2BP0A

M144l mutant of nitrite reductase from alcaligenes xylosoxidans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQASKTGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGLSGTLMVLPRDGLKDPEGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
molecule tags Oxidoreductase
source organism Achromobacter xylosoxidans
publication title High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
pubmed doi rcsb
total genus 87
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2005-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0A02
2AANA 1W6LA 4GY4A 4HIPA 1NTDA 2GB2A 2IWFA 1WS8A 1GY1A 3EH4B 1OV8A 4HHWA 1GS7A 1AS6A 5I6OA 1WAEA 2WO3B 1MG2C 1NZRA 1FA4A 3QJQB 3NJJA 2TSBA 4JHVA 1WA2X 3OM3B 2XLLA 1IKOP 5FC9A 4KO7A 1CYWA 2XVBA 3FYEB 2OV0A 3T71A 1PZBA 5I6KA 1SF3A 1F56A 5I6NA 2MTAA 4FAAB 1XMEB 2IH8A 5I5MA 4G7QB 4YSRA 4YVUA 3ZBMA 1EHKB 2EIJB 1NIEA 1B3IA 1ADWA 1SFDA 2YXWA 4P5RA 4DP2X 4A66A 1ASOA 1NPNA 2FWLB 2UX6A 2XV3A 1PCSA 2GI0A 3NJGA 1JOIA 4AZUA 2FTAA 1IBYA 2X88A 2W8CA 5IY5B 2DWTA 1QNIA 4G70B 1ET7A 3IE9A 4G7SB 5B1BB 5B7EA 4DP5X 1ILUA 1AZUA 3L45A 4AKOA 1N68A 3CVCA 3OMNB 4HAKA 3DIVA 1NWPA 5I6MA 1BQRA 2IDFA 1KDJA 1A3ZA 1JZIA 2PPFA 5I26A 4NAJA 1MZZA 1PZCA 3ABGA 4P5SA 1KDIA 4DP0X 3FQ2A 4YVNA 2PPAA 4KOCA 2PPEA 3NT0A 3NP4A 3WI9A 1AG6A 2BW5A 4BK5C 3KW8A 2BP8B 4E9SA 1URIA 1OE1A 1OCOB 1TEFA 4AX3A 4UANA 1FFTB 2YARA 3T9WA 2PP8A 1NINA 2GC7C 2IDQA 1XB3A 1J5CA 2FT6A 1M9WA 4PAZA 4BWTA 3EF4A 1W8EA 1XB6A 2HZHA 1NIAA 3NJNA 4AKPA 5I5IA 1M56B 4UF7C 5I28A 1NICA 1TKWA 1SHXA 1NIDA 3UADA 3S8FB 5E9NA 1BAWA 3FQYA 3NSCA 1SDDB 2ZWNA 3QJSB 3X1BA 1E67A 1JXDA 2BW4A 3FPYA 3S3DB 1BQKA 3FU7A 3EH3B 4DPCX 4HCIA 1AIZA 5B1AB 4Q89A 1E5ZA 4NERA 1ETJA 3KW7A 3S3BB 2XV0A 3FSWA 2PPDA 2IH9A 4FA7B 3CZUB 3AG2B 2HRHA 1TEGA 5PCYA 3D12B 2EINB 4M3HA 2I85A 3H4FA 1CYXA 3T6VA 2R7EB 1SNRA 1BXVA 1AZCA 5B7FA 4AI7A 3T6WA 1A65A 2VW4A 3ZX1A 4TXVB 1NIFA 2FT8A 2DV6A 4Q8BA 1GS6X 1J9RA 5A7EA 1AG0A 3FQ1A 2AZUA 3PPSA 4GXFA 5D4IA 5I6PA 1JXGA 1V54B 1L9PA 1HAUA 1RZPA 2FJSA 4G7RB 2H47C 5AKRA 2XX1A 1A8ZA 2QDWA 4NB7A 4A2HA 1I53A 1J9TA 2GHZA 1OE3A 3H56A 4GP5B 5B1JC 4N4YB 4E9TA 4DP7X 4RH4A 1CURA 2FQDA 2NRDA 3DKHA 2UXFA 2N0MA 1PNCA 2B3IA 1SFHA 3QJTB 2XV2A 3T6ZA 5F7BA 3CVDA 4UAHA 4KO6A 1R1CA 2UXTA 2J57A 4X4KA 2AVFA 4E9RA 3IBOA 2JKWA 4DP6X 3GXUB 3PAZA 3PCYA 1MZYA 3JTBA 1AQ8A 4F2EA 1VLXA 3S8GB 1IBZA 1JZFA 1SJMA 2EIMB 3FS9A 3ERXA 3WKPA 8PAZA 2MRYA 3UAEA 3PLYA 1FWXA 3QJVB 2A3TA 4A2GA 1AS8A 1X9UA 3HEIB 1KBVA 1A4CA 2YAQA 1NIBA 3NSYA 3RYMA 5B3SB 2BZCA 1W6WA 2CJ3A 5B1KA 3WG7B 4YSAA 4AKQA 3SBRA 2XWZA 3S3CB 3ASNB 1JZGA 1E30A 4WTQA 2HLEB 2J56A 3DTUB 3BQVA 2FQEA 1N70A 5TK2A 2TSAA 1PAZA 2VW7A 3AG4B 4N8UA 4DP4X 1QHQA 1KV7A 2HX9A 3MX0B 1KCWA 2JXMA 3ABLB 2W88A 5PAZA 1OOWA 2GC4C 2ZXWB 3CDZA 2UX7A 1A4BA 2AFNA 3NYKA 4HZ1A 3NP3A 4DP9X 4F2FA 3IN0A 3PAVA 3NSFA 4GYBA 2YAEA 2Y1AA 4YSPA 1BXUA 3X2QB 2BZ7A 1BYPA 1GSKA 1NWOA 4YSCA 1AZRA 2R7EA 2VM4A 1BQ5A 4KO9A 2YXVA 4DP1X 2DY2A 1WA1X 3CDZB 3IEAA 3AG1B 1WS7A 1AZBA 2QPDB 4YL4A 4G71B 2ZONA 3H4HA 4BXVA 3UGEA 4A68A 4MFHA 2QT6A 1V55B 5TK4A 1T5KA 1IUZA 1AZNA 1GR7A 1JVLA 1GY2A 2XU9A 2DWSA 3AG3B 4A67A 2J55A 3ZDWA 3BVDB 6PCYA 1RZQA 2P80A 3U25A 2VSKB 3X1GA 2PCYA 1L9RA 4DPBX 1ZIBA 2E86A 4E9XA 2X87A 1OCZB 3AZUA 2HX7A 1PZAA 4YSDA 3NSDA 3QQXA 5B7MA 2I7SA 3TASA 2BO0A 3ABKB 4QKTA 2VM3A 2CCWA 1OCRB 4KNUA 1PLBA 3X1FA 5AFAA 1ET8A 2GIMA 3N2JA 1BEXA 4HCFA 3X1NA 3FSZA 3UACA 1GYCA 4BDVA 4GP4B 2PCFA 4K9JA 2IWEA 1A4AA 4DPAX 2Q9OA 2HX8A 2IDSA 3EHBB 1J9SA 1JZEA 1RCYA 5F7AA 1UATA 3SBPA 4E9WA 4BWUA 6PAZA 1ZV2A 2XXFA 2XYBA 3QPKA 3WNIA 3V9CA 5EHFA 3ABMB 1CUOA 1SF5A 4KNSA 3NJKA 1SHWA 1X9RA 1V10A 4E9YA 1OE2A 3JT2A 1HAWA 2EILB 3NJLA 2YAHA 3GDCA 5B1JA 4YSUA 4KNTA 1PMYA 3NJFA 1L9OA 4A2EA 2BWIA 1ASPA 2JFCA 2QDVA 2YAFA 7PCYA 1AOZA 4YSEA 3T6XA 1NPJA 2YAPA 1ILSA 1E5YA 3UAAA 1EZLA 2Q5BA 3FT0A 3TA4D 4W1TA 5D4JA 1QLEB 2FNWA 2DYRB 2BP0A 2J5WA 4JKNA 3ASOB 3N55A 1L9QA 2B08A 2I7OA 2PLTA 2YAOA 2OJ1A 3SQRA 4CSPA 1AS7A 2LLNA 1OCCB 2CALA 1SDDA 1WA0X 3NJHA 3X1EA 3HB3B 1DZ0A 2H3XC 1NDTA 4E9VA 3AY2A 2XUWA 1ASQA 2GBAA 1IC0A 1TU2A 2PP7A 3FU9A 1OF0A 2Y69B 2CAKA 1YLBB 1KBWA 2XXGA 1J9QA 5ANHA 1L9SA 1AACA 4W9ZA 5I5JA 1PNDA 3C75A 2BP8A 2IDUA 1KCBA 4YSOA 3NJMA 1PLCA 3OD3A 4QLWA 3AW5A 1ZDSA 2GSMB 1PLAA 1HFUA 4ENZA 1PY0A 1ET5A 2VW6A 2FQGA 1J5DA 3PXLA 4ZK8A 4BXSV 2BHFA 4F7KA 3FU8A 5I6LA 1GS8A 1GW0A 1JXFA 4L0PB 1JZHA 1JERA 2PP9A 4M4RB 3ZIYA 1AR1B 1AANA 1MDAA 2VN3A 4CSZA 2ZOOA 1ID2A 2FT7A 3EH5B 2YQBA 1KGYE 3CG8A 4E9QA 3TBBA 1ZPUA 2HRGA 2IDTA 3FYIB 1BYOA 4KOBA 4BDVB 4EF3A 7PAZA 3FU7B 4YSSA 4YSQA 2CBPA 1AAJA 2AZAA 1ZDQA 3V9EA 4A2DA 3CVBA 2DYSB 2OCCB 3FPXA 3UABA 4HALA 2H5UA 3FSAA 3WKQA 2EIKB 2UXGA 9PCYA 2FQFA 3MBWB 1E65A 2HXAA 2BWDA 1DYZA 3IN2A 3OMIB 4A2FA 2VMJA 2WSDA 3G5WA 3OMAB 2YAMA 3QJUB 1CC3A 4G72B 3NJIA 2RACA 4YSTA 5LDUA 3QJRB 1RKRA 3SBQA 3WNJA 1MG3C 5D4HA 2UXVA 3PAUA 2P80D 1XB8A 1JZJA 3OQRA 4HCGA 4GP8B 1KYAA 3TU6A 2VSMB 4DP8X 4BWWA 1JVOA 1L9TA 4KO5A 1ZIAA 1PF3A 2WO2B 1BXAA 1M57B 4JHUA 2XX0A 2PPCA 3TBCA 2IWKA 4PCYA 3WIAA 2CUAA 3FSVA 3GYRA 2IAAC 4WKXA 5AZUA 2QPEB 4HHGA 2BP0B
chains in the Genus database with same CATH superfamily
5T1KA 2AANA 3VFSA 4DGVL 2DF3A 1LEIB 3CLFH 3LH2L 2BFVH 2ILLA 4CJ0A 1NTDA 2YGPA 3QG7H 3OJVC 4GPVA 3WFEL 1WWBX 3EH4B 3EBHA 3QA3A 2WQXA 3OZKA 3KPOA 2GBVA 1E5BA 4FX5A 1N10A 3U6RA 4ONGL 4OD1L 5HGDB 4QXGH 4KO7A 1CLOH 4QHNA 3AGWA 5F9JB 4AGLA 3VFWB 2Y3AA 1RZGA 2E7BA 2VLRB 5F7YC 3UYPA 5I24A 3QUXD 4L8BA 2OYMA 4GBXC 4G6FD 4B9CA 5F7KC 3FULA 5IEHA 2PYEE 2DN7A 5I1EH 1RHHA 2C1OA 1F1GA 1FYTD 5IV2B 2IJ0C 4FXGB 5KS9E 3MGTB 1RMFH 3RIAF 5JYLA 4AQOA 3CV5A 3Q1EA 3GWJA 4IGBB 1AGDB 1DJIA 4LARL 5F9OH 3HE6D 1IJNA 1H6EA 1WUZA 2D4DA 3FBQA 2F8XC 3EFOB 1VFAA 5HHOD 5C0CB 3L45A 1BMZA 3VI4E 3HZVA 4U3SB 2XTJE 3QAZB 3OR7B 4OZIA 3HC3L 5I6MA 1Q8MA 3BFOA 2OJZL 3EADA 5T5FA 5JXED 2NY6C 1MFEH 1MZZA 4UM9D 1YN6B 3HI1A 5DURB 2FYVA 1D6EA 3X3GH 1VZHA 4N26A 5M94B 5IVZA 1TG8A 1CK0H 1E9PB 4R2GB 2K6WA 4WDIB 1K6QH 1MVYA 2E27L 3KBHE 3PNRB 4FFVC 1NGQL 5A3IC 3KYOB 3U7WL 3O8XA 5KYUA 4XNXL 3WE6A 2ZIDA 2FT6A 1JV5B 2M1KA 2AV7A 4P3CH 3OBAA 2K4AA 1KEMH 1RVFL 3TX4A 5IB1B 1NSNL 2E59A 3CJJA 4OIFA 1FZOB 3FT9A 4OI8A 4R8WH 4RISL 2ED6A 3OC5A 4OF8A 4NZ8A 1T20A 1FNLA 3HMWL 8CGTA 3GTVA 4NRYB 4G59C 2W80C 2OMWA 4CU8A 5FK9B 5KYWB 4PJ9A 1UG9A 2HA1A 4PTUA 2BIHA 1Z2KA 2A77H 3TH3T 3APFA 1UKTA 4UTBL 3DMMD 2JIXB 2P48B 3DGDA 4ZNCD 3QUZA 5D7JB 1HH9A 2PPDA 1JTPA 1EPFA 3AG2B 2D73A 5K39B 4XX5A 3QISA 2GAZB 2FWOA 2G2NA 4LSQL 5FYJL 4ZZFA 4LEBA 3T6VA 4Q9QL 3PNWB 5LGHH 1Z66A 3T0EE 2KQNA 5AWNL 4EOWL 1BOGA 3Q2CA 3QQ4B 5AYUH 1CLOL 3DMMB 2AQQA 2NY2D 4IIQA 1SLXA 4YN3A 4QMEA 2CR6A 4WNQB 3U30C 3A23A 2G2PA 4ZTPH 5D1XC 2VC2B 4MLIA 4H26B 2MOVA 2CK0H 4O00A 1WCBB 1A6TB 4R4ND 2BOBA 2VLRA 3V0GA 2QGEA 3UAJC 2BXYA 5AALA 2VITA 3D85A 5HGAB 5CEYB 4JPVH 3QXWA 2W9LA 4HFWB 5LG6A 5JPNB 3LQAH 3MRLA 4V1DE 1HL9A 2DWDA 4ODUA 4EMZA 3BIAX 4DP7X 1CURA 1D9KD 3IMBA 4OCWL 1R3KB 1QW9A 1ROWA 2R69L 2I60L 3HKZA 2EEXA 2IH3A 3H7BA 4KFZC 4KWUA 4Z7QF 3OTTA 5F1KC 2YKKA 1MHHB 3LPWA 4GSDH 4GS7B 1DJXA 3HNVH 4HUUA 2Y1VA 4JHWH 3ZHNA 2LOEA 4UNVA 5HYIA 1EVUA 3F7RA 1ONQA 1J7VR 3FB8B 1QSEE 1TJXA 1DQTA 2OMYB 3PHAA 3WIIL 3T0AA 4TLTA 5E1QA 4JDTL 2PKDA 5CGYC 4HULB 1SYSA 1E4HA 4XP1L 1DVZA 5EBMA 5IM7B 1AQ8A 1HHJA 3QUHA 5AL8A 5LJYH 1IL1A 2WN3A 4PSRA 1V3JA 1AI1L 4JFDB 3GIZH 4ZMQA 4MXWL 5TH2A 4FQXD 4A7VA 5ALBL 1F58H 2CE6A 2PO6B 4P3WA 4OVUA 3U0WL 3ZJAA 4N90E 4C8XA 1F11A 2ZSWA 4XVSH 3KJ4B 2EXWD 1BGXL 2EDJA 5ID1B 4ZYKB 3Q5OA 1ERNA 4R7NA 3TZVA 2LV4A 2X4NB 3L3JB 3WG7B 2QMJA 3ULUD 3GSXA 5DZLA 5AW7B 3PWNB 4N0YH 2JI1A 4HKZA 5AW6B 1S7VB 4UOJA 1RUML 4HOZA 1J8KA 3RVUD 3TBSB 1CZ8L 5EUOF 2OYLA 3RWFB 5EOQH 1A3RH 4OVVA 4QTIH 3IM1A 3ZL1A 5D70H 5T1DL 1NJ9B 2X9YA 1SLWA 2ENYA 4FQCL 4XN5A 4JRXB 35C8L 4MNQD 2LW3A 4ZT1A 4B3EA 3SPIA 1IC4H 4QXWA 3QE5A 2E6PA 4AEFA 4DP4X 5HHPA 3ALWA 2ODHA 4M5YH 3DIFA 1H8OA 4DJMA 4GKOA 2HKHH 3PQYA 3CDZA 2AFNA 4DAGL 1XCWA 4WLCA 4PJBA 5E08H 5DMIH 3ULUE 1C8QA 4Z0XA 3A6CL 5TDPB 3IGUA 4LEEA 2VZVA 3KD4A 2Y1AA 3QIWC 3C9NB 4Z7UF 4DK6A 5B39A 5FO8A 1IC1A 4PLJC 1TQVA 3VRLF 4B9FA 1OSZB 2AABH 4B0MM 4YSCA 4MA7H 2CJTA 3CVIL 4H1LG 4DK3A 4ONOA 4TLUA 1SXNA 2MIZA 3BE1H 3MRDB 2DQ6A 4H8HA 4PJHF 1Q9KB 3HG1B 4HWUA 4WWKB 5HHOA 1SJEB 5IGXH 4GG6E 5KVGH 4KK6D 4NNXA 3V8CA 1WRFA 2PCFB 3AXHA 3MRHA 2OKMA 4MJ2A 4OGYH 4ZFOA 3O6FA 5C71A 2GT9B 4UQEA 1BIIB 5AVXB 3VFSB 2XHNA 1B0IA 1JSYA 2CLVA 1DQJA 4FFTA 4HUMB 4EPSA 2J6EA 4AM0B 3X1GA 1I9JH 3EYVB 2YSSB 3BP5B 4N85A 4PJAA 5D5ME 1UM6L 1NFDF 2Q76B 4I7ZC 4KROD 4BRJA 5EEYA 1M71A 4OZFG 4TUKH 5IESL 3X3FL 4Z7QE 3MNWA 5H35A 4XWGH 3P4OB 4MCZA 2HPTA 5EBLA 3MRIB 1P5UC 1SM3H 1UWGL 3HE7B 1PLBA 4KNUA 4ZW7A 1YMMB 1Y7VA 3QNYA 1T2QH 3JV6A 2VZUA 4OUUB 1KJ2H 2XZZA 5GXBB 4Y2DD 2NNAB 2R27A 3FC8A 4J3OF 1A9BB 5DUPH 1JUFA 1P7BA 1DN0A 4OV5B 1E0OB 2DWXA 3QG6A 5E7FA 1JE6A 1N6UA 4MNHA 2BIPA 1D7CA 3BKYL 1G7IA 3S2AA 4EXKA 3HTLX 3MLSL 1DL7L 1I3GL 1AIFB 2AK1H 2YOAA 1NMBL 4MJIE 1FGVL 2EC9T 2Z4QB 3B9KA 3N44B 3ABMB 3W1ZA 4LSUL 5B21A 1XF2A 2XZAL 1IAKA 1MFNA 3SIKA 2VR6A 3IRZA 1K8DA 3BH4A 4JKLA 3WS6C 4HJEA 1XGZA 4CGUB 1PMYA 1MCHA 3WD5L 2YPLE 1UXMA 2BSRB 1SBSH 2JFCA 3L95A 3HR6A 3S3PA 4GG8B 1K85A 1FE8H 1ED3A 1UWFA 4PRHB 3VYNA 1Y6KR 4WO4B 5KW9L 3LS5L 4NQCA 2D7MA 2YAPA 3CFNA 1BQSA 3NABL 2Q5BA 1IM9A 4KJPC 4MBRA 4KQ3L 2WJ7A 2BP0A 1GYAA 3FQWA 3QUMH 4W6XB 3RNKA 1JF1A 3BGMA 2NY7H 3CFKA 1FNFA 1J86A 4AQ1B 1M7DB 3FT2B 4IU2B 3MRQA 4JKPL 1N6VA 2Q0ZX 4PR5A 5GJSH 4WV1C 3WJJA 4ZW5A 1W91A 3HBQA 3UIZA 4B6ZA 1AYRA 1DQML 4R7LA 4TSAH 1II4E 4PGZA 4JPIA 4WUKL 4Y89A 4UCFA 2NMSA 2OJZH 4XHQA 3DV4B 5GRZA 4OGXL 1TU2A 3FU9A 3FUFA 2FL5A 4OJFH 1RP8A 4S1DD 5HHMD 5IBUB 3TZVC 1G9NC 3N0AA 1SXSA 4JY5H 2IDUA 4N0RA 2DBJA 3DX2A 3FONB 4QF1B 5JPMB 4JFEB 1WC7B 3KPSD 5AKSA 5SX4I 3WTUA 4K2UH 3T0BA 5EBWB 5B1CA 1ZHLA 4XI5C 4MMXC 1NH6A 2NY0D 2ZZUT 5AAMA 2AEQH 4OQTA 1I8IB 3ZE2B 5GZNC 1K4CA 5KTEH 1PY0A 1TQUA 3FRUA 4YDIL 3INOA 1NAML 2YEQA 4LAQL 3BHBA 2Z0BA 3GZPA 5BMFL 5AB2A 3Q2WA 1XIWC 3IJSB 1MDAA 2DQJH 1MIMH 2FT7A 1VFBB 2F58L 3WO3B 3UJIL 3BUIA 4QRQB 4ZMNA 2E6QA 4Q4IA 3V0VB 1HJCA 1BM3H 3MGOB 2Q6WB 5FO9A 5CINH 3RU8H 1K5NA 5DQJA 4AUUA 4X5WA 4L29B 1JGEB 2VLRE 3FH8A 3MLVL 4JZJC 1H6TA 3S37H 3ES6A 1J48A 1YY8A 3S35H 4B5ZA 4Z5RA 4E42A 3DUSA 5F7HA 3STZB 2NW3B 1L7TL 1QYGL 2FD6H 4TQEH 2X2IA 3K91A 4F7PB 1FN4B 1A6VL 2W65A 2QKSA 4KDTC 4X7FC 5KBMA 1DYZA 2E3VA 1JPFA 5C0ND 3K6SB 4U7KA 1M2VA 5IF0B 2HTLD 2CLVB 2MCPL 4MWFB 3TBTA 1P4BH 3U6XS 2R0LH 1XCXA 2NY1B 1A4KB 4Y0GA 1WAAE 1UZ6E 4EN3D 3APCA 3RTQC 2ITEA 3D39D 1UM4H 3JTSB 3EJYD 1M2VB 1S7SA 4JHUA 3TT1H 5IF0A 3QDGD 4IRJD 4HEPA 4TPRH 4TOYH 3ZGHA 1HC1A 3WIAA 3QIWD 4QXUH 4DKFL 1UT1A 4LEXH 5D1ZD 2BP0B 4RQQA 5HHVL 4L8CB 1SYVA 4KXDA 1T0MA 5CP7A 5T5NG 2P1YA 3OR6A 4KJPD 2UZPA 3FAXA 1KB5B 5H37G 2ZCHH 3EYUH 1RUPL 1E2ZA 1EEZA 5HHPB 5ENWB 2C1PB 4B9IA 3CX5K 1JPSL 5LDSA 1IKOP 5AB0A 3SPVA 3L3OB 2O5ZL 1KXHA 4JFVA 1IBGL 3FU0A 3T71A 3EJRA 1U8PA 5I6KA 3GUTA 3LQAL 1XMEB 2BCKA 3L16A 1HYRC 4Q74A 2X70A 1JZ2A 1IV8A 1CFQB 4NYLA 3CZKA 1JFHA 1DQIA 5IW3A 2OMXB 3D52A 1SFDA 5JLZA 5J3HC 4JEGB 3R19A 3JTTB 1I1YA 4ZTPL 4DFHA 2FTAA 2UY7A 4MRBA 3UC0L 5CR1A 2W8CA 1DJHA 1M3JA 3E6HB 4XPHL 3KDMB 4DN3H 3IDJA 3AACA 4YHPA 5TJWK 4M9PA 1RSFA 5EZLB 1FYTA 4G7SB 5B1BB 5KJ7E 1UM5H 1NCTA 3MBXH 3NEOA 4LDEB 3OMNB 1BLIA 3DIVA 1NWPA 3TXAA 4EI6A 4Z77B 4JFED 1MREL 4HKXB 4K5PA 4BZ1L 3DVNB 2DRUA 3HZKA 1XTMA 3N40P 3MRMA 4NPYB 1LEKB 5C0BB 2C4FU 4YHML 4HMEA 4UQ2A 1AJ7H 4QGTA 4X0KB 1XSOA 4DP0X 1P7QD 2FX7H 2VR4A 2Y25A 5BZWB 5I8KL 3GXNA 5E1AB 3ILPA 1DFBH 2FJFB 2QBWA 4PJGB 1QKZH 4JZNA 4WHYH 2WUCL 4E9SA 3NCEB 1TEFA 1LO4L 2Z8VC 1HZHH 2DMHA 3O11B 2AJ3A 2IALB 1ED3B 2WSPA 4F5CE 4HIQA 5KVFE 5I8EA 1FZKA 4GKSB 3GF8A 4KKBD 3W82A 5HYEA 3KH3A 1AQHA 1MW3A 3LNDA 1Q9KA 2FIKB 5E6RB 2FEDD 3VGEA 3SYPA 2R1WB 1KN4L 1KPVB 1NEUA 3B6SB 4Y19A 4QEGA 4ZMXA 5I5IA 5EEWA 5I28A 4TTDC 2P5WD 5E0QA 3KEHA 1KEGL 3GSQB 4XP4L 3IFPA 4LBEB 4AEHL 3GKWH 2P9RA 4J8RB 2JE8A 3FPYA 4JRWA 3QUYB 3PV7A 4ZAKD 2WOYA 1YNTB 3SBWC 5E6SB 3OJDB 4XCEA 3K2MC 4NNYB 2BY2A 4PRID 5F1IB 3RFZB 2GY7B 4JREB 4KQ4H 3N04A 4JDZA 1L3WA 2DQCH 4KUCD 3KS0H 4PRAB 2BIIA 5D5MB 1IC7H 3R1GH 5GGSY 4AQEA 4PJEE 3LRHA 2NY3B 3KPLA 2I85A 4URKA 2VLLA 1C08B 4P0DA 1R3JB 3DMMC 3MLZL 2BOLA 4WENB 2ITDB 3ULSA 4AM0Q 3VA2C 2APVA 3FN0L 5F96H 1NCIA 2CGRH 2PYED 1QBML 1IB5A 3S36H 4OZFB 3ZX1A 2AK4D 5AOKA 5G4MA 4JG5A 3MFFB 3OKOB 1WWCA 1ORQA 3PV6B 2IPUK 4RZCA 4WWOA 3HE6B 5CGBA 3QDJA 4HUKB 4LLAA 4HA1A 4MD0B 4MS6A 4LXFA 3O41B 3IJYA 1SXCA 2XY2A 4K7PL 3VVWA 1G0YR 1IGCH 2R2HB 3PUUA 1UA6L 4Z6AT 1LDPL 4JFSA 5K9OB 5HDBE 3EJPA 5F3BB 5T8IA 3FFOA 4KI1A 1I9EA 4KXZI 4MMXB 4NN6B 1ZK9A 5EU3A 1MFBL 3MRHB 3VXUE 3WE6B 4ODSL 5GZOA 4P2OC 2Q86A 3I84A 4Y1AE 4ZQKA 3QIUD 2WBJC 2UXFA 1T5XA 3QDMD 1AGBB 4QPEA 4FQQB 3SDAD 4GXVH 4D3CH 2VZTA 4G80B 3MBXL 4ELMB 4ZD3H 4GW4B 3QEQD 2NX5E 3SYQA 2DM2A 4DTGL 2WV3A 3TNMA 5K33A 3WMSA 2XWJB 1CDIA 1YN7B 3C9NA 5B39B 1KBBA 1YPZB 2A9MH 1T4KA 4Y16D 3TIEA 2YLKA 3A21A 5DMGC 1W72L 2VLKE 1MHCB 4F58L 1DQLH 4GINA 3BIBX 2YBGA 1HHGB 2WYHA 3BXNB 1L3NA 2OMVA 2XA8L 2XDHA 3HS0C 4L4TD 3WAKA 2NTSP 1I1AB 4DGVH 1NBCA 4AQ1C 3VSVA 2MRYA 4HUXB 3QH3B 3TF4A 1ITBB 4OGAC 1MY5A 2CR3A 1KBVA 4FXKB 5D7KE 2XOTA 4WV1B 3CHXA 1COBA 1F4AA 2X28A 1OGSA 3BH8A 4WO4D 3RE0A 5B39G 4NRZA 1HKLL 2WBJB 4FQJL 4WU5B 3I85A 4HS3B 4AC2A 1YEDA 3MRFA 3DTXA 4YSAA 5ES4B 1UENA 1F3JA 3ESPA 3RG1C 3T3MF 3EYQD 1DL7H 4ODHH 1P53A 3GNML 3R06B 1E50A 1I7RB 3P40A 1CDGA 1FGVH 1IIIA 5F7NC 3O3AB 2ZF8A 4NO0A 5DZAA 4JX0A 3DBXA 4JGUA 3MYZA 4XN7A 2WBJA 5A6LA 1MPAH 1TVHB 1GSMA 1KFGA 1G87A 1CMOA 3QJHB 4RFNC 4NZJA 2WZPA 4OF7A 4L0ZA 1NGWA 2VDQB 3AG4B 2APXA 1N19A 2P45B 3B56A 3O9WB 1Q38A 2ZG3A 2W9EH 4PMFA 4GXUN 5PAZA 2KH2B 2GC4C 2ZXWB 3U9UB 1OAJA 4YJZL 1A4BA 5EC2B 1YEIH 2XN9A 4UYQA 3L9RB 2O6EA 5K93A 3QJFB 5CP3H 3DLQR 3DX1A 5IHZB 2PO6D 2B9BA 4HLZH 4XXCC 1UB5A 1XL4A 5CJXA 3HE7D 2OW6A 4NQQA 5FDWB 3T3PF 4X7EC 1EZVY 2BS8A 2EECA 3U1SL 4U1HA 4JJHA 2ED9A 2WWMC 4KPHH 4NO5B 2VN7A 3J07A 3OWEA 3VFRA 5HDBB 4PJAF 3SJVA 1WP6A 4R90H 3CTTA 3VI3A 4AYID 3B9KC 3ELQA 1BGXH 2V3EA 2GK0A 1L7TH 4GMSL 4C4BA 3WFHB 3VSTA 3HI5H 3ZE0B 4MFHA 4GSXA 3GEWB 4HIJA 5IMLB 1N3NA 3MLWL 4LGRB 4WY7L 4YXKL 1S7XB 4BELD 2EKSB 4ELME 2KZ1B 2BPBA 4ICWA 3CDGB 1A9EA 4FI7A 3KYKL 1NEZB 4UAOC 3VFPA 1T2XA 3F5WB 5EU4B 5FA3B 1OCZB 1CDHA 2JCWA 3GLEA 3MA7A 1MWAH 4N2CA 3MNMA 1XH3A 5I18H 2X9WA 4WRLA 3H53A 4BEIA 2P43B 4RNRA 5CUSH 2FCBA 2O61B 2XNAB 1W0WB 2E46A 4Y16B 3PNWA 1MFMA 3N2JA 5SWZD 3ULSB 3DX9A 1XBRA 5IR1A 3OKKB 3IF1A 3TCTA 1CFTA 3SE3C 1KN2H 5KVDE 1G43A 3CLFL 2J3SA 4X80L 5JXAH 1AMYA 1JMZA 3VDAA 2FK9A 3L3KA 4K55A 2ED8A 2HX8A 2PF6A 3V0DA 4EKJA 1KPUB 4IIZA 1WV7T 1NDGB 4FG4A 5FYLH 5SV4A 4K9EC 3F7KA 3E7JA 3D39B 3TF7C 3O45B 4HWNA 3JUYA 4PHZA 3GSRA 3BVNA 3NCXA 5GGTH 1Z5LB 3IJEA 2WGXA 5EUOA 4JFDE 5E6ZA 3VXRD 4AMKL 3GSQA 3RKPA 4KNSA 4HJIA 5FFLA 2VXQL 5ABAA 4MKTA 1JZ6A 2P47B 2JCCA 4Q14A 2VERA 5DZ9A 1RJLB 1OAKH 4EIZC 5DWUL 5HGHA 3KVPA 1L4IA 4CVZA 2YAHA 3GDCA 2NXZB 3D4YA 3OKEA 2R8SH 1MLBA 3QT2A 3SYOA 4JK0D 3T0EC 5F97E 3TA4D 1L9MA 4PBDA 1F6FB 1WZMA 1ZANL 3I3BA 4BZ2H 1MCWM 3HUJF 4YHZH 3DPBA 5E8NB 4OCLC 5CBAA 5FUOH 2R59A 3KYMB 1FUNA 3UTTA 4MMXA 4CU7A 4R0LC 2F1EA 4LLDB 2VOTA 3PDGA 4Y4KD 1EDHA 5E8EA 1XH1A 3MFFA 3OKOA 2YN5A 3DHPA 1X5KA 4F5CA 3HLAA 2H3XC 3OR7A 2GBTA 4X4YB 5HSFA 1UXWA 4CU6A 2O5XL 1XH0A 5F1NB 5IROC 1Q72H 4WHTA 1VRSA 2G4EA 1TEYA 4F7CA 2JB5L 1J0KA 3W39B 1D2PA 4JDZB 3CFEA 2D3NA 1ZA3B 3BWSA 3MLYH 1WEJL 2QKIB 3CHOA 2VUYA 1JGVL 3GS4A 5I5JA 3SHSA 3TNNA 2R0KH 3ZYIA 2CO7A 2VABB 2CBMA 1QFUH 4GW4A 1NL0L 3UJJL 4N2OA 3HHMA 4FEIA 4Y5YC 1CT8B 5L2KB 1KJVA 1RURH 2W92A 4C4UA 2Z31B 1X5XA 3ZKQD 1ZOXA 1XQ4A 2TRHA 2VW6A 3NAAL 1E7UA 1WAPA 3LKPA 5FWQA 1QPKA 1OSEA 2JQMA 1BAFL 3B1TA 4Y5VB 3CZFA 1P6WA 3BD4A 4M6OH 1B0RA 4NUGH 4M93C 5EO9A 5I74C 4E9QA 3C08H 1NANI 5IVXB 1J12A 3ATDA 1LNUB 3GJFB 4ODTH 3FU7B 2NTFA 3G5ZB 2YGQA 5CJOL 4KKRA 1IAOA 4HP5A 1MCLA 3VWJD 2VDPB 1U9KA 4P4KD 4BQ9A 1QUNB 5EO1A 4JDVB 2V5YA 5BUAA 4XN4A 5G4OA 2MQ3A 4ACPA 2FATL 3BLPX 4YGAB 1ZT1A 1R0AL 4G8EB 3WSQL 1JIBA 3EGSA 3D50A 4OGXH 4IK7A 3V0HA 1WSST 4LSVL 5E56A 3SDYH 4D0BA 2G9KA 3KG5A 4HZAA 4RAVA 4PLKD 4K5LA 2OZ4L 2AABL 4WTZG 3UZVB 2BNRB 3ZTNH 4JFZH 4KV5F 3MV7A 1RVFH 4M8RA 2PWFA 4YHKL 4GRLC 4JL2A 1U8LA 2CXGA 4MDJB 1C16B 2R83A 4H25B 2VLKA 3SPCA 3ULAB 4PVBA 4CN1A 4PJ8D 1B90A 3WKYA 4ANUA 2HTLC 1IKFL 4YNYA 4C54A 5MEOA 5TQ0L 1AH1A 2KLTA 1QRNA 1TJIL 2IWKA 2J71A 1T1XA 2EDOA 5H4YA 4YEFA 3HFMH 2JKXA 4F15C 5GRVK 2ZKYA 3IJ9A 1GMIA 2NLJB 1VF5C 3RFRA 3TBYA 1J10A 2MCAA 1T6WA 2XA3A 3I6GA 1MNUL 3ZUCA 1ZS8A 4HIEB 4NO2A 2UZYB 3RWCB 5AG9A 4N8CH 1GS7A 3ATFA 3DRTB 5GJTL 1WAEA 2E47A 3KPRA 3VRLE 1OLLA 3QJQB 5C2UB 1XH2A 1IGCL 5FC9A 3MJ9H 4NUJA 3QRGL 4OTXL 4X6CB 2VZ3A 3OZ9L 3ILQD 2XVBA 3K72B 4IBVA 4GAAA 5I1EL 5KN5A 1XCQB 1L5GA 2EIJB 2DQGL 2Y7OA 1CQYA 2D3LA 3MUGB 4BD4A 2YXWA 1IM3B 1HCVA 4U6YA 5LNGA 1NPNA 1MSPA 3SKMB 1UWEL 1W15A 4FCAA 5H37A 4EDXB 4DTGH 4HT1L 3CXDH 4KQ4L 2NPLX 4JFEE 5BV7L 5E2UH 5BOJA 3V4PB 4G70B 4N5UA 1WF5A 3B2VH 3D09A 4DP5X 3CMOH 4XTRD 3TP4A 1A7NL 1OM3H 3STBA 3CVCA 3WBDA 4PJDE 4D9RE 1KXVC 1F6LL 3V4VL 4MD4B 4PLKC 5JR1H 3VTMA 1K5WA 3AABA 1F6AB 1QG3A 4ZMLA 2BFVL 5KYYB 5L2KD 2CCVA 2P28B 4U1MA 4P5SA 1JWMA 3F04A 2W0KA 4OFQA 1HU8A 2NY5C 3EGDB 5DJAA 3PABA 1ZK5A 2DQTH 1BCIA 2VN5A 5I76B 2YQGA 2BRRL 3GDBA 4X8XA 5D2LF 5FKAB 3TBWB 1JF1B 3OR6B 3HFFA 3JWDL 1NCBL 4Y2OB 1XGYH 3MUUA 3LN5B 3H3KA 4EZLA 4TULL 3UG5A 1JFQH 3QPQC 2EIDA 1J5OH 1XB3A 3ATAA 3PJSB 1XB6A 4KV5E 5IBLC 3W56A 1D2OA 2MTPA 4KY1L 4KAQL 4PV8A 2AJYH 5E4IA 5C07D 3H85A 2IEPA 4XP5L 5FO7B 1KTLB 2HH0H 4LF3B 4FNRA 4OZIF 3MJ9A 1SDDB 2VR9A 4ZPVB 4WWKC 1ADQA 4DZ8A 5E9DA 5JMRA 1BQKA 4OLYL 3AB0C 1VIWA 4IW4C 4JN1H 5D7LD 4ODHL 1LQBC 2FYYA 1ECZA 1ODAA 4S1RL 1TJGL 2LE9A 1D7BA 3FF8A 2IH9A 5HJBA 4IOFC 2O4EA 4XNZB 2VJ8A 4D9QE 4E0RA 1IGML 1RZIB 5HHQB 1J1OL 5D2NC 4XO3A 2UZXA 2AAAA 4YK4C 1QBBA 2P24A 4M02A 2P42B 3ALPA 2FSEB 5EEXA 2CLZB 1UQSB 3L3GB 3RI5K 5A40E 1FL5A 2RGSA 4XZUA 4HHAB 4YK4B 5DVOA 1TQCB 4U3CA 4Y4FD 4D8PB 4K4KA 5EOTA 1FL3A 1KN2L 3WLWD 4YC2B 1IGJB 1U2HA 3FQ1A 4GXFA 4ICXA 3IJ8A 1GZHA 4PS7A 1AGEB 1JRHH 2WUBL 5D8JH 2GFBB 4RAUB 5FYLD 1PX8A 2XWEA 4RMBA 3BOVA 2KQMA 3RILA 1DQJB 4GMTL 1ES0A 1ETA1 2ZYRA 3LRLA 2H47C 5D9SA 3SDXB 1NFIA 3CSTA 5SWZB 1Q1JL 3QRLA 4ZFOB 3SQOH 3UZEC 1WZAA 5F89A 3DKHA 4YDMA 1ZLUK 5BNXD 5AEAA 2DQDL 2QQLH 2VH5H 3AUWB 4FQIH 3T6ZA 4YHZL 1G84A 4O9HH 1KJMA 5L4FA 5F7UA 4XPGL 3ORJA 5BQ7A 3QR0A 2Q7NA 4WKZB 2XXCB 2NSXA 2HUEA 2A9BA 1GGUA 2Y5QA 1OL0A 4CBZA 3GRWL 5ACLA 4FN0A 5C0DA 1WFIA 4Q6KA 2CWRA 3G6JF 4GRMB 4OD3L 1CGXA 4F2EA 3S8GB 2L4OA 4EUPH 4BHUI 1D9KC 4G1EB 2ZUTA 3C5ZC 2NNAA 3PWLA 3VG0L 1ZHNA 2AAVA 3KLSA 1DSYA 2BDNL 2FJHB 3IPBA 4W6WB 4TQ8A 1Z9OA 3K71A 4LFHD 3H6AA 1MHEA 3ECBA 2ORBH 4ZDHA 1T04B 4APXA 1G1KA 4P59L 1RPKA 4OIAA 2I5YL 1W6WA 1FZJB 3EOBA 3P9LA 3HG1D 5ICUA 4WU7A 2H0EA 2KI6A 5KVDL 5IFAH 2AQRA 2YD6A 2VLJA 2GSIA 1CD1A 4DQOL 3MAWA 4DW2H 1Z3RA 3VFMB 3TZVB 4MJIA 5IBLD 3KYMA 2VXVH 2CDFA 2Y5TA 4N8UA 4KKLC 3E9UA 4WEEA 4YDVA 1V05A 3BIKB 5DD5L 1OK8A 1U8CA 3AADB 2ZAHA 2W59A 3V9FA 2YR3A 3GUFA 2UX7A 3HMXA 1FCCA 3KCWA 4LAJH 3LNIA 4RBPH 3UCQA 4KVCL 3TTSA 1FFPA 3IN0A 4XMXA 5T1MA 2YUVA 5IW1A 4QXTB 4I2XA 5KZCB 1GSKA 2KLRA 3QRGH 2IANA 3VD5A 2VM4A 4DP1X 1C5BL 1YEKL 4WW2A 3CDZB 1CXFA 1PD0A 2BVOB 2Y4SA 4H1LH 4F7CB 2YK1H 3SDXE 4YHOL 3QNYB 1D6VL 2Q7AA 3IF1B 3STLA 4XB3A 4TNVF 1PX3A 4EBQL 1D7FA 4XNMA 3BKML 4ZRGA 5HD8C 1ZVSB 3GI8L 1UD3A 1YNLL 3C09C 4Y7OC 4R7VA 1G5AA 2M26A 1IUZA 1BJMA 5T3XL 5CSZB 2QGBA 4KZEH 3BPNC 1AC0A 3RJQB 4F80A 1S3RA 4WI0A 2HT3C 3VRJA 4LASL 3QDHA 3QIUB 4XRCA 4DPBX 2EVFA 1ETZA 2OMBA 3APDA 3T0XA 4Z95L 5BMFH 2BVUA 1N59A 2BP3A 3BPCB 3MYJA 1DDHA 1BZOA 1AXSA 1P4LB 3ZRSA 4P3DA 3KLQA 1JGUH 1RIHH 4U1KA 2EABA 3U4AA 1KYDA 1TF4A 4S0HA 2HMID 3JSSA 5L4MA 3MOBL 4FJZA 2K3HA 5JIHA 1E8ZA 1AO7A 2XQYK 1ACCA 1BECA 1NBYA 2DI7A 3DX7B 1EJ6A 4JQVA 4K94H 3VI3F 5K9KB 2KERA 5E2WH 1SBBA 3SDYL 4Y2LA 3U2IA 5IMLA 2O72A 2PTVA 2VMDA 3WEOA 1YCSA 3WFZA 3FOLB 1HDMA 1BDYA 3VQMA 4I77L 3W9DB 3SCMA 2JIXA 3SPJA 1SHMA 1EAJA 2JI2A 5LCVL 1PCXA 2AXWA 5D7LA 5E24E 4RDQG 5HVWA 4Z78A 3MA9H 2J4WH 5FK9A 1ACYL 4U1HB 1GKEA 3CVHH 2QQQA 5I0VA 2JI3A 1NDGA 1ZE3H 3WY1A 1LILA 3Q3GA 3D18A 3TPUA 3B37A 1IT9H 3DX9B 4PGDA 2FGWL 2YMXH 1OK0A 5I66B 5E2VL 4WJG3 4CKQA 3SZ6A 5JW4Q 4Z7OB 2V5RA 3LKOB 3QP3A 4M1DL 4W9GC 4XMLH 5J11C 3D48R 3KL0A 3Q6FB 4HG4K 2IWGA 1TSHA 1J5IA 2J6EL 4YHYB 2ZCLH 3BZ4B 3JV4A 2P44B 2ZG1A 2HMIC 2BWQA 5EMYA 2FSDA 4HJ0C 4AVHA 5EU4A 5FA3A 1IGMH 4LHQB 1EHXA 1ZWIB 1EJFA 3BAEL 2GQHA 4ZW6A 1OTUC 4GRWH 2GCYA 5F88B 1G9MH 2PO6A 1HOCA 5DQDL 4WI7A 5E6IA 3KBEA 2FLRT 2X2HA 5DK0B 4I3SH 4R4BA 1MFAL 4X9IA 1ZLWH 4JKWA 1OXYA 2XUWA 3IAPA 4PGDB 3REVA 3BX7C 2M8XA 1EUTA 4HU2A 2BIMA 4G6ML 3B1UA 1GC1H 1U8NA 1KCSH 1VDGA 5DXWA 1HIMH 1JRHL 5D8JL 2IOOA 2VDRH 2HWZH 4R0LB 1M7IB 3FO0L 3BMVA 4KKQA 1UM5L 1CD8A 4NKMA 4BH7A 5DQ9A 3HPLB 5BQDA 1G5GA 1QR1A 2NY1D 2DYPD 2IPTL 4XWGL 3O9WA 4BXSV 4Z3TA 3FU8A 5GGUA 2XBDA 2MHAA 4NC1E 4XMVA 3O6LL 2R29L 1TSRA 3SBWA 1DQQA 1TQCC 4CSZA 3UC0H 3HCVB 1FFPB 3EH5B 3L1OL 1RJYA 3VH8B 1CLYL 8FABB 1WBYA 1AO7B 2IOIA 4UDUA 1DDHB 1P4LA 4K8RL 5G4NA 3BDYH 3O41A 4ZOAA 1XF3A 3NEXA 2B2XH 5EZOL 5KOVC 2CBPA 4F7EA 4YSQA 2I9TB 5E8PB 3LQZB 2AV1A 4LP5A 4Z0BL 3WJLA 4MAYA 4XMTA 4WU5A 4AIXA 5ESAB 1MCBA 1S7TA 4V1DA 4L3EE 5GS3A 2VSDA 3OHXC 2BSTA 2VLJB 4TUJA 3IXTA 2AITA 1N7MH 3PP3K 1XSKA 2IQ9H 2JF1A 3P2TA 5KBNC 2HG0A 1FIGL 4NUMA 1R9FA 4F8LA 1DQDH 4PU2A 4EQ2A 3ARSA 1ZLUH 4PV9A 4XGZA 4MA8H 1W0VB 1NCBH 1E4KC 4Q4EA 4BH8B 4OI7A 4UQAA 1JTTA 7FABH 3JWOC 2V5MA 1Q90A 2WO2B 1EHAA 3NZHL 4UTAL 1OAYL 1YNTA 1CVSC 4NXSA 2UUDK 2N56A 4XCEB 3HUJE 2QVMA 2CUAA 4LLMA 3AC0A 1TVBA 4ZQKB 4R8WL 5TGBB 1EMTH 5SWZE 4QUOA 4FXGA 4GJTB 5HGDA 4RWYH 2BRRH 5EZJA 2WMPB 4LNRB 1TCMA 4FLHA 4JE0A 5FM5O 5K9QI 4K3EH 3WU1A 4MJIB 1KJMB 4QNPF 1XR9B 5DHDA 5I0XA 2NT1A 2B5IC 2CDFB 1NUFA 3ARZA 3EOYG 4P2CG 2FD6L 3C2SA 2IALA 1C8PA 3V4UH 2APWA 1NGQH 5F70A 1K8IB 4G6AC 2YRPA 3OJ2C 1U93A 3RGVA 4JVWA 4U6HB 3FTYA 3NPSB 4NZDA 5ALCH 4JFTA 4W4NA 3QFJD 3WEBA 4DKDC 1M6OB 3L3DB 1FH2A 2AEQL 4Y4HB 2ENPA 3ULVL 2ZWKA 1Z5YD 4Y1AB 3ZBMA 2YPKA 2WNXA 2HYMA 5CD3B 3O9WC 4R97C 4IKJA 1OZTG 2AJUL 4TUOB 2OSYA 5FGRA 1WZLA 4PRPA 2EEAA 3ECBB 5JW4R 5FUCC 4QCIA 3DVNA 3DOSA 3HZKB 4P2RA 5CEZH 3I2CL 5T3ZE 3MV9E 4AV4A 2BNUA 3AUVA 2DL9A 3Q48A 1UM6H 3FF7A 1LEKA 1A4JB 2IPUG 2D7QA 4H8WH 3LB6C 2G75B 3LJ3A 4JO1L 1Y6MR 4LZKA 4WNSA 1ILUA 4K2UL 5ETUB 5F7MC 5JLZB 4OCSL 3S0PA 1OY3B 3VFTB 1MQ8A 4PJXB 1BQRA 4KHXH 4R2GC 3WJMA 4MNGE 3BISA 2Y36L 4MNQE 3SO3C 2C26A 2R1WA 2X6AA 3B6SA 3VGBA 4OCRL 3MRPA 3OGCA 4MQ7B 3WL9B 4BK5A 2X4PA 4UV7H 5DVKA 1GPOH 5IVOA 4N8CL 2FUQA 4ONFH 1XAKA 1QI5A 2YEZA 5E9DB 3NBNA 3MLZH 5C0GA 4BFEA 4YBHA 5M7QA 4MA7L 5DD5H 4GKSA 5HHMB 2VMEA 2KKQA 2JLPA 2X7LA 1A1MA 3HS9A 4I18A 4OD1H 1UEMA 4LKCA 4UM9A 1WCQA 5FECA 5IUSA 1IZKA 3EZJB 2EC8A 3HRZC 3VWKC 1DN2A 3CVHL 1WWAX 2IDQA 3FO2A 2VWEE 4UQBA 3BH9B 5EA0H 2WINA 3DC0A 5KSBE 2FJFA 4HQQL 1AP2A 2P5EB 25C8H 5IEKA 4R96B 4ANXA 1IBFA 3VFOA 2DWEB 4YHOH 3SDCB 1NIDA 2FHCA 3PABB 3ZZQA 1FO0L 2XWTA 1PJ9A 1MFVA 2WXHA 4P2OB 5DHVA 5HHQA 2HKAA 3NCMA 5BV7H 3GNMH 5EC1A 4N22A 2P24B 3X14B 1S7QB 2F53E 3SCMC 2PCPB 2RMNA 3G5XB 4UOW0 4WFGE 3MC0A 2ITCB 4NP4L 1L7IL 2Y6SD 1BLNB 4W4OA 1AY1H 4P5TD 2JXMB 1P2CB 2P8PB 5DI8B 1RI8A 3PJNA 1OB0A 1RSYA 4AL8H 2FO4B 3B9DA 3ROOB 3I75A 3TYGH 3RGBA 1MCEA 3L7FB 2J8UF 4POZC 4DT2A 2EUWA 1F13A 4JJ5A 4X6FA 3QC5X 3GO1L 3MVSA 1QOKA 3G5XA 3PF2A 5DD0H 3KWWB 3FN0H 2BFGA 5C0EA 1R47A 5AW5B 4HIXL 5LBSH 3RWIA 4F7TB 2L7UA 5MHSE 3UDWA 5FW8A 3ZTEA 3GMNA 1PYWB 3S4SB 5L8LB 4A7SA 5KN5B 4CBPA 1DTUA 2X6VA 3QIBC 4YIQB 3V0FA 4J3OH 4QRQA 1MQKH 5DJ8A 2WLZA 3QJXA 4EDWL 1MJ7H 2FEJA 4UOW1 5FW7A 3F58H 2X3CA 3SKNB 4ZX6A 5LWYH 2E9JA 2EDBA 4QHKI 5J5EA 2E74C 3PXHA 2R0WH 3MSPA 2RTTA 2NY0C 4HMCA 5C0EB 2UXTA 1V7NL 4X4KA 5B22A 6FABH 4PRIE 3RWIB 3SGKA 3LXUX 2R2CA 1R5VB 4AITA 3L5XL 2DLFH 4NJAH 1U3HD 1MJUL 1MCIA 1S8DB 3M17B 5KYYA 4N24A 4XXCA 1LXMA 3VXOB 3MO1B 3KL5A 4LO9A 4N2HA 4R5TA 3HG1E 1JTOA 4KJWC 1ZGLM 2ZYHA 3MCKB 3VMNA 1I9IL 4PJ8B 1FZMB 4XNAA 4OAWB 3CCHB 2QV4A 1JWUB 2VWEC 2J1ZA 3GSNL 3CH8A 2W60B 2VXQH 2HPOA 3LNFA 3PY9A 4GLRI 4M8VA 4PLJD 2RH0A 5A2FA 1G4RA 2X4RB 5HXMA 1OAXL 2RR3A 4FP8L 4L4VB 2A9CA 2EDEA 2DWEA 5J3HD 4TF4A 1PJWA 1ZEAH 4MKMA 5EUKA 3BH9A 4XBMA 3MGOA 1J05A 3QCVL 1IEAA 4PJIA 3TV3L 1JZGA 5DGRA 1QHOA 5CFHA 3DTUB 2RB8A 3RVTD 3Q05A 3K72A 4WI3A 1J8HA 2DJUA 4JDEA 4L3EA 3TCLB 3O4OC 3DRTA 4WO4A 4KC3B 1XL6A 3VB9A 3C09B 4ABQA 1UCBH 3QDGE 2FGWH 1IM9B 1QVOB 1JDAA 1KXVA 4J3BA 3MZTA 2W88A 3E1F1 1T22A 4P4KB 3BHBB 4ZFQA 4TQIA 2V2XA 1NOLA 1TENA 4DVBA 5JOPD 3LCYA 4JB9L 3D3VD 3P54A 5D2NB 4Z0BH 1GCYA 5F3FA 5A16B 2XIIA 4LIQH 1AR1D 2Z91B 3D69A 3EBGA 5TQ2H 1QYGH 3QQNA 5L9DH 3EXLA 1R19A 1BYPA 1AZRA 3I75B 3T8XA 2VUKA 1MI5A 4KO9A 4MXWH 3MOQA 4K3DH 1T1YA 3WHXB 4UDTA 4RMQA 4OB5L 2X4SB 4CMHB 2W0LA 1I85C 2IAMB 4YL4A 5HPMB 1HCYA 5AAMC 2CHZA 4JQVC 1WFOA 4JO3H 2ESVE 3BEWB 1IAIH 4LOUD 3VAEA 4NC1C 3WMPA 4OV5A 1N0LB 2X6CA 4RAVB 1PGRB 2H3KA 5GS0D 1DJSA 1J5OL 1MH5A 5KAQG 3QUYD 5AD0B 2F9BT 1IMHC 2I25N 3SYAA 3ZDWA 4DN3L 4EDWH 3ZE2F 4OZHA 3S5LG 3G9VA 3RWHB 2NZIA 3FT2A 3FT4A 4IOSA 5DR5L 5FCUH 5DZOA 1VFOA 2IF7A 1U93B 2WYIA 1OLZA 1M2OA 4XNUH 2A7BA 2Y5EA 5TDOB 3S35X 4JO2H 4DEPC 1SN2A 2AJVH 2NQCA 1SMOA 5FUCE 3VD9A 5MERB 2ZUVA 3DROB 3DX3A 5A2JH 3CK0H 5FYLE 4DEPB 2I9TA 1YA5A 3GO1H 4PRPE 3C5ZB 4FI6A 1DSFH 4LNRA 4PHXA 4P2RE 5ITFA 4HIIA 2ZKHH 3T0VA 2VABA 5JDJA 4TSAL 2G5UA 5BCAA 5I16A 1J1XH 3US0A 4UT6A 1TQSA 2IXQB 4MB3A 5I71B 4L8DB 5C0BD 1SF5A 1JUFB 3DGGB 1YY9D 4JFQB 5FYKH 1Z9LA 4I87A 1DANU 3O0RL 1JPGA 1HAWA 2DQGH 5GS0L 1TITA 1SJHB 1ZA6A 2WAHA 5BRPA 3E2HB 4FNUA 5CU5A 4YS4A 2WC7A 4PGCA 2X1XR 5DK3A 5EU7E 3NFPA 2VR3A 1YAIA 4YHIA 1I82A 3HLAB 1EZLA 3X17A 1F3RB 3GBEA 4XVUC 3ARGD 3GSNA 4OBSA 1NAMB 3ULVD 4GRWE 4L4VD 2YAOA 3FT1A 3CAFA 2BSED 2Q76A 4LBAA 1NCOA 2H2SC 3ESMA 2EAEA 3MLSH 3FUHA 1JZ8A 3FFCE 4LFHG 1G7JA 4HV8A 5E1GA 4QT5A 5GRVL 3P77B 4BFFA 4L3FA 5DUPL 4ZO8A 4JQIH 1FVDB 1CXEA 4JPWL 3PWPE 4U4IA 1WFMA 2XI9A 4EJ1C 1CDUA 3K0WA 4FQXC 1MLBB 1XZ0A 3JZYA 4I77H 1OHQA 2XXGA 5HI5D 1J9QA 1J0IA 1KJ2L 4PS3A 1S9YB 1TIUA 2AK4E 1KGXA 1GOHA 3UZEA 2GUOB 4AC4A 4LRIC 4E41A 4JM2A 5IB3A 3ABZA 5D7HA 3FDWA 3P3TA 1WGOA 1U8HB 3HG2A 2J8HA 3RTQB 3NJMA 2CM5A 4QLWA 2YPVA 1OGTA 3ZTJH 4UU9A 4PCKA 1JAEA 1KLUB 4F92B 3L1GA 3ZO0A 4RRPG 1TZOA 1B88A 3LPOA 1M7IA 1BEYH 1GW0A 3RKDD 4FADA 1OAZH 4AIZA 1MWAB 4TVPH 2ZOOA 5JORB 1KFAL 3Q5YA 4IJTA 2M83A 1Y1DA 4OD2A 3VRIB 3N42F 2LLGA 3RX9A 2XNAA 4YBLC 4G9FA 1AAJA 3NIFE 3RI5F 2VCOA 3OKKA 5EO0B 5FCSH 3HRPA 3TYFA 4EBQH 4GT0A 4GEIA 1TPXC 4XMZA 3FPXA 2OXHB 2ZOTA 4N9GA 5FGSA 4Y4KC 5C0AB 2N4IA 4OCYH 3RWEB 3OKNA 3UABA 3TJPA 2ZKHL 3VXUA 3ZE0E 2UXGA 5ADPH 1Q0XH 4FZ8L 2OR8A 2GCYB 4GS7C 4NAMA 4WWID 1R33A 1IFHL 3CFJA 3MRKB 1AQKH 5GJSL 3DJZA 3GJEA 2A6DB 4NHUA 2EKSA 1S3KL 5KUKA 4G72B 2VXTH 1P7KB 1AGCB 3TYFB 4IRJA 3D18B 5CEXB 4WI0B 3VRJB 2QVKA 3PHOB 1BHGA 1EJOL 4AWJC 3MCLL 2H0PA 3QYCA 2XTJB 4Y8AA 2WUCH 1KYAA 3B83A 4ELDA 2DBLL 4PWIA 4DP8X 4NQEA 5KVEH 2DAVA 5C0CE 1YQ2A 3ZVVA 4WJ5A 4G9FB 4HPHA 2BSBA 3Q6FA 3BXNA 4JLRB 3T4AA 2XX0A 4HGKC 4KKCC 4D3CL 2ODIA 3GBMH 3TBCA 2Q3ZA 3P1VA 4FGMA 2RCSL 2XWXA 5I0YA 4N0CC 4S0TD 3B3IB 1ZGLA 1CR9H 2GEEA 3LX9A 1EV2E 3C08L 1RY7B 4HOXA 4G80A 3UTSB 5JNYA 1T2QL 3QEQE 1KG0B 2F53B 4XO4A 4V1DD 5CJQH 1OV8A 1RZ7H 3VCLA 4TSBH 4XPAL 4CC0A 1FBIL 2WO3B 4J3OC 4JHVA 4YHMH 3L2MA 3R06A 1C9SA 2XLLA 4FFVD 1XZWA 5FB8A 1R3HA 4IRSC 3OKMA 1P7QB 1FORH 3QQDA 3ZYZA 3UJJH 2J88H 3DMMA 4A38A 4GT7A 3T0EB 2EVGA 3H0TB 1T0NA 5BVJA 2V8MA 2MQGA 3LZLA 3CSYA 1VCBC 5K59F 3CSBA 1WBXA 5EF3A 1QFWH 2VXQA 2G3ZA 4M7ZC 5IVZB 5F6HJ 3ECQA 2IVFC 1T3FB 4AZ8B 3DO7A 3D08A 3LKQA 4G2AA 4PGBB 5ISZB 3T0ED 3B9AA 3C5ZD 1N67A 2K70A 4N6RB 4YUEL 1JNHB 1MCCA 2ZP9A 4QJ4B 2Y72A 5LBGA 1EGJH 5HDBF 1IGTB 4NUPA 3ZYJA 4HLJA 4EKXA 2VXUH 5J6HA 4WGVB 1A3ZA 2Y7QA 2DEXX 1UD6A 2HLFD 2PCXA 4OLVL 4NN7B 3VD2A 4CMHC 2WWOA 1BFSA 5D7EA 4CUCA 2ZCLL 4IMLB 3TA3D 3V6ZB 4G8GE 3UJIH 1ZT7B 3HC0A 4Q9RH 1VADB 3GZOA 1CJYA 12E8L 1AG6A 2Q20A 1QEWB 1EDYA 5E00A 4OZHE 3IPFA 4Y19B 3MNVA 1BV8A 1FFTB 3KPSB 1FJ1A 4KK8D 4AJWA 1YMMD 2Q86B 1HTYA 2EDHA 3KXFE 4EXPX 2BINA 4PBXA 1AD9B 1VACA 3H6JA 1RLBA 2XSKA 4KY1H 3T3MB 3VFMA 3W0WA 2A2QT 4HS6A 1WWWX 1NICA 2I27N 1ZLVH 3FHAA 3NCJH 1UZ8B 5D7SH 3WXVH 1HKLH 1BPVA 2ZPKL 2EYSA 3QDJB 3FU5A 1JGIA 2MOQA 4AIEA 2VLLB 3EH3B 4DPCX 3QCUL 5B1AB 1X7QB 4Q89A 3V5HB 4M8QA 5K9JL 3C8DA 3AWEA 1MJJA 4L8SB 5CAYB 4GO9A 2OZNA 3MMEA 3RWHA 4J3WA 4OCXH 3MFGB 3RA7H 4X5RA 4EAEA 3N41B 5IQOA 5D1XB 3NFPB 2HRHA 2XA8H 3DUUB 5EU6A 5CIPA 2OQJA 2P26A 1WICA 1D5IH 4NCC1 3I02B 3QGVA 1CK0L 1ZA6B 5EU6D 4GBXA 4ONFL 3OJDA 4PRHD 1KPVA 4HS8H 4AI7A 5B7FA 1A65A 2E7LC 1EX0A 4ORGA 5B3NA 3F05A 5CCKL 3U0TB 2DV6A 2UWEA 2ZWYA 2X70B 3FNKA 4RFNB 4EIUA 1ZTXH 3IFPB 1LP9A 2G60L 1M53A 3HRZA 4IOSD 5F9JA 1VPOL 2DL2A 3BKMH 3KH4A 2BK8A 4AUYA 1AXTH 1XGPB 2CGZA 2X4OA 4PPTA 3HN8A 3I9GH 4IHOA 2B3RA 2WNWA 5DRZA 4IBWA 2QDWA 3D5OF 5BQ7B 2GHZA 3FH5A 4KGJA 5B1JC 1HILA 1DBAH 2ZQKA 3T2NL 2FQDA 3H1ZA 5F7LB 4HUVB 1A9VA 1MFDL 5G55A 2COQA 1RUAL 4HUNB 4PEEA 1UQSA 3S5YA 1CGVA 1NCWH 3RQ3A 4H2CA 1E3ZA 4DEUA 3LEYH 1J0ZA 4TVUA 1UWEH 3BP6B 3EFDH 5DC0A 4YPJA 4FQ2L 4WHYG 3P73A 3U1SH 1ZRUA 4X0NA 1GTNA 2FJHA 3EBAA 1FLTX 4X4XA 1IGJA 1K3ZA 3CCHA 4KH2A 1EZUA 3SE4A 4NPYA 3SE8L 3SN6N 3B9VA 1JWMB 2H45A 3MCYA 3POHA 4PJAE 4XNZC 5D5MF 5I19L 3D3VA 5KSBF 2D9QB 3D51A 4UINH 3AFLA 5TF1L 3HZYA 2XVGA 5HJ3B 2O6FA 2E27H 2P49B 4PY8J 1K6QL 3HEIB 1NCGA 2A73A 1UXLA 3NIDF 4GSQA 3NSYA 4QHLB 1MW1A 5ERWB 3L6FA 4K7FA 4HK0B 1MFBH 1KEGH 3MTRA 4NZRH 1IGYA 2VQUA 4EDXA 2Z91A 2YLHA 3K6DA 4XCFL 1J9CT 2VDPH 2AK1L 4X5PA 4GIAA 1KEML 1NGXA 3WTXA 2A38A 3QUXC 4FD0A 4Z7WE 2DICA 5MI0B 1KGWA 1IRAY 5IFJB 2PNDA 2XCMC 3GJFK 3WFCH 4R2GD 4OF3A 3SE6A 4DQOH 3C8HA 3QPXL 3VM5A 5D7LE 3AITA 2NW3A 3BGFC 4F3FA 1X9LA 2AI0L 4KKBC 1RUKH 1QEXA 4JFYA 4CN6A 5DJ8B 4S1SH 4CNIA 4YR6A 3BPLC 4QRSA 2YO3A 5DA0B 2FHFA 3BZFB 4IU3A 3T2OA 3A24A 5I76A 1TZ8A 3BVWA 4PBVC 3MOBH 3QFJB 1SHSA 1GZQA 1MKFA 1M4KA 4ETQB 4WI9A 2ZUXA 2CRIA 3KPTA 1E4KA 2XWBB 4NQEE 4MS8C 5EIQA 2P8MA 1BQ5A 5IFJA 2YXVA 3S2CA 4FLSA 1F6AA 4P9HC 1QRNB 1A2YA 3P2DA 4P59H 1G6VK 4F1ZA 1OD9A 3TJHC 2EUVA 1ZVNA 4FFYH 3ZZ1A 2A73B 3VGAB 4M62H 2W65B 4G6FB 3O6LH 4IMKC 2GSGB 5JA9A 2EIZB 4AYBA 3MU3A 3QZOA 1CL7L 2HJLB 5AZ2L 1QW8A 5J1TC 4F93B 2YKLL 4YHNA 3X11A 1L5GB 4E9XA 4LVNC 4UZSA 3OSKA 3SDXF 3TA3C 3EG9B 1SN0A 3MUGA 4AOFA 2BIOA 2F53D 3NSDA 5C07B 3GK8H 4JO4L 1G7MA 3LMJH 3EOAA 2R15A 3G7TA 1V3LA 3THMH 3CHPA 4MCYA 1EFXA 3TIDB 4MYPA 4RWYL 4QR7A 4Z5RB 1IC5L 4FDWA 1SXAA 4ZMZA 2BS9A 2YD3A 3JT0A 1S9XB 3V6OC 4X5LA 3L2NA 4I0PC 3F3HA 4BQBA 4J7RA 2AK4B 1DLFH 2BH0A 3ARWA 2YUXA 1K8DB 2ZKWA 1JK9B 3ZKSD 4XNDA 3W9EB 3NIFB 5FXCH 5SWQA 2EDKA 4JFEA 2XVLA 3WLWC 4RIRA 4NFCA 3ZDXF 1AZZC 3ARRA 1WTLA 2EH7H 1A22B 3ARQA 3QORC 1SVBA 1X44A 4FC3E 4E9YA 1LO3L 5F9WC 2GW5A 4G83A 3CBKB 4YGVA 2BXZA 5LXVA 2IQ9L 4BKTC 3U0WH 4QXVA 2ZX8A 4M1DH 4R84A 4ZOCA 1WIOA 2QDVA 2FGZA 4PJCA 1X4XA 3Q1SH 4LK4A 5E2VH 4FF9A 1QAWA 2VLKB 2W5PA 4WHCA 4XP6L 3DUUA 5EU6B 1GZPB 3WNNA 1QA9A 1BD2D 2J6EH 5LN4A 3O3DB 4RX4A 1PPIA 3MLTA 2BNUB 4N2FA 3U4BH 5KVGE 2PLTA 3QAQA 3SQRA 4DGUA 1HYSD 2ZG2A 2LVCA 2VL5A 1S46A 2GIYA 5I1GL 3PG2A 3VXTB 1E8WA 4FABL 3OB0K 5GGTA 5DJYB 4JE4B 1H15B 4UZGA 4FMKA 3WNLA 4TVSa 2EE6A 5C09B 2ZNXA 3W0WE 3W11D 5DRZB 1FPTL 4J39A 2CAKA 5SV3A 3QIWA 4NQCB 2EDFA 4JREC 5EV7A 1RZKL 1S78D 3Q43A 1E40A 3KYKH 2WWNA 4PD4J 2N7AA 3NJVA 4L8SC 1Q9LB 1JDDA 1SJEA 5EA0L 2AEOA 4FFWD 1ZVYA 4JCLA 1UCBL 1DEEB 1NGZA 4F9PC 1HFUA 3EW3B 3C12A 4UT6L 4X6BB 4DKAA 4X5XB 1O0VA 2DM4A 4MB5A 3BVXA 4L1HA 3ILQC 2NUPA 4FFZL 1YNLH 3ZIYA 1FNSH 3VXQB 4FXKC 5ESQA 4N3UA 2Q7YA 1FRGL 4XX1E 2C3XA 4FQ2H 4W9KC 3CG8A 3HAEH 1RL1A 3UP6A 4O02H 4QYOB 1UGNA 3QNZA 4B60A 1AGFB 5J6HB 3HE7A 1Q94B 4X6CF 5EZIL 3WEAA 5JW4M 3D39E 3V5HA 4KHXL 4HVBA 3MNZB 5C0NC 2RAMA 2XTLA 4W6YB 3RVUC 4CW1A 2YPVL 3A22A 1KXTB 4CADA 2KL6A 4HPOH 2FH8A 2DIJA 3HPJA 4OTXH 1OPGL 1EAPA 3U1QA 1OTUD 1WBXB 1UH4A 2BWDA 3P0VL 5A2BA 2SODB 4UOZA 3M88A 3CHSA 2AXFA 3CZEA 3UIYA 1EIBA 1SLUA 2VDPL 3F8UB 1G7LA 1USZA 1SY6A 1LDSA 2Y2YA 2A4EA 5JHBA 4G6KL 1A1NA 3OWRA 4BWWA 1WVZA 1BMWA 4PY7B 1F18A 3DA0A 1FFQA 1YMHB 5A2AA 1YAZA 3LNHA 3KWTA 3OX8B 3DYMA 3VCLB 4N0UE 4PCYA 4QHMA 1UOLA 1QLRA 3L1FA 1RULL 4O2FB 4UM8A 3GYRA 5L0QC 3BN9C 1AD0A 1RU9L 1GYCA 1DVQA 4HHGA 3BP7B 3SGDI 5JW4N 5HGBA 5HYQB 3ARYA 3IPEA 2PR4L 3RY6C 3H7BB 2K0RA 4KKCD 1P0SE 1XWVA 2NY6D 4BQCA 1TQWA 4KX8A 2GB2A 3IFOA 4M4PA 3L3OC 5AL0A 5IK3B 5DFTA 5DZVA 4UV7L 4YE0A 1CBVH 4FLOA 4F57L 1ZLSH 2YD4A 4JFOB 5DHMC 4HLZG 1I8UA 4FG0A 5T3XD 3NJJA 1DBJH 3H2WA 2HT4D 5J12C 5DK0A 1IFRA 5A6IA 1SXBA 4RNRB 1OANA 1KNOA 4BYHA 3REVB 5L7XL 3QJHA 5CJ8A 2IH8A 1NKGA 5IHUH 3S36L 4QJ3B 1B4JL 4Z7OE 1WHPA 1H3WM 1I7ZB 4JAMA 1BAFH 3V95A 1SN5A 3O4OB 5CEZL 5FB8B 1R0AH 3DX8A 4MAUL 3WEXA 4CL7A 3LNGA 1ZTXL 5SWSA 5ABZA 3N6YA 1LDPH 3U2SB 1E27A 1TVDA 3AQZA 3BZ4A 3ULVC 5KG9A 1M6UA 5KJ4A 5F0JB 4BV1A 1F4XL 4GUPB 1F4WL 4AKOA 3FB8A 3B9KD 3PRZA 1D5XA 3VFRB 1O9WA 2EVJA 1KDJA 2P5WB 1BVLA 1M7XA 4HS8L 3GMLA 5I1GH 5I1CL 5I26A 4RWHA 5BO1L 5E6UB 1PZCA 3ABGA 1JMXA 3P0GB 5JA8B 5D7LB 3IT8D 3B3IA 2ZOWA 3TWCH 5E6ID 1A7PH 3C60C 4LLYB 4H7VA 5I5RA 4KKNA 1CGWA 2Q2EB 4FA8A 4S1SL 5BXFB 5FX3A 2J8UB 3K4AA 5HBBA 2XPYA 2L7QA 2ZSVB 4M5YL 3WIFB 1GIGH 2BVQB 3GMLB 3KW8A 5DUML 1J1OH 1I1FA 5IB3B 4WEMB 3UJTH 4N8VG 4HCRA 3OKLB 4IRJB 5CEXA 5JPNA 3OF6D 1IJ9A 3EDFA 2AQNA 1JL8A 1NINA 2FBRA 2FWUA 2FATH 1M9WA 1WJ3A 2DWDB 3GJEB 3NSXA 3PWJA 4LRIA 4ODUB 5E6IB 2ICEC 4NQEB 5BVPH 4EUPB 3UAJD 3MNDA 3NJNA 1AGCA 4PY7A 1KN4H 1P4UA 4PJ9D 2R51A 3F64A 3KR3H 3ZL2A 2ENSA 2V3DA 1AO7E 3VXSB 4CMMB 1NBYB 1EEYA 2XJKA 5D1QB 3FQXA 3MXVH 1ZWIA 2R8SL 2D7TH 4KROC 1U21A 1LL1A 4LSDA 2WVUA 4JM2D 4LL4A 3TV3H 4N2DA 2QPUA 4J28A 4LL1A 4OD3H 2GKIA 4UINL 3CH1A 2YMOA 3QXUA 5GRJH 3IFOB 4FA7B 4PRDB 1SOSA 3EFOA 2DH2A 5C3LD 4AT6A 4U7SA 2WXKA 3U30B 4TPRL 4QHPA 4XPGH 4P5TB 4AE1A 2DLFL 4NJAL 3U0PB 1ITCA 4IDLA 3MUZ1 1WFJA 4NC0B 4M7JL 1J8HE 3T3PE 1AO7D 3MREA 2AP2A 1NPUA 4TNWK 1I1AC 1ADQH 2BVOA 5F1IA 1MXDA 1MWAA 2UWEF 3TOPA 1UKSA 5GIRA 2JKJA 4CJ1A 3STLB 5C9JB 4MMZA 2NY2B 1IGFL 1EBAA 2YFNA 4DF9A 4NI6A 3JWDH 2K9FB 1EHLH 2OA9A 1J9RA 3E6FB 1C5DB 4J8RA 5CCGE 2H1XA 4NQSB 3S34L 4NM4L 2MSPA 5D4IA 4B9PA 3N85H 1RZGB 2B1OA 1Z3GL 4FQQA 4XMKL 3NACH 3AU1A 3SCMB 3SDAC 3Q13A 2DKMA 3B2VL 2FJSA 3EJSA 3LSOB 2E9WA 3FN3A 5TTRA 1A8ZA 3T65B 3CVHA 3BUYB 2EP6A 1HQRA 4X5QA 1JV5A 4G43A 4MD0A 2PYEB 4L3AA 4DKEH 1FZKB 3L4TA 4RH4A 3W11C 5AVWB 1QSFE 3T4YB 4AH2A 3MYJB 2H6PB 3F65A 4M7KH 4YLBA 2WXOA 3VI3E 5IZ7A 3KPMB 4ENED 4LPVA 2Q1EA 4HS3A 3P9LB 4YFLI 5ADOH 3CZLA 2R1XB 5E2UL 5J8OA 2EXSA 1NC2A 2ESVA 3SSGA 2BNQB 3QWOA 3KDPB 1OARH 3FZUD 3LQMA 4O5LH 3IBOA 3RGVD 4OZGA 4WV1A 3BWUC 2NY2C 3K71B 3ATEA 3GXUB 4FG6C 4PJ9C 2ZXCA 1CR9L 2EDTA 1MAJA 2J6WA 4LIQL 4OLYH 2MEJB 4OUOA 4UQ2B 2OMTB 3RP1A 4APXB 5BRZE 5LG1A 2Q7YB 3IDIA 1P1VA 4M43H 2CIIB 1FZJA 3EOBB 5DD0L 8PAZA 2WTPA 2O5ZH 3LRMA 4A7UA 3CLEL 4DCQA 2NSQA 1FBIH 5JIDA 3KYNB 1UVQB 4IKLA 2VQTA 1UD5A 3TJHD 3VMOA 2LABA 2JV6A 2FIKA 5GS2H 3JYBA 1MAMH 2EADA 4HXBH 4QHMB 1CXKA 3R7RA 5BRZD 3SBRA 3QCVH 4Q9CA 1GGIH 3HR5B 1IQWL 4GB9A 2YD8A 4BIKA 2D03H 5SWSD 3GMOA 4KQ0A 5CZVH 3QUYA 1JXJA 2HLEB 3WS3B 2A9NL 2YRLA 1DBBL 1ACYH 2WCPA 1RULH 1XGUB 3NRPA 4G42A 5F3HB 1TZAA 1QHQA 5AB9A 5F89B 4WFHE 1CICB 4PRBB 4X7DC 4BSJA 4F91B 4ANKA 1KBGH 5KAQF 3QDJE 2WQUA 1OOWA 4GEJA 1UADC 4HZ1A 2EDXA 4JZNB 2C9SA 1R5IA 4AV0A 4OZHB 2AQSA 2FZ3B 4PVLA 3FT4B 1OT2A 4L18A 2YEVB 3KPSE 4NWUL 4H5SA 2ZD0A 5KYNA 5DHEA 2FAUA 3PL6D 3H55A 3KEDA 3L3GA 1QO3B 1KZQA 5BRZB 3K46A 3RX5A 2UY7B 2Q8BH 2FX8H 4FQJH 4D8PA 4G71B 5LNDA 1Z3GH 1AZVA 1GYVA 4FLRA 1TQBC 3OLDA 3MACL 1FDLL 3JBG7 4DN4L 2I5YH 3MJ7A 3RTQD 1T5KA 3B2MA 3T8XB 4PJ6A 3BUQA 2X2YA 4RMVA 3LZRA 1AZNA 2EH8H 2ZXBA 3FB6A 1GY2A 4UDTB 4A67A 5IWLA 2BSSA 1J1PH 3N40F 3OAWA 4WF7A 1S9WA 5CKGA 3RRQA 3UX9B 5DC4B 2PCYA 4YLQT 3BSZH 1NCCL 4F20A 1F4WH 4TNGA 3DVFA 2GJ6D 2QSCH 4WKZA 2EDYA 4X9GA 3FTWA 3MGAA 4F8OA 3B34A 2EIBA 2JSFA 4M7LH 1B2WH 3JVGA 1OCRB 2DKUA 3VXMD 1UOKA 2H32H 1KLGA 1ET8A 1BVNP 1UJ3A 2X9ZA 3OHMB 4K0OA 4JZOB 4KJYB 3N1MC 4F27A 4ZFGL 3NJXA 4HXAH 5IIEB 4BKSC 1BQUA 4P23D 3A4DA 4XPTH 3WTVA 1U8JB 3OHXB 1DVUA 1Y18A 4P4KA 4UNIA 3SOBL 4EI0A 3RWGA 3RB7A 1T0MB 5CP7B 3KJ6H 1CICC 4E9WA 2OCJA 5SWSE 1AGEA 2E8ZA 4LLQA 4QXGL 1KENL 4Y4FC 1C5BH 3C6LC 1U30A 3MOAL 1T66D 1OPOA 1YC7A 2XKNB 1D5MB 3FU6A 4LKXA 3V52L 5BJTA 1CUOA 5EOCJ 4J4PC 3ZKMD 1H9DA 4G9FE 1HYSC 1H6FA 2AJUH 2NY0B 3WO4B 1HWGB 3PIQA 3Q0HA 5DLML 1N12A 2CGYA 2V7HB 4RMTA 4G1MA 4LDCA 1V7MH 4FNSA 1KWGA 1YEJL 2I32A 4F2MA 5ITBH 4FLQA 2X42A 3PIQB 5EOQL 1S8DA 3MV7E 1ZHBA 2F08A 4MJ5B 4PREA 3TN0B 4E42B 1NOAA 4CN4A 1KTLA 4LF3A 4JKKA 4PW4A 1GZQB 4HK3J 1UH3A 4F58H 2AJVL 4RIRB 1TTUA 2CALA 2R2BB 1D5MA 1MCQA 1LTXA 1SDDA 4ZPVA 2K6ZA 5DHVB 2YRBA 2LAGB 1FN4A 4P2YA 1MW2A 1NDTA 2P5PA 5AKVA 5EC1B 1LO0L 1BAGA 1LEGA 2PYFB 2AERT 2RQEA 1MDTA 1T7WA 4PV8B 3V55A 4HGMA 2F5AL 1NMAL 2Y06L 5LBSA 3CLEH 1KB5A 3RHWF 4AQ1A 3KPRB 4WI6A 1KY7A 4HFUH 4F15B 3OHXA 1KBWA 2BDNH 1SVCP 1H3TA 2ZXEB 3DX6A 3HG4A 2P5ED 3FQRA 4KK8C 2OI9B 3MLUL 4J27A 4L29A 3CVIH 1PNDA 4OIBA 5FHBL 2BVYA 2VTFA 3RVXC 1KCBA 3RIFF 1WT5C 3IJSA 3LZPA 4A6YA 1GH7A 4YSOA 1NAKL 4IRZL 2RFXB 3QUGA 1AC6A 1RMFL 1ZDSA 4D7PA 4PWEA 3EKCA 5F8QC 3NH7L 2FQGA 3TN0D 2JJVA 4F7KA 4YDJB 3EJTA 1Y6NR 2YQ3A 5I18L 5DHVH 2X2UA 4I9WE 3D3VB 1ID2A 1UWXH 2XZCH 5AYTA 1BMGA 6FABL 5JTWA 5FA4B 3SCMD 2LAAA 3WGVB 3EJZD 1LO5A 1A9BA 3ETBJ 3BSHA 1AFVL 4K3HA 2RD0A 4HD5A 4X98B 4Y9GA 4H20H 4UIMB 4QRUA 4NKDB 4O51B 4A2DA 3EUDA 5IGXL 1JNJA 3DVIA 4KJQC 2G9HA 1N6QH 3BSZA 2XWDA 3ARBB 2QMKA 5JIPA 5FYLL 3ULUC 3L7EA 4P06A 1JV2A 3HB3C 3H9SB 2HXAA 1TT6A 4X5WB 3UTQA 4PRPB 5DQDH 2VRKA 2DLEA 4LHUG 3NMEA 4OFDA 4LLQB 2BOCB 5GS1B 3WTSA 4Y5XA 4OFVA 4G6AD 1KELL 1RZ8A 4JFFE 1I3UA 3UTTE 4JR9H 4MASA 3FT3A 3EXJA 1XIWD 5T1LA 1IEHA 1IILE 1JG9A 4KO5A 5I9QC 2OULB 4PJDB 3OAUL 2E75C 1NGYB 3Q8FA 2QQNH 2ZTBA 3DWTA 3HNTL 3L3HB 2BZDA 5ESVA 2AJYL 3HG1A 1A6WH 1ZHLB 4GG8A 1I85A 3FMGH 1BD2B 4FHBD 4W4OC 1J8SA 1JZDC 1A7RH 4LGSB 1O7SA 2IAAC 3LRSA 5DHYA 1ZMYA 2FH6A 3MXWL 4OLZL 3US9A 3QEGL 1CCZA 3D6GA 3F6LA 1UD4A 2ZT9C 4OJAA 5EIIG 1VEMA 1E8YA 1CPUA 4Q0XH 1TLKA 3V4LA 4OKVA 1CLYH 4O58L 4R5VA 4Q7DA 3GT6A 2VZSA 3DIFB 5GRWA 4HBCH 3TBVB 3K6IA 4QCIB 4WHTB 1T89C 5EFIA 3F7PC 1O6SA 5C8JB 3IDIB 1QTPA 1KTDB 3BAWA 2CZNA 1I7TA 3W0WB 5A2CA 2EDDA 2WZPD 5B8CC 1U42A 4QI3A 3O2WL 1ADWA 1N5AB 2OP4H 2X1OA 2LR4A 4FKHA 2VLJD 1ASOA 1UEYA 2HWZL 3CXDL 3K8LA 2F8IA 4U6HA 1XSJA 1EO8H 2X88A 3CNKA 4P8QA 3P2BA 3F7LA 3MNVB 5MEND 4KH9A 3TM6A 3WNPA 4Y5VA 4LLDA 3SEPA 3KPSA 3IE9A 1B0RB 1DQMH 1A6UL 3T4YA 4AH2B 3FSOA 3M8OL 2V37A 4GAJH 4TSCH 4U49A 4AGQA 1DQQB 4LSSH 1I75A 5BS0E 4CVZB 3F62A 5CJOH 3U48A 1WBYB 2PABA 5AQ0A 4AL8L 3EO1A 4MJ4A 3U0TA 5GGSA 2H7WA 1G9ML 2K4WA 2Z93B 5KYXA 4L0YA 3S34H 5E8OA 1YECH 1NMAH 2Y06H 4NQCE 1C5DA 3OAZK 2QPSA 3QFDB 2WXPA 2L7JA 1UVQA 3QNXB 1TZHA 1H3XA 3A6BL 2XACC 1A7QL 4BK5C 4FERA 2RHEA 3D0VA 4A1RA 4PGBA 3MCLH 4UANA 1JGLH 2GJRA 2HFFB 5AW9B 1LO2L 3IDNB 4BH7B 2DBLH 1T03L 5E1HB 2QR0A 4EVNA 4HKZB 1IGTA 3C2AL 1NL0H 5H35B 4D9LH 4BH8A 2C7FA 2CKBB 4HZLA 1I9RL 4NQCD 3MI6A 2K9UA 3RIKA 1XDTT 3CXFA 4A7GF 3MRCA 1BAWA 4O2CA 4AEIH 1K3IA 2YWZA 4ZMWA 2XZQH 4F33B 2AI0H 1BIIA 2DMGA 5DJ0A 5GSVB 4YXHH 2WVSA 3CGTA 2XZCL 2NQ3A 3CFDB 4GH7B 4M03A 3TVMA 1Z9SA 2H2PD 2ICCA 2AV1B 5I1IH 1HEZB 4PM1A 2AS5M 1VGKA 1GPOL 4IS6B 3ULVE 3VXSA 2CG9X 3GSUA 1N18A 3BUYA 5DT1L 2VZOA 4RGND 2QV2A 1HHIB 3CFBB 2PYEA 4DPRA 3D12B 1JPEA 4IBSA 5BOPA 1BZ7B 1JDCA 3RB5A 5DDHB 5CHNA 3KJ6L 2NUTA 5JZ7D 3TPUB 4WTXA 3KWXA 2ZYIA 5K1JA 4TXVB 5JORA 3BKYH 2BVEA 3ECWA 1DCLA 1S6NA 5DS8B 1NLDH 1DVFA 3MLXH 4RRPM 2ADIB 5DJ6B 1PZSA 2OMYA 4E5XG 1KPUA 1TZIB 1JF6A 2HJFB 4H8WL 1ULVA 4LSUH 1AXTL 2I9LA 1NQBA 3D07A 1KTBA 3EJCA 5KVGL 1FP5A 1E4XL 4U1SB 4G7RB 5DJ2B 4MMYB 4G7YH 4P2RD 4HUUB 3CSPA 1HN1A 4N0UB 5HI5C 2WQWA 1QNZL 1U41A 2PR4H 4XO8A 1T3FA 1RUAH 4MQXC 4G5ZH 5ABDE 2H9GB 2XV2A 3LZQA 5DK2A 3CUPA 2MJWA 2O61A 3PWPA 3L9YA 3GBDA 4KO6A 2WQVA 3CN1A 5JW5A 3G08A 4FQLL 3G5VB 1B2YA 4YFDB 3VE0B 3BN3B 3UZQB 1KY6A 1C12A 5GSVA 3CFJB 3MRKA 1KYUA 2ZSWB 3EO9H 1A6TA 4NO0B 1ECYA 3LIUA 1R3HB 4E41E 4ETYA 1KNOB 3HI1B 4ZUWA 4MAZA 4ECNA 4U1NB 3SODB 2OR7A 3QDMB 3MRFB 4WK4B 4WK0B 1IX2A 3PLYA 1FWXA 1DUZB 3F7YB 3OL2A 3INUL 1A4CA 4Z8FL 1UT9A 1NIBA 3RYMA 5I8KH 3EIFA 4ZAKC 4YFEA 1CXIA 2V5SA 5C08D 1FNHA 5IQ7H 2GITB 5D7JC 4V2BA 4XBGB 4L2LA 3DYOA 4BJLA 1Y07A 4GMTH 3ETSA 3JQOB 4FYQA 4U6VH 4WSGA 5KVDH 1A7OL 2CUIA 1QRND 5JDSB 3B7RL 4QRAA 3U36A 1XMWA 4GRWF 1T4KB 3ZMNA 1O7DC 2J5LB 3IJHA 2JKLA 3VTTA 3ASNB 2YC1A 1E30A 3ARFB 3ZT5A 2VLKD 1OP5H 3ARXA 1CFSA 3AWFA 2V7NA 3DSNB 2BNRE 3VWKB 3VDBA 3RTQA 4LL9A 2OSWA 4D94A 1KCVL 1N70A 3DRQB 4LOVA 5F7DA 2VW7A 5JIKA 4AVJA 1BPLB 3AT9A 5F9WB