2BOPA

Crystal structure at 1.7 angstroms of the bovine papillomavirus-1 e2 dna-binding domain bound to its dna target
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure at 1.7 A of the bovine papillomavirus-1 E2 DNA-binding domain bound to its DNA target.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*CP*GP*AP*CP*GP*TP*CP*GP*GP*TP*CP*G
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1994-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bopA00
4C4WA 2CPDA 4IO9Q 4PRFA 3NNCA 2J0SD 2MJNA 1N54B 1K9MT 2M52A 3UCZP 1WHYA 2DK2A 2DO4A 1WI6A 1ZZFA 3LPYA 5GAEU 3VAFA 2XS7A 3LQVA 2M70A 3G6ES 1WI8A 4M5DB 4C7QA 1FNXH 3CCQS 1FJCA 2DNPA 2O3DA 2KRBA 3H2UB 2AYEA 1WG4A 1FXLA 2LCWA 2RT3A 4F26A 2FC8A 2LA4A 2HVZA 4IOAQ 3I56S 4QU6A 3P6YC 1VC6A 3N9UC 3K0JA 2DGWA 2I2YA 1H2VZ 2AYMA 2RQ4A 2XS2A 5IQQA 5HO4A 3MOJB 2MKIA 3VAKA 1SJRA 3NS6A 4TU7A 2CQ3A 3UCGA 3MUMP 1S72S 1BY9A 2MZQA 2JWNA 5D77A 2CQ0A 2DNKA 2KHCA 1WHWA 3G96A 1U1PA 3CCRS 1KQSR 1X5SA 2CQ1A 3CMAS 3RW6A 2ADCA 2E5HA 4CQ1A 2M88A 3CC7S 2X1AA 2DNMA 2MQPA 1U1KA 2X1BA 2M9KA 1VBXA 1JMTA 1FT8A 3VALA 2KU7A 2Q79A 2KG1A 4UY8T 2HGLA 1NJIT 3G8SA 3THPA 3S8SA 3CCMS 5IM0A 2RRAA 3VAMA 2DGTA 2KFYA 4LIRA 2M0GB 4IOCQ 3ZZZA 2DGVA 3MUTP 3DXBA 2KM8B 4F02A 1U1RA 1B7FA 2DGQA 4FXVA 5DDQC 1Q86T 1Q82T 1X4GA 1VC5A 3CCES 1YTYA 1H6KX 1HA1A 2XSFA 5CYJA 1FJ7A 2XNQA 2KT5A 2MQLA 1WF1A 3IRWP 1R8PA 1WHXA 1WEYA 2KXFA 2NLWA 2CQHA 4Z2XA 5LJ3Y 2MKHA 3R1LA 2AYBA 1VQ8S 2KM8C 2LXIA 4QPTA 1P27B 2XB2D 2CPHA 2F9DA 3SDEB 2LQ5A 2X1GA 3HHNB 3BEGB 1SJFA 3VF0B 3NNHA 2M7SA 3US5A 3RW7A 2MGZB 1QVFR 4RU2A 2CPEA 1YJ9S 2CQ2A 2DHAA 1A9NB 3CTRA 4YB1P 3CCJS 2EK1A 1M5PC 5GADU 3R1HA 3MDFA 1M1KT 2YTCA 2YH0A 2I38A 4WIIA 2MKKA 3CCUS 5IFMA 3BO4A 4A8XA 2JRSA 1HD1A 1PO6A 2DISA 2CQ4A 2J8AA 4OZ1A 1YWXA 4CIOA 2CQCA 1FHTA 1PGZA 2M4MA 1CVJA 2RS8A 2LKZA 3NS5A 4C0OC 3CC4S 5JVGQ 2N3LA 3CCSS 1DHMA 1DRZA 1D8ZA 3HI9A 3DLLQ 2MKCA 2DHSA 2LYVA 5DDPC 2KH9A 3B4MA 1HD0A 2E5IA 1WF2A 2ZJQQ 2KG0A 3V4MA 1X5OA 4TU9A 3CULA 2J0QD 4WF9Q 2DNGA 2EK6A 1N52B 2L41A 1WTBA 4EGLA 2DIUA 1M5VC 1WF0A 2MJUA 1X5TA 1X4DA 2MSTA 2BZ2A 2DNQA 3S01A 3J7YU 3SXLA 3THTA 2V94A 3R27A 4WFAQ 3NMRA 3CUNA 1IQTA 5BJRA 4TLQA 4IUFA 1X5PA 2N82B 1YHQS 2RU3A 1N8RT 2MSSA 5LXRA 1WWHA 1SXLA 3G4SS 2HYIB 3PIPQ 4ED5A 1F9FA 1N88A 3VAHA 2CPIA 5CXTA 2LEAA 2MXYA 1L3KA 2MQOA 3MI7X 2N7CA 1VQNS 3VAIA 2WBRA 2DGSA 2A3JA 3CPWR 2CPZA 1U6BA 1XN9A 1H2UX 1U1OA 2G1DA 1UP1A 2EVZA 3JB9k 2YKAA 4WKRA 5DDRC 3UD3P 2ADBA 2JVRA 2X1FA 1X0FA 2DNRA 3J7ZT 2QFJA 3SMZA 3ZZYA 2MGZA 5D78A 1ZH5A 3NNAA 5LSOA 2MZJA 1Q7YT 2D9OA 2VOOA 3MXHP 2OSRA 2OIHA 2G0CA 2E5JA 1OWXA 4W90B 2L9WA 4PR6A 1OPIA 3U1MA 3PIOQ 3G71S 2MMYA 4Y0FA 4U67Q 2MZ1A 2DITA 1U6FA 2MQQA 1FJEB 2XS5A 1UAWA 2DHGA 2CJKA 3CCVS 3P5TL 2CQBA 2D9PA 3Q2TC 3FEYB 1W2BR 2DNLA 3UWTA 2B0GA 3EX7B 1HL6A 2RS2A 5JVHQ 2DNHA 4UQTA 2KI2A 2MKSA 2DB1A 1WG5A 2OTLS 3MD3A 4WFNQ 1OO0B 2FY1A 2ZJPQ 2M2BA 2CQGA 4J5OA 1U1MA 2F9JA 1YI2S 3MD1A 1JJ2R 5GVQA 1VQMS 1X4HA 5DETA 1X4CA 1JJ4A 1DZ5A 2DO0A 3ULHA 1VQKS 2RQCA 2SXLA 2CQPA 1SJ3P 1ZZNA 5FJ4A 1X4AA 3FEXB 2E44A 2CPXA 1VQ6S 2OSQA 1WHVA 1VQOS 2DNYA 2KYXA 2HZCA 4CH0S 2DGOA 1FO1A 3CXCR 2JX2A 1WEXA 2FC9A 2LMIA 2K3KA 1A7GE 2YWKA 1VQ4S 5CA5A 3P3DA 1VC0A 2ERRA 3OW2R 2F3JA 2DH8A 3VAGA 3CCLS 2LECA 1M5KC 3UD4P 1YITS 1Q81T 2LXUA 1WELA 1X4EA 5HL7Q 1R8HA 4LMZA 4V19X 4ZKAA 1WG1A 5GAHU 2AYGA 1H2TZ 2KVIA 1QM9A 2DH9A 1RKJA 2U2FA 2CPYA 3S6EA 2L08A 2ZJRQ 2LEBA 5LJ5Y 3G9CA 2FPHX 2JVOA 2BOPA 1OIAA 1U1LA 4YOEA 3H2VE 1VQPS 2CQIA 2LA6A 4TU8A 5EN1A 4FXWA 1K73T 2MZSA 2VOPA 4F25A 4YUDA 1YJNS 5H1SV 3P49B 1KOHA 1AUDA 1KC8T 3TO8A 3MURP 1KD1T 2XNRA 1URNA 2VONA 2RNEA 4PKDB 1U2FA 1RK8A 2QA4S 4QQBA 2DGUA 5GMKa 2CQDA 1VQ5S 2PE8A 4WFBQ 4P6QA 2MY8A 3D2WA 2DIVA 2RUGA 3I55S 5LXYA 3EGNA 4BS2A 3MUVP 2DHXA 1UW4A 3CD6S 1DBDA 1SJ4P 2MPUA 4W92B 1YJWS 3G8TA 3L3CA 3U1LA 1X4BA 3UCUP 1QVGR 1NU4A 3S7RA 1O0PA 2MY7A 2DH7A 2MYFA 1X4FA 2CPJA 1U1QA 2QEXS 3EGZA 2OTJS 4LJMA 2U1AA 2DNNA 2MB0B 2D3OR 1NO8A 2MZRA 5DM6Q 1SJQA 5LSLA 2M8DB 1VQ9S 5IM0B 1VQLS 2K8GA 1P1TA 5DM7Q 2OJ3A 4CH1A 3UE2A 2KRRA 4QU7A 1D9AA 2CPFA 2J76E 2KXHA 4OZ0A 2PEHA 2MQMA 3BS9A 2MHNA 2HGMA 1VBYA 2G4BA 1S79A 1M90T 2GHPA 2MKJA 5GAGU 3BO2A 3CMES 3TP2A 1G2EA 2UP1A 3CC2S 2VODA 2M8HA 3VAJA 2NZ4A 1UFWA 3CF5Q 1U1NA 2DGXA 1M5OC 2YH1A 1WEZA 5ITHA 2DNOA 2KXNB 1KOOA 2RRBA 3TYTA 3Q2SC 2GO9A 5MLCV 2KN4A 4WCEQ 2RVJA 1JJHA 2HGNA 2MQNA 3B4DA 5DDOC 2FHOB 1K8AT 4ERDA 1VQ7S 1VBZA 2DNZA 3SDEA 3BO3A 2AD9A 3IWNC 2N3OA 4Y00A 2E5GA 1YIJS 2MZTA
chains in the Genus database with same CATH superfamily
5DG9A 4MTPA 3I31A 2OELA 3NRBA 4DV6J 3NNCA 4PRFA 2J0SD 2XQCA 3Q22A 2XO6A 2MJNA 1UETA 2H4WB 2M52A 4TY8B 3OSPA 3T6JA 1FDDA 4DR7F 1KVKA 2DO4A 2F8MA 4JP8A 2UUCF 1WI6A 3PY8A 3QT5A 5GAEU 1UMJA 4P74A 2B4OA 5B0DA 4DU8A 4DV0F 4J37A 1VFJA 3CB4A 1RTZA 3EXCX 4FVMA 4NEYA 3NGDA 1UVIA 4C7QA 4OLOA 3GILA 5AT1B 2R8GA 3QWPA 4MYTA 2ROGA 3QO9B 4FN5A 2DNPA 2O3DA 3BDPA 5J2PA 1CLFA 2GQCA 4TN2A 2UVWA 4QWBA 4U95A 2RDJA 1FXLA 3W65A 3DRXA 3DM2A 4QBUA 5KFYA 3ELHA 1VRUA 2LA4A 1U09A 4IOAQ 1W25A 3D5MA 2W9AA 2C2NA 1J5OB 4QU6A 2K1RB 2XMAA 4CNZA 3BR8A 5E2QA 1RTJB 2F65A 4AUKA 3P6YC 4QCLA 1MNEA 1TV6B 2ILYA 2B7BB 3A3PB 2AYMA 3PVXA 1LEOA 1REVA 2J7UA 3DOLB 2CZVC 3MM8B 3RBXA 5FLXU 4K4SA 3VAKA 1SJRA 2W2NP 3I32A 1BY9A 1ELOA 2DXEA 2CFXA 5LMUF 3U1NA 3KK3B 3EZ5A 1ITPA 4PEOA 1RT7A 2EBGA 3SYZA 2J6UA 1SH2A 1UL3A 3A3NB 4P71A 1T11A 2WHOA 3CJ8A 3HXMA 1HWKA 4OFZA 4OX6A 2ADCA 1HNIB 1FFGB 3CD0A 1HNVA 4RX6A 2G1HA 5ETPA 3S1TA 1C1BA 2VDIA 4USMA 2X3DA 3AJDA 1Q8BA 3HZGA 2X1BA 4G1QA 3VGVA 2AF6A 2C42A 4RNFA 2H9ZA 2M9KA 5K14A 4KGVB 2KU7A 5SUHA 5A6WA 3D6HB 1GTEA 1JK9B 2B4VA 1OYDA 2E7VA 1SPBP 2P6SA 4PAAA 3TA1A 5F8MA 2JEIA 1TKDA 3CT9A 2HMIA 3J7Z5 4FKYA 4PWUA 2HQDA 1BQXA 1SH0A 2R4FA 1BQMB 1S5ZA 4ZVTB 1CJTB 1SCJB 1CSJA 3N0VA 1QJHA 5K8OA 3OL6A 3VAMA 3VCDA 1KFDA 4C3LA 2A6MA 2IPOB 4XDCA 5B0BA 4NLYA 1PYOB 1CG2A 1EETB 2F5GA 3NOCA 1NM2A 4DPYA 1D8YA 2YKMA 4GKKJ 3VQSA 3V6KA 2DGVA 1KLMA 4KO0B 1FWKA 3OL7A 4B3SJ 5KFZA 5KFLA 1QAYA 2VU5A 1UEVA 3GFYA 4OYAA 4EBCA 4B08A 2VIHA 2NXJA 4FXVA 4LSLA 2QL5B 5DDQC 3QRRA 4UT4A 4OX7A 1J5EF 4NLWA 3CJ5A 4ZVHA 5KG5A 4JI7F 1HA1A 1H6KX 4RW7A 1TKZA 3GYGA 5KFAA 1WC3A 3SSQA 3MPUB 5DGAA 5KT7A 5IS2A 1R0AB 4N8OA 4OZNA 4ZN3A 5DM7Q 3OBIA 4OHXA 2YNFA 4IFVA 4LF2A 4DG1A 2RRNA 4OZJA 3IRWP 1XEZA 1K44A 2V50A 1WHXA 3RAQA 1WEYA 1MW7A 2KXFA 1L3TA 5T7LA 2HHSA 2MKHA 2CNLB 1SL1A 1XK8A 2CDRB 3EGVA 2JC0A 1P9QC 4JBCA 4RR5A 3R1LA 4W4MA 1HHSA 1HPZA 4RWXA 1I6JA 4MKYA 1LW2A 2KM8C 1EHWA 3LH2S 4FF3A 2DKOB 3UPFA 4XTTA 4JI0J 3O2IA 3W2VA 3G6ES 1N36J 3TZYA 5L1JA 1LWCA 3PW4A 2X1GA 3K5MA 1OPZA 3AXKA 3N79A 3MF5A 4K4YA 1U24A 2NUHA 1IN0A 2XZTB 1HNZJ 4LVOP 4WFZA 1QE1B 2BOAA 3AXMA 2I5JB 4OI0A 2W9CA 1CQNA 1WDDA 2VF3A 2MGZB 5GAEI 4OZ3A 4RU2A 4F4AA 3MEGB 2CQ2A 3KK2A 1SV5B 3ZO7A 3OUYA 1KVIA 2AKWB 5D6GA 3RRHA 3QYYA 4RKUC 3GR1A 2Z4PA 2NQPA 2NYIA 3IFEA 4KR0B 1FD2A 1DTQA 4I56A 4Q2MA 5G0RA 3PXGa 2QL9B 3MDFA 2VQEJ 1TFYA 2BE7D 4HEA9 2JEGA 1MMLA 3A3OB 2BJEA 3ENWA 2BABA 3LGMA 4ZVPB 1M1HA 1BXNA 1FK9A 2GVDB 2OD4A 3V4IA 3QPIA 2WVDA 2JRSA 2FLOA 1V5IB 2ZH2A 4ZIWA 1R43A 2VB6A 1MWQA 2E1RA 4WFYA 3CCTA 2ROPA 3DHXA 1RABB 3OTCA 4OYXA 2CNNB 3WDOA 5BXIA 1NSQA 5HLFA 1FHTA 4DL0C 2XLJA 4NLVA 3HO1A 1CVJA 3GZ7A 3KHGA 2LKZA 3NS5A 2BE2B 3TJ9A 1AYEA 1SL2A 4TVAB 1RHJB 5EX0A 3QT7A 2OJ3A 3CC4S 1FJGJ 3DCAA 2CVEA 3TAMB 2H51B 1DHMA 1JLCA 1UVMA 3KMQA 3J7A1 3HT0A 4JI3F 4OV6A 1EAYC 2BKNA 4TKTA 1XR5A 4DR3F 4NXNJ 5D0EA 2DHSA 4M5LA 2RKIB 4KT0C 2ZH3A 1X9MA 1H0HB 2MEWA 2MLZA 3B4MA 2HHVA 2KZZA 4ID8A 1CJVB 1WF2A 4Y28C 3I6PA 3DGVA 2BM1A 2ZJQQ 3M2RB 1X5OA 1JKHA 2XGQA 2HQIA 2DNGA 2HIYA 3QAUA 2EK6A 1FJGF 3H42A 2R7RA 1BLUA 5HVFA 5CH7B 3AAWB 4B3SF 1P1LA 2MJUA 1UVKA 4ECWA 1X4DA 1YG0A 1RI7A 3FSYA 1TP7A 3J7YU 1TKXB 3QGGA 4H4KC 3OL9A 1RWMB 4URQU 3MPYA 1XMOJ 2J6SA 2Y8WA 2QLXA 2B7CB 1IQTA 4ES2A 2PIIA 5DQGA 1BC6A 1YHQS 4LRCA 2B8PA 1UWAA 3KG1A 3JQMA 2WOMB 1FWPA 1N5YB 1K0TA 3LP2A 1ULRA 1NKEA 4ED5A 4OX9J 1MG7A 4HT7A 3QQCD 3BYPA 1VDHA 4CZCA 2IJNA 3WBZA 3NKYA 5KFBA 4B9TA 2CWXA 1FNMA 2MKYA 2ASJA 1T05A 1DTTA 2I9SA 1F5BA 2XMKA 4AL5A 3P45B 2OEKA 3O5TB 3PKYA 1RT2A 2HFUA 4J7CA 2R7XA 5F9LA 2L3MA 4TLRA 2IA0A 4Y3CA 2Z30B 4ZPVR 1NRKA 5HQ8A 5LMUJ 2DVIA 5KFFA 2IYGA 2YQ3A 4PXCA 3MM5B 3JSMA 1IKXB 1TMMA 3KK3A 4M8LA 3AD7C 1L3SA 3C46A 3GCXP 1JQGA 3RBZA 3EPGA 2AGPA 4QZVB 1C1BB 3CJSA 4Y6IA 2LXFA 1HARA 4MMOA 5KFSA 4CO0A 1I94F 2NR0A 1UP1A 3PG9A 2IBKA 2J7WA 2Y0BB 4RPFA 4A8SA 2FD2A 2RAQA 3M9NB 5IV3A 4IR1A 2YNHA 4TQRA 3ENVA 1CS4B 2K7JA 3FGVA 4B17A 3CDUA 5I3QA 2ATCB 2UUWA 2DR6A 3D6FB 2Z2ZA 3KUGA 5DDRC 3PV8A 2HMIB 2OPQA 4EEYA 4NYOA 2V4JA 1H98A 3W5YA 3W62A 1J5EJ 1U0HA 1NSAA 5LL6d 1CJTA 2NSCA 1VLYA 4C8NA 5HMYA 3E01B 3GJSB 1IKWB 3NGUA 3M6UA 4O44B 4RBUA 5HI7A 4O3QA 1HHQA 3J7ZT 3VGTA 2ZH9A 3HVRA 3FMBA 4RW6B 1Y0HA 2MGZA 4B9SA 2YNIA 3R3TA 5D78A 4HKQA 1YRXA 4Y65A 3PR4A 2RIJA 3NNAA 1Q7YT 1CJUA 2WVFA 4GKKF 5KFHA 1JLGB 2EFQA 2OSRA 3H4DA 3BSNA 1TL1A 2HK3A 2UUCJ 2EFOA 2PN6A 1CJKB 4OX8A 4RW9A 3QFWA 2ZOFA 1NK6A 2KTQA 2G0IA 3OVSA 4W90B 4RUBA 2OMLA 1NJXA 2BANB 2ZEJA 2BQRA 3O8WA 4X4OA 1ACMB 3H40A 2BKOA 5HATA 2YKOA 4WXOA 4Y0FA 3GYXB 1SKUB 4DQSA 5KOXA 1U6FA 2H3EB 2MQQA 1QUPA 3C15B 4NLPA 5KFUA 2C2EA 3UVJA 1IBMJ 4UUXA 2YKQA 4HI1A 3MAAA 3FDSA 3A13A 5F0UA 3WC0A 4DFMA 1RTDA 1HBMA 3BB5A 2BW2A 1OYEA 1M0SA 4MYUA 5L9NA 1HBOB 2XYPB 3BV8A 4I2PA 4YDDB 3Q2TC 3FCVA 3GIMA 3PX6A 1RACB 5F3ZA 4ENOA 3R5JB 5HANA 4YS2A 3ZZUA 3AY0A 3W2VB 2FVCA 1GMUA 2RS2A 5F8JA 1KQGB 4PUOA 1RJJA 3VV2B 5CYMA 4UQGA 1WG5A 3QGIA 4A8YA 2OTLS 5U47A 4ED3A 1HMVA 3VWSA 5C24A 2JEFA 4J5OA 1U1MA 4ANDA 4F04B 4ELTA 3G82B 4NZ0A 4A8OA 1QY7A 2F9JA 4I6WA 3M8PB 5IC6B 3KUHA 4DPUA 1YI2S 1DFDA 1SV5A 3ISND 5GVQA 3OUYB 1JKHB 1ZA2B 4LREA 3WIVA 4DL7A 4PG8A 2AQ4A 3EDRB 5G0RB 3LALA 3QGHA 4X4RA 3T5KA 5D4LA 3HKWA 3ZTSA 2EG1A 1SJ3P 2I1RA 2YPZA 1PYTA 2DRDA 4DZ6A 4J9UE 1ZZNA 4F2RA 4NMLA 4QYRA 2GVDA 1LWFB 1VQ6S 2HIQA 2OSQA 5IWAF 3RUBL 2JZ5A 5GMDA 5HQMA 2Q3PA 2JLGA 1X60A 4KKOA 3WIUA 4IG0A 3V6JA 3GE9A 2HVHA 1T94A 3SFGA 3AOCA 4XO0A 2QA4G 4ECTA 2XLKA 5H9EJ 1WEXA 3JAMU 3IO1A 3HT3A 1AA1B 1RT1A 2YWKA 4QJVA 1U26A 5KG4A 3P8BB 5CABA 4JV1A 2PMHA 3QBCA 1TR0A 2V69A 4LFBF 4J9QA 3T1AA 3Q8UA 2ERRA 4ZCKA 3O44A 4DMZA 2ALYB 1HBNB 2F3JA 3HCXA 3HSDA 4ZLLA 5J2NA 4YP3A 4CT9A 2Z56B 1M5KC 2C2ZB 3MEKA 4R5PA 4C8YA 3UD4P 1Q81T 1Z4UA 2HBZB 4USTA 3RAMA 3TA0A 2HRTA 2F4FA 3AD9C 1WG1A 2LU1A 2Z57B 3DOMA 2IM0A 3J81U 2PMWA 1RT5A 5AJ3J 1H2TZ 1RT7B 2DH9A 2KVIA 2NXNA 1IKXA 1F1BB 3KUEA 2DR5A 5HBMB 3NP5A 3S6EA 1EKSA 2L08A 1EP4A 3IRXA 5D4OA 3BKUA 2JVOA 1KRPA 4JI6F 3ONQA 3HSJA 2D41A 2WSEC 2ZD1A 3D1HA 4LRBA 2E9RX 4YOEA 5CCMA 3V6HA 2FJVA 3JTPA 2UUBJ 2HNZA 4LFBJ 1UJ4A 2CQIA 2V34A 1SC4B 2LA6A 4O0NA 4K4ZA 4FYDA 4F4KA 1XMQF 3Q23A 4USUA 2R7VA 1GTHA 2CZ4A 1U2RA 3T41A 4ELVA 4WBFA 4DF8A 3MCSA 2HFOA 3OTOJ 1S7HA 1KNZA 2WZ1A 2YWHA 3IWXA 1KC8T 2HNYA 2WBMA 1S10A 1VYAA 1GX6A 2HBQB 2AZ1A 2QA1A 2VBYA 2Q66A 3TZWA 1URNA 4PKDB 3W2WA 2A10A 2VFUA 1VHIA 4J9PA 1U2FA 4PG4A 1FRKA 4BC9A 5HN0A 2KL8A 2QA4S 2VZ9A 1VK3A 4F4YA 1JXLA 4OHYA 1OQ3A 1OY6A 1Q8KA 2AX0A 3OXLA 4QIWD 4F3QA 4B3MJ 2OPPA 4FNIA 4NLOA 4NXMF 2GAHC 5LXYA 1VI7A 3OHBA 1EJ7L 2J9CA 3CO9A 3EGNA 3MUVP 5D15A 1UW4A 3L7UA 4DI6A 1S1WA 3CD6S 1JX4A 4K4UA 2PFFB 2YXLA 2ZE2A 5C2CA 1IBKF 1TKZB 3V81B 3R5DA 1C1CB 2F8HA 4NEZA 3W5ZA 3SCLE 3SQOP 1XNRF 3U1LA 1X4BA 1RT4A 1AZSB 1NU4A 2LQBA 3S7RA 1KTQA 1YRUA 3LA0A 4EZ6A 1Q95G 1X4FA 2CPJA 1FRMA 2PD1A 3A8JA 2GMLA 3CJ3A 3FC9A 3TWZA 1U1QA 3H90A 2B56A 1Z2ZA 3IS9B 2R2TA 1MWYA 1NO8A 4NE9C 2E1PA 1IBLJ 5ETQA 4X4QA 2GJIA 4M5HA 3KJVA 2QT7A 3FBBA 5DM6Q 4X62F 4B3RF 4CYUB 5LT5A 1AT1B 4LFAF 4FF1A 1VQ9S 5A8WB 4I7FB 4IH5A 1PJ7A 4CI0B 2K8GA 3NEKA 5IM0B 4OIXA 5CAAA 3W63A 4FVCA 4NYZA 3UE2A 4QU7A 1MLAA 1F9HA 2IVMA 2PEHA 4NXMJ 2MQMA 3BS9A 2XWXA 2ZDOA 2J5AA 3MEGA 4RW6A 1S79A 3W61A 3PO4A 1TELA 1I5OB 2QSFA 3E2EA 2IVYA 4RNOA 3NAIA 3CC2S 1SQGA 2UP1A 2FGCA 2CRLA 1DTQB 1IVZA 4ECZA 1V3ZA 3VAJA 1B70B 4RW9B 3CF5Q 1TUGB 4H4MA 3OTOF 3DI6B 1WEZA 3H8YA 4N41A 2AEMA 4ED6A 3FK4A 2BJ1A 4UTGA 3TEHB 2UXBJ 3SCJE 3BZQA 3IA0A 2YWWA 4C0BA 4F8RA 1N34J 4ZP7A 1HQ2A 1SQEA 3QT6A 4OV1A 2NPIA 5MLCV 3C6UA 3W8GA 2BRKA 4U7CA 1RBAA 2UUBF 2C1EB 1FRXA 3TEGA 2V5HG 2XI3A 1XR6A 3ITHA 1HBMB 4YB6A 4P2XA 1IJFB 3SZ2A 5KFGA 2E9ZA 3R9LA 3I82A 2KO1A 4NI2B 3TQ1A 3TVYA 2BJ8A 1RAGB 3PTWA 1JLCB 4Y00A 3PYFA 4DL2A 4RNHA 4LRFA 3PEHA 3RGIA 2IC3B 2P9EA 3EZOA 4LR8A 2EPIA 2PDAA 5CHCB 1N5QA 5IC4B 1RAOA 1UWBB 2ZBIA 3LO3A 5DQIA 4IO9Q 2VG7B 4GMKA 4KQZA 4L73A 1IXKA 2N7YA 3DOLA 4IRDA 3UCZP 2HNDA 3PRDA 4CWBA 1WHYA 2EI5A 3ILLA 2ZBPA 1QSSA 1GXTA 3PFOA 2V4QA 3GG0A 2G2OA 1RT5B 3CDAA 3VVUA 4ZLPA 3TI0A 4NLGA 2CJ9A 3CJRA 3L4BC 4USVA 3M2UA 3VAFA 2XS7A 4P72A 3VGUA 3OD2A 4ED4A 1N33J 3T1HJ 1FA0A 2VJVA 3HVWA 4WP9A 1SUQB 1FNXH 1JLFA 3IP0A 2YQ1A 4C8MA 1FJCA 1HWIA 2WONB 1B0TA 1WUUA 1KDNA 1FX2A 2AYEA 4CLYA 5IWAJ 1WG4A 4WZQA 2LCWA 5K14B 4F26A 4JYAJ 2ZUAA 2HWIA 2KFNA 1RADB 4O4GB 2ZKTA 2R8HA 3DHWC 2HKEA 3K5LA 3MEDA 4ZS6A 3MMCB 1JLBB 4LRAA 2EG2A 3AFGA 1RT6B 1YX2A 3GMGA 2KHDA 5D4PA 1N6QA 1MMNA 1NNDA 2GX8A 2VG6A 3HX9A 3KXDA 5FIIA 3OPKA 2V8HA 3OSNA 8ATCB 5L1LA 1HNWJ 4TXSA 1FESA 1Q78A 3K0JA 3G86A 1NLKL 2F63A 1H2VZ 2X7IA 4PWWA 4DR2F 2I2YA 2PSZA 1EETA 1LNQA 4CLFA 2XS2A 1RAHB 3RB6A 2XULA 3UQSA 4Z7CA 2GIFA 6FDRA 2RQKA 3AT1B 4TU7A 5M2RA 2CQ3A 3BGRB 4WTYA 1QTNB 4KAIA 3M8RA 1S1UB 5D77A 2JNJA 3DOMB 3I87A 2NXEA 3OQ2A 1NJZA 5D4NA 5JJBA 3CCRS 2UXCJ 3GLJA 3MM7A 2YKNB 4M5DA 2E5HA 3MZIA 2GIRA 3RW6A 5HVHA 1EP4B 3IRXB 3N6MA 2MQPA 3UN2A 3DMJA 4K5SA 1T9TA 4PXBA 5IV4A 2ZBCA 3OR2B 4LT6A 4C3KA 2Q79A 3VALA 4DR5F 3BQ0A 4FYYB 4JI8F 4NRTA 3HSGA 1YJTA 1U45A 3O1LA 2PC6A 2IY5B 3CWJA 4EZ9A 5GAGI 1NJIT 2CG4A 3G87A 4CYUA 1DAXA 3BGFA 4OZLA 3THPA 2E1CA 1YJUA 4ED2A 2HPUA 5B09A 2HZAA 1IKWA 2F8EX 3Q0AA 1YLXA 3D4JA 5BYSA 2OPRB 4YEAA 1RHKB 5L1IA 4HTIA 3G6XA 1HQUA 2XI2A 4OYWA 4L6V3 4XPEA 5ADZA 1VOMA 2V67A 1DQ9A 1GK8A 3JAMY 3NGRA 2KM8B 1U1RA 5D3GA 2DGQA 2Y9HA 3KK2B 3GYNA 4WFXA 1Q86T 4GC6A 3ISZA 5KFDA 2XY5A 1Y00A 1GNKA 5CYJA 2MTLA 3OVAA 2YQ0A 3CDBA 2GCFA 2KT5A 2MQLA 1RYSA 1FNOA 2VFTA 5KFQA 2QYGA 1WKKA 3GV5B 1GMVA 1R8PA 3D3BJ 4K4TA 1I94J 5KFVA 2XYGB 3AQOA 5LJ3Y 1RTDB 2OPSA 3AOAA 2OI2A 3DKDA 3FKBA 4L74A 2ZOMA 1P27B 2YPYA 2XB2D 2CPHA 2F9DA 4KB7A 1N32J 1TAUA 3F56A 1B64A 3MM9B 4X65J 3KHLA 2FLLA 1C0TA 4HH1A 1TFWA 4IFYA 4F3MA 4NLXA 5H9EK 1NHKL 5KT3A 3KLFA 5C24B 4RWWA 2RU9A 2M7SA 3AQPA 3MM8A 4LR7A 3US5A 2ZZTA 4ED7A 2DPJA 2O5DA 3HHLB 3IR6B 2CPEA 1TL7B 1PBUA 2A2DA 4LVNP 4OYPA 3R97A 1LWEA 2BR0A 2V63A 1WOSA 4K2JA 4OX9F 3KKFA 5CD4A 5KT4A 4E8UA 3CCJS 2WB1D 2F4VF 2N4CA 4X4NA 3M2RA 1WTFA 1XNQJ 1N0VC 2EK1A 1Y11A 4P7VA 5I3UB 1JNRB 3DRYA 3R1HA 1HYSA 4KIAA 2QIFA 1LK5A 3HK2A 2YTCA 1S1XA 4F50A 4K50A 4WIIA 3H98A 2H5JB 3DI6A 1UW9A 3IG1A 4DHVA 1YKWA 4FKXA 1D3WA 1JLFB 4I2QB 4YY3J 3IM9A 2OFGX 2IAJB 4AXJA 3BO4A 2E1MC 4EBEA 2V2ZA 4Q8EA 1UVLA 4PWDB 1U8SA 2DISA 4OI1A 5B0CA 4IG0B 1TQLA 4C8ZA 2BM0A 2J8AA 3M32B 4OZ1A 3D66A 5E3PA 1NDLA 2PMZD 4C48A 1RYRA 1T3NA 1WC4A 5D0HA 4DPTA 2DRAA 1F0XA 1Y5LB 3TUJC 2W9BB 3KHHA 3KHRA 3CD5A 3BH7B 3WHIA 1KBRA 2N3LA 3JTNA 2D3UA 4DFPA 3D9BA 3HI9A 2B4UA 2MKCA 1YGYA 3PRBA 4ZVGA 2HQFA 4ZVQB 1RAJA 3JQJA 7FD1A 1BD6A 1GXLA 2KH9A 1HD0A 3HULA 4NCGB 3GONA 4EMDA 3OLAA 4NXNF 4FYXB 3W60A 4TU9A 3CULA 2KJVA 4DLEA 1URRA 2ILZA 3CD7A 3X1LB 4KGKA 4CLUA 4DFJA 1TL3A 1I1GA 1NPKA 1YJ7A 4RL1A 3W3SA 2WVBA 4I6AA 1M5SA 3MMAB 5KG2A 4FS1A 4DUYJ 4F36A 1YZ6A 3DLJA 3I9V9 3PW5A 5GADI 1RTIB 2WCXA 4NOHA 3MFIA 1NK0A 4PQUA 2BZ2A 3H25A 1VBKA 4DL4A 4M95A 1OS5A 2DR8A 2V94A 4RBVA 4C98A 1F60B 2KKHA 2QN6B 3AH6A 4QPXA 2QE5A 3NMRA 1NBEB 2ASLA 2RMLA 1H38A 2WSCC 1PCAA 4LF8F 2ZUGA 1N8RT 2RU3A 2DR7A 4DR4F 3MEDB 4RLEA 1EQMA 2VQEF 1SXLA 2G2ZA 2KYZA 4JV0A 1FKOB 3G4SS 2HYIB 4HDHA 4GKJJ 4C9DA 2VG6B 3E3XA 2I6WA 3T1YJ 1EZZB 1QE1A 1U0HB 1C4AA 3CEDA 4A48A 4ZJLA 1VGYA 4X64J 3IXQA 2OPRA 3VAHA 4ALZA 1Q79A 4H4OB 1N0UA 3THVA 4H4KA 2VG5B 2LEAA 2JJ4D 2NS1B 3BKTA 4A8QA 3NWRA 4OI3A 2NZCA 1S6OA 3MM6A 1PKUA 3DLKB 2CNKB 1T03A 2MLXA 1L3KA 1APSA 2EXUA 1ZA1B 2MQOA 1S4FA 4J9MA 3MI7X 3V81A 2XG8A 4EFAC 2N7CA 1SB6A 1Y4ZB 3VAIA 2HBRB 2WBRA 4JI2F 4LF4F 3R6LB 3HJVA 2A3JA 2RJZA 4NX9A 4JI0F 3Q24A 3RTVA 3D0GE 2B9XA 3ADAC 4ECQA 2VBWA 4Y34A 2CPZA 2JOQA 1JLQA 1H2UX 4CLWA 4ECRA 3TARA 1B0PA 3V6DA 2V2VA 3H20A 1RTHA 3J80Y 3JB9k 2E66A 1PSDA 2G9OA 3M7VA 2JSXA 4NCAA 2CG8A 3NY0A 4IO1A 2AW0A 4IDKB 4J9KA 1K0VA 2DPIA 2YKAA 1EIYB 4IRCA 4WKRA 3CJQA 1H73A 3D28A 4FZVA 1SKSA 2HWTA 3UD3P 2PT0A 2AMCB 1RA6A 3EMTA 3ILIA 1NAQA 1XWLA 5D0RA 1UJ6A 5AXNA 2I5JA 1RB0A 3M8YA 3NG8A 2PGCA 2W9CB 4ZPTR 4LF5J 5IT9Y 3H5XA 2IM3A 1HQUB 3UFCX 4N5SA 3SMZA 3BM7A 4KY3A 3ZZYA 4QR0A 1SVDA 3MCNA 4RUCA 2YWGA 4CO2A 2ZDPA 2D9OA 2HZVA 4PZVA 3QATA 1U2CA 5D3GB 1FKPB 1RU1A 4KC5A 4ILLA 3JSYA 2B5JA 4TNOA 4ZPWR 4LQ3A 4USWA 1HYSB 2E5JA 2IM1A 1D9DA 4PQAA 1PIEA 3HF5A 4PR6A 4QW9A 3U1MA 3IG1B 3L9ZA 4K0KJ 2BQUA 2H5IB 2JFDA 2XS5A 2DCLA 4I0WA 5LM7E 1DLOA 1ZAXA 1NDKA 2HFZA 3PX0A 3A12A 3MAHA 2LQ8A 5E5NA 2E7XA 4FYWB 1O6XA 3IBFB 1BE4A 3EE3A 2V8GA 2Y1JA 1UVJA 2ZOGA 3CO0P 3FEYB 1W2BR 1Y5IB 1Q8LA 2DNLA 3EWGA 3N6LA 4OMFG 3UWTA 2PA8D 2D7SA 2IMOA 1HL6A 1DARA 4RO0A 2YKPA 4JUZA 3TX8A 5F41A 5JVHQ 3TAMA 2IC3A 3ET6B 2KI2A 2LLZA 2MKSA 4DX5A 3CSKA 2E5LJ 2A2CA 3NCPA 4MKVA 3MD3A 1W2IA 1RU2A 2XYHB 3GG1A 4IKAA 4CP5A 1F5AA 2LEPA 1OO0B 1TK5A 2CVIA 2Z2YB 4IH6A 3BSCA 2ZJPQ 2ATLA 2FY1A 4U7UD 3JYTA 5ETVA 1E6YA 4C2MA 1RHUB 4OHVA 3QLHA 2FJDB 3MD1A 4R5PB 4DSIA 1F5CA 5C5JA 3HSZA 5DETA 5ETRA 5EDWA 1CEZA 2XZWA 2B6AA 2QJ3A 3HHLD 3M2UB 4RW4B 4F0HA 1RBOB 3SSSA 3K57A 2WVCA 2RQCA 3Q8VA 4A8FA 4AD6A 2UU9J 3HLUA 2R3VA 4I69A 4L3KA 1X4AA 5AE2A 1UZHA 2CPXA 4I2QA 2ACYA 5LSRA 2C2OB 4DFKA 1RP5A 1HHTP 2DNYA 1RHMB 2HZCA 2HLUA 2XSJA 3K5PA 2OO4A 1LWXA 3AOBA 3AODA 3KNGA 4IOBA 3WC2A 1B7YB 4ECSA 4ZCIA 2QRRA 1FO1A 3MPVA 1TVRA 4LBHA 2RQMA 4HL9A 3E8OA 2JDJA 1MN7A 2JX2A 4ZVFA 4DJBA 1TK8A 2Y0SD 2ZFHA 1E6VA 1RWPB 5CYQB 3CJKB 3SQGB 2IRYA 5CA5A 4USIA 1R31A 3P3DA 4X4PA 4DV1F 5HK4A 1VQ4S 3DLEB 1S9GB 2AJ4A 3E01A 4BBYA 1WC5A 2P9CA 3FCHA 2IBOA 2APOA 2I8EA 2QLWA 2CJYB 2DH8A 2RHQB 2R7OA 4C11A 1YBUA 4Q43A 2HG4A 4I4BA 3OR1B 1U0SA 4O3OA 1RT3A 2LDYA 2ZNYA 3HFVA 1HNXJ 2LXUA 2XZDB 3LOUA 1WELA 4LQ9A 1X4EA 4BDPA 1R8HA 4X4VA 1IM4A 4V19X 4J9NA 4OJ3A 4WYWA 3GQCA 1W7WA 3CVKA 1P9YA 3CDWA 5KFJA 1KP6A 2RUSA 3O6QA 1KQFB 2LP4A 3MM7B 2XMMA 3M6VA 1S1WB 3M2VA 2CPYA 3K8VA 4K2XA 1HQEA 3N5FA 2XM3A 1NK7A 3BF4A 1FVQA 1KHVA 1O8BA 3DRPA 3W8PA 3UR0A 4HI2A 4D3GA 1OIAA 3DMJB 3DDIA 2AEJA 5KFXA 1WORA 4FS2A 3PYGA 1U1LA 5HAOA 1RT4B 5E33A 2ZH6A 1X8DA 1FE0A 1MWZA 1PBAA 5DRKA 1OJ4A 3LTOA 3OTBA 4HH0A 4TU8A 3MAAB 2GV1A 4CLZA 1MU2B 4FXWA 1IM6A 1AXQA 2LVWA 3EZUA 4I64A 3PJWA 3ZZTA 4UZCA 4WJBA 4CTAA 2MZSA 4ZN1A 2QMXA 2V9KA 2VICA 5KFTA 1K73T 2KFZA 2V6AA 4XK8C 1HI1A 5H1SV 1VJQA 1S49A 2JLFA 5K9FA 3KLEB 5C2GA 5DGBA 3CJTA 3PO5A 1KD1T 3ZXWA 3TJ8A 4B9LA 4DZDA 4RUAA 3PNIA 1I51B 3NBPB 4O44A 4L3NA 2DTJA 2FY8A 1RK8A 3U02A 2HRUA 3BBFA 3K17A 1OMSA 3QFHA 4OJHA 1VQ5S 2CQDA 3OVBA 1EB0A 4W98A 1WSRA 1NK8A 2HHXA 2GGPB 4P6QA 2JH3A 3D2WA 4DCPB 3FMWA 3VGSA 4OHWA 1KFSA 2DHXA 5KFOA 3HHEA 3LAKA 1Y9OA 1H3DA 2H4YB 4BWMA 2B5JB 3DFEA 2VQFJ 3PHTA 3C19A 3KOAA 1VQSA 2HFSA 1R0BG 3PR5B 3UCUP 3A8KA 1QVGR 2H5EA 3MR5A 4OL8A 3RR8A 3NCQA 2DH7A 2J9DA 3WX8A 5HROB 2EEYA 4ZDNA 3HFZB 2QEXS 3PDNA 4G1IA 4ZPAA 5HMZA 4RNMA 4LJMA 2U1AA 2ZVIA 3FSIA 3TNVA 2MB0B 3D1QA 2BJ7A 3DLGA 1AFJA 2UUTA 3SI8A 1CULB 2OEJA 1HBOA 3QJLA 3LGHA 2YWEA 3I0SB 3TA2A 5KG0A 5KFIA 4WFNQ 3BSOA 1R6VA 2HS0A 3BBCA 4X2BA 1AB8A 1K1SA 1NSKL 1TKTA 2P2CB 3C6TB 3LANA 4GVBB 4KFBB 3WZ0A 4ZHRB 4DLGA 2ALZA 4PUOB 2VBZA 4X66F 2J76E 4R8UB 2UU9F 4ECYA 2KVQE 4EWTA 1Q4RA 4ZVRB 3D7SB 2VA3A 1R7IA 1S6QA 3PW7A 3BO2A 6AT1B 2J9DE 1O5JA 2HVIA 1YDLA 5DQHA 1P8GA 3H59A 4QWAA 2NZ4A 3N6NA 3DGPB 3CNQP 1GT8A 1UFWA 5F8GA 2VHGA 1PC4A 3U27A 2DGXA 4LSZB 1QAJA 1N5SA 4PABA 4DPWA 2R2SA 5KFPA 2YH1A 2RDIA 4N76A 5C25A 1HNIA 2YWFA 1HNVB 5ETSA 3DYAA 1WC0A 2YX4A 4DV7F 3VZHA 1HFEL 1PJ5A 1SUQA 2RRBA 3TYTA 5KT6A 4GVLA 3LW5C 3Q2SC 5HMWA 2GO9A 2KN4A 4WCEQ 1MROA 4B3TJ 2FHOB 3I4PA 4OYBA 1RKIA 2ZH1A 4CLPA 3KLIA 2GAGC 3GV7B 5DG7A 1XC9A 1NDCA 3I5BA 2W9BA 4YQWA 3SDEA 1BHNA 2GVZA 4QWDA 2CJAA 2PO4A 2WRMA 3CJ2A 2EFPA 3I5AA 4UUWA 5FLXY 3BO3A 2AD9A 3PCOB 2N3OA 2L9DA 2C22A 5CYQA 4IG3A 1N6QB 4DQPA 1IUJA 2YVSA 4KH1B 3MECA 2E5GA 4OYZA 4CT8A 4ZJQA 2AZ3A 3BPSP 2QG9B 3SSRA 4P75A 3VTIA 4LFCJ 1YBAA 4C4WA 4ZLJA 3SFUA 4ETXA 1TL5A 1KLMB 4KO0A 1RAAB 1N54B 2HHHJ 1RT3B 1GQEA 2DK2A 3HFKA 4LSLB 3LPYA 4DV3J 1V9OA 3W64A 2ZE2B 2ZNZA 1IWAA 5IXUA 5HVGA 1VIOA 1LOUA 2DBBA 1FFWB 1IBCB 3M2VB 4HHHA 3TAQA 2FVRA 1Q8IA 5EWGA 3LQVA 2M70A 1HI8A 3MMBB 1WI8A 2YKNA 1RTIA 4M5DB 1AZSA 5B08A 5K8NA 1SJ1A 2JEJA 4PQUB 1NZAA 1TMJA 1RXOB 4I68A 3OJSA 1FRLA 3TAPA 4ZVOB 4I67A 2GJFA 2HNZB 4S0MA 4G1QB 2DY1A 3DDKA 3Q83A 3IS9A 2DXFA 2FHJA 3ILJA 4WK1A 4F67A 5J2QA 3OR2A 2H65B 4CTAB 5IT4A 2XY6A 2P8IA 4DX7A 3IGVA 1T9VA 2Y1RI 2QYCA 4TYAA 4ZVSB 4OZ2A 5LOQA 3C3LA 2PFDA 4PYDA 4ZP8A 2R8IA 1BWVA 3QT8A 2C28A 4DSLA 1T02A 3DC2A 5FDLB 3JS9A 4KYZA 1TZ0A 3N9UC 1VC6A 3MR2A 3TZZA 2JC1A 1LFPA 2DGWA 2W2OP 3M1VB 2E1AA 2RQ4A 4M5JA 5HSPA 3LAMA 4X4TA 2YX1A 4DUZJ 4KHPF 2FJXA 4XDDA 2RB7A 2W24A 3QIPA 3EGWB 2MKIA 1U47A 3DN9A 3MOJB 4NPOA 5I42B 3NS6A 3TR5A 1A0OB 3UCGA 3HDSA 1RAIB 4ZIVA 7FDRA 2JWNA 4DV5J 1KN6A 3GB0A 2W7AA 5CZXA 1WSVA 2KHCA 1WHWA 5FD1A 1U1PA 4QOTA 1S0VA 2JHEA 4H4MB 3CMAS 2IDLA 3ILOA 4WP8A 1QAIA 2FJBB 2UZAA 3L7OA 2DNMA 1U1KA 1KR4A 1S57A 2CXEA 1PAUB 1VCTA 2QV6A 3T1YF 3V6DB 1YRTA 1Q1KA 3C6UB 1FT8A 4WU2A 5HROA 1VBXA 4UY8T 3MWBA 2F40A 4GKJF 2DRBA 5T7LB 5DLGA 1HR0F 2R8JA 1NMEB 3NGKA 5HJXA 3Q89A 4M5NA 4PG7A 1HPZB 3TQEA 3IGNA 4LF8J 2HGLA 3PRVA 3NAHA 4F3OA 3B78A 2X3GA 3G8SA 4B9MA 2YBVA 3S8SA 3CCMS 5IM0A 4P9SA 4FBTA 3VQTA 2DGTA 4HACA 4M5IA 2WW4A 2CZ9A 4OHZA 2KFYA 4DV4F 4IFYB 3AJ1A 1UA0A 2PI4A 4AL7A 1S1VA 2M0GB 4LUBA 2BJ9A 3R8YA 2GC8A 2NSBA 2OGUA 3ZZZA 1JXVA 2XMWA 3Q8YA 4NMXA 3KTQA 2GQQA 4MKBA 3DXBA 4QR1A 2HNDB 4YHHJ 3MUTP 4F02A 5K5MA 3GP9A 2AU0A 4JI4F 1B7FA 4Y2AA 5KT5A 3DOKB 2F7VA 1Q82T 3R5GA 3ENAA 2AX1A 1G3OA 2GIQA 1X4GA 3GJTB 2NXCA 3PJXA 3R5CA 3O3LA 1VC5A 2MHEA 5KG3A 3DGPA 2K2PA 2DD8S 3D6MB 5I3UA 1BQNA 2XSFA 1YTYA 2W2MP 3B8HA 4ES1A 1GH8A 3MFHA 4KRWA 4R0JA 4ZPBA 1WF1A 2H54B 4DU7A 3PW0A 4NLRA 4LF9J 3NMAA 1NKCA 3ETMA 5F0WA 1RLCL 3FNNA 4Z2XA 2DYAA 1RLDA 3IWLA 1NZ8A 2AYBA 1WKLA 4L72B 2GMHA 5LMNJ 1ZTTA 2LXIA 3DLGB 3M32A 4QPTA 5DG8A 1LW0B 1FFSB 4ED0A 2LQ5A 1J5OA 1ZTWA 2V4RA 1V6HA 5KG1A 3PYEA 2B43A 3ET6A 1S7IA 3HHNB 3R2CJ 3BEGB 2QFIA 1V5VA 3D68A 3FSXA 3FUYA 4OI2A 5ETNA 3DLBA 3C8YA 1S48A 2ZVSA 3VF0B 3K5NA 5BR8F 1T7PA 1Q0NA 3R7BB 2NPFA 3GFHA 2FIUA 2QLBB 2ZHOA 1S0OA 2J6TA 3W66A 2Q43A 4LBIA 1YJ9S 4RBTA 4OJ1A 1CJVA 1Y5NB 2CWKA 1RT2B 2DHAA 3CDEA 3CTRA 2CIMA 3FVYA 4LR9A 4QIGA 3C14A 3C16B 1DJ0A 2B6AB 1S0NA 2XGPA 2QTWA 3I5CA 4ZP6A 2W4CA 5J1EA 1M5PC 3IBWA 5GADU 3SBMA 3IC1A 1T3OA 1VHFA 3QIDA 4LIWA 2DY9A 4Q7AA 3CCUS 4DQIA 2QLFB 1R27B 3JTOA 4Y2IA 5C25B 1M5HA 1S1TA 3HKZD 2ZC4A 4DR6F 1S12A 4GRSA 1G4CA 3UN3A 4A8XA 2D69A 1D09B 2N4DA 1F3FA 1QUVA 1VJWA 2GO8A 1T9YA 2OAUA 2OEMA 3CE8A 2CQ4A 1Q53A 4C0HA 5JMNA 4X65F 1DURA 1YWXA 2EKYA 2CQCA 2YNHB 4CIOA 3T5LA 1GMWA 3CIMA 4P52A 4X4UA 5IT0A 1F6TA 2M4MA 3UW1A 4A4JA 2OP5A 1R6YA 3PFEA 3OL8A 3T9NA 4C0OC 5JVGQ 4M63A 2ZITA 1AW0A 3CCSS 3ZNJ1 3ZZPA 1D0EA 1D8ZA 3G8QA 3RB0A 2KDOA 2D3O1 2DJWA 3DLLQ 1MMDA 4LF9F 3KNAA 1F2GA 1T9XA 2C3PA 2FHJD 3DXSX 3K7RA 3M1VA 1W26A 2LYVA 4C11B 2MLYA 2FHKA 1UFLA 1UPMB 1ZOTA 3BGUA 4A47A 4DXLA 1S0MA 2YNIB 5ETOA 3KYLA 1QSLA 2BJDA 3MM6B 3RYLA 4OYOA 1CJUB 1LXNA 3CGIA 3T9ZA 4CLLA 4YMEA 1NB7A 4ILMA 4MIWA 3TVZA 5E0OA 4PXEA 1U02A 1HQEB 5A0YB 2L41A 3JSMB 4PYAA 1WTBA 1TK0A 1H7WA 1LV5A 2R42A 2DIUA 2M3DA 4BWJA 2VDHA 1WF0A 3I0RB 4XPCA 2YNFB 3FBCA 4AE5A 3GFXA 1VK8A 5K8MA 1HI0P 1JLEB 2HVDA 3AHPA 1IJEB 3HVTB 3THTA 5H9FK 2A1BA 4DR6J 5HLFB 2PI5A 1PAEX 3FRZA 5BJRA 3POTA 1RCXB 4QIEA 4IUFA 1X5PA 1YZ7A 5B7WA 1C0UA 1VIXA 2AP6A 4G6VB 1X7VA 2MSSA 4IDKA 4NZ7A 4WWSA 3P96A 3LP0B 1LWCB 9ATCB 4DS4A 1HR0J 4JI8J 1WWHA 4DR5J 4AXIA 4OZ5A 1ZBTA 1N5TA 3EJMA 3UDVA 2R2RA 3LP1A 4BHQA 3NBPA 1H74A 2VPXB 1JJCB 4Q45A 4QWCA 4A8WA 1U7LA 3MCOA 3BR9A 5A8KB 5EUHA 5RUBA 3LWLA 3SV4A 5KG7A 3G82A 2BX6A 5BR8J 2MXYA 5I42A 4DEZA 1NK4A 3MR6A 2V2QA 2FHMA 4DV5F 2R7SA 4V1Ak 5KFNA 4F4ZA 4DV2J 1VQNS 1ROFA 2CA9A 5J2MB 1S9FA 4NCBA 1Y3KA 2DGSA 4QR2A 5ETLA 1WACA 4KHPJ 1L3UA 4MIAA 4URSA 1UJ5A 3K2YA 4MFBA 4N47A 4DR2J 2P9GA 4K4VA 3GCWP 2IMWP 1SIWB 2HAFA 1U1OA 4QWEA 3C15A 2E9TA 2QC3A 3UVJB 2OPSB 4ZPDA 2HS3A 2R7QA 3L95X 4AYBD 3JSBA 3G6VA 3D1OA 1AROP 3HJFA 1JB0C 3RJMB 1YVFA 3W5XA 5F8NA 4JYAF 1N5YA 1FEHA 2W2QP 3FZ2A 4QIVA 4ITSA 3M8ZA 1JLAB 1NH7A 1NCLA 1X0FA 2ZZMA 2AV5A 2DNRA 4F2SA 1AFIA 3ZTRA 5GMEA 2VH7A 3KLFB 4ZA1A 4JI4J 3N5BA 2B3TB 1RWKB 3ZFVA 4B9VA 2EFGA 3EDQB 4BC7A 1ZYQA 1N33F 4ECXA 2LDIA 4L75A 1IR0A 3QSIA 3QRQA 4XAKA 1ZH5A 5LSOA 2MZJA 2GJ2A 1LWEB 5F8LA 4N7TA 3H5SA 4DCOB 2XBPA 2OIHA 2G0CA 4DV4J 2C3MA 4Q8FA 1FF2A 3DRRA 1UZDA 3BYRA 4HR2A 5EWFA 3NGSA 5EX3A 4PCQA 1S1XB 4JB8B 2ASYA 3G71S 2MZ1A 2BJ3A 2VV5A 2ZC3A 4ZPCA 3MPWA 4LSNB 3IN5A 2IAJA 3BBBA 1FJEB 2BKPA 3QAEA 2DHGA 3OJUA 2YNGB 1N4LA 2CJKA 1WKJA 3QZ8A 4ED1A 1U48A 4KKOB 4KTQA 1HLWA 2P5VA 3B6BA 2D9PA 3F0NA 3RRKA 8RUCA 2IA6A 4DSJA 3OXFA 4ELUA 5HQLA 4HYKA 2R7WA 2HQ3A 3HM9A 3LP2B 4UQTA 3KK1B 4CLKA 1A6LA 2DB1A 1L5UA 2AJ1A 4DV7J 3RBEA 2XMUA 3DLEA 3GSIA 3AB2B 1OSDA 3BN4A 1HKAA 3MPDA 4MJKA 1YK9A 2UXDF 2M2BA 4TY9A 1DTTB 1DY3A 1HBNA 2BA9A 2W4PA 4LF7F 3OR1A 2Z2LA 5AE3A 2OPPB 5A76A 4CNYA 2ZH4A 4A8KA 3EXYA 3JXOA 1CJKA 1RHRB 3EVMA 1X4HA 4KHRA 1LK7A 2Y1IA 1N56A 5ETKA 3T3FA 1TL3B 2ZWOA 1JJ4A 3EUNA 1XNQF 4B3OA 1CPZA 4ID5A 1RAFB 2DO0A 3MMBA 3R6GB 4MK9A 3ULHA 2EFVA 2SXLA 3M30A 3TANA 2DEIA 3EM1A 3L7PA 3GJQB 1S59A 3UR3C 5KFKA 5FJ4A 3FEXB 1KTVA 2E44A 3KG0A 3TOQA 3R7SB 4N56A 1WHVA 1U25A 1RWOB 2KYXA 3FQLA 4CH0S 4I1TA 1ZM9A 4B3RJ 3IAS9 5DLFA 3NL0A 4Q0BA 2AJQA 5I4MA 2FC9A 4WU3A 1FRHA 1UVNA 3IBCB 3KLGA 2K3KA 1A7GE 2ZHAA 1WC1A 1NH8A 1FCAA 1REGX 4DV3F 4X4SA 4Z7YA 1VC0A 1RISA 2XHWA 2M5YA 2VKRA 4CO5A 3OW2R 2W1BA 1RGVA 1FDNA 2VPWB 3VAGA 3CCLS 4PG5A 2DHHA 4WE1B 4IR9A 2FVPA 2VQFF 4IYQA 4FBUA 4QIFA 4OJGA 1JLGA 1NSPA 2GGPA 1VRTB 4AFFA 1KEKA 1RSCA 1LQ9A 5HL7Q 4UZBA 3BJYA 4ZKAA 1FKPA 4DQQA 4DS5A 3R2DJ 5GAHU 2AYGA 2J0XA 1QM9A 3NWGA 4C97A 2R7UA 4CO1A 3W7BA 5J2MA 2MQ8A 2LEBA 3SV3A 3MGJA 1OQ6A 2J0WA 2EW9A 2FPHX 1WOOA 2HQCA 3KFWX 5LJ5Y 3H5YA 4DL6A 2BOPA 1NEEA 1A9NB 2FJAB 3H2VE 2X51A 4CDIA 2AJ2A 5J2PB 1VQPS 1DLOB 5MAOA 2WTFA 4DL3A 5EN1A 1TAQA 1BGXT 2VC1A 5L8RC 5KAKA 1B0VA 3DM2B 3W9JA 4KJIA 3KLHA 2IRXA 3R5BA 3TUIC 4J91A 4YUDA 5IZHA 1KOHA 4K8RA 1YJNS 3UDCA 2JL9A 4NA2A 2K1RA 3RR7A 4DBQA 4JI5J 4KPYA 4FYVB 5L38A 5A8WA 3D3CJ 3GFZA 2QMUB 1TV6A 1FX4A 1S1VB 4DQRA 2FYXA 1ZPVA 1G7CB 4J90A 4JI6J 3M05A 1TU0B 3ICLA 4WTOB 5KFWA 4CCHA 4O0IA 2PE8A 4NYPA 4BLGA 2RUGA 3I55S 2ZM6J 1UFKA 2H48B 4X66J 2ZH7A 4AL6A 4FPRA 1S6QB 4K59A 5KG6A 3UN5A 5AJ3F 4J9SA 4BS2A 3P4UB 2PEBA 4LF6F 5C42B 1SJ4P 5J1PA 2GMJA 2K06A 2MPUA 4F0MA 1DQAA 2R9LA 4W92B 1YJWS 4K4XA 3HHKA 4DX8H 5A8RB 3G8TA 2BYCA 1HW9A 5F8HA 4KE5A 3J81Y 4WK3A 3IM8A 4C3MA 1XQIA 5EHHA 4DL5A 1QTMA 2WONA 3IR5B 2CKWA 5IQ6A 1NHUA 2MYFA 3AA9A 4UOCA 5CZVA 3EGZA 4DV1J 2AGOA 2OTJS 1WOPA 1ZM3A 2DNNA 2YNGA 2VFRA 1Q7LB 2CAJA 3PYDA 1GMWD 3ZZOA 2ZH8A 2MZRA 3KLIB 4IQXA 3M6XA 2PA3A 3MMCA 2M8DB 2J9EA 2A6OA 1H7XA 3ZNUA 2YX7A 1RT1B 2GVZB 4P2SA 1B99A 4P7TA 4E98A 4K4WA 2O66A 3LGNA 3HVAA 3KJQB 1P1TA 1EARA 1RCOB 2B51A 2XC9A 1S9GA 1QAXA 3D6TB 3M8QA 3W2WB 2VL1A 3ZZRA 3F44A 2QSWA 4LF6J 2XHCA 3MECB 2CPFA 3W9HA 4OZ0A 4AT1B 4ANCA 3TZXA 1S6PB 3UDEA 2MHNA 1VBYA 2GNKA 2KT3A 5I3PA 2WVEA 2ZHBA 5DJBA 1E6YB 2XCAA 2VJUA 1OY8A 2MKJA 2C2DA 1FTCA 2XTJP 2ROEA 3CMES 2VD3A 1G2EA 4P73A 2VODA 4UOGA 3M8WA 1XMBA 5B0GA 1VLOA 2FJWA 2RHSB 4B3OB 3MCMA 4YN3B 4JI5F 5K20B 1NPPA 2RILA 2HLTA 3OFFA 4J9OA 3D0IE 5ETTA 3RRGA 4DG1B 4LF1A 1NPRA 4P10A 2KXNB 5EWEA 3M8SA 2E5LF 2CJXB 1ZS6A 5C7PA 4JV2A 4MAKA 3QNWB 2CJQA 2RVJA 1JJHA 1VISA 2HGNA 3B4DA 3DU5A 3FZBA 5JUMA 5DDOC 3KJNB 1K8AT 4F7VA 3RBDA 2B9WA 3SCIE 2YY3A 7AT1B 2D74B 1XERA 1VQ7S 2FLPA 4ERDA 4KBIA 4Q0BB 3RZAA 4E2FB 2DNZA 3PM9A 2VPZB 3SEOA 3GTYX 4NZ6A 3IWNC 1S76D 2WAQD 1Y10A 4F4XA 1SC3B 3J7AN 2W2PP 3GPAA 1T9WA 2J8SA 3FFIA 4DSFA 1R89A 1YIJS 4KGMA 4B9NA 1FE4A 4KHMA 2Q6BA 3CMQA 3G6YA 4IH7A 4Y2KA 1HNXF 2CPDA 1SIZA 3HD2A 1PILA 2L9NA 3KWMA 1RBLA 4EO8A 1SKWA 4ZVEA 2W25A 2P6TA 3T5JA 1K9MT 2CADA 3ETOA 1CBKA 1YSJA 1S9EB 1U8WA 3H2LA 3BGRA 4F4WA 1NJWA 2K3IA 1ZZFA 4B3MF 3F73A 2IJFA 5A0YA 4NRUA 5AE1A 4P2FA 4NA3A 4ANEA 2EC2A 4K7QA 2ZZNA 3GV8B 4B9UA 1KWMA 4ID5B 4RW7B 2IM2A 4M5MA 3OHAA 4LF5F 3HHDA 3OV7A 1Q5YA 1D9FA 3Q8SB 2BACA 1L3VA 3CCQS 1M1GA 2XMVA 1PG5B 4IFVB 5B0AA 3G2XA 3HVTA 2KRBA 4OQJA 3H2UB 4MIBA 4FDFA 2IIHA 3MR7A 1CQMA 3QMQA 2RT3A 3R7NB 3ZC4A 3K59A 3POTB 4HVZA 3TW0A 4O4RA 2K7KA 1K47A 3VHQA 5KFRA 2FC8A 3KLHB 2VA2A 2FVSA 2HVZA 2V8DA 4NI2A 4ZCMA 3J81j 3RAXA 3I56S 4KFBA 3KLGB 2B4PA 2NUUG 1GAOA 4YDXA 2AWZA 5AXKA 4X84A 5BYRA 4CRJA 1KHWA 5H9FJ 3P49B 2WSFC 2DEJA 4R8UA 2FDNA 4O3NA 2QMWA 4LF7J 5IQQA 3T6BA 5HO4A 1LKZA 4JI2J 4UF4A 4LF4J 1YQHA 2FB0A 3MUMP 1S72S 2UXDJ 1TL7A 1RE1B 2Y8YA 2DXDA 3PKMA 2HHWA 3BSAA 2XMTA 3BGLA 4BCAA 2MZQA 2CNOB 3GR0A 4HHJA 2FTRA 2CQ0A 4NA1A 2DNKA 2ACMA 3G96A 1KQSR 3P5BP 1J27A 1X5SA 2CQ1A 2HWHA 4NLSA 1RDRA 2G0JA 4CQ1A 1FDBA 2M88A 3OFEA 1BQNB 1F9EB 3Q86A 1RWXB 2X1AA 3CC7S 3DNCA 2LQJA 5D0GA 1KONA 2IFXA 2POKA 1X9WA 4UOFA 2RDDA 1JMTA 3H5UA 2KG1A 2C2RA 1EX8A 2QZ8A 2HHPA 3UD5A 1ZM4A 4NL5A 4DWIA 1CC7A 3X3UA 4O3RA 4K0KF 3ITHB 4C6AA 3ISNC 4DR4J 1CULA 2GQ2A 2EKNA 3KDNA 3QZ7A 3HHLC 3HD1A 3MOZA 4HLBA 1V3SA 1JLAA 2BE2A 1NDPA 2BW7A 2EWHA 2WOMA 3C6TA 2RRAA 1GX5A 1XMOF 2FLNA 5E3CA 4UOHA 2V68A 3M8QB 2HFNA 1LXJA 4LIRA 4FXDA 4PPDA 4IOCQ 2VG7A 1S6PA 2RKIA 3M4XA 1T05B 1IR2A 3MTJA 2FGOA 2R8KA 3H0PA 3HHLA 1N5VA 4ZP9A 4FP9A 1Q5VA 3EICA 4KGXB 3QJPA 4KV8B 3DRRB 1U6ZA 3QSYB 4G1PA 4OLPA 3CCES 5J1EB 1XTZA 3GIKA 4EBDA 1FJ7A 1T0TV 4MKAA 2XNQA 3RG6A 4Z37A 5DS7A 1SL0A 1Y3JA 2JFKA 4DR3J 2ZBRA 1RA7A 3UNYA 4JI3J 3TRGA 5HP1B 2NLWA 2CQHA 4ZOSA 1TKXA 3PACA 5F8IA 1HW8A 1MROB 1PC5A 4M5KA 4KPCA 2FVQA 1B4SA 1FEEA 3DU6A 1NB2A 1VQ8S 4U8YA 3D54A 4YB5A 3OFHA 3SDEB 3LPEA 1RT6A 4CLSA 3CW2C 4DV2F 2V4JB 3EVWA 1ZETA 2AEFA 3KK1A 1N48A 4Q2LA 4IG3B 3N01A 1RUSA 1WD6A 4RW8B 3RU0A 5L9XA 3WQPA 2HSEB 3T5HA 4YY3F 4DN0A 1SJFA 2WK4A 3NGTA 1O51A 2O67A 3NNHA 4N77A 3RW7A 4C8LA 3BH6B 5B0FA 5L39A 3MMJA 4RUHA 1QVFR 1WNEA 3I4HX 3I96A 4RJVA 2ABYA 2IVFB 4B3TF 4X64F 1GEHA 3DLKA 4YB1P 1T03B 1KSPA 1KKHA 3K8WA 4WKYA 3KG4A 4ETZA 5CCLA 1ZAWA 4J9RA 3NS7B 4ER8A 3C66A 1NHVA 4M5GA 5J1NA 2V2KA 1M1KT 3UI3A 4D3HA 2YH0A 2EBEA 2I38A 2MKKA 3BDEA 3MMAA 3KDOA 1VS3A 5G4DA 3Q8QB 4DF4A 3I9ZA 2NREA 3A4TA 2RSQA 3I0RA 5IFMA 2A0FB 3FRYA 1FXDA 1JLQB 2UV8G 4DPOA 1HD1A 1PO6A 3VVTA 1TUWA 2FZGB 2AT1B 4H54A 1JLEA 1MN9A 1N36F 3IAM9 4WXWA 3WX4A 2D3ZA 4FF2A 1HIYA 2JLEA 1CS4A 3VR1A 1PGZA 4DUYF 2UVUA 2RS8A 1C0UB 1ZAVA 2DT9A 4JI1J 4DUTA 1RWNB 1TL4A 9RUBA 1IR1A 4TQSA 1DRZA 5CYMB 2V0NA 4EYIB 5FDLA 5L1KA 3QWUA 1K1QA 3GIIA 4WE1A 2HVEA 5DDPC 2FJEB 3QIPB 5T14A 3ZTPA 2VG5A 2E5IA 4JI7J 2HK2A 3TVKA 2DR9A 5F9NA 2KG0A 1GXUA 3V4MA 4L76A 2Y1LB 1R0CB 1S9EA 1HBUA 2FZKB 2C3OA 3FJ2A 3AA8A 3NCRA 3OXGA 2J0QD 4WF9Q 1TL1B 3B54A 4E0DA 2I0XA 4Y2MA 1N52B 2LQ9A 2OFHX 2E7WA 3NOGA 2QGFB 3OTDA 2GZOA 5E3QA 4NWBA 4EGLA 5A2QY 4YR2A 4URGA 2BANA 5GAHI 4DN9A 1Z2LA 1FK9B 2UV8A 5E41A 1M5VC 4IRKA 3V4IB 1X5TA 1IKVB 2QX0A 1WDTA 2XEXA 3ENQA 3FBFA 1FRIA 2MSTA 5AXMA 2DNQA 4PWDA 3MTKA 5KFEA 1FTRA 3L09A 4MFBB 1KLNA 3S01A 1JWWA 3SXLA 2Q1LA 2H1YA 2XCPA 1U4BA 3R27A 4MH8A 3LWMA 4WFAQ 2XO7A 2C2KB 3CUNA 3GSDA 1WJ9A 4TLQA 2IJRA 4NLQA 1UTAA 2CUYA 2N82B 4NLDA 3MEEA 3RB4A 2OLWA 2HW3A 4Q44A 1BMQB 5LXRA 1BUXA 1QD1A 1S99A 3FBEA 3K58A 3ZZ0A 3PIPQ 2OH2A 4PG6A 3EYZA 2OD6A 4A8MP 2F4VJ 1F9FA 1N88A 5K8PA 3A1YG 1S97A 2CPIA 3LUYA 3PEJA 4ZCLA 5CXTA 1ZPWX 5KFCA 5J2NB 4NCGA 4RU9A 1R3NA 4U8VA 3VZIA 4CO4A 4MT1A 5CD4H 4KSEB 2UXCF 2KT2A 2ASDA 2KB2A 3DDNA 4U9RA 4DX6A 5F3TA 5C42A 4EO6A 2XY7A 3DOKA 3K5OA 4DSKA 1G6BA 3FCWA 4OYMA 2GW8A 2UVRA 3PHEA 1FERA 1R8CA 2VFSA 3DRSA 5B0EA 1N32F 2GHWA 3AD8C 2B9EA 2ZD1B 5LMNF 1S1TB 4KH0B 3CPWR 1U6BA 1XN9A 5HP1A 2G1DA 1LWFA 5A2QU 3ZTOA 4RNNA 2EVZA 2XMJA 2G2YA 3HZEA 1WC6A 2QO3A 5IOLA 3TUZC 4XIUA 3T19A 1FXRA 3BGOP 4J9LA 1RHQB 4EYHB 1S4EA 2LU2A 3EVOA 2WB4A 3GJRB 4UY85 1LW0A 4FF4A 2F1FA 1EKRA 4DDFA 2QL7B 4ES3A 1UA1A 2ADBA 3RB3A 2JVRA 1QDUB 2X1FA 2W8LA 1BQMA 1OY9A 3W1YC 3SQGA 1RWWB 4EUVA 2RF2A 1BWEA 4H4OA 3BPDA 2OKQA 4OI4A 1XJWB 1C4CA 1Y7PA 1UEUA 2ZWPA 2QFJA 3UDLA 1F3VA 4YHHF 1NJYA 2FUG9 2COLA 2NYHA 3NLCA 3PJ9A 3GIJA 4DV0J 2BRLA 3PZPA 3JYTB 2VOOA 1JNZB 3F41A 4RZRA 4U7UK 4UW2A 3MXHP 3CIZA 1ZM2A 2VASA 1UPPA 4M1KA 4OYIA 2WW8A 2O1PA 2VUGA 3C14B 3BKFA 3C16A 5E3RA 1NK5A 1UEKA 1QSYA 4DR7J 4K5RA 4HT5A 4F0KA 1X0PA 1C1CA 1OWXA 4PPZA 2L9WA 8AT1B 5AXLA 2HURA 2CJBA 3OT9A 3PX4A 2KZMA 2VC0A 4R0EA 1OPIA 3SIPB 3N4WA 3PIOQ 2MMYA 4DV6F 4U67Q 2FZCB 2DITA 3KMSA 3PW2A 1P6TA 1TTHB 1UAWA 2HFVA 3MR3A 2B8QA 4LRDA 4B02A 4DCJB 5M2UA 1S77D 3CCVS 4QYZJ 1JXEA 2HS4A 2W7OA 2UUAJ 4YFUA 3FQKA 3P5TL 2CQBA 3KJVB 1LW2B 2VKZG 3LP0A 2W8KA 2W4DA 2B0GA 4TYBA 3EX7B 1FKOA 1TUVA 2HNYB 3E51A 2CYYA 4FNHA 4USJC 3J80U 2DNHA 2BMBA 3LF0A 1T8EA 1SKRA 4ICLB 3GIRA 3Q8RB 3R5AA 4JOUA 5A8KA 2UXBF 2GHVC 4WIQA 4ZK7M 1IKYB 2ZH5A 1FRJA 2CQGA 4ED8A 4YB7A 2VFVA 2V8PA 1HWUA 2ZBQA 4DUZF 4G65A 1VRQC 4OI6A 1JJ2R 1U49A 2GS8A 4YR3A 1FKAF 1HNZF 1PJ6A 4N8NA 2HHQA 1LFWA 2HAIA 1VRTA 1HBUB 2W01A 1VQMS 1HNWF 1VR6A 1X4CA 3TX0A 3V5RA 5CQGA 3TUPA 6FD1A 3CJ0A 1DZ5A 2BBEA 2Z0GA 1VQKS 3JSRA 2AJ0A 4DR1J 4ECUA 1QLNA 1AUSL 1YBTA 2CQPA 3KLVA 4Q5VA 3JQKA 1FI4A 2OHDA 2ZKUA 2IHR1 3H4BA 1RTHB 3IR7B 1VQOS 2E29A 4U96A 2DGOA 2BVZA 2QA2A 2BQ3A 1MU2A 2B9YA 4JV5F 5SZTA 3T1HF 4I6YA 3CXCR 4O3PA 2IYIA 1IBLF 2LMIA 1UKUA 4IQMA 3BQ2A 2NCKL 4ILRA 5A6PA 4WYLA 5EGYA 3KLEA 1TKTB 4GVBA 1KQKA 5M2PA 4C8KA 4C8OA 1T95A 3LP1B 1PYSB 2EC0A 3DRSB 1HMVB 1J2VA 1VMBA 3UO0A 1UWBA 4GO5X 5E7OB 4O3SA 1XNRJ 2HHHF 2LECA 3M8PA 2R2UA 1IWGA 2Z8QA 3CCWA 4TY8A 1YITS 4ZMMA 2HEKA 4CLTA 2LFVA 1IBKJ 4LFCF 4M94A 5KT2A 4LMZA 5T41A 1R8BA 3M9OB 1D1UA 1UCNA 4RW4A 4KGZB 3C2PA 2AJFE 1RKJA 3FEZA 2U2FA 1SC6A 1Q16B 5HMXA 2GFFA 2ZJRQ 3U7JA 3G9CA 4HTJA 3J7YI 1N34F 1DQ8A 1I3OB 5D8HB 5A8RA 1ICEB 2IRUA 4ZITA 1IQZA 1IKVA 3QO9A 4AQYJ 3QGPA 4A46A 3N28A 1NXIA 2XSJB 2NXUA 3K89A 4NASA 1SH3A 3AJ2A 5ETMA 3BQ1A 4ECVA 2BEFA 1S6UA 1KVJA 1JIHA 3MHYA 4R25A 4FPIA 3M6WA 4EI2A 1NKBA 4O4GA 4USKA 2VOPA 1VRUB 4F25A 1FDAA 5DZ7A 1E6VB 1JLBA 1AUDA 2HHTA 3MEEB 3TO8A 3MURP 2W7PA 2C3UA 4U6PA 1RTJA 2C2MB 4PXDA 2AGQA 2XNRA 3UNGC 4WPAA 2GA7A 3AB4B 4AQYF 1X9SA 1FVSA 2RNEA 2VONA 4EU0A 1SBRA 1HWJA 4QYZK 1REVB 4QQBA 2R7TA 2DGUA 5GMKa 3OFGA 2RD5C 4WFBQ 2MY8A 3QLHB 2VBXA 2DIVA 4WP3A 3SCKE 4KV8A 4HDGA 1VQYA 3Q8PB 2BUNA 3TJAA 3EPIA 1HWLA 2VPYB 2OUGA 1X31C 4J9VA 5HBMA 1FWLA 5DO2A 1DBDA 2BDPA 3MM5A 4CO3A 1RZMA 3DRPB 4QW8A 4LFAJ 2XWYA 4X62J 3ZTQA 1C2PA 4DSEA 4G3IA 3QJJA 2HQGA 1YJVA 4MK7A 3L3CA 1XIQA 2HHUA 1O0PA 1GFWB 2D1CA 2Y3YA 3QRPA 4DOZA 2MY7A 4LSNA 3DYAB 1T9UA 3GWCA 5KTQA 3HP6A 3A8IA 5IT9U 4P2MA 4O23A 3HPOA 2G13A 2D3OR 2O01C 2A18A 1TVRB 1XR7A 2AIRB 1SC1B 4JV5J 2J7KA 1SI9A 1SJQA 4EK2A 1RAEB 3CCZA 3OTEA 3D67A 5LSLA 1NK9A 4ZJOA 2RE1A 3CJKA 1VQLS 4RW8A 2OPQB 4MK8A 4CH1A 4WZMA 1RWUA 2KRRA 4ICLA 2RF2B 3FFIB 1D9AA 1XBWA 2KXHA 3A8EA 2YKMB 1RQ0A 3CJ4A 5JXSA 4ZLNA 4Y2CA 1IKYA 2L48A 4CM0A 2HGMA 2Q6CA 1Z1ZA 5L46A 5KFMA 3H7HB 4DR1F 2G4BA 1EQ0A 1RWVB 1M90T 1KS2A 2GHPA 1NUEA 3D0HE 5GAGU 2XLIA 3M9MB 1OSCA 4NLUA 2HBYB 3TP2A 5DZ6A 2V9WA 3HMJG 3MAQA 1S1UA 2C3YA 4LBPA 2OMOA 2M8HA 2MDAA 2EFNA 3B82A 4GO7X 3GU0A 3V2UC 1U1NA 1R8AA 2AHOB 2UVVA 3BREA 1M5OC 1MSWD 2BV3A 1YJRA 2DCUB 3M30B 3NXZA 5ITHA 2DNOA 1R0AA 4USHA 1SQFA 3KJFB 3IMQJ 2RH3A 1KOOA 3BN7A 2HRYA 2V8VA 1XMQJ 3W9IA 4JI1F 4GC7A 5KOWA 2MQNA 4CM2A 2QLJB 2ZM6F 2FQQB 2Z58B 2KJWA 5E3AA 4V19J 5J2QB 2BXJA 1B3TA 1H72C 2IDEA 3I0SA 3OLBA 4CH7A 5THWA 1VBZA 2CDQA 3DLHA 1FD8A 4HHUA 2BE9B 3MM9A 4I2PB 4I7FA 2UUAF 1G1XA 1CC8A 4ZVUB 4NLTA 5BYQA 1C0TB 4ZHRA 5HJYA 2Z2MA 4DPXA 1IBMF 4ATNA 4HACB 1F2HA 1V3RA 4YR0A 2MZTA
chains in the Genus database with same CATH topology
5DG9A 4MTPA 3I31A 3NRBA 4PRFA 3NNCA 2J0SD 3Q22A 2MJNA 1UETA 2M52A 4TY8B 3OSPA 3T6JA 1FDDA 4DR7F 2DO4A 2F8MA 2UUCF 1WI6A 3PY8A 5GAEU 1UMJA 2B4OA 4DV0F 4J37A 1VFJA 3CB4A 3EXCX 4FVMA 1UVIA 3NGDA 4C7QA 4OLOA 3GILA 2R8GA 3QWPA 4MYTA 2ROGA 3QO9B 4FN5A 2DNPA 2O3DA 3BDPA 5J2PA 1CLFA 2GQCA 4TN2A 2UVWA 4QWBA 2RDJA 1FXLA 3DRXA 3DM2A 4QBUA 5KFYA 1VRUA 2LA4A 1U09A 4IOAQ 1W25A 3D5MA 2W9AA 1J5OB 4QU6A 2K1RB 4CNZA 3BR8A 5E2QA 1RTJB 4AUKA 3P6YC 4QCLA 1MNEA 1TV6B 2ILYA 2B7BB 2AYMA 1REVA 2J7UA 3DOLB 2CZVC 3MM8B 4K4SA 3VAKA 1SJRA 3I32A 1BY9A 1ELOA 2CFXA 5LMUF 3U1NA 3KK3B 3EZ5A 1RT7A 2EBGA 3SYZA 2J6UA 1SH2A 1UL3A 2WHOA 3HXMA 2ADCA 1HWKA 4OFZA 4OX6A 1HNIB 3CD0A 4RX6A 1HNVA 3S1TA 4B9MA 1C1BA 1Q8BA 3HZGA 2X1BA 4G1QA 4RNFA 2AF6A 2C42A 2H9ZA 2M9KA 5K14A 2KU7A 5SUHA 5A6WA 1GTEA 1JK9B 2B4VA 3TA1A 2P6SA 5F8MA 1TKDA 3CT9A 2HMIA 3J7Z5 4PWUA 1BQXA 1SH0A 2R4FA 1BQMB 1CSJA 3N0VA 1QJHA 5K8OA 3OL6A 3VAMA 3VCDA 1KFDA 4C3LA 4XDCA 5B0BA 4NLYA 1CG2A 1EETB 1D8YA 2YKMA 3VQSA 3V6KA 2DGVA 1KLMA 4KO0B 3OL7A 5KFZA 5KFLA 1QAYA 1UEVA 3GFYA 4EBCA 4B08A 4FXVA 4LSLA 5DDQC 4OX7A 1J5EF 4NLWA 3CJ5A 4ZVHA 5KG5A 4JI7F 1HA1A 1H6KX 4RW7A 1TKZA 5KFAA 3SSQA 5DGAA 5KT7A 5IS2A 1R0AB 4N8OA 4OZNA 3OBIA 4OHXA 2YNFA 4IFVA 4DG1A 2RRNA 4OZJA 3IRWP 1XEZA 1L3TA 1WHXA 2HHSA 1WEYA 1MW7A 2KXFA 5T7LA 2MKHA 1SL1A 1XK8A 4JI1F 2JC0A 1P9QC 4JBCA 3R1LA 1I6JA 4MKYA 1HHSA 1HPZA 4RWXA 1LW2A 2KM8C 3LH2S 4FF3A 3UPFA 3O2IA 3W2VA 5L1JA 1LWCA 3PW4A 2X1GA 3K5MA 1OPZA 3N79A 3MF5A 4K4YA 1U24A 2NUHA 1IN0A 4LVOP 4WFZA 1QE1B 2I5JB 2W9CA 1CQNA 2MGZB 5GAEI 4RU2A 3MEGB 2CQ2A 3KK2A 1SV5B 3OUYA 1KVIA 5D6GA 3RRHA 3QYYA 4RKUC 3GR1A 2Z4PA 2NQPA 2NYIA 3IFEA 4KR0B 1FD2A 1DTQA 4I56A 4Q2MA 5G0RA 3PXGa 3MDFA 1TFYA 4HEA9 2JEGA 1MMLA 3ENWA 2BJEA 2BABA 3LGMA 1FK9A 2OD4A 3V4IA 3QPIA 2JRSA 2FLOA 2ZH2A 2VB6A 1R43A 2E1RA 4WFYA 3CCTA 2ROPA 3DHXA 3OTCA 3WDOA 4RNOA 4B9SA 5HLFA 1FHTA 4DL0C 2XLJA 4NLVA 3HO1A 1CVJA 3GZ7A 3KHGA 2LKZA 3NS5A 2BE2B 1SL2A 5EX0A 3CC4S 3DCAA 2CVEA 3TAMB 1UVMA 1DHMA 1JLCA 3KMQA 3J7A1 4JI3F 4TKTA 4DR3F 1XR5A 2DHSA 2RKIB 4KT0C 2ZH3A 1X9MA 1H0HB 3B4MA 2HHVA 2KZZA 4ID8A 4Y28C 1WF2A 3I6PA 2BM1A 2ZJQQ 3M2RB 1X5OA 1JKHA 2XGQA 2HQIA 2DNGA 3QAUA 2EK6A 1FJGF 2R7RA 1BLUA 5CH7B 3AAWB 4B3SF 1P1LA 2MJUA 1UVKA 1X4DA 1YG0A 1RI7A 3FSYA 1TP7A 3J7YU 1TKXB 3QGGA 4H4KC 3OL9A 4URQU 2J6SA 3MPYA 2QLXA 2B7CB 1IQTA 4ES2A 2PIIA 5DQGA 1BC6A 1YHQS 3KG1A 1N5YB 2WOMB 1K0TA 3LP2A 1ULRA 1NKEA 4ED5A 4HT7A 4CZCA 2IJNA 3WBZA 3NKYA 5KFBA 4B9TA 1FNMA 4AL5A 1T05A 1DTTA 2I9SA 1F5BA 2XMKA 3O5TB 3PKYA 1RT2A 5F9LA 2L3MA 4TLRA 2IA0A 4Y3CA 4ZPVR 5HQ8A 1NRKA 2DVIA 5KFFA 2IYGA 2YQ3A 4PXCA 3MM5B 3JSMA 1IKXB 3KK3A 4M8LA 1L3SA 3C46A 3EPGA 2AGPA 4QZVB 1C1BB 4Y6IA 2LXFA 1HARA 4MMOA 5KFSA 4CO0A 1I94F 2NR0A 1UP1A 2IBKA 2J7WA 4A8SA 2FD2A 3M9NB 4IR1A 2YNHA 4TQRA 3ENVA 2K7JA 4B17A 3FGVA 3CDUA 5I3QA 2UUWA 5DDRC 3PV8A 2HMIB 2OPQA 4EEYA 4NYOA 2V4JA 1H98A 5LL6d 5HMYA 2NSCA 1VLYA 4C8NA 3E01B 4O3QA 1IKWB 4O44B 3M6UA 5HI7A 4RBUA 3J7ZT 2ZH9A 3RR8A 3HVRA 3FMBA 4RW6B 1Y0HA 2MGZA 2YNIA 3R3TA 5D78A 4HKQA 1YRXA 4Y65A 3PR4A 2RIJA 3NNAA 1Q7YT 4GKKF 5KFHA 1JLGB 2EFQA 2OSRA 3H4DA 3BSNA 1TL1A 2EFOA 2PN6A 4OX8A 4RW9A 2KTQA 2ZOFA 1NK6A 3OVSA 4W90B 1NJXA 2OMLA 2BANB 2BQRA 3O8WA 4X4OA 3H40A 4Y0FA 2YKOA 4WXOA 3GYXB 4DQSA 5KOXA 1U6FA 2MQQA 1QUPA 4NLPA 5KFUA 2C2EA 4UUXA 2YKQA 4HI1A 3FDSA 3WC0A 5F0UA 4DFMA 1RTDA 1HBMA 3BB5A 2BW2A 4MYUA 1M0SA 5L9NA 1HBOB 4YDDB 3Q2TC 4I2PA 3GIMA 3PX6A 5F3ZA 1B64A 3ZZUA 3AY0A 3W2VB 2FVCA 5F8JA 2RS2A 1KQGB 4PUOA 1RJJA 5CYMA 4UQGA 1WG5A 3QGIA 4A8YA 2OTLS 5U47A 4ED3A 1HMVA 3VWSA 5C24A 2JEFA 4J5OA 1U1MA 4ELTA 4NZ0A 4A8OA 1QY7A 2F9JA 4I6WA 3M8PB 1YI2S 1DFDA 1SV5A 3ISND 5GVQA 3OUYB 1JKHB 4DL7A 4PG8A 2AQ4A 5G0RB 3LALA 3QGHA 4X4RA 3T5KA 5D4LA 3HKWA 2EG1A 1SJ3P 2I1RA 4F2RA 1ZZNA 4NMLA 4QYRA 1LWFB 1VQ6S 2HIQA 2OSQA 5IWAF 2JZ5A 2JLGA 2Q3PA 4KKOA 3V6JA 4IG0A 3GE9A 2HVHA 1T94A 3SFGA 4XO0A 2QA4G 4ECTA 2XLKA 5H9EJ 1WEXA 3IO1A 3HT3A 2YWKA 1RT1A 4QJVA 1U26A 5KG4A 4JV1A 2PMHA 4LFBF 1TR0A 4J9QA 3T1AA 2ERRA 4ZCKA 3O44A 4DMZA 1HBNB 2F3JA 5J2NA 4YP3A 4CT9A 1M5KC 3MEKA 4R5PA 4C8YA 3UD4P 1Q81T 1Z4UA 3RAMA 3TA0A 3DOMA 1WG1A 2LU1A 2IM0A 1RT5A 1H2TZ 1RT7B 2DH9A 2KVIA 1IKXA 2DR5A 5HBMB 3NP5A 3S6EA 2L08A 1EP4A 3IRXA 5D4OA 2JVOA 1KRPA 4JI6F 3ONQA 2D41A 2WSEC 2ZD1A 3D1HA 2E9RX 4YOEA 5CCMA 3V6HA 2FJVA 3JTPA 2HNZA 1UJ4A 2CQIA 4K4ZA 2LA6A 4FYDA 1XMQF 3Q23A 2R7VA 1GTHA 2CZ4A 1U2RA 4ELVA 4DF8A 3MCSA 2HFOA 1S7HA 1KNZA 2YWHA 3IWXA 1KC8T 2HNYA 2WBMA 1S10A 1GX6A 2QA1A 2VBYA 2Q66A 1URNA 4PKDB 3W2WA 2A10A 2VFUA 4J9PA 1U2FA 4PG4A 1FRKA 4BC9A 5HN0A 2QA4S 4OHYA 2VZ9A 1VK3A 4F4YA 1JXLA 1OQ3A 2AX0A 3OXLA 4QIWD 4F3QA 2OPPA 4FNIA 4NLOA 4NXMF 5LXYA 1VI7A 3OHBA 2J9CA 3CO9A 3EGNA 3MUVP 1UW4A 1S1WA 3CD6S 1JX4A 4K4UA 2PFFB 2ZE2A 1IBKF 1TKZB 3V81B