V2ZA 1PCAA 1CJUB 2VC1A 2J7KA 1VBXA 1L3KA 3THPA 3CJ0A 1BWEA 3G96A 1UPPA 4A8XA 4KKOB 4ATNA 2JOQA 3J7YI 2R7WA 4IUFA 4DR6J 4PUOA 1HW8A 2OPQA 4KKOA 3GTYX 1T05A 2VPWB 1JLEA 4GKKF 1KR4A 4F4ZA 1S9EA 4YDDB 3J81j 2Y8WA 3ISZA 5HN0A 3K17A 1JLEB 5KFRA 4QYZK 4IYQA 2G0CA 5E7OB 1C1CB 1TKZB 3W9JA 1Q5VA 2R7QA 3NGTA 3OR2B 4J9RA 1HR0J 1S79A 1V5VA 2ZDPA 3PW4A 1HD0A 3LH2S 2IRYA 3PFOA 5GAGI 1ZZNA 1FT8A 4HHHA 3PO4A 2YKMB 2FC9A 1IKXA 4K50A 1HW9A 2EFGA 4TNOA 3TVKA 4DV5J 1OO0B 1S1XA 4WP9A 1JJCB 4ENOA 4U95A 2BM0A 2KT2A 1DTTA 3PHEA 4HH1A 4QIGA 4RW9A 2C2RA 4CNYA 4WF9Q 1ZH5A 4DV7J 5LSOA 1CSJA 5KFXA 4ZN3A 3PW5A 1TVRA 1SIZA 2X1FA 4ECZA 2KDOA 2RMLA 4B02A 3GV7B 2DNZA 2VG6B 3LQVA 1FJ7A 2F4FA 2E5JA 4NX9A 1NMEB 4RUCA 5J2PA 3D68A 1NJIT 2KKHA 1LWEB 1U6ZA 1KFDA 1PAEX 1U7LA 2AX0A 2CPIA 1S1WB 4DF8A 1JXLA 1VLOA 1WG4A 2EXUA 2JWNA 2W7OA 1WC4A 1RT2A 4LRAA 4CNZA 3O1LA 4ZLJA 1B3TA 1MN7A 2HVDA 5C25B 1J5EF 2AJ1A 2RUSA 4PG6A 5FD1A 2W4CA 4YMEA 1VQ9S 2KRRA 1QLNA 4B3OA 2XHWA 4PABA 1H2VZ 4RW4A 4JV5J 3N6MA 1QAJA 4N8OA 4BLGA 4N77A 1N5QA 1RT4B 1LXJA 2H5EA 2OO4A 4IH7A 5J1EA 3QT5A 2CXEA 3H40A 1N33J 5KFCA 3V6KA 2DJWA 4HR2A 4IFYA 1IKWA 4K0KF 4IG0B 5CXTA 3AXMA 4ZVRB 3ENWA 3G6XA 2NXCA 2XY5A 2DCUB 3IMQJ 3IBFB 5ETQA 2HHQA 3ZZRA 4HTIA 1EQ0A 2RH3A 3TZWA 4FS1A 1O51A 3IAM9 4FPRA 1F9FA 3U1MA 3CUNA 2ILZA 4B3SJ 1ZA1B 4DS4A 4JI3F 5IOLA 3V4IA 4Q0BA 2VFTA 1JB0C 1R6VA 1VDHA 3JTPA 4ZP6A 4XDDA 2QLFB 3RGIA 3TVZA 4EO6A 3RAQA 2EFQA 1R0AA 4BHQA 3X1LB 3GSDA 4FDFA 4ZK7M 2YH0A 2XLJA 3D2WA 2R9LA 3VAIA 1R0BG 1XBWA 4Q8EA 2G2YA 4I1TA 3M9OB 2HVZA 1VQKS 2ZBCA 1NJZA 4FKXA 2IVYA 2B6AB 3GZ7A 4QR1A 1FKPB 4FPIA 4O0NA 4WP3A 3VR1A 5F9LA 3MUVP 3MR3A 4G1PA 2YNIA 1FXDA 1BY9A 2PMHA 2CUYA 1E6VB 2V2KA 3A8IA 4DBQA 2CJQA 2EK6A 2HAIA 2R7VA 4RWWA 4DQIA 2CFXA 1OYDA 1XR7A 2VUGA 1A7GE 3CJRA 1NB7A 1KQGB 1EP4B 2MGZA 3OFFA 1KN6A 2YVSA 1FFGB 2HWHA 4QPTA 3R5CA 3CNQP 4KO0B 2N4CA 1JMTA 3ZZOA 1VRQC 1ZM9A 2B5JB 2E7VA 4P9SA 4ZPCA 1AUSL 4UUWA 4XK8C 4DXLA 3M8QB 5GAHI 2IRXA 4F26A 2I38A 1RWXB 3KLIA 4QCLA 2IY5B 1HNVA 4J9UE 2RVJA 3KLIB 3SQOP 5D78A 5KFUA 3KLGB 5GAGU 4DV7F 2E9RX 4DL3A 1F2HA 3IWLA 3C46A 3A4TA 4NLSA 3FEZA 4ED1A 2ACMA 3CD7A 4YR3A 3I0RB 3KG4A 4CCHA 3G87A 3MEDA 4HI2A 4JI6J 2XGQA 3TA2A 1S5ZA 2IJFA 2VH7A 5K9FA 3KK2B 2AU0A 2NZCA 1Y7PA 3RTVA 2VZ9A 1JLCB 4LVNP 4DUTA 1JJHA 4WE1A 3P45B 4OIXA 1HHTP 2ZC4A 5KG7A 1U0SA 1VK8A 3LWMA 2AF6A 1J5EJ 2CPFA 4RBTA 2HS3A 2CPHA 3O2IA 1Q1KA 3M4XA 2KZMA 2FJDB 2CWKA 3BKUA 2GCFA 3MR2A 3C16B 2RD5C 1KVIA 3JS9A 4JI2J 3RR8A 2O1PA 1ROFA 4TLQA 4USHA 2RDDA 1N33F 4PPZA 3TQEA 2KVQE 5K8OA 3RB4A 4A8OA 1S48A 4FYDA 2YWKA 4KHPJ 2ADCA 4P2FA 2H51B 3LAMA 4UOHA 2ZH3A 3UCZP 1S1TA 5B0AA 1FRKA 2V4JB 1XC9A 3C3LA 4KHRA 2XY6A 1Z2ZA 1QVFR 4MK7A 3MFHA 2VOOA 2OPPA 2ZKUA 4DN0A 1QAYA 4KPYA 2DHGA 5F8GA 1RJJA 2OPPB 4WXWA 4ZA1A 4MAKA 3U7JA 2J0XA 2Q1LA 1ZM4A 2YY3A 3DRRB 4NWBA 2B8QA 3GU0A 2BM1A 2VQEJ 3Q8UA 3BF4A 1ZBTA 4L76A 4O3RA 1MMDA 1RWNB 1FA0A 2VFUA 3M6UA 3CJ8A 1FJEB 1M1HA 1VHFA 2HBRB 3T9ZA 5FLXY 3KK3B 4PXBA 3G8SA 4DSFA 3MECA 2FHJA 3NS6A 5A6WA 4V19X 1HPZB 3W2WA 4ZPAA 2MQQA 3T5JA 1IBMF 4E0DA 1NO8A 4RUHA 2JC1A 5ETRA 4WIQA 4P10A 1S99A 4LBPA 2LQ8A 4ZPTR 5JXSA 3ZZUA 4EBDA 1S9FA 2AD9A 2WOMA 1LWEA 3HFVA 3AB2B 3FRZA 2BZ2A 1PJ6A 2JJ4D 5FIIA 1AT1B 4C98A 3VGTA 1MMNA 1YWXA 2RHQB 4V1Ak 2Z56B 2CADA 2ROPA 3I31A 3ZTQA 2EFPA 4AUKA 5CAAA 1GK8A 5C25A 4JI5F 1YJ7A 2P9GA 5B0DA 5KOXA 2DGQA 2FZCB 3Q8YA 4PXDA 2Z8QA 2E5LF 4OHYA 2JFDA 3EZUA 2C2EA 2IPOB 4U7UD 1SI9A 2ZFHA 4X4VA 1UFKA 1RHRB 5BYRA 1I3OB 4WK3A 4FKYA 2WK4A 4JV1A 2KVIA 1EZZB 4IG0A 1N6QA 2AJQA 2Y0SD 1WC3A 4DR5F 1Y5LB 2VIHA 4HVZA 4B17A 1BHNA 4OYIA 5U47A 3M30B 3B54A 1L3TA 2EK1A 5HP1B 5H9EJ 2DNLA 4DR2J 2F4VJ 1BC6A 3HT0A 2KFZA 5HP1A 1CS4B 1JLAB 3CJ2A 3I9V9 3CCVS 3HJVA 2AYGA 2ZE2A 2QX0A 2E9ZA 2UZAA 3DNCA 1NSPA 1RDRA 2VL1A 5HMZA 3OSPA 4E98A 2F8HA 3KLEB 2J0QD 4XO0A 4ZCLA 3W3SA 1K0VA 4V19J 4OYAA 2HS0A 4LR9A 4I2PB 4ANEA 1CULA 1OY9A 3AJ2A 1VCTA 2PT0A 2EFOA 5BR8F 1OQ6A 1NK9A 3MM6B 2AWZA 3AJDA 1XR6A 4F4KA 2B6AA 1N8RT 4LT6A 2HNYB 4PXCA 1FD2A 4DG1B 3OVBA 5F8HA 3GB0A 1ULRA 1EAYC 2F5GA 2HNYA 3BO3A 2HQCA 1S6UA 3FFIA 2W8LA 2BE9B 2DR5A 2B8PA 1R6YA 2B4VA 3NGKA 4QIEA 2RNEA 4O3QA 4HT7A 3AB4B 3BBCA 2RS8A 3W60A 1URNA 2BE2A 1N54B 2MKSA 4DR1J 4NYOA 1SUQB 2C2KB 3ZFVA 3TP2A 2DIUA 4WFXA 3G8TA 4NCAA 5LSRA 4P74A 2Y1IA 3F44A 2PEBA 3PACA 4LREA 1B7YB 5DRKA 4ALZA 1DQAA 2BRLA 2KJVA 3MUTP 3W5XA 4ECWA 4A8SA 3UCUP 4HTJA 4C0BA 2MKJA 3DLKB 1HYSB 3I4PA 1NRKA 4NMLA 4OMFG 3KLVA 3UO0A 2GQ2A 4FYVB 4RNHA 1JLBA 1RAJA 2CNKB 1LOUA 3Q0AA 1U1RA 3MI7X 4KHPF 3RRKA 4ED3A 4DR4J 2V9KA 3UNGC 3H42A 1NBEB 2QJ3A 2RKIA 5CCLA 2EC0A 1X5PA 1S76D 5C24A 1E6YA 3D6TB 3LGMA 4WTOB 4J9MA 3HX9A 1Z1ZA 1J2VA 1MWYA 1RUSA 2DGSA 2G1DA 3SYZA 1B0VA 4LF5F 2W25A 1FRIA 2K8GA 2C3PA 1FJGF 1RYSA 3NOCA 5BXIA 4NXMF 4AL5A 4Q8FA 4HACB 3BREA 4K4YA 2QMXA 4Z7CA 5GAEU 4CIOA 5A6PA 1IBLJ 1S4FA 2JLEA 2NPIA 4OYMA 2EG1A 1OPIA 3KLFB 1WF0A 2YKPA 1N5SA 4LSLB 1UW4A 2HYIB 2H1YA 2LDIA 2KFYA 2DHHA 2AEJA 3H5UA 2DPJA 2MZQA 3RAMA 1VQNS 4DV6F 4IFVB 2ZKTA 1FWPA 4DL2A 3QAUA 1RHMB 2G2ZA 5KFZA 1RTIB 2A10A 2HQGA 2CNLB 3EZOA 4ID5A 3Q2SC 2MKHA 2UV8A 4GMKA 1MLAA 1XR5A 4BC7A 2P9CA 2EG2A 2F7VA 2XO7A 2BANB 4R25A 4MKAA 3J7ZT 4RKUC 3M8RA 3Q23A 2D69A 4ED6A 4EZ6A 3O8WA 5T7LA 3NGRA 3GYXB 3IN5A 1SJRA 2ZWPA 2Z2ZA 3D6FB 4DR2F 1VQSA 5T7LB 2W9BB 4DLGA 1K0TA 3FC9A 4JI1J 2BABA 2RT3A 3R1LA 3W64A 4DV1F 3PHTA 2SXLA 4PYDA 3SQGB 2GIRA 1U6FA 2CQCA 4ED2A 2MEWA 3V4MA 4AL6A 4CDIA 1BQMB 1A0OB 1WKJA 2BACA 2W2MP 3FJ2A 3HSZA 2AGPA 5T14A 3EZ5A 1FE4A 1N0UA 1FDBA 3OBIA 4PQAA 3PKMA 1S7IA 3MECB 4MFBB 1RI7A 4R5PA 2C42A 4OI4A 5I3UB 1HFEL 3TUJC 4YN3B 3CDAA 3R9LA 4NPOA 3SBMA 4F04B 3KMQA 3OL9A 1B7FA 2JFKA 2QC3A 2V94A 2DY1A 5ETMA 5EHHA 1IKVB 3MM9A 4IH5A 2UXDF 2AP6A 3UN3A 2BX6A 3DYAA 4DR1F 1URRA 1PC5A 1WELA 4A48A 3CJKA 3DOMA 5HROA 1X31C 2BEFA 1U8WA 1VQ5S 1S6QA 2LVWA 3NCQA 3GV5B 3ZZPA 2EKNA 1X0PA 4PR6A 4DLEA 2ROEA 2D1CA 3CIMA 5HBMB 2RE1A 1X4HA 3ZZYA 4DV2F 4AYBD 1W2IA 5M2PA 4R8UB 2I8EA 2LQJA 3PYGA 1RK8A 2GJFA 1I94J 4C2MA 1YTYA 2C2ZB 4LJMA 4H4KC 5GAHU 1FJGJ 2ZZNA 2ZC3A 1RP5A 2RAQA 3BZQA 2CQIA 3GIRA 1JLAA 1U2CA 2YXLA 4OLPA 4PYAA 3RG6A 5DDRC 1NDCA 1R8BA 3NKYA 4NCGB 5IT0A 4FVMA 1PBUA 1VRTB 3OJSA 4WKRA 4QJVA 4LF7F 4ZPBA 2E5IA 3MAQA 3ILJA 5EWFA 3BQ1A 3QNWB 2PMZD 3FUYA 2EKYA 1CULB 3QO9A 2PIIA 3UNYA 2COLA 1T9VA 2Q6BA 4WCEQ 4B3RJ 2I9SA 4YHHJ 4KSEB 3I9ZA 3C6UA 4K5SA 1PAUB 3H98A 1TL1A 1YBUA 1YSJA 1GMUA 2GFFA 4N7TA 1Q8BA 2CQBA 1HKAA 1LKZA 4JOUA 4CO4A 1SVDA 1F5CA 2V8PA 3GG1A 5DDQC 1X4DA 3JSMB 2H4YB 2L9WA 3GCWP 2C3MA 3H5YA 5DGBA 3R7NB 4USMA 2J7UA 2UUBJ 5KFGA 3HKWA 1SBRA 1VBKA 1RT5A 2KT5A 3DMJB 4NLRA 4H4OB 5ETOA 2Z0GA 2RDJA 4O4RA 3A8JA 3QWUA 1D0EA 4DSJA 1HNVB 1TR0A 4H4OA 5CD4A 5A0YB 2MQPA 5HI7A 2KO1A 3KLGA 2MXYA 4CH7A 3CCSS 2B3TB 3T5KA 2L9NA 3QLHA 4MKYA 4U96A 1ELOA 1HI1A 4MYTA 4Y28C 3MAHA 1BGXT 2HPUA 1OY6A 3KYLA 2MZJA 1Q7LB 1TELA 1WC6A 3MCMA 5DZ6A 3BKTA 1HQUA 2V4RA 3T19A 3CJQA 1HNWF 4DPTA 4F0MA 4ECVA 2E44A 1N5TA 3C8YA 2JC0A 3D66A 2HGLA 3EPIA 1JLCA 1KQFB 1FTRA 1SB6A 5I3QA 3HM9A 4DR3J 3V81B 3CULA 3FEXB 1Y11A 3IG1B 4L72B 1NCLA 2GV1A 4KT0C 5DG9A 1Q53A 5F41A 4ECQA 4OQJA 1FDDA 3G6VA 1O8BA 5DQHA 2ZHOA 2MZTA 4EBEA 2UUAF 2C1EB 1ZAWA 4P73A 1HWIA 3OTOF 4DQRA 1SKRA 4KGZB 3BYRA 3Q8VA 3PIOQ 3BSNA 3OPKA 2MB0B 1TKXB 3HD1A 2XO6A 3M32A 1V3ZA 1Y3KA 4NA3A 1RBOB 1RTJB 3H7HB 3LPEA 3DLJA 3PM9A 3QAEA 5HATA 3ZNJ1 4U7CA 2XCAA 4DF4A 1XMOJ 5LMNJ 3CMES 2N4DA 1FESA 1BD6A 1NB2A 2DEIA 2RRBA 3H90A 4K2XA 1NK7A 1NK4A 4I2QA 4BS2A 4FXWA 5IT9U 2YKQA 2MZ1A 4I2QB 1RLCL 2R7RA 4B3MJ 2B4PA 3L09A 4IOCQ 3NNCA 2QLBB 1N32F 5IWAJ 1YGYA 2A0FB 3RBXA 1VJQA 2MLZA 2P2CB 1SQEA 2FHMA 1H7XA 1RADB 1XNQJ 2B9WA 2GHWA 4ZCKA 3CMQA 5ETVA 3P6YC 3PRBA 3K5NA 2DK2A 4L3NA 1C0UB 1HWJA 3I96A 3NLCA 1V5IB 1W7WA 2LDYA 3LP2B 3FBFA 1WEXA 2MLYA 5CYQA 2JEFA 3MEEB 4UY85 1D3WA 3KMSA 4NCBA 3M1VA 4U8VA 3E2EA 4F4XA 4ECTA 4CLUA 2OUGA 3ENQA 3TNVA 3C19A 4JI6F 4DPXA 1FRXA 3SZ2A 3NGSA 3J7YU 2Q6CA 3IC1A 5CZXA 3WDOA 5AXNA 3VAFA 3VAKA 4M5LA 4DPYA 2HFOA 2E5GA 3OXLA 4X64J 4ERDA 3US5A 4AT1B 4U9RA 2RRAA 3L9ZA 3QPIA 4Q45A 1IJEB 2WSFC 3OFEA 1N4LA 5J2QB 1QAIA 1HI0P 1GFWB 3PYFA 5J2QA 1F5BA 1RT1B 1SV5A 2HK3A 4KQZA 3IWNC 3BDEA 4H4MB 4DDFA 3KHGA 4NRUA 3T1AA 4CQ1A 4QW8A 5HLFB 3FZBA 4NL5A 1S0NA 2HGMA 3MPDA 1QY7A 2GA7A 5EWGA 1RKIA 4DOZA 3RAXA 2XHCA 3PJWA 1Q5YA 3BQ2A 1G1XA 2GVDA 2K7JA 2XC9A 3MR5A 1X4AA 2DXEA 3TA0A 1WC5A 3L7UA 4U67Q 2HURA 3VZIA 3HSJA 1CC7A 3CB4A 1OYEA 2H5JB 5CYJA 2VA2A 3PYEA 3J7Z5 2NSCA 2ZOFA 3HSGA 4O3OA 3P3DA 2GJIA 5CYMB 3AOCA 3GONA 3LF0A 4MIWA 4URSA 3TJ8A 5KFBA 4Q5VA 1W25A 1KDNA 3MOZA 2L9DA 5L1JA 2A2DA 4A8FA 3JAMY 2K06A 1NLKL 1RHKB 1S6OA 2R2SA 1LNQA 4IH6A 1O5JA 6FDRA 4IOBA 1TUVA 2NYHA 4OYPA 1RWMB 2F9DA 1KQSR 1NPRA 2Z2LA 3EX7B 3D28A 2BOPA 2RILA 3P4UB 4B9LA 2APOA 3CDEA 3NXZA 4C3MA 2HAFA 1SC4B 2DXDA 2FJAB 3ETMA 1HD1A 4KV8B 1HNXJ 1D8YA 4NYPA 4XDCA 1LW0A 5D77A 3B82A 4JI3J 4ECXA 4PEOA 4KV8A 3KK1B 4KO0A 2YKAA 1S1XB 4P2XA 1HNIB 4AE5A 2R2UA 3KK1A 2B5JA 4XTTA 1HNIA 3A12A 2GAGC 1MROB 2HFNA 2BJ7A 2WZ1A 3VVUA 4OJ3A 3AD9C 5AXMA 1OJ4A 2MZRA 3OV7A 2RKIB 3H8YA 2PSZA 7FD1A 4OZLA 3D3BJ 1F3FA 3G82B 3W9IA 4LF9F 4ELUA 4CLLA 1NM2A 1UTAA 1SPBP 2QIFA 4CM0A 5E41A 4M5NA 1U1PA 1I51B 3FVYA 1NSKL 3DU6A 1KD1T 1KS2A 3PEHA 3IXQA 1RLDA 2ERRA 4GKJF 5JVGQ 2PDAA 4F0KA 2QA4S 3UD4P 3M2RA 4QU6A 1QSSA 3ETOA 2CJKA 4DQSA 2NUHA 3MMAB 3MPUB 2W9CB 3SCLE 2XI2A 2MHNA 3GPAA 3CWJA 3NAHA 1N36J 3H0PA 4YOEA 2HBQB 3CCJS 1TKDA 7AT1B 1H2TZ 3TUPA 2FVCA 1GMVA 4ZVOB 1G2EA 5LM7E 5J1EB 3BKFA 4ZCIA 3PJXA 3OQ2A 4YY3J 1UVKA 4Z7YA 1FVQA 1T3NA 3TARA 5A76A 2E1RA 3DHXA 1UA1A 4K4WA 1H98A 2FB0A 1SC1B 2R2RA 5IQ6A 1EKRA 4RW7B 3NNAA 4O3PA 2WB4A 1RT6B 1X5TA 1P27B 1BQNB 2EW9A 3GWCA 1OSCA 3BH7B 1ACMB 3GFHA 1EIYB 2FVSA 4DFPA 4CLYA 2W01A 1GAOA 3ENVA 1RWOB 2M70A 1C0TA 2ZVSA 3D0IE 4P6QA 1ZAXA 2DNKA 3R97A 1PILA 4M8LA 3SQGA 3IGVA 1U09A 2XG8A 3HULA 3WZ0A 2C22A 4FYYB 3ZZ0A 2M3DA 3M2UA 4GC7A 3HLUA 1BQMA 1JK9B 4A46A 3GJRB 2MKKA 2OIHA 2BQUA 1H72C 3FCVA 2OFGX 2ZH8A 1RQ0A 1IWAA 4B9VA 1C0UA 4TKTA 3IR6B 4LFBF 3QSIA 3IM9A 3EVWA 4HI1A 4DX8H 4O3NA 1QD1A 2VBYA 4I6YA 3DM2B 4Y2CA 2DGVA 3K0JA 3T41A 1DJ0A 1DQ9A 2CPEA 2NXUA 3LOUA 4LBHA 2CQ3A 5KFFA 2CA9A 2DH9A 4C97A 1FWKA 1BLUA 3A8EA 2OI2A 3FNNA 4A47A 2VQFJ 4K4SA 4KAIA 3ZO7A 1K1QA 3CJKB 2GX8A 5CD4H 1LW2A 2XGPA 3MTKA 2E5HA 4ECUA 1IBKJ 4EU0A 4M63A 2CQPA 1GXLA 1LW2B 2V2VA 2GZOA 2ZBIA 2OPRB 4USWA 2CDQA 2NYIA 1NPKA 4B3TJ 1CQNA 2GHVC 1V6HA 2F65A 2OPRA 4QYRA 3MD3A 4M5MA 5D4LA 3KWMA 2LQ5A 2XMWA 3SSRA 1U6BA 2RRNA 1PJ7A 1RA7A 1WHYA 5LMUF 1XN9A 5KT3A 2IVFB 5KFQA 3EYZA 2J6UA 1M0SA 2GGPB 1Z4UA 2QT7A 5CCMA 3RJMB 1YDLA 5F8JA 1A6LA 1OSDA 3ET6A 3M6XA 2AYMA 1GTHA 4ZVTB 3BSOA 2DNYA 2B4OA 6FD1A 1CJVB 4UW2A 1IBMJ 4TQSA 4M95A 3J7AN 1REVB 1F60B 2X3GA 3M7VA 3MEDB 1CJVA 3A8KA 5KFKA 3FDSA 2AX1A 4ED0A 3HJFA 4OZJA 2DNOA 1IUJA 2R4FA 4JP8A 4NCGA 5E3AA 2FJVA 3MM7B 1MMLA 2A18A 2HGNA 3VHQA 2W7PA 2MQLA 3OTBA 5GMDA 4PWWA 5L9NA 3U1LA 2V4QA 1T8EA 5IV4A 2KM8B 2IM1A 2M8HA 1JNZB 4WXOA 4CYUB 1X4CA 4Z37A 1VQPS 1UPMB 3QO9B 3SXLA 3J81U 2AMCB 3HHLD 1MG7A 3I55S 1ZTTA 5ETKA 1QSYA 3OXFA 4YB1P 2Y8YA 2HG4A 1NH7A 2N7CA 3Q22A 5D6GA 1TK5A 2OPQB 1H2UX 4RU9A 4WJBA 3M8PB 3LWLA 3FFIB 2W9AA 2NZ4A 1LK7A 3QT6A 5AE2A 4A8WA 5B0FA 1DTQB 2JVOA 2P9EA 5E3PA 4ES2A 4ZMMA 4QW9A 4CO3A 1M90T 1XTZA 1RHQB 3HHLB 1IKYB 1T95A 3ZTOA 3GYGA 4GO7X 1LW0B 1FRJA 4P71A 3TEGA 5KFEA 5HQMA 1NK6A 4EZ9A 1YRTA 1R3NA 2DITA 4O44B 5DETA 1HA1A 2YNFA 3AQPA 3JSYA 3MR7A 4KGVB 1RKJA 3DGVA 4IRCA 3KOAA 3DC2A 4DSEA 3CIZA 5BR8J 2VF3A 2EBGA 3MTJA 2OGUA 2HQFA 5M2UA 2CQDA 1U8SA 2RJZA 2ZNZA 5HVGA 2B56A 1CEZA 4RBUA 1WEYA 4NLVA 1U25A 4E8UA 2DXFA 2O3DA 1MN9A 2LEAA 4TY8A 2BDPA 2NUUG 4MIBA 5KOWA 4CTAA 3HF5A 3HPOA 2UUTA 2XNQA 5B09A 5J2PB 2WAQD 2HRYA 1RT3A 4K8RA 3OL7A 3BR9A 1V3RA 3M2RB 3VAMA 2IHR1 3OVSA 4A8QA 2AGOA 1YVFA 2VG7A 1SH3A 3I0SA 4OI2A 2YTCA 3N79A 2XZDB 4U8YA 3CCQS 1IBKF 4LF7J 2NQPA 1DFDA 1RTDB 3J81Y 3PJ9A 5K8NA 2XTJP 5F8IA 4J9QA 1PC4A 2L08A 4LQ9A 3GV8B 4FBUA 2YKOA 2HK2A 3W7BA 3P49B 5ETNA 2UXCF 2MKCA 4J91A 2OEKA 4USVA 1VQ6S 4ANDA 3QBCA 3TUIC 3HHLC 3ILOA 3E01B 3CJ5A 1UFWA 2AYEA 2M4MA 3R6LB 3W8GA 2XYHB 3OL6A 5CZVA 3C6TB 2HKEA 3BV8A 3KJQB 2VFSA 4PAAA 4IO1A 1VYAA 5CABA 3GJQB 3KDOA 4C8MA 3SV4A 3NY0A 4LIRA 4X4PA 2HVEA 4I67A 1FRHA 4X66J 4Q2LA 5I42A 4IRDA 2J5AA 4QU7A 5IT4A 2K3KA 1IBLF 1C0TB 1WHVA 1VHIA 4LUBA 1FKAF 2GMLA 5ETTA 5H9FJ 1U49A 3B6BA 2QEXS 2KZZA 3TZYA 1KOOA 3QRQA 4UUXA 3BO4A 4K5RA 4JV2A 1F0XA 2V69A 2XB2D 1M5HA 2RQ4A 1TL3B 4C0HA 2IMWP 2DNPA 1XJWB 4OZ0A 2HZVA 2LU2A 1AXQA 3QIPB 1J5OA 2NXNA 2V0NA 3LTOA 1NSQA 3DXBA 1Q8LA 2HEKA 2OELA 4NXNF 2V2QA 1JQGA 1UVLA 1R31A 2Q3PA 3BR8A 2LEBA 2HHUA 1YJNS 1NAQA 1PG5B 1ZPVA 2I5JA 1FRMA 1RWPB 4TLRA 1YZ7A 1QE1B 2EPIA 3CDWA 4FP9A 4FYXB 4HEA9 3ELHA 4L75A 2MQNA 1QE1A 2XMKA 2DHXA 2XMTA 3CEDA 5HMXA 4J9PA 4DV1J 1PIEA 1SJ1A 3CW2C 3FCWA 1HIYA 3N28A 3DOMB 3CCLS 4I69A 4EYHB 1KP6A 3KHHA 1IR1A 5B0EA 1LWFA 2F8EX 2GW8A 1JJ4A 1JWWA 1LQ9A 1HMVB 1RTHB 2VFRA 3RW6A 3K89A 2RQCA 1X9WA 1R89A 2IC3A 4IR9A 2GMHA 5KFWA 1VQ8S 4TYBA 4ZHRB 3QZ8A 2X1GA 2ZJPQ 1N88A 3DDIA 3IRXA 2G2OA 2LP4A 3FGVA 1JNRB 4LR8A 3MMCB 2Q66A 4K4UA 2WSCC 1N5YA 2ZUAA 3VV2B 3TX8A 5F0UA 2HVHA 3DLGA 2CG4A 4IKAA 1JX4A 3PEJA 3PX4A 4A8KA 2DNQA 1AZSA 3PR5B 1M5SA 1SC3B 4C3KA 2F63A 1XMOF 3EVMA 5LMNF 1AZSB 5KFSA 2QLXA 4QBUA 2VJUA 3MM7A 2WSEC 2IDEA 1H73A 2GVDB 4MK9A 3R5JB 3FCHA 1UP1A 1XK8A 1C1BB 1WTFA 2KXFA 3MMBB 5I4MA 2IM0A 2N82B 3MEKA 2FJBB 2DNGA 4B3MF 2YBVA 3MMBA 3P5BP 5IWAF 4C8OA 1MWZA 2QG9B 4BC9A 4F2SA 3MOJB 1EHWA 1SKWA 5D0EA 5LT5A 1R7IA 3MUMP 3A3NB 2XSJB 3HO1A 3M05A 1IR2A 4MJKA 2A6OA 4X4UA 1F6TA 3BH6B 2XWXA 5DQGA 2D3OR 2YWFA 2BBEA 4UQTA 1XMBA 3NGDA 1VFJA 1U45A 3BQ0A 3MXHP 2XYGB 3HVTA 1RGVA 2B9YA 1YJRA 4MMOA 4DWIA 3MMJA 1JXVA 2EC2A 5IXUA 3I4HX 2AKWB 5SZTA 1WOSA 3L4BC 2V5HG 2UP1A 3IFEA 4F02A 3UFCX 1Q16B 2YNHA 1TKTB 2B7CB 1GMWD 1QAXA 4I7FA 2BE7D 2G13A 1TL7B 2VPYB 2YNHB 5D0RA 1HBNA 2VDHA 2XY7A 1K8AT 4J37A 2UUAJ 2OJ3A 1FKOA 1LK5A 1T9YA 3QYYA 1HQEB 4DEZA 3PVXA 3BGRA 3UD5A 1FKOB 4H54A 3TA1A 2K1RA 4ZJLA 3PXGa 3WBZA 3GJSB 3N6NA 3V5RA 3S7RA 1W26A 1U26A 2J6SA 1GQEA 4MFBA 1LWCB 4OZ5A 1KTQA 2X3DA 4WYWA 4EI2A 3QJJA 3DRSB 1CG2A 1PYSB 2HBZB 3KG1A 4UF4A 1GMWA 3ADAC 3W2WB 3G6YA 4CTAB 1TAUA 4I6AA 3CSKA 5E33A 1HI8A 1RWUA 1KKHA 1ZA2B 4LF1A 4CH1A 1W2BR 3KNGA 2CYYA 4F0HA 1IJFB 1X5SA 1NPPA 2DNNA 1GNKA 3A13A 4J7CA 4QIWD 2D7SA 4OX6A 4WFYA 3VVTA 5A8KB 3ENAA 3EUNA 1J27A 1IWGA 1FI4A 1T0TV 1RT2B 1HHQA 2BRKA 4J9KA 3OR1A 1T9TA 2ZOGA 5KFAA 5DM6Q 3TW0A 1UEKA 3LAKA 1PBAA 1REGX 3QT8A 5EUHA 4LMZA 5HBMA 1KFSA 3K7RA 1CJKA 2R7XA 3SCJE 1T9WA 1RT4A 3CVKA 4HL9A 5BJRA 2AJ0A 2XI3A 1N6QB 2W24A 3AA9A 3M6WA 5IT9Y 4CP5A 4N76A 2ALYB 2LQBA 2BJ8A 2PA3A 3EVOA 3M30A 1U0HB 5D4OA 5IZHA 3NG8A 1I1GA 4YR0A 1ZOTA 2Y9HA 2HWTA 1FEHA 1SJQA 5KFTA 3AXKA 4NZ7A 3BN7A 4CO2A 1WD6A 2VKRA 2ZH1A 2P6TA 1HL6A 1JLFA 2CQ0A 3ISNC 3JXOA 2DR6A 3UDCA 3ZTSA 4G1QB 2R2TA 3OLBA 1H7WA 3MCSA 4JUZA 3B4MA 3SV3A 1UA0A 4DCPB 1WUUA 2OMLA 9RUBA 2HNDB 2RB7A 4I2PA 4QWDA 2JEGA 1RAOA 4LSZB 1JXEA 4ANCA 3JYTA 4M1KA 4ZCMA 5LJ5Y 3WQPA 1VQ7S 1J5OB 2CQGA 1F3VA 1QM9A 2L3MA 4EMDA 2FVRA 4DPWA 3JYTB 3P5TL 2IDLA 4PG4A 1X4EA 4OI0A 1GTEA 1TL1B 1UJ4A 1Q95G 5K5MA 4OJHA 2F3JA 4RR5A 4DCJB 4GKKJ 4ED8A 2ROGA 2B0GA 3VTIA 4DS5A 3HFZB 1U1QA 2AYBA 2VFVA 4ECRA 2Z4PA 5A2QY 3JSMA 1NK8A 3DI6A 1CLFA 1GH8A 1FNMA 1N34F 3KDNA 3THTA 1S0OA 2CJ9A 3DI6B 1P9YA 3KJNB 4YB6A 5FDLA 4ED4A 2VU5A 4I56A 3ZZTA 4RBVA 1PKUA 2FQQB 2LXFA 1MU2B 2HFZA 3MCOA 4FXVA 1FRLA 4P2MA 1QUPA 3G9CA 1HHSA 2VG5B 3PW7A 1V3SA 3CC7S 3JAMU 2IC3B 2R8JA 3AOAA 2WB1D 1S12A 4WZQA 2VG5A 2FY1A 3QLHB 2NS1B 3MMCA 1ZPWX 4HDGA 4EWTA 4DL6A 4GKJJ 1G4CA 1G7CB 3UI3A 2PFFB 2A3JA 2J8SA 4M5KA 4F3MA 3RR7A 2O5DA 5HL7Q 1N52B 4LRCA 4IR1A 4FF3A 3MPWA 4B9NA 4PWUA 4PG7A 2ALZA 3FKBA 4OYXA 5DLFA 2FZKB 1YG0A 4TXSA 4DFKA 3KKFA 2IJNA 4LFAJ 2PFDA 1XQIA 1QVGR 2E1MC 4C11B 5AJ3J 2RDIA 2BA9A 2LYVA 1C1BA 3AODA 3DU5A 4JB8B 5J1PA 3KK2A 1WDDA 5L46A 3QRRA 3IG1A 4QIVA 4X64F 3BS9A 2BJ3A 3FK4A 3MM5A 1FCAA 5HVHA 1YRUA 3UD3P 5LOQA 1L3UA 3PRDA 2YX1A 4L73A 2QL7B 2YNGB 5CYMA 1GX5A 1CPZA 3TQ1A 4ECSA 4ECYA 2EI5A 3CDUA 2V8HA 1FFSB 1CBKA 3AHPA 3PFEA 4NE9C 5A8WA 3M8SA 3K57A 2VD3A 3DLHA 3N9UC 1YKWA 1WC1A 3Q86A 3R8YA 5EGYA 4ITSA 3BJYA 1X7VA 1S6PA 5E3QA 2QRRA 3GMGA 3R5GA 2NXEA 1SL1A 1NU4A 2CG8A 1VC6A 2HHTA 1UAWA 3PX0A 5J2NA 1DTQA 1X8DA 2CPDA 2V4JA 2PO4A 3GG0A 1TKTA 3H59A 2W9BA 1S9EB 2B43A 2X1BA 4OZ1A 4I7FB 4UOCA 4DV0F 2VOPA 1IKYA 1EX8A 4B3SF 4RJVA 4WU2A 4RNNA 2OKQA 1IKXB 5IM0A 1RISA 4NLYA 1HQEA 4C8ZA 4KH1B 2NCKL 3DN9A 2EEYA 5F3TA 4FBTA 4RW9B 3FBBA 4OHZA 2VICA 2UXBF 2BOAA 2GVZA 3DOLA 4KPCA 3T6BA 1H74A 2FJXA 3MPYA 2DO0A 1LWCA 1RB0A 3ILIA 1Q82T 2VV5A 3SMZA 1WHWA 3OTCA 3LP2A 1IQTA 3DRSA 4G6VB 4JI7F 1VISA 3HI9A 2BMBA 3OLAA 1AFJA 3GJTB 3CCTA 3R27A 2F40A 3M1VB 4QWBA 3M9MB 1IM6A 4TY8B 1RAFB 3S8SA 3FBEA 1NK0A 4FF1A 1YJVA 3GIJA 2XS5A 3J7A1 2HHPA 2RQKA 8ATCB 3VGVA 2ILYA 1KVKA 3I0SB 4LSNA 5L38A 1M5OC 4RU2A 1WOOA 4CZCA 3M2VA 1UMJA 5DM7Q 4NRTA 3SSQA 3MMAA 4CLPA 4O3SA 5DG8A 4UT4A 3JQKA 4DN9A 2KTQA 5HMYA 1GXUA 1HWUA 3UE2A 4URGA 4OZ2A 2KRBA 3H2UB 3PR4A 2XEXA 3UVJB 3DDKA 2JL9A 3UDVA 1NKEA 4X4TA 4KIAA 3HVAA 2HWIA 5GMKa 4TU7A 3QGIA 1Q78A 4W4MA 1U02A 4WTYA 1S0MA 4ZPWR 5KT5A 4ZITA 2BR0A 3L7OA 4PQUA 2B9EA 3IS9B 1IR0A 5E0OA 4F4AA 4B9SA 1FTCA 1P6TA 3ONQA 4F8RA 3V4IB 4DX6A 2DRBA 5F8LA 1HR0F 2HMIA 2AW0A 4ZLPA 1UVJA 4CT9A 5EX0A 4NEZA 4C48A 1T03A 2UV8G 2OHDA 1KQKA 4LQ3A 3H4DA 2AQ4A 4KRWA 3QWPA 2XLIA 2VHGA 3QQCD 4TN2A 1TL3A 4JI2F 1AA1B 1Y0HA 3QIPA 5CH7B 3CCZA 3MM6A 4NLWA 3U1NA 4ZN1A 2R8HA 4F3OA 4FF2A 3L95X 3OFGA 4KH0B 1NKCA 4OX8A 2P6SA 3AT1B 5JMNA 5KT6A 2OMOA 2QA2A 2ZH6A 3OW2R 3C2PA 4RW6A 2ZWOA 3W9HA 4EYIB 5HQLA 1YQHA 3WC0A 2MY7A 3FRYA 1SUQA 4TYAA 2JDJA 3MGJA 2DT9A 4FF4A 3PV8A 2FDNA 1ZETA 3GR1A 4PPDA 3FSIA 4F4WA 5KFLA 4YR2A 4EFAC 4CH0S 1DY3A 1MU2A 2OD4A 3FMWA 5C42A 4WWSA 3NBPB 3JB9k 2WHOA 4Y3CA 4AXJA 2F1FA 4GVBB 3M8WA 3NBPA 1RT5B 3DMJA 4C8YA 2KT3A 4JI0J 1MROA 3O5TB 1QTMA 2R42A 4JV5F 4AXIA 3R5DA 4R0JA 3SFGA 5C2CA 1CC8A 3GYNA 4A4JA 5DG7A 3X3UA 4P75A 3PW0A 1RU2A 4JI7J 4PWDA 4RNMA 2NLWA 3TR5A 3D54A 3VCDA 3EGNA 1E6YB 4I64A 1TTHB 3SEOA 2KG1A 3GIKA 3K5MA 2FLNA 4IOAQ 3I0RA 4DUYJ 3Q24A 3EGZA 3W5YA 1TV6B 1REVA 1S1VB 2W2PP 4FNHA 5KG2A 1XNRJ 2W4DA 1OQ3A 1EARA 1OY8A 3DLEA 1EKSA 3V81A 5AE1A 1UWBA 1JLGB 1KLMA 2M5YA 3HHKA 3QT7A 5GADU 1BMQB 4RWXA 2EFVA 3CCUS 4NLPA 5J2MA 4B3TF 1JLGA 1KLMB 2AJ2A 3PYDA 1XERA 4I6WA 4OX7A 2YPZA 1Q86T 1KTVA 1WOPA 1JLQB 3C16A 1Y5NB 5LMUJ 1T02A 3NL0A 4XIUA 3NS5A 1KVJA 3VZHA 1T05B 2D41A 4J9OA 1B4SA 1TKXA 2AT1B 2FHOB 4FNIA 5DQIA 3K5LA 2ZJRQ 1KNZA 1NHUA 3Q89A 5AE3A 1YZ6A 2YWEA 4ZOSA 2XQCA 3HVWA 1K73T 5JUMA 1NH8A 1SC6A 3BGLA 2ASJA 3HHLA 3BGFA 2DNHA 2AZ1A 4DPUA 1SH0A 8AT1B 1D9FA 3ISND 4RUAA 3I5AA 5CA5A 1S7HA 1SL0A 4ILLA 4WZMA 3D0HE 2VASA 2I2YA 3FZ2A 4ED5A 4M5IA 1TUWA 2GNKA 4WFZA 4NOHA 2HLUA 4O4GB 3UQSA 1VGYA 3SDEB 2MQOA 3GQCA 1FE0A 1TVRB 2BJ9A 3T5LA 2FJEB 3D1OA 2Z58B 4LRDA 2ZH9A 3DOKB 2DNRA 5THWA 2LEPA 1TP7A 2V34A 3QGHA 2YPYA 2ZBQA 3LP0A 1FNOA 2VONA 2M8DB 4QWEA 3VAJA 4CLSA 5H9EK 1RT3B 5DGAA 1SJFA 4HDHA 2CQ4A 3WC2A 3M2VB 4OZ3A 2GHPA 3CE8A 2R7OA 3QIDA 4PCQA 5E3RA 4OLOA 3MEGB 4EGLA 2QE5A 3PKYA 1X4GA 2MLXA 1TUGB 1S6QB 3CDBA 2IM2A 1FERA 1RBLA 2BKNA 3NS7B 4RZRA 2E1PA 2PN6A 2CVIA 2M2BA 3HFKA 1F9HA 5G4DA 3Q8RB 2QA1A 4P7TA 4WKYA 4QIFA 4X4RA 2ZH5A 4K4ZA 4LF5J 3OFHA 3DKDA 1KLNA 1RAHB 3R3TA 1DARA 5HLFA 4DUZF 1HBMA
chains in the Genus database with same CATH topology
1WWHA 4JYAF 1HWLA 4ICLA 2FHJD 4NYZA 2ZJQQ 3LO3A 4ICLB 4USIA 1TL4A 4Q43A 2KYZA 3FMBA 5LSLA 2A2CA 4DSKA 3BN4A 3CJ4A 1G6BA 1X0FA 1R0AB 3CJ3A 4NLOA 2RF2B 4ZS6A 1FD8A 2DR7A 1OPZA 1SH2A 3HKZD 3P96A 5L1KA 3OXGA 2DTJA 2FD2A 1D9AA 5BYSA 1U1LA 4DG1A 4M94A 1FK9B 2V8VA 3Q8QB 3H2VE 5D4NA 5L8RC 3HVRA 3Q8SB 1WI6A 2VPZB 1MW7A 2WCXA 2RIJA 2YNIB 1UVMA 3C6UB 5K8PA 2ACYA 3TVYA 3I6PA 1APSA 1Y5IB 4CT8A 4MK8A 3FSXA 5KT7A 4ED7A 2DVIA 2EFNA 4BWJA 3S1TA 3T1YF 4L6V3 4X66F 5AXKA 3AY0A 4LVOP 4ES3A 3RRHA 4W92B 2JVRA 4ZDNA 3JTOA 4YQWA 4YB7A 3QGGA 1NKBA 5FDLB 1KSPA 2FPHX 1YI2S 3QMQA 1N0VC 3U02A 4BBYA 4RW8A 2ZM6F 2R7TA 1PGZA 1AW0A 2MQMA 1M5KC 2CZ4A 3LP1A 3MFIA 3KJVB 1ZAVA 2FC8A 1SIWB 3LGNA 4F50A 5EDWA 3KJVA 3CF5Q 5EN1A 2IA6A 2LXIA 1FDNA 2CPZA 3FEYB 1ZYQA 2XCPA 1TV6A 3MDFA 2KI2A 5G0RB 3O6QA 5B0GA 4QR0A 4M5DA 2V9WA 3CPWR 3W2VA 2VG7B 3D1HA 1ZZFA 2FHKA 3D1QA 5GADI 2A1BA 3POTA 4HHJA 2Y1JA 1UFLA 2D3UA 2VBXA 1R27B 1R8HA 2DH8A 2YWGA 1RYRA 2OTLS 1RT7B 3G86A 1C4AA 2U2FA 3S6EA 2IFXA 2JH3A 2DGUA 1RT7A 3BEGB 3Q2TC 4FXDA 2P5VA 2D9OA 1UJ6A 5MLCV 3E01A 4PG8A 3EPIA 2OD6A 3BJYA 2V8DA 4IFVA 4DL5A 5ADZA 3QGPA 2RS2A 3G4SS 1OIAA 1VI7A 3D5MA 1I94F 1DLOB 2HHSA 4PUOB 4ETZA 2LCWA 2O67A 3I32A 1B0PA 3LANA 5L39A 1ZTWA 2BANA 3C66A 3M32B 3AAWB 1UJ5A 3KNAA 3EXYA 4NZ6A 3DRPB 3RYLA 5HO4A 3H25A 4X4NA 2GQQA 2W4PA 3H20A 4ZP8A 4Q44A 1TFWA 3PIPQ 2HS4A 1PSDA 2VC0A 2ZUGA 2WONB 3IWXA 3G6ES 1NZAA 3R5BA 1X4BA 2ZH4A 3SDEA 2FLPA 1FJCA 2XMUA 1U1OA 4DR4F 2U1AA 4P2SA 3DOKA 2ZDOA 4HT5A 4R0EA 5F9NA 3F73A 2CJBA 3DM2A 4O23A 3TAQA 3K5OA 3MEEA 2QV6A 1U47A 4A8MP 2CQ2A 2J9EA 4YP3A 1S9GA 2B4UA 1IKVA 3MM9B 5AJ3F 1KC8T 1KEKA 3DYAB 3RU0A 2I1RA 4ZP7A 4EUVA 2DD8S 3K8WA 4ZVGA 1FJEB 3B4DA 3JSRA 5A8KA 2DO4A 3OUYB 4NZ0A 3HT3A 1HMVA 1RTHA 1VRUB 4DPOA 2X51A 3OUYA 3HZEA 3VF0B 3N01A 2M9KA 1VRUA 4F2RA 2QSFA 4G1IA 2YX4A 2QMWA 5J1NA 1RT1A 1SV5B 3EGWB 4KGKA 2R7WA 5KT2A 5I3PA 2C3YA 4Y2MA 3B78A 2Q79A 2UUWA 3KFWX 4XPEA 3QZ7A 3KG0A 3L3CA 4ZVEA 5E5NA 2J9DA 2XNRA 2KN4A 3CD0A 3VAHA 4NLTA 4D3GA 1JLFB 3IR5B 3K5PA 1VC0A 4IQMA 2ADBA 4IG3B 2WBRA 5FJ4A 3BO2A 2J6TA 2ZNYA 1FK9A 4QQBA 2L48A 1WHXA 1VQYA 1X4FA 1ZM2A 4RX6A 3I5CA 2IM3A 4QZVB 3TAMA 2HNZA 1TQLA 3RZAA 4NLGA 1N5VA 2YQ3A 2CPYA 4C8LA 3ITHB 4PG5A 3F56A 4QYZJ 3K2YA 1FDAA 4PRFA 3PDNA 2HIQA 2DB1A 2RSQA 2B7BB 1EP4A 2MGZB 1IM4A 2AJ4A 1O0PA 2MMYA 4WU3A 4CO0A 4N56A 4RW8B 3OJUA 2WRMA 3CT9A 1FVSA 3H5XA 4MKBA 3JSBA 1N56A 1XNQF 5D8HB 3HHNB 1NNDA 5HQ8A 1UVIA 4NA1A 5K8MA 3GE9A 4PWDB 2CKWA 2ZITA 4GO5X 1GX6A 1R43A 2IBKA 2MJNA 3L7PA 2XS2A 3QJPA 4N8NA 2JSXA 4G3IA 2HQ3A 2DHSA 3IR7B 4HLBA 2F9JA 4Q7AA 1HWKA 3VQTA 3DCAA 4ELTA 4C11A 4DL7A 1WI8A 1FF2A 4WE1B 3MM5B 3TYTA 3V6DB 1VQ4S 3Q8PB 4K4VA 2E66A 4LF8F 2C3UA 4J9LA 1T7PA 4Z2XA 4Y00A 5GAEI 2ZHAA 1D9DA 4YHHF 3PO5A 3NAIA 2DR9A 1DLOA 5IQQA 3FQKA 1FXLA 3CXCR 4OI3A 1S6PB 1S1TB 2E1AA 2KH9A 5L1LA 1RT6A 2CQHA 4KGMA 1TFYA 3H5SA 5J2NB 3ULHA 2FUG9 2IBOA 1RTJA 4HKQA 4B9MA 2D74B 2LA6A 1TKZA 3T3FA 1S72S 3BDPA 4Y2KA 4D3HA 1D1UA 3CD5A 2LKZA 2UUBF 1YITS 3SFUA 5LJ3Y 2J76E 3DOLB 4MH8A 1T94A 3TO8A 2J9CA 3GFZA 1DRZA 4TQRA 3PX6A 1Q79A 1SL2A 4RLEA 2HHXA 2IVMA 4F25A 1XMQF 1L3SA 3EPGA 2GO9A 1P1LA 2W7AA 3NRBA 3V6HA 1HNXF 4X4SA 4ILRA 1SKSA 4WYLA 2C28A 4LSNB 2EWHA 3CCES 1YIJS 3MEGA 3NP5A 4DR3F 3OHAA 2G9OA 4UY8T 2XSFA 5KG6A 2PC6A 3I87A 3DHWC 2R8GA 4OHXA 3DLBA 3BB5A 3IO1A 2M7SA 2IAJA 3IRXB 3RW7A 4DR7F 5T41A 4R8UA 3SSSA 5KTQA 1VIOA 4KC5A 1VQLS 4WZQA 3BM7A 1CQMA 1HNZF 4DR6F 4IFYB 1K1SA 3GFXA 1JKHB 2FIUA 3NWGA 4F3QA 2HQIA 1EETB 2IMOA 3OTDA 4EEYA 3IS9A 5DO2A 2GC8A 4EBCA 5IS2A 4BDPA 1TK8A 3CO9A 4Y2IA 1LXNA 1N36F 4IG3A 2R8KA 1VK3A 4A8YA 4O0IA 2NR0A 4QPXA 3SCIE 1U1MA 4YY3F 1DHMA 4ZVHA 3TAMB 3B8HA 3N5BA 3TUZC 1B0TA 3HDSA 3TANA 3DFEA 2MY8A 4JI8F 5JVHQ 1Q7YT 4OFZA 1IXKA 2YWHA 4DL4A 1E6VA 4MIAA 3HHDA 4FVCA 4BWMA 1JJ2R 3FQLA 4Q2MA 2IA0A 2N7YA 2CPJA 5IM0B 2J8AA 2YKMA 3THVA 5EX3A 2CJAA 1MSWD 4O44A 1DAXA 4KFBA 3GIIA 3O44A 2VPXB 4QOTA 1R8PA 2BXJA 2OAUA 4C7QA 5DLGA 4ES1A 3I56S 2VG6A 2FLOA 3N0VA 2IYGA 2YH1A 1G3OA 4LF4F 3I82A 4B3OB 4Y6IA 1R8AA 5HMWA 2QLWA 3AH6A 1AFIA 3MM8B 5KT4A 1HQUB 2XMJA 3GILA 2HRUA 5MAOA 3E8OA 4M5DB 3SCKE 3MM8A 3J80Y 3KLHA 1VJWA 1S1WA 4JV0A 3KLHB 2M52A 1KONA 3BGUA 2E1CA 5DS7A 4KBIA 3CD6S 2CPXA 5IFMA 4LSLA 2RU3A 2PD1A 3D0GE 3T1HF 2HHWA 2QYCA 3TOQA 2KG0A 4KB7A 4MTPA 4DJBA 2POKA 4JI0F 4FN5A 5J2MB 3IBWA 4DFMA 2DRBA 4TU8A 1GT8A 5CHCB 4C3LA 3M6VA 5K14A 3K59A 1RTIA 3N6LA 2WW8A 1ZM3A 1JLQA 4OV1A 1U1NA 1BQNA 1D8ZA 3V6JA 4C8KA 4DUYF 4RW7A 4IO9Q 2DGOA 2YKNA 4OX9F 3TAPA 3AA8A 5F3ZA 2ZH7A 3TI0A 5I42B 1FEEA 2PI5A 1XNRF 1S0VA 2XMVA 3HZGA 2I0XA 2K7KA 4Q0BB 2R8IA 2C3OA 1T03B 4YEAA 2J7WA 4NA2A 3KHRA 2ZHBA 2DHAA 2OLWA 1XEZA 1SJ4P 5B0BA 2GMJA 2ASDA 1WG5A 4HYKA 1QUVA 2BVZA 1U2FA 4IDKB 3O3LA 4Y2AA 2O66A 3F41A 1Y3JA 1YHQS 3DRYA 5KFYA 1Y9OA