2BP3A

Crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
91
Chain Sequence
MVNHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FILAMIN A
publication title The Structure of the Gpib-Filamin a Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 91
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bp3A00
1L6ZA 3JBG7 2HT4C 4JREB 4MGXA 2NR6C 5JW4R 1OAXH 1T0MB 5I73C 4GLRH 5K9KB 1DZBA 2NX5A 3P9WB 2E7LA 1RZIB 3AREA 4PGBB 5C0CD 2JF1A 3EGSA 3C5SA 5DEFA 4L8CB 4YWGH 4NM8H 3GI9L 3H3PL 4G8GA 4OCLC 4QHUB 4IDJH 3TBVB 1LK2A 3GJEB 3TNMB 3REVB 3ZHLA 3L3OA 4J4PC 1TPXB 1ZTXH 3M07A 4QY8A 4K8RH 3AB0C 4Y5YB 3B9KD 2VDNH 3KYAA 3RVTD 2YN5A 4Y88A 2OTWA 4NJAL 3VI4E 3T8XB 2BJMH 4R4FH 2OM5A 5CSBA 4NDMA 3Q5OA 4YPGA 1L0YA 3W11C 2MOVA 6FABH 1ZWIB 2O26U 1LO0L 3DUSA 3UC0L 1MCPH 2RB8A 1KNOA 3OGCB 2WSKA 3MXVH 1BF2A 1C12A 1UYWH 1KCSH 2V9RA 2Q8AL 1BPVA 1E4KC 5J3HD 5GSVB 5DSCA 2VUYA 4ZAKB 2VDLH 4OGAC 2PYEE 3QQ3B 3O4OB 4WWID 1T03H 3MGTA 4CDHA 3BGAA 2XQYK 2F53B 3G6JF 1UM6L 2BNRE 3B8SA 3FRUB 3SJVD 5J6GA 4KJPD 1MEXH 5HBBA 5IMOB 3V6OC 1K4DA 3PHOA 3U0WL 3B5GA 1FIGH 1YEHL 1SJHB 4H8WH 2OMBA 3GHEL 1FLTX 2V2XA 1NDGB 5H2BB 4HPOL 4NO0A 4FS0A 1PW3A 1N5YL 4OI7A 2ESVB 3KPRB 4RAHA 3LQZA 2H26A 5ISZB 2NTFB 4JZNB 4MNQE 2BVQB 3VXTB 4K9EH 3QQNA 1ES0A 5GGVY 4LASL 3QEHB 1XCQB 3QCUH 1R3IL 1VEOA 2G5BB 4TOYH 4HUXA 1FLRL 3KPLA 4MQXC 1DBBL 4N8VA 1Y18A 4HKJB 5GSRB 3QO1A 4JFYA 4WWKD 2VZVA 4HIXL 3V5DB 2C3VB 5LKNA 3CZFB 1DBJL 3CFJB 3EAKA 4K3EH 4ZFOB 2BCKA 4H0IA 5DD3L 1QVOA 2BVUA 2FB4H 2B4CL 2VMFA 3EO0B 3DRTB 5DK2A 2VLKB 3TCLB 2XPGB 5EZOH 3MYJA 4WFGD 3RWIA 3EYFA 2MMXA 5FFLA 2P49B 2E9WA 5DJ6A 1BHGA 3AXLA 4PJGA 4ETQA 1IARB 1CZ8H 2ZCLL 1BOGB 3CC5B 3BUYB 4WFEE 3OX8A 3N06B 1JGDB 3RU8L 2JK5A 4XAWH 4R3SB 4KKLD 5C9KA 1QFUL 5FA4B 5HTSA 4N1EA 2IF7A 4HW6A 4PV9A 3EUUA 2YPLB 3B8YA 3RWCA 2RQ8A 3HN3A 2HT3D 1RZKH 3BDYH 2IJ0C 1CE6B 4XCEA 3VFGH 1ZSDB 5D7SH 3C08H 4C58B 5FDWA 1XR8B 4KJWD 1A14L 3RDTB 4UBDC 1G7JB 5IWLA 4OZFA 2FBJH 4EN3C 4XH2B 5CD3B 1IJ9A 4NQCB 3O4LA 1CTNA 1ZLWK 1X5YA 4KI1A 5DUML 4QLRA 4XNYH 2R4SH 1SYVB 4Y5XA 1MCNA 3QUMH 4OD2B 4EUPG 3OHXA 3UZVB 3DARA 4V1DE 1QA9B 5DUBB 5FO8A 3AS3A 2N7AA 3KVQA 3DUHA 2VYRE 4DKFH 5C0FB 4OZGB 1Q0XH 1WIUA 4XCCH 5CEZD 3C8HA 3O9WC 3SY0A 2DICA 4IRSB 3W5NA 5HDOA 2A77H 3STBA 4ODHH 5C2BH 1B90A 1NJ9A 1EHLH 3P73A 1B4JL 2X9YA 3DHMA 5FA3A 1MI5E 5HDQH 1L7TL 1HINH 2HTLC 5KSBF 4H8WC 4ZFZA 1JHTA 1FL3B 1T21A 4JKPH 3OQ3B 5JZ7C 3SDAA 4I4WA 2PCPB 4Z7UE 5E4IA 2R4RL 2E3VA 4WTZA 4K9EC 2F8VA 5AZEH 2R0ZH 1CDGA 5IESL 1AR1C 4YR6A 1U8QB 4JQVC 3MFFA 1WFOA 3U0PB 1A7OL 4HJ0D 5HHQB 4I48A 4JANA 1VACA 4NRZB 4HLZH 2Z4QA 1WFUA 4YFLI 1E27A 5GGVL 5CJQH 3GBLA 3ARPA 5F96L 4XMLL 4YBLB 5C07B 1JFQH 4OF8A 5C08B 4PRAA 4YDKL 5CEXA 4PLOB 4RFEB 4CADA 3DO7A 4JPIB 4I2XB 1Q9LB 4MAYA 4XCFL 2B1AL 4F8TA 4M9OA 3KLSA 4NQTA 3QNXB 3MRDA 4XNUH 4QGTA 3PGCB 1UKTA 3NTCH 3OKNA 3VE0B 5H8DA 3PWUA 3LQAL 4HC1H 3MRNB 4IRJB 3R8BB 1DE4A 1PFCA 3MCKB 4XT1C 3G5ZB 5HHNB 5EO9A 5EZJB 3SKOA 5T3ZD 1PY4A 1UCBH 1MLBA 2YXMA 1KCRH 3DMMD 4NNYB 1RZKC 5EO1A 1OSZB 5SWQB 1FPTH 2JB6A 2VDML 3SDDC 2NY1B 1CDBA 2ORBH 4MA8L 2BP3A 3T3MF 3CFEA 3QHZH 1KJMB 2HKHL 3MMEA 2YC1A 5D1XB 5SWZB 4TNWF 1KB5L 2GTWA 1MFCH 4LAQL 5IJVB 2EEBA 4Z8FH 2IG2L 5BV7C 3TIDB 3WFEH 1DBKL 5F9WB 1G0DA 1F4WH 2VTFA 1Q9KB 4JPVH 5E1AA 4OV5B 4NRYB 1A7PH 2X6MA 1QUNA 1YMMD 2KKQA 4AIZB 1JZ2A 4ZO7A 3PQYE 3S6CA 5GHWH 4M7JL 3UTTA 5HHVL 4OAWA 2C3XA 4OCWL 1AD9A 2DM7A 3O3EA 4FHBD 4PD4J 4LSUH 4JY4B 2JELL 3FRPG 5T3XD 3V6FA 2YKLH 1CK0L 1FE8L 5C0NC 3OJVC 3GIZH 2F5BL 4MSWA 3RVUD 5EOTB 1OTUC 3L7EA 1QSZA 3EYVA 4LCWB 3V0AC 2ZOKA 3QP3A 2YMXL 5A2KH 5KVFH 1FNEB 3KDMB 2EDQA 5DQ9A 4GQ9H 4X0KB 3DSFH 4I3RH 1KXTB 4X6DA 3B5HA 3STZA 2R1WA 4ZUTB 4TVPD 3GSQA 3UTSB 1Q1JH 3T65A 4RISL 4I9WD 2GSGA 3TF7C 3FTGA 1LK3H 3MCLL 4L4VA 5HVWA 1KG0A 3ZZ1A 1Q94A 4PBXA 1I7RB 5FB8B 3GI9H 3H3PH 4ODUB 3BO8A 1M7IA 3RX5A 4ZSOA 4P57A 1ITCA 1JE6A 3H9ZA 3VGHA 3BD5A 4FFWC 5I71B 1R3KA 3P0YH 4LCCA 5KAQG 3WFZA 4OSUH 2J8UA 1CICB 1NBZA 3P0VL 3VFPA 1ZLVH 1LO0H 3UC0H 3K1DA 1F42A 1TJGL 4NQVB 1QLEL 3PF2A 3B6SB 2UWEB 3DROB 5CGMA 2A2QT 2H8PA 4GRLD 5EORL 2Q8AH 5IFAL 4GAYB 4D0BB 4WDIB 5F1NB 4XP9L 4J3XA 1VGKA 3WLBB 3QNYA 4YDVB 1HYSC 4PJCF 1CGXA 5IB2A 5HI3D 4FXLA 4G6FB 1OP3H 5K59E 1A4JB 5I1DA 1VFOA 1KJ2L 4OLEA 5FUZH 4HPOH 1L7IL 5J8OA 1N5YH 4P2OD 4TRPL 1K85A 4XBGB 3QEUA 2QR0B 2OR9L 3I3DA 4ZXBB 4N0FA 1PX4A 4LASH 1KV3A 1R3IH 4U1LB 1XF1A 5IMKA 5JLZA 2VDKL 4BFIA 1FJ1A 1YNTB 2X4TA 3FFCB 2CDEA 5TDPA 4HIXH 1MNUL 3ARQA 1P9MA 3M1BA 1SVZA 3VFRB 1A8JH 3BP4B 1RJLA 1B0GA 4KUZH 4QRRD 3NN8A 2APTA 4MJ6B 4FN0A 5IV2A 1DN0B 1I8KB 2CR6A 5I1LB 5FV1L 3FT4A 1KJVA 5D7IF 1AXTH 4M6ML 4UQ3B 3IGAB 1QEWA 2YEZB 5T5NF 1DANT 2P5WA 5CILL 2VLLB 1M7DB 5F8RC 3VGAB 2ZCLH 4LLAA 1BZ7A 2CGRL 3HE7C 4WO4D 2UZXB 3QDJB 5L9DL 4UDUA 1RVFH 3MJ8B 5BMFL 4C56B 2FX7L 5FECA 4TSCH 3K2UH 1OGAB 3MA7A 4Z76B 2H2SD 1NC4D 1QFUH 5FO9A 1O0VA 4NUJA 3T4AA 4Z95H 1JYXA 3P4OA 1J0JA 3FO0L 5B8CB 4BQ9A 4F9PA 4YBQC 4LLMB 5ECJE 1I9JH 4X4MA 2BNQE 4BK4A 1GZPB 2I07A 1JGEA 1ZGLB 3QDMD 5ESAA 4ERSL 5DD1L 3BP7A 1BLNA 3HZVB 3U7WH 5CEZL 4J3SA 2G2RA 3TN0D 1REIA 4JG0H 3O3UN 2P42B 2CSPA 3SGDI 3D39A 1YEFL 3HE6A 5F7KC 5DUMH 4O2EB 2E7MA 2VLRD 4RMTA 1L0XA 3K0WA 4LEXL 3H9HB 4HXAL 1G6RB 2EIZB 5GPRA 4NGHL 2ATKB 3IJYB 2E6QA 3VFTA 1TITA 2NY3D 1EFXA 4PJ9C 1C5DA 3WHXB 2J6EA 2ED8A 3IDXH 3MV9E 2D31A 5IFHL 1S9YA 2Y36H 4XNQB 5IHZB 4HWEL 1XGPB 4ZO9A 3RRQA 2X1WL 1XIWB 4POUB 2P44B 2EDEA 2EKJA 1LO4L 2PYEB 4NC2B 1C08B 3QZWG 1YEJL 4C55A 3JTTA 3UPAA 2ZUYA 1CFSB 1L7TH 3QRGL 4FXKA 1B9ZA 2BNRB 4OGZA 2YSSB 2CLRA 1OT1A 4NBYB 1UENA 3D0VA 3G04B 3RIAF 1JZ8A 5KS9A 4HJGA 1I9IL 5J56B 2R8SL 5KOVC 1Z5LA 3U30C 1CN4A 1I8IA 1ZHNA 4MNQB 4NSKA 3P4LA 1A7OH 3BPCB 2PW2B 4PRIE 1K4CB 3OKOB 2IPKB 4YZFE 5LXGL 4X98A 1QHPA 2XFXB 5JHDA 5C09D 1TVHB 3FB5A 2B4CC 3O6FB 1IEBB 4J12A 4XMLH 1UB5B 3SDXF 3SPVB 4AQ1B 2XXCB 1BD2D 2Z31D 3PWPD 5T3ZL 1LE5B 4J4PA 2QJDA 1UQSB 3LKPB 1PG7W 1GC1L 3R1GH 1A9BB 3G5XB 4YHPB 3RGVB 4D9QD 2UZIL 4XCFH 2JCCA 2B1AH 4JFEE 3G08A 1KTRL 32C2A 5TDNB 3N1FC 1FNAA 4YO0A 4JB9L 4RGMB 5DMKB 4FQ1L 2EDFA 4P5TB 5T1KD 1K5NB 3CFBA 1PYWB 4Q6IC 3PL6C 5E7BA 4L4TD 1WIOA 1E4KA 4JO4H 1T89C 4JE4B 2W9LA 4OIIL 3GIVB 3ZE2E 1FG2A 3L7FB 2E6PA 4KJYB 4NO3A 2GAZB 4MCYA 12E8L 4JKWA 2M1KA 3CSPA 4FQLH 3ZKXB 1LNUA 3RWEB 4YAQB 3D0LA 3SCMC 2M8XA 5T3XL 3V6OA 4MA8H 4APQB 4UMGA 2DI9A 4MNGA 3NZ8B 1KPRA 4LHUB 2HKHH 4JO3L 4QRTB 5KSUA 2ZSVA 3OB0K 4P9HL 2HVKA 1KB5H 2X05A 4X83A 4LAQH 1LO2L 1GGTA 1HHJA 5IVZB 2IG2H 3BIAX 1CD1B 3WEXA 1DBKH 5BXFA 4XAKE 4HIHA 4DEPC 1AKJA 1H5BC 3OKMB 1AXIB 2HJKB 3H9SA 1U3YA 3ILQD 1Q0YL 4ACPA 3O45A 3C8DA 3HPLA 5HHVH 2OQJA 4V1DB 5JUEH 4UDTB 1AR2A 3ALPA 4CVXB 4TVPL 1WISA 3DTXB 3WV0A 5IKCB 2FL5B 4RMUA 2HLFD 1CK0H 1W8OA 1FE8H 1QYGL 1J0KA 2ZOLB 3OKDA 2F5BH 1ZLUK 2ADFH 3WO3B 4UTBH 2BXZA 2CLZB 5DVLA 4K3GA 4DVBA 4LIQE 5ETUB 3X12B 1MCLA 2OJEA 4HKBA 5A40E 1FRGL 3HMWH 2VABA 3VH8A 1B0WA 4ZPTB 2CDFB 4WU5A 5H94A 3RI5K 1MI5B 4JPWL 3U4AA 1SBBA 4RX4D 4HAFA 4PTUB 1S7QB 3T3PE 4PJEF 5IG7B 4LLVB 1CFBA 4QRSA 1KLUA 3WXVH 3TBWA 1UWXK 4RISH 3HAEA 1HEZB 4A2MA 4Z7UB 2R69L 1XF3B 1CL7I 4FQXB 3MCLH 2GKIA 3JWOL 1UM5H 3Q1SL 4HIJA 3BGFB 5IHBA 2R1XA 2IAMD 3QQ4A 1M1SA 2HLAA 2AK4E 3UTTE 3BSZH 1P1ZA 4I3GA 4EN3A 1PQZA 3KPTA 1IM3A 4ODVH 5JA9A 2I9TA 3G6AB 4UT9H 4BFBD 3GMLA 2ED7A 4F7TB 4L9LC 2ZWLT 4X7DC 4LKXB 1PKOA 4A6YL 3P0VH 4P3CL 3FFDA 1R24B 3X13A 4MVBC 4NFDA 5IMMA 1YUHA 1Q9WB 1BFTA 2DQJH 4EXPX 3MV7E 5C6TL 3BKML 2OI9B 5EFIB 2FJGA 5F1KC 4WUUA 2Q6WA 1U8NB 3LQAC 4OD1L 1FZOB 2EKSA 4KJQC 3GUTA 3ESVF 4MA7L 4GO6B 4IS6A 4XGZB 3O9WA 1C5CL 1VGEL 1UH2A 3GMNB 2OZ4H 4U3CA 2ITDA 4OM1L 1AP2A 4YXLH 2EICA 3TGXA 3U4EA 2G75A 3X17A 1NFDE 1GYAA 4U1JB 3QXUA 4GG6E 2WANA 3CVHL 4PGZA 1L7IH 1IT9L 4KV5F 4TRPH 1X6LA 2FJHB 4ISVB 4ZSOE 2B7DT 5JPNA 4W6YB 4G7VH 4XPHL 2W65B 1PZ5B 3R4DA 2VDKH 3ALWA 4L8BB 4JQVA 4NCDA 4P4RB 3UPRB 1F8TH 5IB5B 3T2NL 1CLOL 5F8QC 4UIKL 4WTXA 4KXZI 3PQYB 4XTRD 4QTHB 4Y2OA 1ORSA 4HPYL 4ZOBA 2R56L 5I8EB 1P4IH 2MFNA 4M6MH 4CMHC 3NCCB 4FZEL 4QRPA 4UILH 3NIGE 5DRNB 5CILH 1NGWA 3QWQB 5FHAL 5TF1L 3V0WH 4M61B 3BEVA 1L4IA 3B9KC 4WGWB 1B0RB 2FH8A 2Y9RT 3SOBL 5BMFH 3UO1L 5IBUG 5I75C 1F58L 4JCMA 2C1PA 4UU9A 1LDPL 4M3KB 1DDHB 3GGWB 2CJUL 3I6GB 3U6RA 5J89A 4HIEB 1WFTA 3G6JA 3IVKA 2W60A 2IGFL 3FOLB 3JV4B 4GMTL 3BXNA 2E9JA 1YN6A 3ROLB 5H37H 4ERSH 5J3HC 4U1HA 5DD1H 3KPSB 4M6AA 4RBPH 3SDDA 3LB6D 3QWRD 1EV2E 3TNNB 3GMMB 3NCFB 1BQHG 3O8XB 3BQUB 2NPLX 2BHYA 4DN3H 5GS1B 1F5WA 4ZNEA 1YEFH 2X44D 3EFDL 5MI0C 3Q5TA 4DZBA 4KJPC 5B39B 4HXAH 2UVEA 1V05A 1S5HA 4NGHH 1J5OL 3LRSB 3MODH 3ZKSD 5I30L 4PD4K 4ODWB 2E7BA 1EEZB 3HC4L 3QB7C 3OZ9H 4LNRA 2JE8A 1ACYL 4XPGL 5IFHH 1J05A 4Y5VC 3V5KA 4HWEH 1BZ9B 1XH3B 4MD5B 4NN7C 5T1MB 3VW3L 3IXAA 4KROD 3F65A 4MHHI 2GK0A 2VL4A 4WWKC 1LO4H 5GGQH 5KBNC 1EO7A 2IPTL 1NUDA 2YBRB 1TMCB 3OR7B 2KBGA 4U1KA 2CQVA 1XF4A 1J87A 3QRGH 2ICCA 3VA6A 1A1NA 4X4XA 4EXKA 2CKBB 2A73B 3QA3A 1S7WB 5D1ZB 5I1JL 4U1GB 2GW5A 1TDQA 3SGJC 4XVUD 3DV4A 5A43C 2VKWA 5DEFB 1I9IH 3RPIA 4N90D 5MEPB 2VXUL 2R8SH 3TYFB 3HMXA 4KTYA 3F7VB 4UQ2A 2P8PA 3C9NB 1F6AA 3DHJA 4PG9A 1IKNC 5IK3B 4XPBL 1IZJA 1BAFL 1DBAL 5F9DC 5F6IB 4YPGB 4KKLC 3VJ6B 2DQHL 1I3GL 1QO3A 5SWSE 1RUAH 1KNOB 4ODSL 2D2OA 5FO7B 2HT3C 2GJ6A 2ZCKL 3U36A 3N9GL 1E6JL 1U8LA 4R7NA 1LEKB 1RUMH 4GW1A 4XP4L 3E2HC 5FV2A 4WRLA 3TPKA 4FQ2L 3W9DB 1SEBB 4NM4L 4LF3B 3MLWL 5C92A 3MX0A 4FQ1H 5FOBA 4P2QD 1WZ1L 2DRUA 3UBXA 3TT1L 1Z0MA 1NANH 4F58H 1X5HA 1OAYL 1D5XA 2DMCA 1FZMA 3VWJD 1JUFB 1YY8B 2HAZA 5GGRB 4HC1A 4LPWA 2UZYB 3SDYH 4OIIH 1U2CA 1BJMA 1HH6A 1P6AB 3NGBC 43CAB 4PB0H 3MRBB 3P11L 12E8H 3ZLQC 3UJIH 1G9ML 3OJDB 2E7CA 2DB8A 4WUKL 5KSBA 5T3XH 2Z9TA 2NZ9C 1X7QB 2BNQB 4U0QB 3KPLB 4QT5A 1R3HA 4G6AD 1WJ3A 4S11A 4P9HH 2X42A 3CFDB 1P5VA 4BK5A 1CDIA 4UAOB 2GHWB 2E8ZA 4NT6A 4GRWF 1LO2H 4G9FD 1J9CT 2ZKHH 3VG0L 3WS6C 3ARDD 4P5MA 2ZJSH 2JCCE 1GGBH 3KXFA 2AV1A 5TDOB 4TVPH 1CLYL 2NXYB 3U46A 3UYRL 1FNLA 1U3HA 3MV9B 4GKZA 1NLBH 4KPHL 4RFNC 1QYGH 4GS7B 4HJ0C 1YZZA 4E42B 4U1NA 2ARJA 1HHKA 3BPNC 1V3MA 1HHGB 3MRJB 2UY7A 1EO8H 5FKPB 5IR1B 1ZXQA 2VXTL 5BRZA 5SX4I 5E6ZA 1INQA 3GMPA 3RWCB 1AGFA 3HE7A 4IMKC 1CFVH 4OV6F 2CPCA 4JPWH 1NKRA 5M94B 5IFJA 4MNGE 4XCEB 2XZAL 2QSTA 5IT2H 4F9LC 1KXVC 3KPMB 4RRPG 5ANMB 2Q76B 2R69H 1Q8MA 4C57C 4CRPA 3EJYD 3VXME 3JWOH 5IEHA 1ITBB 3Q1SH 2R0LL 3DOSA 4JN2A 1UGNA 5I17B 4FMFA 5FM5O 3SE8L 4Y5XB 1G6VK 3HNTL 1LEIB 4PRIB 5HVFB 3ZDZF 5TE7L 5DMGD 5CFHA 2CRYA 1INEL 4OIAA 4WEBH 1RULL 4YHNA 2X9XA 5L2KB 4NKIL 3S35L 4NN5B 3RGHA 3DMMC 4S0TD 1GC1C 5DJAB 5DJ0A 1I1RA 3WUWB 3MOQA 1YPZF 4A6YH 4P3CH 1OF2A 4AL8L 4YQXL 4U31A 2R0WH 2LABA 1ZLSL 5E8DL 4JFEB 4PJ9A 5DC9B 1CCZA 2FYYA 3PGDA 1A1MA 4D0DA 3MV01 3Q3GA 4OD1H 1F4YL 5KVEL 5GXBB 3KJ6L 5GS2D 5CWSA 1HQRA 3JWDL 2VLJA 4L5FH 4KK9D 5GIRB 3FONB 1FC1A 3MLZL 1VGEH 4XPTL 3K8LA 2X4QB 4PJDF 3F7YB 4OM1H 3TCXA 4LQFL 4BZ1L 4NWTH 1MFEL 3HTLX 1OAQL 4V2BA 4DAGH 1P2CA 1VPOL 3TFKD 5E2TH 5CMAA 2VLMD 4OD3H 1RIHL 3CVHH 3P77B 3C5JB 4JFOB 4HULB 1IT9H 3DYOA 4P9HC 2NY7L 3VRIA 1HXMB 3RVUC 3ZHKA 1SQ2N 4ENEC 2YWZA 4XPHH 3S35X 4G9DB 2CRIA 1LEGA 5HGBB 1F4XL 2AEQL 5GS0D 5HPMA 4OUUB 4YGVB 5GISL 3ZO0A 3NCMA 2AQ2A 5FUCE 5HYJD 2XA3A 4OFIA 1F90H 1IAIL 4RAUA 3T2NH 1CLOH 5I1KL 1IGCL 1QSEA 3UJJL 4NCC1 2OTPA 1MHHA 1B2WL 1MFDL 4WUUE 4Y4HB 3E6FB 3D85B 4HPYH 1WBZB 2R56H 4JDTL 1MVUB 1JN6B 2HFGL 4XVTL 4FZEH 3PWUB 4K2UL 1NAKL 1G7IA 4NQEB 2AV7A 1CFNB 4JR9L 1PLGL 2IADB 4JFDE 3MRIA 5FHAH 3SKOB 2Q8BL 5EU6D 4AY0A 3SOBH 4NP4L 4M7LL 1FFNA 4Q6IA 3UO1H 3PL6A 1RK1A 2IC2A 3B5TA 5D7KD 3LY6A 5I8OH 5F88A 1MSPA 2CJUH 2X1OA 2I9LA 4JM2B 3O2WL 4W6XB 1XCTA 1CGVA 5J0BA 1T89A 3RFZC 3KR3L 2YC1B 2IGFH 4PJCA 4GMTH 4XNZC 4I18C 3JWOC 5E8EA 3KYOA 4GRLC 4LLUB 2IH3A 5IQ7L 3SCMA 2P43B 4OFPA 1CIUA 4WHCA 1AY1H 3VRJB 3T0ED 3QDHA 1U8HB 3GSRA 4OZIF 1S9KC 4HUVA 1HIML 5E8OA 5BQ7A 4JLRB 3MNWB 2GTZA 5JORB 1NBQA 3VWKB 3EFDH 5HI3C 2AK4B 4OAWB 4UUJB 2IFFL 3L5HA 5ICXA 1J5OH 5BVPL 3LDBC 1H5BA 5I30H 2HFEB 5T33L 4P2OC 3HC4H 3QO0A 4MSWB 4OKDA 4B53A 1ACYH 2YA1A 2DQIH 3QDGD 4QHKJ 1X4ZA 4XPGH 2NY4D 2ZOKB 3MV7B 1VERA 1ZT4B 1N5AA 3CD4A 4QHNA 1QFWL 5D7IA 2SEBA 1U91B 1HI6B 3QUYB 1KB9J 2IPTH 3VXSA 3FQTB 3V5HB 2WMPA 3G6JE 5FKAA 3IFPA 5DJZB 3FO2A 2R1WB 4NQDD 1IL1A 4Q2ZA 3IDMA 4EI5B 2IPUG 3FTGB 4NO2A 3MO1B 3WFDH 1NFDB 1QFOA 1OB1B 3FB7B 5BS0A 3D3VD 4XNMB 4GG6B 5LAXB 4G6ML 2X1PA 3VGFA 4ZNEE 1X5KA 3VFUA 3AFLA 4PY8I 1I8MA 2COQA 4HGKC 3CSYA 4WHYG 3SGKC 4WO4C 2C3WA 2AJ3B 4XPBH 1SVCP 3U9PH 1TQBB 4PRPA 1KACB 1MRDH 2FHBA 4AH2B 2CIKB 1BAFH 2FZ3B 3DBXB 2QHRL 2H2SC 3GKWH 1A4KA 3ZYZA 1U9KA 1A6TA 2DQHH 1I3GH 2V2TB 3HLAA 2HRPH 1A6ZA 1JGVL 2XTJC 3SO3C 4ZG1A 2LU4A 2ZCKH 4TNWK 5F7UA 1E6JH 5GRVL 3DUUB 3OL2A 1Y6NR 2PO6B 4L9LA 3RY6C 1MCIA 2X7LB 4FQ2H 2HP4A 2VWEE 4NM4H 3X14A 3MLWH 1MIML 3TN0C 2AXGA 3KGRA 1WZ1H 3K74B 3EYUL 5JXAL 2OJZL 3MLTB 3QNYB 1ZLVK 4X6FB 3TT1H 3WFBL 4EKXA 4OFKA 3MOBL 3V4UH 1K6QL 4OJFH 4DZ8A 3Q0HA 3ARYA 4QKXB 3TO4D 3DXAB 3T0DA 2WBKA 1J0YA 5C0IA 2W59A 2NY3C 4YHOL 2RR3A 2BRRH 3JWNC 1JHKH 3DURB 4JFFE 3L1OL 3P11H 4ORGA 3VG9C 2ZUUA 4QOKA 1T5WB 3QEQD 4WUKH 5DQJB 1ED3A 3BPOC 1A1OB 3RVWD 1DVFD 3AS2A 1K8DA 2C1OB 1RZGA 1G7MB 2X4TB 1WLHA 5JW5A 2CDEB 1G7LB 2EYSA 4EUPA 1E4XH 4FFZL 1TETH 2WV3A 1XAUA 5JXED 1KB5A 2F54D 4PRNA 1RJLB 1VADA 3S3PA 5GGSB 2ZG1A 5DFWH 1OL0A 2LVCA 3FT4B 3GMQB 2XRAL 5EU5B 2HWZH 3C09C 3CZJA 1H8OA 2NCMA 2EH8L 1WF5A 4AG4L 1LD9B 4PJBF 4JQXC 3LN5B 1CLYH 1NCCL 3HPJB 4J6RH 4BSWB 2WWKO 3SDXA 1GH7A 5C0DA 2O61B 4KPHH 3TZVD 2PW1A 4U7SA 3DX7B 5C0CA 3IDGB 3VFWB 2ICWJ 4H1LG 1U92A 2XOTA 2PTUA 2XG5A 1DQQA 1NLDL 1A6VH 1N0XH 2VH5L 2BSTB 3VXRE 1I85A 2C26A 1DEEA 2Z31C 3IDIB 3O11B 5KSBE 1MPAL 5MHSD 3B9KA 4HGWA 2FCBA 2XZAH 1TCRB 2C7UB 3BP7B 1MWAB 3BAEL 1QR1A 3AAZA 1PVHA 3MRFB 4BH7B 1G84A 4YXHL 4S10A 3HRPA 3NPSB 4JRYD 1U58B 3WFCH 5A16A 3ZKMD 4NO5A 3OAZH 3EOTL 4J7RA 3JSSA 3ZSTA 3DVGA 5JW4M 1SMOA 5JPMB 3U2SB 2CO6B 1S8DA 3GSNH 1T1YA 2VAAB 3H0TB 4LFHD 5TE7H 1AHWB 5BW7C 1GZQB 5LBSL 3VFTB 1INEH 1XZ0B 4RIRB 1RULH 1ORQA 4LLWA 5F89A 4NKIH 1Z9LA 3L3DA 5FF6B 3S35H 3VGGA 3RAJL 1AO7D 1N64H 2P24B 2BNUB 5E99L 5L8JB 5SWSB 3SJVA 5EIQA 5I0DA 1WAAF 5EOCL 1KFAL 5GRUL 3GBNH 4UIMB 4IBLT 3TBYA 2Q3AA 2Y6SD 4LHJB 1ZLSH 5E8DH 1ADQL 2DYPD 3IDYC 3L95A 4CKVX 2V5TA 4H25A 4G42A 4M5YH 4OBSA 4P23D 4O58H 4LCYB 1BWMA 2E9IA 2Q87A 5BRZE 1F4YH 3MRHA 4Y5VA 5KVEH 2CIIB 3KJ6H 4FXKB 5GS0L 4J1UA 5DHVH 3QEGL 1S78D 4CNIB 4HT1L 5LVEA 3EDJA 3MLZH 4PP1C 3ILQC 1BBJA 4UOJA 1NGYA 4WWKA 4Y16D 4OZHF 1G9MC 4YK4B 1KIRA 4LQFH 4BZ1H 2FIKA 1YN7B 3O4LD 1H3UA 5JOPE 1MFEH 3JV0A 2CDGB 1OAQH 3D18A 1VPOH 3MA9L 1FGVL 2HLFC 4NSKB 4ELME 1KJ2A 2GEEA 3T3ME 5I73B 2Z35A 2NY7H 2YD7A 3JUZA 4PJEA 4HV8B 2R2BB 5C2UB 3SGJA 2H3NA 3ZYOA 2Z93A 1FVEB 1ND0B 1F4XH 2AEQH 4FQJL 2GJJA 3P40A 3ZKND 2VISA 4UT6L 4X7CC 1U3ZA 5CJBA 3AB0B 3R06B 2YZ1A 5F1IB 3BP5B 1IAIH 4K3JL 3SHSA 4DJMA 1IGCH 3G08B 3UJJH 4MCZB 1MLCA 1MFDH 1FL5A 2ERJB 4AEHL 4O51A 2ZCHL 2VIRA 1CE1L 4JDTH 4ZAKD 3BJLA 2DQGL 3MUGA 2J2ZA 2HFGH 2XKSA 1H0DA 4XVTH 4K2UH 1NAKH 2EIDA 2Q7NA 3S8WA 3S5LG 1PKQE 4BA8A 5KSVA 2FEEI 2F53D 1ONQB 3SDAD 3DX9A 2BSRB 1LMKA 1WZLA 1NH6A 4H88L 5F7DB 5T1DL 2BOBA 1OARL 4Z6AT 5GZOC 2KZ1B 1WBXB 4OKVA 4XNXL 4JY5L 4I5BA 3NIDE 4XCYB 1DLHA 4Y19A 3IFOB 3ES6B 2ESVD 3KPRD 4YXKH 5K9OA 3N0PB 2D7NA 2D3VA 4PY7B 2ZSVB 4I13B 4JGUA 3VCLA 4OCRL 3T04D 3VDBA 3ECBB 4YNYB 3BKCL 1CDCA 3HUJB 2LU7A 3JV6A 5IQ7H 1EZVY 3VXMB 2OR8A 4DUXA 5EOQL 4XZUA 2F74A 4LARH 5HGHB 4Y89A 1QZ1A 4CU8A 2RFXB 1HIMH 3T1FA 2R29L 3MGAA 1A6AB 1XR9A 3RIAK 2ADGB 1RK0B 2Y5TB 3TPUA 2IFFH 4ODTL 2IEPA 3QZWB 5A1AA 2X4OA 4QXUL 4JJ5A 5BVPH 1QOKA 3WS6A 4FZ8L 4PRHB 3OKDB 2JJTC 2VQUA 5CS7A 1T66D 3NACH 4MJIA 1T0PB 4ZS7L 1F00I 3CXHJ 1KCVL 1F3JA 3GSOA 4XPFL 1E6OH 3T2OA 3JWDC 1QFWH 3ROOA 4URTB 1SJEA 1JHLL 1H15A 1DQML 1OAUL 5EZLA 2YPLD 5BZDA 1KN4L 3KYNB 4JG1L 4PJCE 4PJIF 4XTRC 3MRCA 2DTMH 4HUWB 2EE6A 2DLFH 2L0DA 4KVNH 1KT2B 4IMKA 3K4DA 4HIJB 4PB9H 4W6WB 3F12A 3RDTD 1RMFH 1WWCA 4ZUWB 3T77B 4G6MH 4XP1L 3SGEH 4KZEH 4F9LA 3P9LA 3ARZA 3PIQB 3GO1L 4D94A 2YN3A 3RJQB 5F7HA 1PQZB 1D5ZB 4MNHA 1AD0A 3CFIC 2YRLA 4HLJA 2BSSB 2QHRH 5EBMA 1T22B 4HMDA 5D72L 2EIEA 1U8OA 2APXA 1F11A 4X5WB 3X13B 1K8IA 3QIBD 4BQ6A 3G5VB 5IROC 1R5VA 1JGVH 3HCVB 4CVZB 5CIPH 4ZFFA 3JXAA 5F3BB 4HMCA 2BHZA 2A38A 3DMMA 3HC0B 5D7IE 1NMBL 4FTVE 2DTSA 4POZD 3LB6C 4IRSD 3AROA 2YHGA 1MIMH 1FFQA 1KIQA 2RIKA 5T5FL 1P69B 5BCAA 3JV5A 3EYUH 4IS6B 2OJZH 3NFNA 3O9WB 4JFDB 4NC0B 5JXAH 1N6QH 2EDJA 4PJXF 1MHEB 3WFBH 5AAMA 3HR5A 3MOBH 1K6QH 4L4VD 3U4EB 5DK0B 5F9AC 5DJDB 4M5ZL 5BS0E 4XWOD 2XACC 1FFOB 1X5LA 1CXKA 4RZCB 3C60D 3F7PC 4YHOH 1ZT1B 2WP3T 4X6CF 3LKOB 4D2NA 1ZS8B 5ERWB 1YMMA 3LN4B 5EU4B 4AT6A 2NY6B 3B3IB 2GT9B 1AE6L 2WBJB 5CZVH 4PRPE 4TNVF 3JZ7A 2DL9A 2Q86B 3G5YB 2BC4B 3HZYB 4UT7L 4KROC 3UTQB 4AYFA 1FN4A 1HHIB 3MV8E 5KVDL 2HN7A 3STLA 2VO5A 1HOCB 4FFZH 1KIPA 2L7UA 1FH5L 3CH8A 5C07D 1LQSR 2FD6L 3OXSB 2Z91B 4PG2C 3SEPA 3ULVD 5C08D 3IF1A 1OPGH 4J3OC 5D5ME 3R0MA 1EEUA 3CH1A 4WV1B 2XRAH 1T3FA 5DRWB 3DETD 3BWAA 4XVUC 2EH8H 3I84A 2FSEA 3O2DL 3QXAB 1I1CA 1A3RL 4Q9RL 2O5ZH 5JR1L 5DD6B 3VFVA 5I1EL 4IRJD 5E4EC 2OTUB 1OT2A 2AEWA 4G80A 1SY6L 1CXEA 1NLDH 2H6PA 4XRCB 1EAJA 3OG4B 4QOKE 4MDJA 2GFBA 3ZSSA 2FO4A 3KYMA 1Z3GL 1QFPA 2ADJA 4HUMB 3IU3A 1HDMB 4GLRI 5D1XD 3C87A 4YXHH 4Q9QL 4C4KT 3PWLA 5MENB 1EZVX 1MJ7H 2FECI 7FABH 2YD9A 4I18A 5TH2B 3GMOB 3VWJC 4GRLA 1SYSA 3LS4L 5GS2H 3QAZB 3DX8A 2WQ8A 1X5JA 5C6PB 4MXWL 2H32A 4FNLL 5HYQB 1WWBX 2GSIA 3QUMB 4U3HA 2P5WD 4JFHE 4RBPK 5D7LE 4LEOB 1EAPB 3TESA 3V52L 2RAMA 3RAJH 1T2JA 1AGBA 1HH9B 1D9KB 1BJ1J 3VFSA 1JF5A 5FXCH 1EBAA 4RQQB 1KFAH 1OAKL 5GRUH 4G6JH 2HMID 5C0CE 4A6YA 4JAMA 4G6AC 3PABA 4LCWD 4OLYL 4U33A 1EEQA 3B2VL 1RZ8A 3HZKA 1IKFL 2IQ9H 5ENWB 4U1KB 1U3JA 5ITBL 1WICA 2D4DA 5GS0H 1EH9A 3QEGH 3ARDC 3VD5A 3OJ2C 3ARFB 1XT5A 5EO0A 4HT1H 1A3LL 4R9HA 4CU6A 3S34H 5IHUH 3UTSD 4WVRA 1EXUA 2AXFA 2X1QA 1NCBL 4DTGL 5HPOA 1AGEB 4QRRA 3HE6D 4H0HB 4JFFB 4DCQB 4J8RA 3MA9H 3DJ9A 4NHCL 4P46B 5F9JB 4JGJA 4YIQA 4LVHB 5FYKD 1JNHA 1KOAA 3RL1A 5F6HJ 2ITCB 4NYLA 2VITA 3VXNB 2CLVA 2WLZA 5KJRL 3WUZA 4Z77B 5CBEA 1ZA6A 4FQJH 1NCUA 1QO3B 1WC7A 5IP4A 1I3RB 2VXVL 4MXQD 1KEGH 3SGKA 8CGTA 3ARGD 4RA0C 1WK0A 1CICD 1A6UL 5DHXB 4K3JH 4MLIA 4HHAB 2FATL 3O41A 4ALAL 1KELL 4JDZB 1NC4A 2Q20A 5EA0L 1G9EA 1MCQA 3VXOA 4P2YA 3ZE0F 4AEHH 1U41A 3EJYC 3FHAA 3LKNB 2DQGH 3X11A 4BKLA 2AGJL 3EOBB 4XBPA 1NCDL 1YPZA 3IXTA 3QDMA 4KKBD 4ZTPH 4BYHA 3RY6A 2N4IA 1VKXB 1P4LB 1MFNA 3TN0A 2WUCH 4H88H 4G6FD 1A9EA 5T1DH 4ZFOL 2Q7YA 5J57B 5ICZB 1OARH 1MHPL 3VXRB 5HYSG 4Z9KB 4MZ2A 4PJ8D 1QBAA 4XNXH 2VLRA 3THML 5H35B 5KSBB 1NAMA 4PRDB 1G9NH 3V0VA 3T1WA 4PJEE 2DQFA 4WFGE 1NEZG 2NY2D 5JHDD 4ZXBD 2VXQL 3IDNB 2WLYA 2EYTA 4I0CC 5IW6A 5ICYA 3SDCB 2IQAB 3C2AL 1RUKL 3W0WE 3FFCD 5EOQH 3PJSA 2BVPB 3MYZA 2A6IA 1JCKA 3GJFH 4K7FB 4M8VA 5JW4N 1QTYT 3L3GB 2AJZA 4KK9C 4Z7WF 3W11D 2AV1B 1F13A 4PV8B 5D9SB 4F7PA 1XGRA 4ODTH 4E0RA 4F37K 5IOPA 2PYFA 3T4YA 43C9B 4GW5A 3P0GB 1HILA 3TFKC 5KG9A 4DKAA 1R3JA 5E0QA 5FYLE 3MQIA 5A2FA 4OGAD 3UTOA 4ZS7H 4R0LC 3W82A 2VL5B 1JZ6A 3SKJL 1BBDH 4JQXA 4F7MA 3QDJD 1KCVH 4XPFH 4C56D 5GS0C 3ULUD 1D5IL 3FT3A 4ZUSA 4TUOA 1N8ZA 2G9HB 1M6OB 2XWJA 1DQMH 3T0AA 1D3CA 3QUKB 5AWNH 3MZTA 3IU4L 4Z7NF 1KN4H 3DVIA 4JG1H 5C09A 3LPGA 3VD3A 1OAZL 5JNYA 4IOSD 2Z31A 1U8PA 3PWPA 1XGQB 3CX5J 3QIUD 1AKJD 3VFNA 4KV5E 4XP1H 3LEYL 4ELMB 3K7UA 3L6FB 4KQ3L 3IETA 5D1QD 4JEGB 1QRNE 3VD7A 2I60L 3GO1H 4GRMA 4PJAB 3I85A 4F2MA 5J1SC 5T1KA 2YUZA 2QLVB 4NHUB 2IANB 3UTZB 4L4TA 4FQHB 4KC3B 5D72H 4ONFL 5BW7A 4OZIA 3IDJA 3BFOA 2BFVL 4WENB 1S7TA 1XIWD 3GBML 3MRLB 3ZHDA 1NMBH 1S7RA 1YNLL 3L5WB 4OM0L 2PYED 5T5FH 3T0EC 3CMOL 4PBWD 1PKQB 1HYRC 3WN5B 2YPVL 3ARBB 1J1XL 3OBAA 3BKYH 3EJJX 1T7VA 3ULVL 5DVNA 1JPTL 3C6LB 3LKSA 1KPVB 2EDOA 4M5ZH 2WUBL 2BY3A 4LPXA 5I8KL 2FDBP 2YRZA 3KNBB 1EHXA 5M95B 1BQHA 4G6KH 3QI9B 1T20A 4MNQD 5C3LD 1AE6H 4Y2DB 1LEGB 1YECL 3U30B 4UT7H 3KJ4C 2XN9D 2ZNXA 3CDFA 5I1HL 5ITFA 4B50A 1FH5H 2EC9U 5BJTB 3O6FD 2FD6H 3WLWD 1JPST 3KYKL 3O2VL 2DKSA 2DIAA 2MJWA 1MHHB 2HT2D 3GNML 3RGVD 3OGOE 3CU1A 3WO4C 3V95A 4RX4A 2DWDA 1RI8A 3O6KL 2AV7B 4JY6B 3PDOB 3MBED 4P3DB 1A3RH 4Q9RH 3MR9A 2GUOB 5JR1H 2WIIA 3RNKB 4P2RE 4TUKL 1V7ML 4L8SB 3T09A 5I1EH 3FO1A 1VHPA 1U93A 2HTLD 4Z5RB 5F93C 4M93C 4N8CL 4ZQKB 4KTDL 3NOIA 5F88B 2I9LB 1MQKL 4C83A 2DLHA 3L5IA 4L3CB 3BMVA 1SEQL 2ZUQC 1FCGA 2AW2A 2FR4B 25C8H 4G8IB 4PJCB 1RUQL 5T3XE 4APQD 1BJ8A 1MREL 4LSPH 1WVZA 4KGJA 2K1MA 5HGGS 5I66A 3LD8B 5EC1B 2A9NL 4ZUVB 4HZAA 1I1AC 5DMYA 4Q9QH 3DSNA 4KZDH 2VDPH 4WFHD 5L6YL 5C9JB 1VEPA 5AEAA 3LS4H 1MHCA 1OY3B 1UWEL 3WNKA 1IAKA 4Y1AA 4FNLH 2XKNA 5E8PB 3TO4C 1UEMA 4YC2B 5CSZA 2VB5A 4NZUL 2X70B 1FL6B 4OZFH 4V1DD 3V52H 5MP6L 4TVPE 1XMWA 4CU7A 3TC9A 4NCC2 5GJTL 4I9WE 3WHE0 4HKXB 4EZMA 3QJHA 3VGEA 4XXDA 4LSRL 5EPMA 1DVFC 1I1FB 5FYKL 4FTVB 4OLYH 2FLBT 2JJTA 4PJBA 5E5MA 2GK2A 3MGOB 1IKFH 5JXEC 3ABZA 3E6HA 5FKAB 2HJLB 3H3KA 5ITBH 3RP1A 1O5DT 4G8EA 3IDMB 1RHHB 5DHVA 1A3LH 3SDDD 2IALA 1GOGA 2FO1A 3KHQA 1I7ZA 5I15L 5BS0B 1UEYA 1RJYB 1NCBH 4PFEA 1KJ3L 2ILLA 4PGEB 5ESVB 5MERA 4LVOB 1N59A 4Q9CA 1J86A 4KWUA 3V6ZB 1I8MB 5I9QC 4Q7DA 4NHCH 3U1SL 3TZVC 5F9OL 2VUOA 1Y0LB 5CJ8A 4GOSA 4FOMA 3AS1A 3DIFB 3MJ6A 3W39B 4U2YA 1NL0L 5J13C 5E7FA 3UAJD 5KJRH 3MV8B 5HYIA 3BW9B 3RHWK 4NQSA 4P9ML 3W2DL 3A6OA 3F7RA 5CCKL 5D96C 1S9VA 2VXVH 5LCVL 3PDDA 1A2YA 3PXJA 3QFDB 1A6UH 1ZA3B 2VXSL 1N26A 1XF5B 1NEUA 2FATH 2HFFA 3FQWA 5D5MB 5C0ND 4JFZL 1NCWH 2ZSWA 1QBML 4IEFB 1J8HA 5BO1L 5IROA 1YEDA 2MSPA 4NPYB 1MVFA 5K93A 2P7TA 2AGJH 1NCDH 1WAAA 3PWNA 1QHOA 1Z9MA 5M7QA 1S7UA 3MJ9L 3LKRB 1IQDB 3P3YA 4JHWL 1FV1B 5CEYA 3QWRA 4NKOB 2XQBL 1GCFA 5I2IB 1IGJA 5I1GL 5L88L 5I8CB 1DCLA 1Q9OA 1G7PA 2E5EA 4RRPA 1IAIM 1MHPH 3RWGB 4QOKB 1FORL 5DJ8A 5L7XL 4OZGF 3THMH 1NPUA 3QUXD 1F2QA 5DJYA 3U79A 1IM9D 2Y6SC 5C0JB 5BVJB 4GBXD 2VXQH 3TV3L 1FFPA 4P23C 4OZHA 1TTGA 1KB5B 3I6KB 3C2AH 2GITA 4LRIC 4G3YH 4WU7B 2CR3A 1U8KA 1FO0B 3W9EA 3ULUL 4X99B 1IEHA 4M7ZC 1S78C 5IW1A 2O93L 1O7VA 3QFJE 5IIEA 1CG9B 1VFAB 3K3QA 2YD1A 3U9UB 1D7FA 5FAAA 3NFPA 3MROA 3PWVA 4L29A 4Y16C 3M45A 3WDIA 2YD4A 3RUGE 5D7LB 5EU3B 2HJFA 4O9HL 4JREC 2VE6A 2D0FA 3TBTB 4PG2A 5C0DB 3LN9A 2VZTA 5HY9B 3LH2L 3QDME 3LEXB 4UZGA 1OHQA 2J8UF 5DJXA 5C0CB 1Z9SA 5IVNA 4CMHB 3SKJH 1EJOH 4Y5YC 4KTEL 5EIVA 1LP9E 3BRGC 2AJXH 1GIGL 1JV5A 3FQUA 1BFOA 3ZKNC 2NW2A 2VLRE 3ULVF 4LHUG 3B9KB 4OLWL 2B39A 2A74B 2DOCA 4X6BB 4OCYL 2M2DA 3IU4H 5GRJL 4UV4L 4HH9A 2DWEB 2P48B 4PJDE 3UPCA 1IVLA 4P5KA 5A16B 3U0TA 3KPSD 4ZAKC 5GGUB 5FHBL 3TBSA 3HG1A 1PG7H 2V17H 3O4OC 4RMRA 5B3NA 1AI1L 3O8XD 3BQUD 3DRQA 5C0AB 3O0RL 1O7SA 4KQ3H 2APFA 5HJ3B 2X4UB 1S8DB 2I60H 1WTGT 3NZHH 1QFWM 3V8OA 2DMKA 1N3NA 1ORQB 5EBGA 1S9WA 4LLWB 5FK9A 4JQIL 5JO5A 1U3HD 5C8JB 2XZZA 1VFBA 4KRPD 1AQKL 1JWSA 5MI0B 3VWJA 1UVQB 3OAZK 1MIEL 4YFDB 3PWJA 4ONFH 2AKRB 3FT2B 3H7BA 1DQLL 1MCFA 4NQXB 3MLYL 1TIUA 1S7SB 1ZKAA 3OR6B 4HWZB 1CL7L 4Q74A 3GBMH 3QNZA 3IAGC 4NRXA 2IH1A 5IQ9A 2H9GA 1A6WH 5BZWB 3S4SA 4NN7B 3WXWL 4ODXB 4QHLB 1UXSA 2W1NA 1WWAX 3F6LA 3D2UB 2JJVA 2YPVH 5C09E 3HNVL 4X5XB 4S1SL 1AIFB 1T1ZB 1BD2E 1IZKA 5DS8A 5D1ZD 3CPLB 1JPTH 4OI9A 4MWFA 4M4PA 5DGQA 2E9BA 4MA3A 3ARDA 2WUBH 4E9LA 4D9QE 4S2SA 3J8F7 5EBLA 2AP2A 5I8KH 4PJEB 1T66C 5ALBL 4JFQA 1WCBA 5DZNA 1C1EL 1F3DJ 2HVJA 5A2LH 4PJIA 3WFHA 1YECH 3WE6A 4ZPVA 5EC2B 2O5XL 2HFTA 4G8FB 1AGDA 1W0WB 1KTDA 4XC1L 3W0WB 4AIOA 3O3AB 1P7KB 1DTUA 1D6EB 2XQYG 4IHOB 3LRGA 4PJ9D 3KYKH 3O2VH 4AENA 4UOW0 5CGTA 1KYOK 1LWRA 2EYRB 3GNMH 5EUKB 5C0GB 4MHHG 2FLRT 3MOAL 2VIRB 2W0FA 1TJIH 5IBTL 4HUUA 2VLJD 3RDTC 2P45B 1MRFH 2VAJA 5ABDE 2JJUA 5HHPA 5KSVB 5I16A 4ZTOL 2EH7H 3EO1A 5EIIB 1V7MH 1JPGA 1T1XB 1IAOA 5HHXL 5MEOA 1MJJA 1BOYA 4HXBH 4EVNB 4JO2H 4KTDH 5E6YA 3SKMB 1MQKH 2NY0B 1SEQH 3QIBC 4B0MM 4RNRB 2GIYA 4QNPF 4PJXA 3VCLB 3WIIH 4P4KB 1RUQH 4G43A 2XWBA 1QBLL 2BNQD 1MREH 3PXHA 4XMPH 1R5IA 3VDCA 5EZIL 3JV6B 4OLVH 1JGLH 5IM7B 5AD0A 3L3KA 3O81A 4POZC 3SQBA 3WL9A 2A9NH 4IRSC 1RJZB 1I7UB 2FJFA 1CVSC 1QSED 3IJSB 3LKQB 4QRUB 2E7HA 4NNPL 1QRNB 2EO1A 4A2LA 1R3LA 4LPVA 4F33A 1NUNB 3TPUB 3BZ4B 3VXPA 4XWOC 4PYHA 4TQEL 3C60C 1EDQA 1URLA 4WHTB 4NZUH 2NXYD 5MP6H 2A83B 3ZE1F 3MV9D 5E8NA 3TH3T 5T1LB 4LCCC 1CFTB 3NPZB 4LSRH 4HS6A 3NH7L 3V4PH 5FYKH 4OFYA 4BH8A 1YDPA 1ADQA 2BY2A 3HKFA 5E2WL 2ADIB 4R0LA 5D2NC 2J6EH 4YBLC 5CP3H 1NBYB 1FAIL 1HXYA 3BIBX 1TCMA 3HZMB 3ULVC 1NGPL 1J1PL 4BZ2L 1IEAB 1BVKA 2H45A 2ENYA 3C2SA 2R2CA 3DETC 3MXWL 1UJ3B 5I15H 3EFFB 1D5BA 1KJ3H 3GKZA 1FGNL 5B39G 3CX5K 4KK5D 3RWFA 4DGIL 1KXQE 5TPWL 3U1SH 2XYCA 3HC3H 5IVXE 5F9OH 5DJ2A 3NIFF 1J1OL 3ULUF 4IRJC 4CGTA 2XY1A 4PRID 5HDLA 1M71B 3RZCB 2Q1EA 4ZFGL 1NL0H 4R2GB 1GAFL 5L2KD 1OWWA 3U7YH 4P9MH 5IF0A 3CUPA 4JFXB 1EFQA 3W2DH 1K8IB 4RA3A 2X9WA 3FCTA 3PV6A 2LTQB 3QCVL 4JRWA 5EU6A 2VXSH 5KOMC 3VGBA 3D6GA 4XCNB 1NC2B 1NCAH 3U82B 1BIHA 4JFZH 3I2CL 4D8PB 1C16B 2QQNL 5D1XC 1QBMH 1TNMA 4PJBE 1KIQB 4H1LA 4MDIA 3DGGB 4LLDA 4U1SB 5ID1B 1M4KA 3NCJL 3CXDH 4P2RB 5IB4A 5F9WC 1FVDA 1AC6A 5GRVK 4JHWH 1MF2H 4PJ7B 5DT1H 3UCRA 3WJJC 1RIUL 2B0SL 4PTTA 2XQBH 3BRFA 3T0EA 1V5JA 1FSKB 4Q6YA 2DQCL 5FGCB 3S96B 5JDSB 2YUVA 1FORH 4U1MB 5DRZB 5L7XH 4GKSB 5D2LB 3WNOA 1FBIL 1AGCA 4TVSa 4I0KA 2VQ1A 2HMIC 3KPQB 1TFHA 5GGRY 4QF1B 4EBQH 4HK3N 3TV3H 4H20L 5HHOE 5IJKC 3IJHA 2X4RA 1YEGH 4PJHE 3QDGA 4U6XB 5TFSH 2MKLC 5E94A 5DWUL 3T08A 4JFPA 3IRZA 5E6IA 3I3BA 1WIPA 2A6DB 4Z78B 1NUGA 3GJFA 3FB8B 4PGDB 3WHE1 4ODBD 1U95B 4M3JA 4X8XA 2D7MA 4HSQA 5DMJB 3BWAB 2YPKB 3MLUL 3KLAB 5B38B 3D85D 3BN3B 2ICWB 1T5XA 1LDSA 4NQDA 4TSAH 2R2EB 3MRQB 1WAAE 1SJXA 4GUPA 4HD9A 4U6VH 1OLZA 3LH2H 4NQED 4D0CA 1D5MA 3LZFL 2ZG3A 1FZJB 4RGNB 3MLSL 3HFML 3L5JA 3CFKA 3D3VA 1U36A 3MNZB 2EDTA 1G7HB 2UYLA 3GB7B 3EIFA 3OAUH 3GSVA 3ZTJG 5I71C 2BVOB 2KQNA 1GIGH 4F7CB 3EOYG 2RBLA 4MXQC 5TE6L 4N8VG 3ARGC 3KYMB 3MREA 4KAQL 5CLTA 1CICC 3JTSB 2AVGA 4JM2D 4OCYH 1A0QL 1BEYH 1A7QL 4RDQG 4UV4H 1LO5B 4H26B 1RQ5A 4OZHE 3WS3B 4XMKH 3QXDB 4HFWB 5KN5A 5FHBH 3QPXL 3QWOB 1DBML 4JHAH 2GCYA 2VQTA 5IB1A 3TA3A 3I9GL 1EGJL 3HS0B 4Y0GA 4WJ5B 4KKBC 3O0RH 1UXWA 3MNVA 2CMRL 4HK0A 4DFIA 4LLYA 5CZXD 4QYOB 3RWDB 1IFHL 2OMNA 3B2UD 4CBPA 1I1AA 2AK4D 3KPPA 4JZOB 4JQIH 1GJIA 3BH9B 3NFSL 3C5ZD 1RJCA 4PJ8C 2CKBL 2Y72A 3WKML 1MIEH 2DLTA 4DGYL 3KPOB 4MD0B 3GSWB 2QKIA 1S3KL 1DQLH 4TUJA 4YDJA 3TO4A 3BEWA 4O02L 4Z7WA 2NY2C 1SBSH 3MLYH 4ZXBC 3S5LA 2P5ED 1R5WB 3GSXA 2QBWA 4P2OB 5CHNB 3BGMB 1RZ8B 1IGML 3QEQA 3QHFL 4CAGA 2YUXA 5CJOL 3FHQA 4BQCA 1HSAB 3NABL 3ULSB 3WXWH 3RWJA 1HQ4A 1DVFA 3QUYD 4KKNA 1UJTA 2P8MA 3HNVH 1CXHA 3B4NA 4DWHA 5TGBA 1MCRA 5IMLB 5JXEA 4E41D 1WWWX 2F54A 2AJSL 3RPKA 4EI5D 5JOFB 3E8UH 4AJ0A 1BMGA 1IRAY 4YGAB 2PXYB 5CINL 1VENA 1YJDL 1HHHB 3CVHB 4X7TB 1AQDB 4MX7B 2APVA 1DUZB 2HH0H 1FVCA 3WNNA 1C1EH 5DVOA 1ZHLB 3VGAC 4QCIA 4V2CB 4P2QE 3ORJA 2CH8A 4L3EE 3S9DB 2XI9A 3WUWG 1ZA6B 5JW3L 2O5XH 2MKWA 4OCXH 5HGAB 3ULUC 2DD8L 3TZVA 3P4NB 5KTEL 3OWEA 4WO4B 1JYVA 1KLFA 3NAAL 3ZTNH 3BPLB 4NUGL 5B8CC 4WY7L 4OTXH 3QFJB 2F15A 4OGXH 3DX6B 4YHKH 4YX2L 3RUGB 4NKDB 3MOAH 2ICWI 2PO6D 5I1IL 3VFOB 5ILTL 2FEDD 5IBTH 1N7ML 3QIUC 1ZANL 4LKCA 3VD4A 4FABL 1CDUA 4N9GA 4EIZC 3FKUS 3QDMB 4F3FA 4LDOB 1NFIB 3O2DA 5D1QC 4ZTOH 2X4SA 4WTZG 4EIGB 4YHYB 2OL3L 1JK8A 2YR3A 4JO1L 3X3FH 4G9FE 1U0QA 4JRYA 5JTWA 2BZDA 1U8JA 4ONHB 1ZOXA 4GW4A 4HF5L 5INCA 1LP9B 1B6UA 1P7QB 4WW2B 1T7ZA 3DXAD 2VLRB 2ICEB 2MWCA 1SY6A 2J5LB 4KXZH 4YHLL 3I6LD 3QQ9D 5DDHA 1X5ZA 5ACZB 4PJDB 4PJIE 4U6HB 3VD9A 4NZRL 3QJFB 3LSOA 4X7SL 1J0ZA 1AO7A 5IW6B 1XIWC 4WW1A 5EZIH 3GI8L 2P1YA 1KUMA 2EC8A 3BPOB 1YMHA 1L9MA 4HS3B 3O3BB 3INUL 1I9RL 2QSCH 2MQ3A 5DJCA 4D3CL 2DYPA 2CRMA 4WI8A 4NNPH 1Z2KA 4P23A 4EOWH 1T6WA 4R7DA 4LCIL 1FYTE 4LLQA 1XGRB 5INDB 4KI5E 4FQIL 4XP5L 3AMKA 4LRIA 2DS4A 5IOPB 4CW1B 2V5SA 4W81A 4J2XA 2VDRL 1OP9A 4TQEH 5KANI 4CUCA 2X89D 3QIWB 3WNPA 4MA1B 3GJFK 2GJZB 1QQDA 2DAVA 4Y16A 4OT1L 3PP4H 4YBHA 4BFEA 1T0MA 1WZMA 3L3JB 1X5XA 2AEIT 3DYMA 3QCTH 4PGBA 2P47B 5BV7H 4Y19D 4ZUSB 4L8CA 2DKUA 5DEGB 5CLWA 4BSVA 2XWJB 1JVKA 1A02N 1P84K 5KVMC 2NZIA 2P4AB 1N6VA 1HZHL 4JHZA 4QHUA 1AXSB 4QRQB 3O6FC 4DQOL 3TBVA 3GJEA 3TNMA 4Y8AA 3WLWC 4FQCL 3MUHL 1RZFL 3REWB 4DN4L 4Y5YA 1NGPH 3RY4A 1J1PH 4BZ2H 1NGZB 2HT2C 3RGVC 3T8XA 1BD2B 2NZ9D 1TVBB 4MD4A 5C0EB 4LNVA 3MXWH 2FGZA 2R2HB 4X6CE 4RGMC 1XF2B 3MBEC 4DGIH 2KL6A 1ZMYA 3FQRB 1CBVL 5TPWH 1T4KB 1LHZA 1PAMA 1XGTB 3ARUA 1J1OH 1MOEA 4S1QH 4F2MB 1GRWA 5GSVA 5T1KB 3ILPB 3F5WA 4UOW1 4ZAKA 3LMJH 3MJ7B 4YUEL 3QQ3A 1T04B 4ZFGH 1YQ2A 4Z18A 1GAFH 5FM8A 4MJID 3EZJB 2F53A 3HMXH 4OGYH 1IGYB 3ZKXC 3FRUA 2WWMD 4N5ED 3KLHD 3QCVH 1A5FL 5IMOA 2R1YB 1LE9B 3GSUB 4APQC 1SJHA 4ZUUB 2VLME 1NCTA 2Z8WC 5H2BA 1DQDL 5HYSB 3I2CH 3I02B 3IFLL 1TZIB 2ESVA 3KPRA 5ACMA 2V2WB 3TEUA 3UDWC 1OTSD 4M4RA 2NTFA 5EH1A 4JZNA 3IDYB 2BVQA 3VXTA 1NEZB 3LIZL 4WNQB 3QEHA 1XCQA 3MLXL 1T2XA 4HFUL 5DURB 2V7NB 2DM4A 1C5BL 4NOFA 5HGDA 5FIEA 4HKJA 5GSRA 1RIUH 2F19L 3V5DA 5HYJE 3BP6B 4DOHE 3CZFA 3CFJA 3G6DL 5F3HA 4HDIB 5E9DE 4YEFA 4ZFOA 5DD5L 1F6LL 3EO0A 4IDLA 3DRTA 3BIKB 3D48R 2QADB 1I3VA 2VLKA 3IS0X 3TCLA 2XPGA 4IIQB 3DI2B 1KPUB 4X6EB 2Z8RA 2BERA 4I77H 4H20H 3RX8A 1OD7A 3CDGB 2YOCA 3MBXH 4AM0B 2VJXA 4GKNA 4LIQL 1R0AL 5J7CC 3CC5A 5L2JB 3BUYA 1OLLA 2ENSA 1JGDA 1PEWA 2PTVA 3D87B 1P53A 5C0BE 4F8QA 1KTLB 4R3SA 5D7KE 5FA4A 1UZ6F 4G7YL 3CVIL 3MLUH 35C8L 2DWDB 5IUSA 2YPLA 5IEKB 1NMCB 3EYOB 3L9RB 1UM4H 4UV7H 1IC7L 4XHQA 3BGFC 1ZSDA 3QG7L 4Y4FB 5GGSY 1QACA 2LQRA 1XR8A 3RDTA 1G7JA 1MCOH 3VFMB 2A6JB 3UAJC 4XH2A 2IAMB 5CD3A 5DRXB 4C83B 4E5XA 3D69A 4X5LA 2VDOL 5TE6H 2DF3A 4KAQH 1SYVA 4UB0L 3CLEH 3CSGA 1NGQL 4OD2A 1A7QH 3D1MC 2VNCA 1EA9C 1QA9A 5DUBA 4ZODA 4ENED 2KH2B 2OI9C 3QIBA 3QDGE 3F58L 4JRXE 2NY5L 2APBA 3VXMD 4P3WA 2W0LA 1DBMH 5C0FA 4OZGA 1DL7L 1CF8H 1JMZA 4F15C 3I9GH 4EEEA 1EGJH 4RFOL 5IVXB 3OAYH 1NQBA 5E00B 3LV3B 2CMRH 4J3UA 4IRSA 2D9QB 3R0NA 3GSNB 4M03A 2N1KA 3ZMRA 3OF6D 4KHXL 1N2RB 2XZCL 4BQ8A 4PRHD 3WKMH 2BMKB 1FL3A 4DGYH 3QUXC 3VMOA 3L3IB 4HKZB 4NBXB 1J8KA 4KKCD 3D3VE 3MLVL 4U1IB 4GBXC 4QHMA 2V5MA 3C60A 2PCPA 1IQWL 2W0KA 1KF9B 1IGMH 3MUZ1 1U8QA 4LU5L 3E6HB 5CJOH 3U0PA 3IAQA 4NJAH 1ZHBB 3QBTB 4NRZA 2JIXB 5F7NC 2XZQL 5AUMB 2XNAA 5E1HB 2OXHA 4R97B 4MQ7B 5DTFA 5HI5D 1OWRM 2OSLB 4LSTL 5D2NA 5C07A 2AJSH 1ZT7B 1OVZA 1VSCA 1DQTA 1WZKA 2I5YL 5GRYA 5C08A 5CINH 8FABB 4RFEA 3TVMD 4JPIA 4I2XA 1Q9LA 1J0IA 1TZHB 1YJDH 3BZEB 1UG9A 2DI8A 1HSBB 1CQKA 3AU1B 4M8QA 5HHOB 5DA0B 4YDLB 1UM6H 4O2FB 3B43A 3PGCA 5JW3H 1E4XI 2DD8H 1DQJA 4YHIB 1S9VB 4PJHB 3VE0A 5KTEH 1U8IB 3U0WH 2EDDA 3MRNA 1YEHH 2NX5E 3NAAH 4IRJA 3KS0H 3GHEH 1ZEAL 3MCKA 4FMKA 4Z7WE 2X4PA 4WY7H 3RWHB 3G5ZA 5HHNA 5EZJA 1G7QB 4G8GE 1S9XB 1JF1B 2FWOB 3WKNA 3MRGA 3QEQE 4NNYA 4M7KL 1OSZA 5D71L 5SWQA 1N7MH 1FLRH 2VSCA 1ZANH 4DUWA 1DBBH 4RAVB 4FABH 3PWNB 2W9EL 3BQUC 3O8XC 1KJMA 5I18L 4JFDD 4YZFF 5GS1C 5D1XA 1BX2B 3FOMB 1DBJH 2OL3H 1IGJB 5DD3H 5IJVA 1U3HC 1C8PA 2B4CH 4HJJL 4KRPC 3TIDA 1CD9B 4PIRF 3BMWA 5E5UB 1A47A 3FL7A 1Q9KA 3AC0A 4NRYA 4YHLH 4Z7NE 3WJJA 4K23L 2X4NB 4AIZA 3ISWA 4I0PB 3V9FA 1NMAL 3U7AA 2NY6D 1FFPB 1AJ7L 2WBJD 4JY4A 1TTFA 3GI8H 4HGMA 3BVNB 3RU8H 2VRAA 2FEEL 1WITA 5EOTA 3OMZA 5EWIL 1I9RH 4D3CH 4LCWA 5IJKA 5FDYA 4JZJB 2NXZB 3EDDA 3NFPB 3UTPD 4LSQL 1FNEA 2XTJD 3KDMA 4XP5H 5D1ZC 1BP3B 4U1GC 4HX1A 1C7SA 4S1DD 1RIVL 3OKEB 3P2TA 3V79C 5LGJB 1MWAL 1A14H 4ZUTA 4M6OL 3UTSA 4PR5A 3K8KA 1CS6A 2DJUA 4JRYE 4IOIB 2VC2L 3FQUB 4HIIB 3IT8D 5F6IC 5I6XC 1I7RA 5FB8A 3IKCA 4M1DL 1GPOL 4NFBA 4LCUB 4DQOH 4HH9B 4FQCH 3BYTA 3PP3H 4PJGE 4DN4H 2BOCB 4ZO8A 5CP3A 5F6HI 1AO7E 1OGTB 3FQNB 1YJDC 3MRPB 3ARGA 1J12A 1CICA 2M26A 1VEMA 1XGYL 3NCBB 3D25B 4NQVA 3A6CL 5MEND 3K81A 3B6SA 3DROA 1B4JH 1N3NB 4P2QB 2QQQA 5JO5B 4L3EB 4GAYA 4D0BA 4WDIA 5F1NA 4YUEH 4YHML 4WFFD 1W0VA 4JM2F 3PWJB 1JZ4A 3T3PF 4WI3A 1A7NL 3CCHB 4YDVA 2VZUA 1IAII 2R4RH 3O4LE 1JWUA 5D70L 5IESH 5FGSA 2P8LB 1A4JA 3NA4A 5CIPB 4NRXB 4PJ8A 1CXFA 1DQDH 4XP6L 4NOBA 3MRKB 4XBGA 4UAOC 3AMLA 4GKOA 5GGVH 4ZXBA 2BVEA 3HAEG 3VRLF 4IMLA 5F96H 4U1LA 3MLXH 3O3DB 1YEKL 1YNTA 4G9FB 1C5BH 3RL2B 4YDKH 3MJ9A 3FFCA 1IC5L 1GOFA 2RCSL 4KFZC 5E08L 2CK2A 4R8WL 3VFRA 3G6DH 3BHBA 1HCFX 5AYQA 2NXYC 5DD5H 1TENA 4MJ6A 4P46D 2VZOA 1DN0A 1H3PL 1I8KA 1IILE 1QG3A 4GS7C 5I1LA 2LVEA 3WE6B 1S7VB 1RZ7L 1I1YB 3LQAH 4JVWA 1INDL 1CXLA 1AGDB 3N1QC 3IGAA 4HG4J 2YEZA 4S0SD 4IJ3B 4YFEA 1R0AH 2VLLA 1M7DA 3E3QE 2W07A 2XWTB 3QDJA 5D93B 3MJ8A 4C56A 1FYTB 4EDXB 1NFDF 2VDMH 1OGAA 3OXRB 1KLGB 4Z76A 1K9TA 4GG6F 2ESVE 2AI0L 2CK0L 35C8H 3CVIH 5B8CA 4KY1L 1MAKA 4EUPH 4PGCB 2DQEL 4LLMA 4KK5C 4PLNC 1IC7H 5I16B 3FB6B 3MLRL 4HZLB 1GZPA 2FX8L 1WUNT 3QG7H 2XA8L 4RCAA 3BZFB 2YD3A 1IAOB 1QD0A 5J6HA 3HZVA 3QIUA 2KPNA 1QFWI 3HR6A 4PP1D 1AFVL 4OZ4A 4U3XA 1M05B 5D1QA 4X9FA 2ATPB 3FMGL 4NN5C 4M7JH 3TJEL 3ZDXE 4O2EA 4OCWH 3KWWB 1YQVL 2JELH 1CT8B 4UB0H 3H9HA 1G6RA 2EIZA 2ATKA 4MJ4A 4TTDD 5J9PB 3V4VL 3KPNB 4CN6A 3WL9B 3EYSL 3WHXA 2FJFB 4PP2B 3SDCD 5F72S 4DFHA 4X6CB 3F58H 2Q3ZA 2HKFL 2YMXH 4XNQA 5GGTL 5IHZA 1XGPA 2ZG2A 1M7XA 1R3LB 4RFOH 1XIWA 3BH8B 4F33B 4DKEL 1OW0C 1CGWA 4I8DA 5A3ID 2QQLL 2PYEA 2DN7A 2OCFD 1C08A 3P4MB 1RU9L 4KHXH 1CFSA 2XZCH 1VB9A 5E5RB 4CN1A 5KSAB 2BNRA 5E8NB 2C4FU 4FXGB 2YSSA 3F8UB 3OKLA 4H5SB 1X5FA 3G04A 5MEQB 3MLVH 1JRHL 2EDWA 1DP0A 1IQWH 1OSPL 4JHBA 1V7NL 4ZMAT 2PETA 4IDJL 2R0KL 1K2DB 4LU5H 4MNQA 4AEIL 4JJHA 2PTTB 3BPCA 3QSKB 4CMMB 5GZOD 1I4FB 2PW2A 2VDNL 1K4CA 2D7TL 3PUCA 3OKOA 1MJ8L 2XZQH 2IPKA 1UADC 4R4FL 2XN9A 4U49A 1X6NA 1RURL 4IOFC 2XFXA 4YHZL 4EJ1C 5GZND 5HYJB 1TVHA 1TJGH 1DUYB 4DOHB 6FABL 3O6FA 1IEBA 4Y4HC 1QLEH 1UB5A 3SPVA 1LE5A 4K71B 2I5YH 5E9DB 1OOAA 1UQSA 3LKPA 4OZGE 5EORH 4KH2A 1UYWL 3G5XA 5IFAH 4NKMB 1BQUA 4YHPA 3RGVA 4Y1AD 4XP9H 3DNKA 2OYPA 5TDNA 4X6DE 2GI7A 3NMEA 1VFMA 5DMKA 1QLRA 3BE1L 4DK6A 9CGTA 3MBEA 1K5NA 3EDEA 2IAND 5C70A 3PV6B 4L4VE 1MEXL 3G9AB 5KAQF 1KJ2H 3QDAA 4JM2C 1ZEAH 1FIGL 3SKNB 2UVFA 5C0BB 1RY7B 3L7FA 4KJYA 2OR9H 1A7BA 4PRBA 2GAZA 1BQLL 1D6VL 4HS8L 2EE9A 4N1HB 4M7KH 5K9JL 2V7HB 2AJUL 3GRWL 4APQA 2W9EH 3NZ8A 5I18H 4LHUA 2J8UE 4QRTA 4X4YB 5CKAA 1MNUH 3M17B 3VXQA 4M02A 4K3DL 3ARBD 5CZXC 3B2UC 4X7EC 1UZ8B 2L7JA 5JIPA 3UDWA 5D2NE 4NZTL 4OFDA 5C07E 2IBBA 2K3TA 5L8LB 5IVZA 4K3EL 1U6AL 3WDJA 1CD1A 3C6LD 3C5ZC 5C08E 2NW3B 2A6KB 4B5EA 4U2ZA 3OKMA 5FYJD 4HLZG 3FQXB 5I74B 2HJKA 4K23H 1BVLB 1NMAH 1AJ7H 4AMKL 1E28A 1P5UA 2EDBA 4V1DA 4UDTA 4CVXA 2NY5C 3DTXA 1I85C 4R4BB 5IKCA 2CGRH 2FL5A 4C59B 2NY4B 5L9DH 1W72B 3MACL 4JRXB 2ZOLA 2FX7H 1NAML 3W81A 3QUYC 2CLZA 3GJFB 4ELKB 2B8OT 1BGXL 3FO0H 3X12A 1J8HD 3C8KB 3UBXG 4JVPA 4LSQH 1T7YA 1ZHKB 5FM4A 4EI5C 1QLFB 3SQOL 2CDFA 4Z0XB 2EDYA 1MI5A 5D7JD 1RIVH 5DI8B 4PTUA 1S7QA 5J12B 5IG7A 5J1AB 1UFUA 1S7XB 1FNGB 2EDHA 4LLVA 5CEZH 3C08L 4Z0BL 3D3VB 5I76B 2FBJL 1HEZA 4Z7UA 1XF3A 3F62A 4HMEA 1NGXB 4LEXH 5I1AB 3RTQB 2R4SL 2DIJA 4GQPH 3WDHA 3ARSA 4M1DH 3QUML 2WK2A 3TO2B 2HG5B 2P5WE 2FRGP 4F7EB 5JIIA 3G6AA 2DMBA 5DZOA 2ZUQB 5ALCL 2PO6C 4FFVD 5KN5B 2FEDC 4LKXA 5CSGA 1Q0XL 1XGYH 1R24A 1WBYB 4XCCL 4LCWE 1Q9WA 3A6CH 3HI1A 3QUZB 1YEJH 5EDXA 5C2BL 5EFIA 2Y7QB 1U8NA 1SM3L 4X4ME 5EB9A 2VDQL 5CP7A 4YE4L 4YHMH 5HDQL 1HINL 2NX5B 4XGZA 3AREB 4XHJD 3EGSB 3QQ9C 3C5SB 3GMNA 3S36L 3GSXB 4G8GB 3D39E 5D70H 3HUJF 5AZEL 2R0ZL 1LK2B 4X80L 3L3OB 4QY8B 4XP6H 4FTVD 5FYKE 3QUXA 1KBGL 2OTWB 5LXGH 3TLRA 1IM9A 3NVQA 4ISVA 4NDMB 1VFUA 4GBXA 3ZL4L 1HK6A 2W65A 3DUSB 3AS0A 5T3ZH 1YEKH 1CYGA 1C12B 1ZV5A 4L8BA 3HG1D 1GC1H 4MLSA 1JFQL 3Q6FA 3MJGX 4P4RA 2RCSH 2UZIH 1G0XA 4D9RD 5IB5A 3UPRA 5DSCB 2I25N 4R8WH 4GAJL 1X5IA 2CRZA 4P99A 4JB9H 4QNPE 3MGTB 3PQYA 4HCRL 4QTHA 1H3PH 4L9DA 5FCSH 1RZ7H 5I8EA 5J6GB 1P6FA 1YA5A 1INDH 3TZVB 3ZT6A 1K4DB 3PHOB 2ZUTA 3VMNA 2C9AA 3MV8D 2V2XB 5KS9E 3A0OA 5DRNA 2BK8A 4NO0B 5D6DC 4JM4L 3S36X 2QTEA 5J13B 1KGCD 3LQZB 4M61A 2H26B 1FFRA 1B0RA 2PUQT 3B9DA 1ES0B 3LEVL 2RJMA 4HUXB 1DDHA 2ORBL 3GGWA 2AI0H 4N8VB 2VR4A 4JO3H 4HIEA 4KY1H 1FNHA 1Y18B 2Z8VC 2DQEH 5JHDE 3QO1B 4JFYB 3ZE1E 3MLRH 1MCKA 3FOLA 3JV4A 3ROLA 1MFCL 1E4JA 4JRYB 2BCKB 2XA8H 1QVOB 3KPSA 5SV4A 5DK2B 1AHWC 3TNNA 3GMMA 3HA0A 3KG5A 3O8XA 3BQUA 3MYJB 3RWIB 1Q0YH 4PS4L 3EYFB 5GS1A 4Z7VF 3FMGH 1A7PL 4GAFB 5JIKA 5LQBL 4OF0A 5DJ6B 3TJEH 1YQVH 2WWMC 4N5EC 3KLHC 2EO9A 3AXLB 4PJGB 4ETQB 4OB5L 2YKLL 3OX8B 1UCTA 3LRSA 3V4VH 3VI3F 4XX1E 4ODWA 1EEZA 3EYSH 5DYOA 2JK5B 1J10A 2MCPL 4YH6A 1OTSC 5J11B 1FRGH 3MC0A 5GGTH 2G60L 1T0NA 2NNAA 1BZ9A 4PV9B 1XH3A 4MD5A 5T1MA 4R7DB 3NIFE 4DKEH 1EGJA 3V6OE 2QQLH 4GQ9L 4M7ZB 4I3RL 5D7LD 2YBRA 5FDWB 1FDLL 3OR7A 1UH4A 4OZFB 3HI6L 3O6ML 2CKBA 2A73A 3O4LB 1S7WA 4X9GA 1LK3L 5D1ZA 5CAYB 2NYYD 3CMGA 1JRHH 2H32H 5FM5M 3H9SE 1OSPH 1CD8A 4AIXA 4BSVB 5MEPA 1V7NH 3TYFA 4AEEA 3OHXB 1IBGL 2R0KH 3F7VA 2BSED 4GRWH 4AEIH 5FO8B 3C9NA 3K2MC 1CWVA 4J3WA 4ZO6A 4OQTL 5IK3A 2D7TH 3P0YL 1MJ8H 1CXIA 4Y4KD 4R26L 4MD4B 1RURH 4YHZH 4OSUL 3VJ6A 4CN4A 2ERJC 3SY0B 5C0RL 5C6TH 3BKMH 5FO7A 5F7WC 1NJ9B 3P73B 5DD0L 1T7WA 4LVNB 5FA3B 1LEKA 5C0AD 2EZ0D 3F5WB 4WI7A 1Y6MR 4MA7H 3W9DA 4ZFZB 1SEBA 1JHTB 4LF3A 1C5CH 1T21B 3BE1H 3HRZA 3RVVD 1CDYA 3SDAB 4I4WB 1IMHC 2EXYC 1HCVA 1JUFA 1YY8A 5GGRA 4YR6B 3MFFB 4OFYD 4EQ3A 5FUZL 5FYJL 4I48B 4JANB 5T5NG 1VACB 3GHBL 43CAA 2Z4QB 3MRBA 1BQLH 2OP4L 5SV3A 5E03A 1D6VH 4HS8H 5K9JH 3OJDA 1E27B 2AJYL 5DA4A 3G9VA 4XVSL 2AJUH 4N0YL 1X7QA 3GRWH 2J12B 2BNQA 3V8CA 4MB5A 2XN9E 3D2UD 5HGDB 4PRAB 4DGVL 4TYUA 5CEXB 4CADB 5FOJA 3DO7B 4K3DH 3CFDA 4MAYB 3MZGB 1OTTD 2EDXA 4TSBL 4NZTH 4UIKH 4M43L 2OL3A 4LSVL 5F3HB 3TH4T 1U6AH 4KUZL 3DV6A 3MRDB 4J3TA 3FJTA 1F02I 1HNGA 2X2YA 2UUDH 1V3JA 3OKNB 4KKCC 4L4JA 1AXTL 2KUTA 1DE4B 1XGUA 3ME0A 3VXUD 4AMKH 5TDOA 5HDBF 3S88L 1BM3L 4QTIL 5DZLA 5EO9B 5TF1H 4GKNB 3MV9A 4HG4K 1NBVL 3MACH 4LP4A 3W0WD 1MLBB 3MTRA 4E42A 1RVFL 1NAMH 1F58H 5EO1B 1UWGL 2Y5EA 1RZJL 2JB6B 3K2UL 4TSCL 1LDPH 1GHFL 1MCCA 5CGYC 1BGXH 5KW9L 3SBWC 5ID0A 3CFEB 5HI5C 1HHGA 4Z95L 3MRJA 5FKPA 5IR1A 5DFVD 3MMEB 3QG6A 3SQOH 4YEEA 2GTWB 4FA8A 1I9JL 1F2XK 3KAAA 3TVMC 3CLFL 5FYLD 4N0UA 1CFQA 3KPMA 4Z0BH 2HRLA 5I19L 1LILA 3U7WL 2B20A 5E1AB 4QXTA 5ANMA 4JG0L 2Q76A 4WFHE 2C3GA 5HYEA 1WT5C 5HVGB 4K8RC 5HHMD 4E5XB 3UTTB 3D69B 5I17A 4QEGA 3CDCA 1AD9B 3O3EB 3MLPA 4FQQA 1LEIA 3V6FB 5FYKU 4PRIA 5FUCC 4QRPE 3ZYIA 2NY0D 4UTAL 5HD8D 1EBPA 4P4KD 5L2KA 4WI2A 4EDWL 3L7EB 3EYVB 3ELAT 5B4MD 1DFBL 3QIBB 3IDXL 5DJAA 5ALCH 5B3JF 5E6ID 2Y36L 3WUWA 3QXVA 4MB4A 3VW3H 2Y1VA 5DQ9B 3CX2A 4Q58C 4BUGA 4JFEA 3ET9F 4K7PY 4Z7QF 1MCDA 1QRND 4GXVL 4X6DB 1WFNA 1PJ9A 5ELIA 3STZB 1SM3H 2E6JA 3GSQB 4HBCL 5B21A 2VDQH 4YE4H 3T65B 2GSGB 5I1JH 4L4VB 3RKDD 5GIRA 1OW0A 3FONA 3BN9C 1KG0B 3OAYK 1Q94B 3S36H 2X4QA 3F7YA 2VXUH 4QHMB 2NY6C 3C60B 3QHTC 5T1LD 3BO8B 1M7IB 2WBJC 4ZSOB 4P57B 4WCYL 4X80H 3P77A 4NWUL 3C5JA 1R3KB 4JFOA 4LCCB 1KBGH 1KCLA 1HXMA 5DFTA 1DBAH 4MJ5A 2XNAB 2J8UB 1NBZB 4N1CA 3VFPB 5DTFB 3ZL4H 4G9DA 5HGBA 4ODSH 5D2NB 3OV6A 4OUUA 4YGVA 2Y06L 3B9EA 4LSSL 4WV1C 3N9GH 3TA3D 2NLJA 2H8PB 3ESUF 3R1GL 4WI6A 4S1DC 4XP4H 4GAJH 2FNBA 1W0YT 2YA0A 1GSMA 4RMSA 1I1AD 4HCRH 1VGKB 4M8QB 1HNFA 1EMTL 3E6FA 3D85A 4Y4HA 1WBZA 1OAYH 2C4XA 5IB2B 3RZCD 1DQJB 1JN6A 1MVUA 3RVXD 3M8OL 4R2GD 4NQEA 1CFNA 5I1DB 2IADA 3OPZL 2X4PB 4JM4H 3QISA 4JO4L 3QEUB 1G9MH 4K55A 1TQCB 3JUYA 3MRGB 4N0FB 1NC2D 3LEVH 4PJ5D 1V3LA 4FQLL 1F45A 5IMKB 5JLZB 4ELMF 4BFIB 1FJ1B 2H41A 4JM2A 1QSFD 3ARRA 2GY5A 4KQ4L 3EZ8A 5TDPB 4PJAF 4OF5A 4PJFF 3M1BB 4AQOA 4P2RD 1BQSA 1B0GB 1NUFA 4PLJD 3VG0H 3NN8B 4LLUA 2GJ6E 2DLIA 3QAZC 1FO0L 1R6VA 4RWYL 5FCUL 2K7QA 5IV2B 4AK1A 3VRJA 1KJVB 1II4E 2B1HL 1U8HA 4PS4H 2GYSA 2Y25A 4JLRA 3MNWA 5LQBH 5JDJA 5JORA 3ZT7A 3VWKA 1QEWB 1D9KC 1IC4L 2P5WB 2AK4A 4BM7A 3UYRH 5JUEL 4UUJA 1PEZA 2DBJA 1FAKT 4OB5H 1OQOA 1MELA 3C5ZA 1BZ7B 4UDUB 1EUTA 5FECB 2HFEA 1F4AA 2VWEC 2MCPH 2ADFL 3MA7B 4UTBL 2UY6A 5FO9B 4NUJB 3T4AB 2G60H 2P5EA 3P4OB 2WNGA 4KU1A 2VXTH 3HMWL 3MV7A 5B22A 1ZT4A 3ARFC 3CK0L 1UH3A 5HVHB 4W68A 2I07B 1JGEB 4HX1B 4K7PL 3NIDF 1U91A 5HI4D 1HI6A 5ESAB 3QUYA 7CGTA 1FDLH 3FQTA 1BLNB 3V5HA 5DJZA 2G2RB 3WXVL 3HI6H 2E8YA 4P46C 3O6MH 4PR5B 3UJTL 4L1DA 1BIIA 4LVHC 4E41A 1UACL 3D39B 4RGND 2R0LH 4EI5A 3HE6B 3KPSE 1ZE3C 3MO1A 1NFDA 1UM5L 1OB1A 5HXMA 3N50A 3FB7A 3CDYA 1CGSL 4XNMA 3SE8H 3HNTH 4GG6A 5LAXA 3IKCB 3KXFE 5TJWK 3T2QA 1IBGH 1EFXB 2ZP0T 1C5DB 3BSZL 3H9YA 2AJ3A 4ODVL 4OQTH 5H37G 2D31B 4UT9L 4AH2A 2CIKA 1S9YB 4NJ9L 4R26H 3RQ3A 2FZ3A 3DBXA 4AL8H 4YQXH 3ARGB 5JOEA 2V2TA 1FG9C 5C0RH 1UA6L 4WI9A 2DM2A 4B41A 2DQJL 2BVYA 3BD3A 3DUUA 5DD0H 2BXYA 1UT9A 3JTTB 3PP3K 3H7LA 2PO6A 2X7LA 3JWDH 2CLRB 4K7PX 3V7AE 1W0VB 3D0VB 4XPTH 4M1CD 3MLTA 4X6FA 1JNLL 5KS9B 4HJGB 2OZ4L 4YXLL 5HSFA 1JWUB 1Z5LB 4MMXC 1I8IB 1RIHH 1J0HA 1ZHNB 3DXAA 4PJ8B 4B7IA 4TTDC 5FYJH 4DK3A 1UZ6E 3GHBH 1ZVHA 3DURA 2OP4H 4X98B 2WWKT 3SDCC 2NY2B 1T5WA 2EC9T 5JHDB 2AJYH 5DQJA 4XVSH 2H2PD 4QXGL 4G7VL 4N0YH 3FB5B 1A1OA