2BP3A

Crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
91
Chain Sequence
MVNHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Gpib-Filamin a Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords FILAMIN A
total genus 18
structure length 91
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bp3A00
2W59A 5IVXA 5CZVH 3G5VA 4M61B 1FZKB 4RGOH 1RZ7H 5T3ZD 3WD5L 3NZHL 1XGTA 3MXVH 4JKLA 5BZWA 4OM0H 3BDBA 2E9JA 2W0KA 3UPRB 2WBJB 1NANI 1QLRB 4PUBL 1QA9B 2NX5D 3LIZH 4X6DF 4LGRB 12E8L 4QRPD 3ARBC 4N5UA 3OKDA 3WKML 4Y0GA 5C07E 4JZJC 2JKXA 1S7TA 3IF1B 1K6QH 4H26B 3S5LA 4U1IB 2NNAB 2XZZA 2OK0L 1Q0XH 2KBGA 3BIKB 3PWPE 4PLOB 3HC0B 4H88H 1CF8H 3VFNB 1J8HA 3BFOA 4U0RB 4XP1H 3WN5C 2CQVA 5SX4I 4NNPH 4Z18A 4Z7UA 1A1MB 3DV6B 2LTQB 1LE5B 3OAZK 2N56A 5DJXB 2G2RA 1MCJA 1I9EA 4LARL 1XF5A 2FX9L 1IM3B 4OF5A 2X4OB 4XI5D 3U2SA 1WV7T 1KT2B 5BO1H 5FHBL 4TTGA 2BSTB 4R2GC 1T3FA 3DLQR 5BQ7A 1ED3B 1C08A 3GGWA 3HMXA 3T09A 4UDUA 1BGXL 5C1MB 3L7EA 1F6LL 3TVMD 3C2AL 1IVLA 1KEMH 2E8YA 4NZUL 3T4AA 1D5IL 2YD4A 4D9QE 5IVXF 3O9WD 5IROA 1TQCB 4NP4L 5B4MD 2P42B 3HZYB 1F90H 1MI5B 5KZCD 3T2NH 1XF2B 4R4FH 5C07B 4NHUA 5F72S 5BOZG 2V5TA 5IOPA 2G75B 1J9CT 2XPGA 4S1DD 4UV4L 5F8RC 5IQ9B 1MNUH 4GW4A 5ISZD 3BT2H 1I8IB 4IRZH 2EE2A 5EZOL 5AZ2L 3VXRD 4U6XA 2A9NL 5IM7A 3EFFA 4LMQI 3FQXA 1H15A 4AM0B 4AY0A 1DBAH 3MODL 5FKAA 1P6FA 3RWCB 1ITBB 1WIUA 1MEXL 5HPMB 1Y6MR 2B20A 2VTFA 4KKNA 4P3DB 2WMPA 5JHDE 1OB1B 2XN9B 5DD3H 2ED7A 3ZDYE 2Q8AL 3SKNB 3CFBA 4XT1C 1HOCA 2VC2L 1YEDA 1JGEA 4R4BB 3MOAL 4ODWB 1F3DJ 2XZQL 1MQ8A 3QQNA 2PR4L 4S2SB 1WWBX 2NLJB 4LSRH 4MXQC 1IBGH 4XPTH 1I3RA 4PV9A 4JZNA 5DC9B 2J1KA 5F9JB 1P7HL 3SKUD 2YPVL 3OKOA 5J06A 4YAQA 3ULUC 5C92A 2YD1A 3CZFB 1EA9C 4Q9CA 1E27A 2QTEA 4WCYL 4Z7VF 1JK8A 4IOSD 4PP2B 2NZ9C 5FM5O 3SQOH 3S35L 3Q6FA 4E41D 1CFTA 2Q7YB 1AO7D 5D8JH 3MJ8A 4XBPB 2VYRE 1TQBB 4S0SD 1F6FB 1T2QL 4OZGE 1B4RA 1P7QA 5C0EB 4LF3A 3NIGE 5E9DE 4LCYB 2NY1B 4XHQA 2HVKA 4PJIE 3HUJA 3O4LD 3MYJB 5B22A 2DBJA 1S7VA 2DQFB 1WLHA 3KS0H 2EEDA 1HIMH 3VH8A 1QYGH 2MFNA 2VXSH 4LHJB 3HA0A 4M48H 4V2BA 1BZ9B 4R3SA 1IT9L 3DECA 1EVTC 4P2OD 5D7JD 1J8HD 4L29B 2VR9A 5I9QC 3DURA 2NY3D 4K3DH 1SEQL 5I1DA 3RI5F 4ZAKB 2OS7A 2BMKB 5JA8B 2DYPB 3FT3A 1OAQH 4GBXB 1MAJA 3U4BH 2LE9A 3UZQA 4XCCL 1T6VN 3MV8D 1QSZA 5IEHB 3W11C 4PGCA 5I1EH 5F7YC 2YRPA 4BQBA 3HC3H 2GY5A 5DRNB 3UBXI 3SDXA 5GGVY 1FNFA 2Y5EA 4IMLB 4XI5C 1JGLH 1T5WA 1KN2L 5JHDA 3TFKC 4PRHB 4F3FB 4DJMA 4G6MH 2OZ4H 5CJ5A 5DLMH 1K85A 1EO7A 2BJMH 3WNNA 2RJMA 4PJAB 1HKLH 4L4TE 5EU6E 3PL6A 3QIBB 3BRDA 4Q6YA 5BS0E 3C60D 1N64H 3SE8L 5LGHL 3ULSA 5M95B 3MBEB 4OCXH 5DS8B 4PG9B 3DWTA 4K9EC 3FB7B 3C8DA 3BJLA 4N8CH 1BFOB 4ONOA 2HT3D 3ARBB 4NKQB 1VPOL 2YUZA 4A2MA 1MCKA 4O58L 2QKIB 1G6VK 2GKIA 1T66C 3KPPA 3SDDD 5I73B 4O5LH 3S35X 4JZJB 5ICZA 5AWNL 4ZSOE 4HGWB 3ARGA 3P9LA 1IQWH 1QPXA 5I1KH 4HPYL 3V5KA 5FA4B 1U8OA 2MHAA 1A4KB 5BMFH 3MROA 4MVBC 2DQUL 4GXUN 3W5NA 1YEJH 2I9TA 3O4OB 2B7DT 4XVSH 3KPNA 3VE0B 5J11B 2YUVA 1UZ6F 4D9RE 2V2XB 2W91A 3BD3A 4GW5B 3VI4F 1ZSDB 3ARQA 4NPYA 3X14B 5EOQL 1DJSA 3VRJA 3HLAA 2R2BB 5A2IH 4L8SB 1G6RH 4Q2ZB 3HG1B 1IL1A 1WBZB 2X05A 2WWMC 2XZCH 5EIVA 5I1AA 1NBYB 4OI8A 3BWAB 3RTQA 4FXKB 4OLYL 4U4BA 6CGTA 1CXHA 1D5XA 1T2JA 1D5IH 4Z7WB 2BNRE 2WLZA 4RMRA 1QSEB 4JRXA 3QDGA 1W0WA 1WAAF 3PWLB 3ZL4H 3EO1A 4Y4FA 1WJ3A 4I18B 4QO1A 2CDEA 1M7DB 4MA8L 4HGKC 2NY2C 3DXAA 4EDXA 1NFIB 5C0GB 4Y4HD 4LHUG 3IJHA 1AKJA 4CDHA 4EVNB 4YHMH 5I8EB 1B9ZA 2HTKC 1KFAH 3KPQA 4JRXD 3O3BA 2Z91B 4YHYB 2HWZL 3VFRB 5KS9A 3HZVA 3C87A 4NQXB 4WEBH 2VISA 3FRUA 2WUBH 3AY4C 3KLAA 4NQTA 5CWSB 3WCYA 2CO7B 1LEKA 1F8TH 1KENL 3WSQH 2R29L 3LH2H 4Z7OF 3CPLB 2UVFA 2DBLL 4OF0A 2J4WL 5CEYB 3LKSB 2R0KH 2GI7A 5GGUB 3QJHB 3RZCA 1VADA 2LU4A 2XKNA 3BQUC 2ICCA 5L88L 3LKPA 3NFSH 2ZSWB 1JCKA 43C9A 4ONFL 4QRTA 4LNRB 3CU7A 3IXAA 3RWJA 3REWA 3BKCH 1WK0A 3KXFE 3WFCL 4Y5VA 2B5IB 2OTUA 3GI8H 1TTGA 4ZPVA 3PE9A 1JF6A 3QIWB 5TH2A 2FLRT 1SYSB 2E6PA 3P4MA 1VFUA 2KH2B 1MOEA 2X4UA 5CEXB 1SQ2N 5HY9A 5IG7A 1IQWL 3VFUB 1YUHB 2CKNA 5FCUH 2CK2A 4X7TA 3AXLA 4WTZG 2ED9A 2PXYA 2VUOA 1RFDL 3WDIA 2VLRB 4K94L 1RZIB 1Y18A 3KWWA 1HEZA 2G9HA 2YS4A 3OXSB 3UTOA 4JFZH 4NDMB 2HMIC 4JO2L 2VDPL 2YWYA 3HE7C 2IH3A 4PJCF 4QEGA 2B1HH 5HHMB 1MFAH 4RX4D 4YO0A 5LBSH 3ZDZF 3MRRB 4P4KA 5E5MA 4Z77B 1MCLA 1PG7W 4YAQB 4XTRC 3VFSB 2FEEL 1I4FA 3QXDA 1H0DA 3I6GB 1MCNA 4DKDC 4D0DA 5I1KL 3B9KC 2P8PB 3LEYL 5E8NB 1LE9B 4X6CA 3MRBB 1TJIL 3O2VL 4POZD 3IDMB 1RUAL 3QIUA 2FATL 4Y5XB 3OKNA 1AO7B 1I7RB 2EIDA 5MEOB 3IGAB 1JRHH 2VRAA 5F3BB 4JFYA 3F7YA 3TO4A 3MV8A 2AV7A 4PLKD 1S5IL 1EUTA 4TSBL 1XR8B 4M7JL 2VITB 5FGBA 3TZVD 4QXTB 5L2KA 1GGCL 1MF2H 3HAEH 1INDH 2Z8VC 1FLRL 4FRWA 1TPXC 5EIIB 1A4JB 1BECA 2H6PB 3U0TA 5FXCH 5B38G 3GSNB 3VFMB 3A67L 3RWGB 4H8WC 2D7OA 4ZAKA 4OUUB 5F3HB 5DK2A 3VFTA 4BSWA 1J5OH 4TQEL 3Q5YA 3L3IB 2OSLA 4K3DL 2AXFB 1UH4A 4QY8A 5DWUH 4OF3A 1BAFH 2R29H 1HI6A 3LH2L 2XRAL 2AJZB 3C2SA 4LBEA 4YHPA 3ZYIA 4OBRA 1KXQE 2X9YA 1BFTA 4GKNA 4X6CE 3RY4A 1PYWA 5GQBA 4LPYA 2EYRA 2PETA 3BW9B 3GIVB 2GTZB 1EK3A 3BKML 2Y07H 4JLRA 3G6AA 1KB5B 4GAFB 3GKWH 4GMSH 3KNBA 1NAKL 5D5MF 3RJQB 1NEZG 4CW1B 5EN2A 1HILA 1XGQB 4ONFH 3SDDC 1WWCA 4IRJC 5JHLH 4DKFL 4O58H 3QEQB 3QO1A 5GS3A 5CBEA 3HNTL 4R7DA 3QIBA 1CFVL 4HPOH 4LPTA 1B2WL 4PJXF 4Z0BH 5JPNB 2OYPA 1HKLL 1T7XA 1CFSB 1FGVH 2VO5A 2A6KA 2XKSA 3LV3B 1QHPA 1II4E 2EDQA 2VL5B 1QLFB 4P46C 1FDLL 4F7EA 3QAZB 1PQZA 3AFLA 5BS0A 2XQYK 2VDRL 3LQZA 2VZOA 3QISA 1RHHB 3B8SA 3ROOA 1ZLVK 3BAEL 4RAHA 3HZKB 3OSKA 2WWKT 1JWUA 3CVHL 4PJ9B 5D96C 3TFKD 1Z3GH 3S36H 2UUDK 1NGWA 1TIUA 1WZLA 2P46B 4N0RA 2MKWA 5DR5L 1G7LB 3V5KB 5HHXH 2H8PB 3VWKB 1AI1L 2ZPKL 4APQB 2XN9E 4HCRL 4NFBA 3UJIL 5IK3B 1YECL 3TH2T 2JELH 4QCIA 2CKBA 4TTDD 4H20H 2J2ZA 3TESA 3CSYB 5MERA 3MRFA 1P84K 4R4FL 1BM3L 3VWJC 1QRKA 5DD6B 4F7MA 5BOPA 2PKDA 4EN3A 4MS8D 4YFLI 1C16B 2AK1L 2YK1H 5D7JA 4A6YL 1OLLA 4LCIH 2A73A 4ALAH 2AGJL 1ZEAH 4HBCH 3DMMA 4HWBL 1EJ6A 1WFUA 3UBXG 5TJWK 4LQFH 4HKZA 1R3HA 3MV9A 4JM2F 2A0LC 4RAVB 2I9LA 4KTEH 3U0PA 5E70A 1XGYH 4NQSA 1NLDL 4XPBH 4LHUA 1J8KA 2P49B 1FFNB 1UA6L 4L3AA 4JRYD 3P77A 5LAXB 2YUWA 2OJZH 5TF0A 1XGTB 3QPXH 2N4IA 2UWEE 2EC9T 2Y23A 4QRPA 2I60H 1PEZA 4LRIA 3OF6D 1CLZH 1CF8L 5EUKA 5AYUL 4D8PB 1S9YB 3PWNB 1AQKL 4PG2A 5IHBA 2AERT 3OZ9H 4XVUC 4WJ5A 4FQHB 1NGZB 4KKAD 5IMOB 4KK9D 4OD2A 4PRIA 1CT8B 1YNTA 1UJTA 4XNYH 4Z0BL 1RUPH 3MO1B 4Q6IC 1JTOA 5GRVK 3TO2B 4QRQA 4WO4C 4F33B 4NOFA 1WFTA 4QYOB 3MX0A 2H26B 3DVNB 3WKNA 1MFCH 5F71A 4P2QA 4H88L 4ZSOA 2AGJH 1B0WA 4Z76B 3DYPA 1INQA 3U2SB 2F19L 3MV9D 1B90A 4M7LT 4K8RD 5D5ME 1T2XA 2Y1VA 1KPUA 1EAPB 4H1LA 4G80A 4UNVA 1C08B 3GGWB 4J4PA 4ZPVB 5DD3L 1I7UB 4NO2A 2HTLD 3CVIH 1JF5A 1XGRA 2Q8BL 2RQ8A 1BJ1H 4AT6B 5D70H 5EIQA 3VFUA 4A6YB 5HHXL 3AXLB 4MD4B 4IRZL 4FQQB 1JUFB 2QQKH 1BOGA 5I71B 3HNVL 4PGZA 3QEUB 2GTWA 4U7MA 2QSTA 1K4CA 5FYLD 3VXPA 4KV5E 3JVGA 3OKDB 2IG2H 2YXMA 4RMTA 1BVZA 4W68A 1IAOA 2DM7A 4LSUH 3RL2B 1ZVHA 1GOHA 1WZKA 4QXGH 3OAZH 4HX1B 5HDBE 4QHNA 3EO0B 2G60H 2X40A 1SEBA 3T2PA 4BSVA 4OGZA 2RCSL 3ZYOA 3KXFD 4XRCA 1QPPA 3F8UB 1BFSA 4FQIL 4U0RC 5DTFA 2GK2A 4R0LB 1A7RL 4HWUA 1KOAA 5HHMD 3KHOA 1QA9A 4KTEL 5F3BA 3SGEH 3L5WB 3GM0A 4WHDA 4UDTB 4JFDE 1KTLB 1S9XB 5D93B 4ZFGH 1P4LB 4Y16D 4G3YL 5CIPA 2Q8BH 3UBXA 3ZE1E 1ZHBB 1AY1H 4HV8A 3QDMB 5D1XA 3H2WA 4IHOA 1JYWA 1AE6H 4NWUL 4R90H 2Q7YA 2H3NA 4CU7A 3W2DH 3VMOA 3N1MC 3VXSA 1PKQB 5FDWB 2AV1A 3QWOB 5DJ0B 4BH8A 5DZNA 3RIAK 1ZT7A 1OCWH 4X0KB 5F93C 3IAGC 1YY8B 2BSTA 5GHWH 3SPVB 2UZIL 3FB6B 3WJLA 3PWUB 5CJXA 1UWEL 1H3PH 2ZUXA 3UYRH 1Z9OA 3LEVH 4X83A 2H2SD 3F62A 2W0LA 5EG6C 4MCYA 4Y5YC 1BD2E 1F4WL 4NQED 1GRWA 4R4BA 4CN6A 1ORQA 3MSPA 5IB4B 5FYKH 4WWKD 1JWSA 3MFGB 1NCNA 3VWJB 4PLKC 2H32B 2ICES 1KPRA 3PGCA 3REVA 2WSKA 4G8GB 3OKOB 1IAIM 2X7LA 4HIHA 4I8DA 4LIQL 4ORZC 3OF6A 1TTFA 1U8MB 3HI5H 4Z7UF 1X4ZA 2YA2A 1QBMH 2DQDH 2P5WA 4POZC 2DLIA 4RAUB 1WAAA 4J1UB 2NY0B 1JP5A 3MJ8B 4Y4FC 3QZWG 4LCWB 4YE4H 5CD5D 1VFAA 3FFCB 5I76A 5GGRY 1SBSL 1M7IA 1P7QB 5C0EA 4HEPG 4JRYB 5KAQG 1T89A 3H3KA 3DMMD 4HMEA 5IB3B 3MYZA 3AS3A 3FO2B 1IKNA 1G9MH 3QCUL 3ARWA 1JV5A 2X9XA 4OCSH 2VKXA 5F9JA 3MUGB 2MNUA 4HC1A 4MHHG 5GRXG 5GGVH 5DURB 3PWPB 3ARDB 5GS1A 4JM4H 3L9RA 5IUSA 3O6FA 2H2PD 3RWFB 3C6LA 3KPOB 5BRZA 5SV4A 3ZZ1A 1HH9B 4U1GB 1XZ0B 2NY0D 2YD8A 4ONHB 2EEBA 4XPHL 1CD1A 1RK1B 4PJGA 3SE4C 1CFBA 1DQML 4NQUA 2ADFH 5KVFH 1OOAA 3H9ZA 3D3VB 1PLGH 4AIOA 1FIEA 3NCJL 3D39E 1Q0YH 2MHAB 4TVPD 4ACPA 4N9GA 1J0HA 4TNVK 5D72H 3VI4E 3ZYJA 3D25A 3T1FA 2UUDH 4RFOH 4KMQA 4ODVL 4WDIA 5D2NC 3L5JA 4OCNC 2FIRT 5H2BA 4YHYC 4GW5A 5CMAA 1KCRL 3SOBH 3N1GC 5I1DB 4M7KL 4NBZB 2AKRA 1G6RB 3HPJB 3WO4C 1W72H 5E6IC 3P11L 2Z8WC 1N6VA 4PJ8A 3FMGL 4FFVD 4JJ5B 4NO0B 4YUEH 4KQ3L 5HYSG 3IDJB 1ULVA 5TGBB 1A47A 3ARUA 1AY1L 1HH6A 5LKNA 3H9SA 2EXYD 3PWNA 1CL7I 2QKIA 1ZHLB 2DQHL 3ILQC 4UNUA 3I3BA 3V9FA 4XP4L 4YX2L 1IEBA 3N50A 4GQ9H 3S3JA 2MCPL 4K3EH 4HDIA 4FZ8L 4UINH 2LV4A 5EA0L 4J3WA 3ZKSD 4B53A 1IGJA 4EVNA 1HCVA 3FB8B 2EDRA 1OTTC 4GUPA 5IB2A 1NC2D 1GHFH 3GI9H 2AQ1A 2OMNA 5JNYB 4NSKA 1KB9K 2RCSH 2VQ1B 1V3LA 3LKNA 2JJSC 3MBEA 5E2UH 1LP9B 4PY7A 4Z76A 4IJ3B 2WV3A 1MAMH 1GGUA 4WUKH 1IKFH 5KSAC 4NFCA 5F7DA 4XNZC 2ZCKL 5FKPB 3TNNA 4ZOEA 1G9EA 2ITCB 4KAQL 4U1NA 3UTPD 1CYGA 4R4NC 4W4OA 2GITA 2R69L 4DN4L 4Z8FH 4JFZL 2HFFB 1KNOB 1J11A 1F2XK 2NTFB 4X4XA 3TT1L 4HLJA 4AEFA 1D5XB 1WF5A 2P44B 3BYTA 5KTEH 4FXGA 3TO4D 2R2EA 4HWNA 3BPOB 4WW1B 3TO4C 4Z7VA 2I9TB 5DC4B 4OZHF 4LVOC 4MJIB 4QF1B 1AGCA 1PW3A 5L6YH 1MHEA 1NBVL 2ATPB 3D48R 3RUGB 1P4IH 1AKJB 3IDUA 4TUJA 1FL6B 1ACZA 1NCBH 3NN8B 4FQXC 3KYNA 3FQUA 1OGAA 4EI5C 4HMCA 3IS0X 4O2CB 4XB8A 5JOFA 3O3DA 4RX4A 4CAGA 1CU4H 1Q94A 4ZUTA 1UM6L 4BQ8A 4RZCA 2FO1A 2F54A 2EO9A 3LZFL 1N8ZB 1W0WB 3L5WA 1CXIA 4BFEA 3UYPA 3BIKA 5DFTA 4GRLC 5E2VH 2RAMA 2CDGA 4JHZA 4PD4J 3SHSA 5GZND 4EBQL 3BPOC 5IMMA 3S7GA 1KJ2A 5K9JL 5GGUA 3IS1X 1J87A 4U31A 4FQ1H 3MV8E 4D0DB 5IMLB 3QJHA 4HHAA 3RZCB 1A1MA 4IHOB 1PD6A 3P0VH 1S7UA 3OAYH 2BX5A 1ZVSA 4UB0H 2X1WL 1PZ5B 2P24A 2GSGB 4OD1H 4PJFE 3QHFL 4HIXL 4KGLA 3TWCH 4OGXL 4R90L 5C6PB 5ISZB 3QCVL 3KPSB 1JE6A 3ALPA 3TYFA 2O93L 3MV11 1JF1A 1LK3H 3FRUB 3CVHA 3I85A 3NFSL 1XR8A 3WL9A 3HAEA 4PRNB 4H26A 3S5LB 1IAIH 4DK6A 4LSSL 4FMFA 2HTLC 1ERNA 5DJZA 2X4UB 3V8OA 5D7JC 4K7FB 4YDJA 1M71A 3EHBD 2XFXA 1R5VB 3C8KB 3CUPB 3LKOB 4RCAA 4G8FA 5TE4H 2C3VA 2QHRH 2HKFL 2X1OA 2AABL 2EH7L 1J0IA 2BHZA 1KIRA 3B2VL 3NH7H 2V5SA 1NEUA 4KI5C 1I8KA 2YN3A 2YC1B 4JFEB 2OI9C 3VWJA 4Z9KB 3CC5A 3F65A 5HYQB 4Z78B 1YEHL 1M05B 2LVCA 1HI6B 2WANA 3MRRA 4HCRA 2R4SH 4RGNC 1Z6JT 3LKQA 4GKNB 1MJUH 1JZ6A 2QADC 1JVKA 4LMQE 4DFHA 2PO6A 1AR2A 1TPXB 3I50L 4Y2DD 1CLYL 2IGFL 3BP4B 4RBPH 3D2UD 3MA7A 1RUQH 2E7LC 4JGUA 4H8WH 1KSRA 2GSIB 1A7QH 2Z93B 4G8IB 5I66A 5CEXA 4X6CB 1KF9B 4CW1A 1OAQL 1URLA 4L4JA 4YIQA 4YXKL 3WXWL 4V1DA 4N0UB 2P5EE 4G8EB 5IW1A 3TWCL 4JQIH 1I3GL 1RJCA 4XMPH 2Y07L 3K46A 4QNPF 1XF4B 1V7NL 4U3HA 3U30C 3PWJB 1CXEA 1ZANL 3GMLA 5E8PA 1Q9WB 5ITFB 1LMKA 5ISZE 3E8UH 5EC1A 2NY3B 1ZHNB 1H15B 2XZQH 4XX1E 3DARA 3I6GA 4I9WE 1BREA 3K1DA 1WWAX 2V7NB 2A0LD 3U0TB 3I3EA 2AAVA 5C6TL 1RUMH 4ODXB 1HYSC 1CU4L 2X6MA 4MCZB 2VIRA 5JZ7D 1FIGL 1HOCB 3IETA 5HGAB 2G5BB 3VXQA 5T3ZL 5FYJD 4HWEL 5HHVH 2R4RL 1DR9A 2R0ZL 1AR1D 1I7ZA 2ARJQ 4KTDL 4WRLA 4WCYH 1KT2A 2VXSL 2A6DB 1I9RL 1MJUL 5BZDB 1S7QA 2H45A 1MCEA 3V0VB 3RX7A 4LU5L 5AEAA 3QEQD 5BV7L 4KMTL 5E1HB 1FSKB 1CDUA 4OFKA 3K74B 4NO3B 4OV5B 3G04B 3GIZH 4X8JB 4QCIB 4IIQA 3VJ6A 4U7SA 5EIIA 5HVHC 2H6PA 4AENB 4E0RB 1FVEB 4RIRB 1MWAH 5DYOB 3GSOA 4WFFD 4LQFL 4NT6A 3U7YL 3QFDB 5LWYH 3A67H 3DGGB 3ILPB 5CD3B 5JW5A 2MCG1 5DRNA 3ULVL 3W0WA 2BFVH 2FX9H 3DUHA 4DTGH 1RVFH 1F4HA 3B9KA 1X5GA 2IFFH 4S1SL 3GMOA 4G43A 1R3KB 1WWWX 5F21B 3B9EA 3LQZB 5F88B 1YYMH 1MCSA 1VEOA 3GHEH 1YQ2A 1TJGL 2QHLA 1AJ7H 1YMMA 3QYCA 1ZAGA 4M00A 4YR6A 3AVEA 2C3WA 4YHOH 2FYYA 5F9DC 5ICXB 5FUCE 1IAIL 4OFVA 4WI6A 4OM0L 5FM5M 4M8VA 4PJIB 2DQTH 5D7KE 3K2MC 4APQA 1J1PL 3X11B 2OJEA 4PFEA 4LEXH 5DJAA 4AJ0A 4F15C 3GK8H 1EO8H 1TVHB 3ALXA 1EIBA 1LO0L 3BN3B 3SKMA 2AK1H 3NPZB 4KROC 3CX5J 4POUB 3E2HC 1INDL 3RJDA 4JCMA 4PJBA 4KU1A 3GJFB 4LK4A 1R0AH 4U6HB 2DTML 2Y72A 4PJAA 3CXDH 1NMAH 3L3JB 3SE9L 4Y89A 3FOLB 5F97E 3MRDB 1I8LC 4XB7A 1F5WA 1FL5A 2BK8A 5GSVA 2HJFB 3SGJA 1F4XH 2FJFA 4JDZB 3KPNB 3VE0A 1U8KB 3V7AE 5FHBH 4P99A 3C9NA 5JIKA 1MQKH 1X5KA 3KXFB 3W0WD 3TBWB 1CBVH 4GMSL 3VG9C 4AT6A 1B0GA 1EH9A 3TN0D 4K9EH 4NCC2 4PJXE 3CDYA 2J8UA 5FGCB 1G7QA 4Y1AD 5E2TH 4PJ7F 1CDHA 5EBWA 1MRDL 2WBJD 4JRXB 2DB8A 5BW7C 4FP8L 1SVCP 1KEGL 4BELD 3VW3L 3QUYD 3S6CA 1PAMA 1J1OL 4Y4HB 1P2CA 2BVPA 3FFDB 1SVZA 4GKZB 4IJ3C 4P2RE 4GKSA 1GIGL 4AEIL 4EDXB 3FO1B 4PRBA 1NUNB 1EUUA 2FEDC 5JW4N 4LKCB 1NLDH 3PL6B 1QSEE 1YDPB 3QUYB 1I1AB 2YD9A 4IOIA 5J1TC 3CMGA 5ISZA 4L9LA 4LSVH 2DQJH 5HYIA 2VISB 4OLXL 1N0LA 4Z7WA 1D5ZB 2HFGH 3K4DA 4I0PC 3KLHC 4PJEB 1QSEA 3N1PC 4ZDHA 4GG8B 4JDTL 4R26L 4MWFB 3IDGA 4TNVF 4PB9H 1Q9LB 2E5EA 3GB7A 5FUZL 5D7SH 3VI3F 3T0XA 2CDEB 2DKMA 4UI2A 3I3DA 1GAFH 1ZHBA 5INDA 2BNUB 2D0FA 5D9SB 3FFCE 4UTAL 4A6YA 1G7MB 4PRAB 2K3TA 4NGHH 1I1YA 1MI5D 3MLUL 4R96A 5D5MA 4XCNA 3FAXA 3D2UB 4RWYL 1X5HA 4ONGH 4E9LA 1U58B 2BNQB 1E28B 2K7QA 3QBTB 4K55A 4RGND 4JHAH 2HAZA 1MCQA 1T89C 3V5HA 4ENEC 3NZ8B 1SJXA 1L7IL 1U8PA 5CBAB 2ADIB 4PJ8C 2FGZA 1T0MA 4W6WB 3LOWA 1U95B 3BKYL 1XGRB 4P5TD 1YN7A 4X7TB 3VWJD 1U8NB 3VFGL 5HYEA 4QRRB 1I9JH 3FT2A 5JIHA 1DBJH 4K94C 1RZIA 1N5AB 3PQYD 1TNMA 4DVRL 3STBA 5CEZL 1EXUA 3L1OH 1SJHB 2JCCE 3VD3A 5GS0D 2JJTA 3QO0B 1AE6L 4NWUH 4L3EE 4L4TB 5EU6B 3C09C 5CCKL 5EO1A 3MV7D 1A8JH 1A3RH 5E8PB 3EBAA 4I18A 3DOSA 5D1QC 4MSWA 1FZMB 1BQHG 3EYFB 2NPLX 3HN3A 4U1KA 1EFXB 4MLSA 2ERJB 1PLGL 1HDMA 4XRCB 3HI6L 1LK2A 5E4EC 4LPUA 3BP6B 1T21A 3MNWB 5FK9B 3IGAA 5DJ0A 3R8BB 4YC2C 1HHGA 5ID1A 4WENB 3QDMD 4XAKE 3ULUL 3MV8B 4P46D 3S4SA 2FX8L 5DMKA 1GGYA 5DK0A 4ZXBD 4OI7A 5C0BD 4JN2B 4NM4H 3PWPA 1ZVYA 1FN4B 3DHJA 4JKMA 2X1PA 1MELA 2D0HA 2AXGB 5A16B 3TGXA 1INEH 4FQXD 1C5DA 4I2XA 1ZWIA 3SGDI 1A6WL 4OV5A 3RWFA 4FQCL 2BFVL 4HG4J 4HJJH 5CP7A 3UXFA 4HXBL 3V5DB 3TZVA 4JG0L 3MGOA 3L3DA 2IJ0C 4OCYH 3Q5OA 4HMDA 5F96H 1PKQA 4WFGD 5EPMA 4XHJC 4JO4H 1XCQB 3SE3C 3REVB 4YE4L 5C7XL 1U6AH 2BOBA 1F02I 2VLKB 2FL5B 3M45A 4JKPH 4RISL 5BQ7B 1KCRH 1TQCC 2VAAA 3ZDZE 1AXTH 1TZGL 5K59E 4JLRB 5ID0A 3T3MF 2BVQA 3U46A 3QCUH 1U41A 5CLWA 5TQ2L 5HY9B 4CJ0A 1MCHA 5DRZA 4FQXB 2ZOLA 15C8L 4OZIA 4OLVL 4QOKA 3DX9A 2DQEL 4QHMA 1G1YA 2XOTA 1NUGA 2HH0L 4QY8B 3C60C 1VSCA 2F58H 3RDTB 4EI5A 4KTYA 3PWPD 3ULVC 1TZIA 3C5ZB 4Q0XH 3MV7E 1OSZA 5FHAH 4LLMB 2VXQL 4FHBD 1CFNB 1FYTE 5EB9A 5J0BA 3HZKA 1T4KA 4F15B 2GUOA 4M4PA 1FPTL 1E4KC 3MLTB 3UTSE 3GUTA 1FAKT 2ZSVA 3BZ4A 5DD5H 3MV7B 1AO7A 3ILQD 4MJ6B 5KG9B 1SYVB 1I8MB 1FH5H 2AQ3A 4I3SL 3PABA 2MQ0A 2MTPA 2MWCA 2Y36H 1DLFH 4I2XE 2VLLA 2YXFA 4HUXB 5K9OA 5KVFL 3D25B 1NCWL 4WGVB 4RWYH 2X70B 1AXSA 4KQ3H 2LAGB 3WFZA 4GMTL 2IPUG 3PGDB 4XBPA 1L6XA 1KEGH 2OI9B 2BRQA 1DQQA 3MRLB 4Z0XB 3O3EB 3TBSB 1OP5K 1N7ML 1MI5E 3HHRB 4R7NA 3WHXB 2X9WA 2FNBA 2HVKB 4KDTA 3R0NA 1PG7X 4NZDA 3GO1L 1JPTL 4M93B 3Q0HA 4YHZL 2WBKA 3MJ9A 3ZO0A 3K80A 1KTKE 2RGSA 2AEPH 1IC1A 4Y4HA 4JHWL 4OZFA 3VXUB 1JFQL 1RPQA 3Q3GB 4J12A 5JW4Q 4WHYH 4LCUA 3NCBB 5HDLA 4M6OL 3RVTD 5C86A 2EKSB 2JB6A 4Y88A 4I0KA 5KSBF 3PNWA 3FB8A 4EUPA 2KKQA 1NJ9A 4QRPB 1UYWL 1MLCA 4M02A 5EFIA 4NSKB 4MXQD 1V7MH 2VQ1A 2QLVB 3O3DB 4LSDA 3QQ3B 4C4KO 4D8PA 4U1SB 4K2UH 3IFOB 4X6BB 1OW0C 4JO1H 2QADD 5JXEC 2QHRL 1MVFA 3WNKA 4NJAH 5EOQH 4I77H 4OLWH 4HJGB 3SE4A 3C8HA 1ZLUH 4OZ4A 1DBBH 2C1OB 3AS0A 3H7BA 4GLRI 4D2NA 4OZFH 2DIBA 3QQ4A 2VABB 1QUNA 3VA2C 5F7LB 1SM3L 5HHNB 2DMCA 5C8JA 1RULH 2AJYL 1FYHB 5I19L 4YDLC 4AQ1B 1CGXA 4ZSOB 3CX5K 1NGYB 4PG9A 3LS4H 5T1MA 4NN7C 4XC3L 1YEGH 2F9BT 2UZYB 3L5XL 3UP1A 3O9WC 4MJIA 2BHUA 2ADIA 1MHEB 2L7UA 2PTVA 3GBMH 5GIRA 4PRIB 2A6IB 3KPSD 3SDCD 3BUTA 2EEAA 1ETZB 5MERB 2QQNH 1YNTB 1MUJB 4JFPA 1JNNL 3OG4B 3HNSH 5FHAL 2EYSB 5HYJB 4HG4K 1K4CB 1EEQA 1KG0B 4NRXB 4WFFE 4JFEA 4TSAH 1O7SA 1H3XA 3NABL 1ZHKA 4U3XA 1NCWH 1FV1B 2F74B 5I8KL 1QVOB 1ZLSL 2UZIH 4NUGL 1R3HB 3MV9B 4FZEL 3VCLB 3T3PF 5IJKC 4J3XA 1Q9KA 4F58L 2HLAB 1K2DB 5AUMA 4OLVH 3F58L 4MGXA 3DXAE 1WT5A 4QOKE 1I7UA 4LCIL 4ALAL 2GSIA 3HC4H 2FD6H 1KIPA 1RZ8B 1WEJL 4PV8B 5T3XD 1J7VR 1QRNE 3VXSD 1OAZL 5CP3H 4DWHA 1OP9A 4DN3H 5A1AA 2O5ZH 4N5EC 4RSVA 1T66D 4HBQA 1I3VA 3ZLQC 3QFJA 4TVPH 3I84A 3ZKMC 4E41B 4OZIF 1RD6A 3WIFB 5TE4L 1JI2A 6FABH 2PW2B 1TVBA 2EDWA 1KCSH 3KLSA 2OL3B 5F96L 4Q9RL 4CMHC 5DK0B 1JGVH 1OP3H 4DZ8A 1VACA 2YR3A 4WEMB 1G7PB 4XAWH 5A16A 4JFDD 3JUYA 5D4QA 2R0WL 4MD5A 1AQKH 4MNGE 1YNLH 5HVGB 2V9RA 4OTXL 5IEKA 2UY6A 4O51B 3IETB 4GS7C 3GSUA 2BC4A 4EIZC 3G08A 3IRPX 3D85D 1JL8A 3HZVB 3QPXL 5FO7A 1FPTH 4C56E 5JOPE 2JIXA 3T0EA 5DI8B 1S8DA 3D87B 3BRGC 4X5WA 1N7MH 2AJ3B 5CHNA 5K9KA 2R8SL 2GYSA 3VXOA 3ZMRA 4KRMB 4Y8AA 1CICA 3X13B 4I3SH 1X9QA 3O8XB 4OCWH 4HV8B 4ZFZA 4MB3A 2KL6A 2BOCB 1BBJA 4ZUSB 1KIRB 4OZIB 4P2OC 4XNUL 4QOKB 3FCTA 4TUOA 3LRSA 1KPRB 1CQKA 3F6IA 2OMBA 1U8HA 3QWOA 1IM9A 3ROLA 4CRPA 5TE6H 3GRWA 5C2BH 5C2UB 4AZ8A 3LHPH 4K23H 4U1MB 5ITFA 3GSXB 4XMPL 1ND0A 4XTRD 4C56A 4G43B 4G8GE 1WCQA 3OR7A 2D7TL 2V7NA 3SCMB 4XCFL 3SGKC 2WBWB 3VGHA 3DI3B 2CLZB 1HSAA 1TFHA 1VFAB 1IFHL 3U9UA 3RPIB 4P9HH 4QRRD 1X5YA 3ZDXF 1I1AC 4PJ9D 3ULVH 2HMID 1YMMB 1G9ML 1GVIA 1RZKL 1JFQH 1ACYL 2NXZC 3MZTA 3IAQA 1Q38A 1QFWM 1CLOH 4F9LA 4M62L 4HUUA 4L1HA 4EQ2A 1FAIH 4X6CF 4O2EB 5DD1L 1VFBA 3NCYS 5F6HI 1OAKH 2I24N 4QRPE 1NAKH 4LLDB 3KPOA 2IPKB 4YJZL 4LDEB 1EBPA 3TVMA 3T0AA 1HN1A 1K4DB 1ORSB 2GAZA 3VGGA 3WO4B 2B4CC 1F8TL 1KENH 1H3TA 3WSQL 1QRND 2B2XL 3DGGA 3BQUD 2MPAL 1KULA 2XT1B 1U93B 4P4RA 2VXTH 1YJDL 3WDHA 4RGOL 3HE7A 4X6DB 4S1DC 4PIRF 1YEFL 3DYOA 1MJ8L 3BGFC 4BUGA 2IPTH 4Z7QE 5F7NC 3C6LB 1I1AD 1O7VA 3JV4B 5ESAB 3L7FA 4UV7L 1I85A 1VESA 2X4TA 3OJDA 1KYOJ 1PX3A 2XRAH 1QFWL 3SDXE 4JJ5A 2O5XL 4CN1A 4Y1AA 3L5HA 2QL1A 3F7PC 1OLZA 3JZ7A 2J5LC 4GAGL 2NY2D 1CZ8L 5DVKA 5F9AC 3PDGA 1A7PH 1TVHA 5T5FH 5FGBC 3RVUD 1PZUB 4HS6A 1ZT4A 1UB5A 1ONQA 1R3KA 4DKFH 5B39A 2HJLB 2JB5L 2A9MH 2I07B 3E2HB 4GAYA 5GZOC 3RIAF 3QULA 1IC7H 4IOFD 4WWKC 2FYYB 3KPMA 4Y4KB 4HXAL 2DRUA 2X4RB 1LO3H 4JPWH 4Q9BA 5ACZA 1BJMA 3ARBD 4F7EB 3D39A 3IDGB 2WNGA 1Q9LA 3VFGH 5TF1H 3QRGL 1WUNT 3ZT6A 1RHHA 4PPTA 1B2WH 5MP6L 4YQXH 5C6WH 2E3VA 4JHAL 2K7PA 2HFGL 1ZE3C 3K8KA 2WQ8A 4OAWB 3NACL 1MF2L 1WC7B 2FIKB 4IRJA 4NIKB 1L7IH 1A6VL 2ICWJ 4G6FB 3MRCA 5E9DD 3IU3A 1JHKL 4HS3B 5D2NE 4LHQB 1RFDH 3B9VA 1NGPH 3UTSD 4QGTA 4G6JL 1MRCH 3LPWA 4WW1A 4P9HL 1QVOA 3LQAC 3P9WB 3NZ8A 1AD9A 2D7MA 5CEZD 5EZIH 3VGDA 3ARYA 3QB7C 4GKZA 3C9NB 4DZBB 4DVRH 1EEZA 4XH2B 2X4PA 4M1CD 1U95A 1V3JA 4JREC 2XZAH 3KPRE 3I2CH 2Z8RA 3CLFL 2KDGA 4V2CB 1CXLA 4ZTOH 3TZVC 4JG1L 1MLBB 5DZLA 1F42A 3QWRA 1DQMH 1NAMB 2WW8A 1XR9B 3SQOL 5GRUL 4MWFA 2ARJB 1BX2A 1P4IL 5EO1B 5HDOA 3QXVA 4KV5F 2KQNA 3TH3T 2X89A 2IFGA 3MUY1 5TFSL 4UILH 5KVEL 3V4PH 4U1HA 2BNUA 2R15A 3VFNA 1CI5A 3CLEL 1D7FA 4NZTL 5I1CL 2IAND 5HD8D 3T0BA 2ZUSA 1HDMB 2CLVA 3NPSB 4FS0A 1LEGA 2GSGA 3OHXA 1LILA 4FQJH 5FOBB 5LQBH 1L7TL 3GMNB 5JNYA 3T4YB 3SE9H 4HUVB 3HE6B 5D1ZB 1R5WB 5E00B 4U2YA 1IM3A 4L9LB 2YPLA 5IHUL 3QUZA 4P2QD 2QADB 4HJ0D 1QR4A 2B1HL 5LBSL 3CSPA 3X12B 2VLRD 1RUPL 3LN5B 2ITCA 4U1NB 1U92B 5C6TH 4PJ8D 1K3IA 4LVHB 2W60A 1U8NA 2XTJE 1YNKH 3RBGA 4WUKL 1HYSD 1W72A 1S7RB 4PRAA 2NW2B 1KJMB 1BPVA 3L3DB 4N0CC 1J12A 5C07A 5JXED 4MA3B 4X9IA 4HUMB 3IXTA 5IF0A 2HN7A 1AGDB 3SDCA 4JM2A 4OJFL 2YMXH 5CUSH 4XVUD 3CVHB 1AGCB 1OAYL 4M8QB 3RWDB 2OL3L 5E1AB 3K7UA 4TSCL 4PBWD 3MLRL 1JGUL 1HSAB 3MJ9L 4N0UA 3TBYB 4F2MA 2XN9A 2ZG2A 5BJTB 1QEWB 3FONB 3KYNB 1CZ8H 2ADGA 4DAGH 1NKRA 3FQUB 4OFDA 1QFPA 5LWYL 5FK9A 2AJVH 1LD9B 4WI5A 2DM4A 1PG7L 5CINH 4GW1A 1KCLA 1LVEA 1P84J 3KYOA 4JDVA 1C12B 4WHCA 4WO4B 4CVZB 3V6FB 2FWOA 1FN4A 3IAPA 4OUOA 4X7SH 4X6EA 2HG5B 3NH7L 4P5MB 3K2UH 3AAZA 2C9AA 4WHTA 5DFVC 3TA3B 2EXWD 3BP4A 4LCWD 2FJHB 2EDJA 1F58H 4LVNC 4LFHG 3C2AH 5KAQF 2KZ1B 4FTVD 2JELL 3MGOB 4U6YB 4KTDH 1BBDH 4UT9L 1CDJA 4OZHE 1KV3A 1Y0LA 1I7ZB 2DQTL 3V2AR 2Y9RT 1AC0A 3HUJB 1N59B 2N7BA 2YEZA 1NBZA 5FV2A 4F7CA 5ADOL 3ZKXB 4KZDL 1UM5H 4L3EA 3HG1D 3TYGL 3H42L 5HGHA 4I2XB 4P2CG 4HKJB 4Q6IA 2VDRH 3EKCA 3RWHB 1Z2KA 2ZOLB 4NZRL 5CP7B 4P4KC 1FVEA 4H25B 4RIRA 5DJ2B 3RUGF 2E9IA 2B4CL 5DZOA 3FZUD 3BRFA 2YC1A 3VD4A 1A7OH 3MLWL 5GZNC 4S1SH 5IB5A 3MLXL 4I18C 2YSSA 4ODHH 3UEZA 1OGAD 3UC0L 4HFUL 2ZP0T 5IHZB 1J0ZA 3R4DA 4XXDA 4Z7WF 1H9VA 2VLKD 3JTSA 4KROD 2Z93A 2APXA 2BVQB 1P9MC 4YHOL 5F1IB 3EFDH 3VJ6B 3BHBB 3DIFA 4M6NL 1I9IL 1CIUA 4JKKA 2IBBA 4NQCB 5MENE 2ENYA 2VR5A 4MJ6A 4BZ1L 4PJ7B 2HA1A 2G60L 3AUVA 4WU5A 5CJQL 4AEHL 3FQWA 1XF3A 3ZKNC 3FAWA 1CE1L 3DBXB 4NC1E 2EH7H 4BKLA 1I1CA 4Y16A 3SKOA 3RGVB 1KGCE 1FORH 3BWUC 4LLVB 1DVFB 2P5WB 3OWEA 1YYLH 1OSPL 1FIGH 3W0WB 5HHOD 1KXVC 3LZFH 1ZHNA 5JTWA 3TV3L 2E27H 5L8JB 4HWBH 2LTQC 2ICWB 1NKOA 4PJHB 2R4SL 5EO0A 5EU5A 1ROWA 4Q97A 3KPPB 2AK4A 3W81A 5L8KB 2QQLL 5IV2A 4WNQA 2DWEB 2DDQL 3QPQD 3DROA 3QUMA 2VDLL 5GS2D 2ORBL 4MJ2A 1JHTA 3MA9H 5F9OH 2YRZA 5KG9A 1EPFA 4PJDA 2F15A 4PGBB 4RQQB 2OXGA 3R06B 1W0VA 5KSAD 1UZ6E 3K2UL 3H9YA 5K33A 5DQ9B 4ZD3L 4ZFOL 1RIUH 5HHVL 2BSSB 4M7LL 3G04A 4M1GH 4GOSA 1CDYA 2WZPD 3W9EA 3VFWB 3B6SB 3LRHA 4GJTB 2NY3C 3DO7B 4TSAL 3ARVA 1JI1A 5JORB 1OAXL 1OGTB 4F9PA 5LCVL 1QKZH 1JTPA 3O3EA 4PJIF 5FO9B 4K8RC 1UVQB 5IFJA 1MVUA 4GRWB 1NBYA 4O4YL 2NY5H 3BWAA 3TJEH 1JPGB 3T3PE 1GGCH 4X6BA 5JZ7C 4HF5H 2EXYC 1S7WB 3BVNB 3I02B 4U3CA 4ODTH 4LAJH 3AM8C 3EOBA 1V7ML 1MFDL 4M7KH 3OKMA 4JPVH 3RY6C 4Z7WE 5IVXB 5GPRA 4WUUB 5DJ6A 4YLQT 5CP3A 3DXAB 4Z7NF 4KKAC 1MCPL 4HT1L 1G6RA 3F7RA 5JDJA 5KVEH 1FNGA 2YPLE 1OTSD 3BO8B 4JGMA 2W65A 3DX8B 4KVNH 5E94A 4MMZC 3O3BB 4TVSa 2GY7B 4CU6A 2IANB 4OB5H 4PRID 2E8ZA 2HFEA 1M4KA 4HKXA 3ZDYF 2AEIT 5DJYA 4RNRB 1L7TH 3KAAA 1N4XL 1GCFA 4OZFG 3CCHA 4GQPH 2O5ZL 3AS2A 3Q6GL 4DQOH 5FCSH 3FMGH 2PCPB 3GBLA 5GGTA 4QTIL 3FJTA 3U0WH 1H5BB 2CRZA 3WUZA 1X4YA 2DBLH 4N0CD 5BRZE 2NY0C 4LKCA 5JMOC 4NQDB 5IB2B 1S7RA 5HYJD 1FGVL 2VXUH 1I1AA 4L8SC 3I6KB 2CK0L 1UM6H 3BEVA 2XZCL 4QHUB 2AJXH 4Z7OE 4MA3A 3VXRB 3CH8A 1HQ4B 1A9EA 2ZUTA 4QRTB 2VLMD 3HB3C 4QTHB 4X7EC 3SDYL 1G9NL 3WE6A 3UJTH 5J13C 3VCLA 5DURD 3O6FC 1J86A 2XN9D 5FFLA 1A14H 4PBXA 2FECL 4PJDF 1TNNA 4M61A 4KKBC 5C09D 3QSKB 2ZCLH 4OF6A 1BLNB 4MA8H 1E6JH 3QIWC 4JFFA 4Y5YB 1WITA 1KIQB 3I6LE 4WI7A 1MPAH 1D5BA 3FT2B 5D7LD 4PJ5B 1A1NB 2NTFA 4YK4B 5BJTA 3TVMC 1EAJA 1X5IA 3VDCA 1IKFL 5EUOE 3U9PL 1E4XH 3WLBB 1RU9H 2MOVA 4XXCC 1RZJL 1OL0A 4R2GD 4ZUUB 4HLZG 1FO0H 3EYSL 5ERWA 4XPAL 4OFYA 4CMMB 4WWKA 3MQIA 4WO4A 4PJFB 3HNTH 1K2DA 3VXMD 1CQYA 1HXMB 3EJJX 1GGBH 1ZLWH 3NVQA 4JKWA 3V95A 4O02H 4M43H 5DJXA 3LQMA 3VI3E 4DCQA 4IOIB 1YEDB 5T1LB 4PLNC 5GGRA 5L88H 5JO5B 2X4QB 4I9WD 2BRRH 4DGYH 5IR1B 5L0QB 1RUAH 1BHGA 3JXAA 3NCMA 3K8LA 4U1IA 2YEZB 1UG9A 3W39B 5IMMB 4PJCB 4L3CB 12E8H 1FZOA 3JV6B 2MJWA 3BMWA 3EYFA 2PYEB 3EYUL 4AIZA 1XCTB 5DJDA 2NX5A 4HKJA 5KSVB 4RFOL 1XF2A 1VGKB 2P8LA 5L0QC 4LF3B 3BZFA 4AIXA 1NAMH 4UT6L 3N1QC 4FABH 2IANE 2DM3A 1JF1B 4GRWH 1WIOA 4D0BA 1V5JA 3MYJA 1KCVH 1JYNA 4QXWA 1U8PB 5CBAA 4OF8A 3IVKB 1MCPH 5CS7A 3I9GH 5TE7H 4JFXA 1CS6A 1NCAH 3JWOL 2XA8H 4LEOA 3G5XA 4NQVB 4ZTPH 3ZTJG 5IMKA 2IQAA 4UIKH 5SWQA 2Q6WA 4GBXA 4H0IA 3BPLC 5D2NB 1N0XH 5E9DA 1MJ8H 4GS7B 3BXNA 2AJUH 1QKZL 3X3FH 2A9ML 3LV3A 1Q0YL 3O6KH 1W0YT 3ES6B 3WFDH 1FG2B 2GEEA 1ODAA 2IWGA 1S7SB 1ZLVH 5HPMA 2EDLA 4PRHA 1K4DA 4HQQL 1GIGH 4AEIH 1M7XA 5SWZB 3MLTA 4MJIE 4HW6A 4ERSH 5GS0C 5H35A 5CJXC 1QYGL 3BP6A 4PGJA 1P69B 3QH3A 3OKLA 1QNZH 4G6JH 2DICA 1IQDA 1YY9C 3GMRB 4FFVC 4S2SA 3WS6A 2RFXB 4MHHI 4MDIA 4BFIB 5E6ID 1ZK9A 4M9PA 4URTB 3L95A 3QDJD 3QEHB 4MNHB 2EIEA 3ARFA 2AI0H 1CFQA 3RHWK 1MHPL 4YBQD 2X70A 4I4WA 1TVDA 5L2KE 4UUJA 4O02L 4XMLH 4FNLL 3DURB 4PJBE 1ZA3A 1OPGL 5EC2B 1CD0A 5GSRB 3B6SA 3Q6FB 5DMIL 4Z0XA 4KDVA 4NM4L 3UJTL 5J6GA 3BEWB 4ODUB 2YBRA 3GI9L 3VXTA 3U7AA 3PXJA 4HIEB 1QSFD 4HIIB 1S9KC 4UBDD 4PBVC 4J3VA 2EDNA 2VH5H 4GXVH 4X4ME 2DLHA 4ZFFB 3G6DL 2HJKA 4M43L 5C0AD 5B39B 4NQSB 4HUWA 3T04D 2F53E 1WZMA 2I07A 4XH2A 4I0PD 1VDGA 5EBGA 5T5FL 5GGQH 2FZ3A 3SJVD 1A6WH 1Z9LA 3DX8A 1U8QA 1FE8L 2APTA 4EUPG 4EI5B 4LRNL 4PGEB 1K8IB 3DNKA 3A0OA 3PHOA 1CGWA 3DVGA 4LVNB 1C7SA 3PWVB 3PWLA 3ARZA 5IVZB 1I7TB 5FYKL 5IWLA 4JVPA 1M7DA 3U4AA 3DV4B 1L0YA 4NUJB 1JJUA 3G6JF 1X44A 4H20L 2HJLA 5KJRH 1FVCA 3DSFH 4D0CB 4IRJB 3PNWB 1BF8A 3MLVL 4F33A 2R1WA 1U8IA 5D7LA 5TPWL 4DTGL 5LJYH 4RMWA 1UWEH 4G3YH 4TTDC 2DQCL 3TN0C 4QT5A 2VDML 1XEDA 4KVCL 4N0UE 4YFLF 4NBXB 3C6SB 1IGFL 4X4YA 2BVOB 5EUOF 5SX4H 1MWAL 4C54A 3DRQB 4G9FB 3H0TA 1NEZB 3BKJH 5DHYB 1TCRB 3P2TA 1QBLL 1OF2B 4NNPL 3OQ3B 3RFZC 1EVUA 4LP4A 5A40E 1QG3A 2GJ6D 5GGSY 3EYOB 4LOUC 2CRIA 2X44D 2VABA 3E6FA 3TBVB 4NRYA 2ADJA 3FOLA 3B9DA 2ZCLL 1ES0A 4JFEE 1BIIB 4NUGH 4GRLD 1MCWW 3HE6D 1EO8L 5IFAL 3F6LA 4YHLH 2F74A 3RHWF 4D9LH 1AGDA 3SDCB 1BX2B 4NKIH 3PP3H 4WV1B 4OZIE 1YMHA 3CMOL 4EIGB 4PR5A 2XYCA 4NM8H 4JZOB 3VFOA 4OZGA 1T1XA 1F3JA 3U7WH 4Y16C 4DZBA 1CD9B 1QACA 3VRLF 1QFWI 4J3SA 4NGHL 1CE6B 3R1GH 3ZKMD 3DSFL 2QSCL 1RJZB 4KMTH 3O4LE 4Q58C 3KPQB 3T0ED 4TRPH 1CTNA 1GC1L 5I1AB 4XX1G 3B3IA 2DLEA 5ELIA 5IB1A 3MLZL 2HFTA 2YPKB 3MODH 4NO5B 3FQNB 4XZUA 1A9BB 5C0CB 1I9RH 4MNGB 5DD0H 5AUMB 4L3CA 3WFEH 1JWMB 1KJVA 3FZUC 5HGDB 4QOKD 4HZAA 5DJDB 1T04A 3S96B 1Q1JH 2R23B 2MQ3A 2ZSWA 3ARTA 4LL9A 1M6OA 1Y6NR 3D69B 1U91A 5IJVA 4KJQC 2CJUH 5FDWA 3REWB 1LO2H 4JM2B 3EDJA 1YPZF 1WICA 5I30H 1S8DB 1N59A 3ECBB 3S88H 2VITA 5ESVB 3IDNB 3S97C 3FN0H 4XWGH 5CWSA 1NBZB 4KUZH 3O2VH 2VZ1A 4BK5A 1CN4A 2PYFA 4OZHA 5H8DA 3SO5A 5KSAA 4LSTL 3RAJL 1J8HB 2XIDA 4ZFZB 3LQAH 4HK3J 4LEXL 1QFHA 5DRXA 2LU7A 1KN4L 1KCSL 1DFBL 4UV4H 1KJMA 1DBBL 1I8LA 5IOPB 3JUZA 1A1OB 1UXWA 5SWSA 1EMTL 4EDWL 5FYKD 2UZXB 4Y4KD 3RIFK 1JNLL 4GW4B 3P9MB 4U1MA 2AJZA 3BN9C 2YKLH 3V6FA 4EXPX 1OAZH 1U8MA 3CAFA 3DUUB 4L4VA 1EX0A 1ED3A 3GIVA 4X9GA 2GW5A 3L7EB 1KB5A 2DLGA 2CSPA 2VLJE 1ZLWK 1JZ5A 1NGQH 2H1PL 5EU3B 3DIFB 4BA8A 4F58H 4ODWA 4JAMB 5KTEL 3TP4A 2ADGB 5MEOA 4XAWL 4YXLH 1C5BH 3FKUS 1FBIH 1IQDB 1Y18B 3RVTC 1UYWH 3GFUA 3RWEB 4BKLB 4O00A 1MH5B 1IM9B 3ROLB 4D3CL 3KYOB 3L3KB 3OJVC 4PLJC 4CVZA 4BZYA 4NRZA 4U6XB 1QLFA 3HC0A 5GJTL 2P5WE 4NOBA 2HKHL 4JO1L 3QXDB 1HWGB 4LLUA 1FO0B 3Q1SH 4XPTL 1QP1A 2AABH 2R0KL 4P23D 1K8DB 3UTTD 1IRAY 4KZDH 5IEKB 1T21B 2G2RB 3HC4L 1BZ7B 2H2PC 2NY5C 3QIUB 3S9DB 2Y7QA 1JHTB 2NLJA 5F6IC 4I13B 5GGQL 4FZ8H 2JJTC 3UJJH 1G0XA 5ANMA 5EULV 5C0RL 5D96B 4KFZC 2EO1A 2GTZA 3UTQB 5D7IB 3O6KL 1QQDB 3CZFA 3HRZB 4JG0H 1DTUA 3LSOB 1ADQH 3D1MC 4BZ2H 3NA4A 1Z0NA 5ESAA 2HTKD 1OARH 2O26U 3V5DA 5C09A 3S34L 5ETUB 5JORA 4MQSB 3RWGA 1V3MA 4WI3A 5CZKA 3VDAA 4ERSL 4OUUA 5F3HA 5KVGH 1UENA 5JXAL 1UVQA 5IFJB 3FRPG 1A6AA 5BRZD 3I75A 5F6HJ 2BSED 5CINL 1U93A 3UO1H 1HSBA 1IGYA 3S37X 1YEKH 3MJGX 4IMLA 2X10A 1GHFL 3QG6A 2A74B 4TNWK 1JYVA 1CIDA 1I7TA 1AI1H 3RGHA 4JO4L 5JMRA 2ZUUA 3L3OA 4WUUA 5I1HH 3DROB 2FB4L 3JWDL 4XP4H 1DUYA 1BEYH 1XGQA 4HDIB 2H2SC 3FT3B 4M1CC 3MTRA 1RV6X 1HHJA 2R1WB 4KAQH 5F8QC 1EGJH 2ADFL 4ODBD 4OFIA 2C3GA 1OWRM 4FQ1L 4O2EA 1CFSA 5JA9A 2ID5A 4IRJD 4RMQA 2ILLA 3D39B 5GRVL 5CKAA 1N2RB 3EGSB 2HKFH 3LN4B 1DZBA 1LDSA 5BVJA 5DVLA 3B9AA 4JREB 5J8OA 4RMVA 1PSKH 3R0MA 4NZTH 4CBPA 3V52L 4XHJD 3OBAA 5HHQB 3QUXA 4ODSH 3VXUD 2FR4B 3D39D 3B5GA 5E99L 3MRNA 3BH9A 4QRQB 1ZXQA 5GGTH 4NQDE 3RP1A 3ULSB 4P4RB 2P5EB 4RQQA 2HT3C 3MXWL 3U79A 2R2EB 5FYJE 3VD5A 4BYHA 3NCYP 4GBXC 4L1DA 4CNIA 5HHPB 3QUZD 1VFMA 2PNDA 1LHZA 1T0PB 2X5PA 4IDJL 4Y19E 1G7HB 5LAXA 5I15L 3HS0B 1KIQA 2BY0A 3KGRA 3GEWB 5DD6A 4F7MB 3V0WH 4M5ZH 2H32H 3T8XB 1CFVH 3WFBL 1SJEB 3RIFF 2EDXA 1S9YA 5HI4C 1NL0L 5HPOA 1XIWB 5C9JB 1JTTA 5IVXE 4MJ5B 4WWKB 4C58B 5K9QG 4HKZB 1ONQB 1MJ7H 1KLGA 2C3HA 4LHUB 4LFHD 3IFPA 4YXLL 3QWRD 5EOCJ 4WFHD 4FFZH 1VB9A 1NLBH 2VLJD 2X4PB 1S7XB 5MEQB 1FYTA 5I8EA 2OXHA 4B7LA 5K9JH 3P77B 2H26A 3DJ9A 3HE7D 5CLTA 1DN0B 5DTFB 3QFJE 2ZJSH 4P2QB 1KPVB 3MRQA 5D1ZA 1AFVL 4XCEB 4ZNEE 1CXKA 3QQ3A 4OQ1A 1NC4A 3RDTD 5C0CD 5FGCE 3RA7H 2XWBA 5ACZB 3LVEA 1LEKB 3MJ7B 5FF6A 2XA3A 1F3DH 3ZSSA 3O2WH 4W4NA 2DD8L 4IS6B 4OD2B 3D9AH 4NNXA 1CGTA 3GZKA 2PYEA 4YDJB 4IMKC 1NMCC 1UCTA 3MLYH 3SBWC 1D9KB 1T0NA 3QDME 4NQDA 4I3GA 43C9B 3NIGF 3OHXB 5FOBA 2JE8A 3LEXB 3HE6A 1HQ4A 1QFUH 5ADPL 2D03H 5EDXA 3B2UD 4WI4A 4P57A 1G6RL 3RY6A 3S34H 3WNOA 3EO0A 2CD0A 4OQTL 1CDIA 4M8QA 2D31A 2PTTA 1JHKH 1WIPA 1KFAL 1OTSC 1T20B 4GRLB 3SCMC 4N8CL 1FVDB 4YXHL 4NPYB 3X14A 4JGJA 3N0PB 2F8XC 4I0PA 3CDGA 1BWMA 2W60B 4U6VH 1REIA 3HG1A 4DCQB 5AD0A 4FA8A 4V1DB 1A1NA 3QCTL 5I8KH 4YQXL 4ZXBB 1HEZB 3LDBB 3OB8A 5H37H 3LEVL 1QBBA 5I0ZA 3EOYG 3PP4H 5E5MB 2VXVL 5E03A 2E7HA 5FCUL 2V9TA 5D7SL 3ZE1F 4KWUA 3T77B 1JPSL 3O9WA 4YHKL 3GMPB 2BRRL 2PYED 2X1XR 4ZQKB 3TN0A 1FZKA 4LRIC 4NP4H 1HHKB 4PTTB 1EFXD 2WBJC 1FO0A 4WEBL 4E42B 4UINL 4WW2F 3IDMA 4AG4H 1MWAB 5DC0A 5AG8A 1AHWA 2SEBA 4A2LA 3ARFD 1BZ7A 4AH2A 2ZCHL 5GGRB 2F53A 3IJYA 1A02N 2Y7QB 3CD4A 1OTUD 2RFXA 4X0KA 1KLUA 3MJ6A 4NQCE 4PD4K 4Y1AE 5MENB 1A7RH 4JDVB 3B5HA 4JQVC 1S7QB 3RY5A 3CPLA 3EDKA 3QWQB 5E5UB 4KXZI 4JFXB 5A2JH 1FGNH 3L9RB 4KJPD 2KPNA 3IFNL 1FZOB 3JV6A 3G9VA 1NGXB 4MXWL 3RZCC 3QNXA 5J1AB 3CVIL 1LE5A 3WS3A 5B8CA 4O51A 1RK1A 2BC4B 5E0QA 5JW3L 1QSFA 2VSCA 1L9MA 4PS4L 4ZO7A 1I7RA 3V7MA 2V5YA 4Y5VC 4WI8A 3VXTB 3T0EB 4S1QL 4EEEA 1SBSH 1RZGA 3Q48A 4TULL 2BSRA 3S36X 4NQCD 1QO3B 2LQRA 3ZKND 5E7FA 2Q3AA 3SDAD 2BDNL 4N5ED 1WGOA 1HILB 2BOCA 1IZKA 4LLWB 2VLRA 4K7PX 2YD7A 4GRMA 1FORL 5FGRA 3A6CH 4ZO8A 3OXSA 3DPBA 3N06B 1RY7B 2ZUQC 1DVFA 1DQJB 3SO3C 1JPST 4JY4A 3LN9A 3BJ91 3ARDA 2WK2A 2X7LB 4HIHB 2V2WA 5C0JA 1YZZA 3MNVA 1WT5C 2BVYA 3OKYA 3NABH 3LIZL 5IVZA 2CLZA 2XV6B 3U9UB 4JPIA 1S7SA 5C0ND 1Q1JL 4J2XA 3MRBA 3WXVH 1JGEB 1W2KT 4PJGB 5DMGC 4FFWC 4NQDD 2CIKB 2ZUQB 5L2JB 1G7IA 5AZ2H 3W11D 1AGEB 4X98A 3FL7A 5IP4A 1XF1A 2E27L 4RBPK 1BQLH 3R06A 2NY4C 3HCVB 5GS2H 4PRPE 3IDYB 4P9MH 3JV0A 2B4CH 1I9IH 2Q8AH 3Q6GH 5CSZB 4DQOL 3QDGE 4CNIB 4Y7MA 3UZEA 2JIXD 2PN5A 4F57H 5CZXC 4M62H 1WQVT 2JCCF 4KKLC 2HYMA 1XZ0A 5JQ6L 1YNKL 1JGVL 3BT2L 3RX8A 3HZMB 5DFVD 1H8NA 3C09B 5GRZA 2D2OA 2F58L 1DLHB 5DFWH 1MIMH 4NYLB 5EBWB 4K3JL 2L4OA 3ZHDA 4HAFA 5C08A 3RNQA 1F90L 4Z5RB 1U2CA 1ZGLB 1ZHLA 2CGRH 2LAAA 5I8OH 1BM3H 4Z7VB 2GCYA 1BZ9A 3G6AB 5DEGB 3S36L 5B38A 2MKLC 5F1IA 2CKBB 2JJUA 3T2OA 4NUJA 3NTCH 4HUWB 1H5BC 5H2BB 5HDQL 3L7FB 2AXJA 1CG9A 1R0AL 3QI9B 5HYSA 4L9DA 3S98A 5FO9A 2NY7H 1DN0A 1LK3L 4HIJB 4D94A 1Z5LA 4HK0A 4XPFL 3RRQA 1TETL 3DI2B 4UOW1 3WFEL 2DTSA 2NY1D 3MUJA 3OAUL 2VL5A 3H9SB 3EYQC 3CCHB 3FN9A 3FQNA 2EDFA 2ICWA 1CR9H 4P23A 4UMGA 3B5TA 1YEEL 2F5BH 3CK0H 2EDHA 1IKNC 4X7FC 4WNQB 3CLFH 5CZVL 1E6OL 2HFFA 1FFNA 2MMXA 2A38A 2VB5A 4OQTH 4MQXD 1D9KA 2BZDA 2EDEA 3BKJL 1IGJB 1LO3L 4M6NH 1XIWD 1FGNL 2ICWI 2Q20A 4HJ0C 5I6XC 3W0WE 2N1KA 3KPSA 5FYKE 3MACH 4O2FA 1AD0A 1TITA 3WKMH 1WZ1H 4J6RH 2COQA 3WL9B 3IDNA 1F3JB 4HS8H 4MX7A 1QSVA 4OGXH 4LSPL 5DJZB 2YUXA 3ISWA 1BLNA 4A6YH 3RUGA 4PJAF 2VDNH 3AREA 4G9FD 3ESVF 4M6MH 3MO1A 3LRGA 4NZRH 5DDHA 1KC5L 3FN0L 2ADJB 3I6KA 2P5ED 5B3JE 4RZCB 1ZS8B 2CR6A 5DUPH 1A9EB 4NQEE 1IAOB 3P0VL 4HAGA 1NCDH 2FHCA 3OXRB 3B8YA 5HHME 2OJZL 5I8CA 1J0JA 1YMHB 1OP5H 4EN3D 1GZPB 4YXKH 5F7HA 3HKFA 1F4YL 2DJSA 5D7KD 3P4OB 5H94B 3PGFL 2W9LA 2VZUA 2W9EL 3VXME 2IAMD 1NQBA 4TULH 5F1NA 3EDEA 3X3GL 4OGYL 2ARWA 4BQ6A 1MWAA 5E94B 2IANA 2X4QA 5E2WH 5EORH 5IESH 5JOFB 1EHXA 1MIEL 2PUQT 3B3IB 3TEUA 3QUXC 4NFDA 3QQ9D 3S37L 1QFUL 5ADPH 2ZKHL 1N8ZA 3CXHK 3WBDA 1G84A 3EO1B 4NZJA 1YQVH 2IBGA 5HI3C 4RMSA 2ZWLT 4RFNC 2FX8H 1UM4L 3KJ6H 3PDOA 5C08D 5M7QA 1HHIB 3RI5K 2GK0A 1J05A 1JRHI 3TO2A 3NAAH 5ILTL 1P7KA 2DMBA 2BNRB 1VEPA 2VXQH 4LVOB 1A1OA 1UXWB 2J8UE 3BEVB 2K1MA 2ITDA 4S10A 3U6RA 4WU7A 3PXHA 4OCYL 3T1WA 2NMSA 3UYRL 4X9HA 4I77L 4OLWL 5IW6A 2XA8L 2GT9B 2ICEA 5L9DH 1U3ZA 3PHQB 3V6ZA 1U92A 1B0RA 4XPAH 4AIZB 2C7UA 2XFXB 3C8KA 3CUPA 2IQAB 1J10A 1KCVL 1YC8A 2ERJC 1BOGB 3H8NA 2Z4QA 2WIIA 5EZJB 3GJFK 1R3IL 3IXAB 5DUBB 3Q1SL 4J8RA 1XF4A 3I9GL 4LLYA 4JRXE 3RWJB 5ESQA 3ZDXE 3O6MH 5D1QD 5J57B 4CMMA 2QSVA 1NC4D 3RDTA 5HYQA 4OIBA 3BD4A 5F7EH 2OL3H 1YY8A 4PJFA 4CN4A 2YHGA 4FG6C 3DUUA 1BJ8A 1DEEA 3EYVB 5D1ZC 3ARDD 3GJFH 3TF7C 3CSBA 4FXLA 3HMWH 1DSFH 3MFFB 5I1GH 4GSDL 4KK5C 1YUHA 3MMEA 3NPSC 3UJJL 1KYOK 1YEJL 2OLDA 3NFPA 3MR9B 2G5BA 3QH3B 4UV7H 3TH4T 2CIKA 4YUEL 3GSRB 1P1ZB 2YA1A 4LKXB 5GGVL 1CICC 5DVNA 4WTZA 1HHJB 3C08L 4GW1B 2J6EH 5AWNH 4J3TA 4YO0B 4P48A 1OM3H 5C0AB 3RVXD 3V0VA 4G8GA 1MCBA 3JWDH 1OPGH 1Q9WA 4UUJB 3ES6A 3QUMH 5F7FA 3DUSB 3RNKA 1FG2A 5DT1H 4F37F 2Z31A 2X2YA 4EJ1C 1ADQA 5JHLL 5DSCB 3GJFA 2W9DL 35C8H 3TIEB 4ODXA 5SWZD 5AG9A 2VE6B 4YWGL 3OKNB 4L8BA 2PTUA 1UACL 3F5WB 3KPRB 1AGFA 1OP3K 2EIZB 4MA7H 1UB6A 1YQVL 1OAUL 3QUKA 3OJ2C 4PJEF 1FL5B 5GSVB 1HSBB 1IGYB 1VKXA 2CR3A 2FCBA 4PJCE 5FYJH 5BZDA 1F13A 1BQHB 3K4AA 3TCLB 1R6VA 4W6YB 2A74A 5C0BA 2GCYB 5DEGA 4PJFF 5I1GL 1J5OL 4U1GC 4OTXH 3WFCH 2CGRL 4U1LA 3ARGC 1GZQA 2VDLH 3X3FL 1RVFL 2EKSA 4LVHC 3DHMA 1E6JL 4ONHA 1H3PL 4FZEH 3B4NA 4BQ9A 5HYSB 3QA3B 3WJJC 1D5MB 3D18B 4YNYB 5CD5C 2OR7A 5I71C 1HINL 2E6QA 3MCKB 3MGTA 2EYRB 3WDJA 5I15H 3D0LA 2DQUH 1N3NB 2XTJC 1CD8A 3NAAL 3WN5B 2R1YB 1TZHA 4LCWA 5CJQH 1IILE 5DXWA 2C1OA 4IRSD 1F6AA 1UACH 2Q3ZA 3W9DB 1DUYB 5D72L 5E8OB 4JPKL 3O6LL 5T1DH 3ZHLA 4P5TA 2X42A 1U8QB 5DGQA 2VXTL 3T2QA 5KW9L 5C3LD 5B3NA 1MIML 5I19H 5GS1C 4GKOA 1J1XL 4PJEA 4O2FB 1P4BH 1N2RA 3EGSA 3DRQA 3UCRA 3ZL4L 3FHQA 1J1PH 3AGVA 1FNLA 4YZFF 2VQUA 5F7WC 3SKMB 3ROOB 5GIRB 1HH9A 5T1LD 3CGTA 2DWEA 4OCRH 5D9SA 5C70A 4NRYB 3QUXB 2FR4A 3LD8C 3TJHD 3GBNH 1A21A 1J18A 4DKEL 3MUZ1 1T0NB 3GHBH 3MRNB 5GJSH 4ELMF 1UWGH 2YBRB 5I1EL 2VJXA 4ZFOB 5JXEA 1NMAL 4OGAC 1DSFL 4POYA 3EFDL 4MA1B 3F7VB 1KXTB 4TOYL 3CFCH 4I1NB 5EO9B 3TCXA 1G7JB 3L3GB 5IKCA 4FTVE 2P47B 1CE6A 4KROB 5DUMH 5CMAB 4ODHL 4U7KA 1WVZA 4PRPD 5KVDL 4AQOA 4Q9RH 2VXUL 1B4JH 4PV8A 1H8SA 1KNOA 4XP9H 1UM4H 3KJ6L 1NDMB 2R8SH 5BZWB 1NH6A 4WHYG 2YZ1A 5B8CC 1BIIA 3RL1B 4K3HA 1SJHA 3IKCA 1ZA6B 4DN3L 1ZKAA 1FFPA 3DMMB 4JPVL 3QXUA 2EIBA 5IFHH 4BZ1H 2DDQH 2IPTL 2DI7A 5D6CA 1B3JA 4KHXL 43CAB 4WW2B 5JPMB 3VFOB 5F9OL 3O9WB 1T1XB 3JVGC 3V7AG 2EICA 3E1F1 4XNZB 4L5FL 1N26A 1D3CA 1T04B 1XMWA 2X89D 3S96A 2CKBL 2F54E 3EJZD 4UU9A 3GJEA 4R96B 4UOJA 4HKBB 3MLPA 3UAJD 2FBOJ 2W65B 3MLZH 1DBAL 1JNNH 1G1CA 4JFHD 1U91B 3JWNC 3EOAB 3C5JA 5IJVB 4BUHA 1RIUL 3BGMA 3ZE2E 1LO4H 1T1ZA 1UXSB 2F53B 3IJYB 1XGUB 4ZUTB 2UWEA 1SY6H 4KPHH 4OKVA 4Y2DB 1G0YR 2OBGA 2F54B 5DA4A 4ZDHB 4QTIH 2V5MA 4FTVB 1IARB 3RWIA 1DANU 3B43A 5DHYA 5C0CA 5DK3A 4DGIL 1AR1C 4HWBA 3HRPA 4OM1L 1MFNA 3VXOB 3B2VH 4IS6A 2NY5L 3TJEL 3VGFA 3B83A 1ZGLM 3A6CL 3QAZC 3SDAA 1EMTH 4HHAB 2EZ0D 2VDQH 3NCCB 4WO4D 4XBGB 2R23A 5J56B 4ZMAT 1C8PA 4OCWL 3U7WL 4TUOB 2G75A 4FXGB 1INQB 5AZEL 2QV2A 4BQCA 4OF7A 3TYFB 1RUQL 3JWOC 1NCBL 4GH7B 1IEHA 1CE1H 4L4VB 3FB5B 4PRNA 3VXSE 4PJAE 1WISA 4ZQKA 3TN0B 5IFAH 2VAJA 1J1OH 3QNYA 4C56B 2I60L 4APQD 2PYFB 4OZHB 3RPKA 3CFEA 3HR5B 4H1LG 4PGDA 4CMHB 1OB1A 1YN7B 4JAMA 3NGBB 2FJGB 3MRGB 2YKLL 3ZHKA 2IAMA 4XVTL 1NSNH 2WINB 1IGTA 1DVFD 1FNHA 4ZXBA 4M9OA 1A5FL 5D8JL 3BDYH 3GMLB 3QO0A 3IT8D 3L3KA 4I0CC 4XNYL 3RGVC 4YBLC 1X6LA 1DANT 3LMJH 4NO5A 4WW2C 2CDGB 2IMMA 3NMEA 4PS4H 4KQ4H 2DQEH 3L3HA 2DD8H 3QNXB 3FTGA 3O6LH 5T1DL 2IPKA 1HHKA 4NKDA 4HBCL 1EFXA 1TDQA 4XP5L 2Q1EA 2VDOH 1RJYA 4PREB 5IIEA 5JO5A 4L8BB 1PY9A 1AHWB 2SEBB 4MD0A 2O5YL 4C83B 3PHSA 4KJYB 1XGPA 1BZQK 1BQHA 1YPZA 2F5AL 4PJCA 5T5NF 1QQDA 5K9OB 2A9NH 4CGTA 5KW9H 1UQSB 4K7FA 5D71L 1N5YH 1R24B 2ESVE 5FYKU 5A43C 4LHUD 1D6EB 2NYYC 5SX5H 2X1QA 5B8CB 5IFHL 1CLYH 2IGFH 3PV7A 3HZMA 5HGAA 3AREC 1NDGB 1CGSL 4N1EA 1D9KC 2OTWB 2UWEF 3QR2A 4LSRL 1MCDA 1A2YB 4DEPB 3ULVD 2Y25A 3LKQB 5E08H 5J1SC 4G7VH 2JK5A 3QG6B 3PWUA 2VDKL 5IBTL 4Z5RA 1B4JL 2E7LA 2OX5A 2BNQE 5HVWA 3OKEB 2XWJB 1ZT4B 2Y06L 4OZFB 1FFRA 1UB5B 1VFOA 4RGNE 5I66B 4QGYA 5EU4A 2J88H 4LCUB 1OD7A 5CJBA 2A83B 1ORQB 1F6AB 4TOYH 3I50H 1G7IB 5ABDE 3QI9A 2BVEA 5J11C 2RIKA 1UEYA 3KYMA 4NNYA 2Y5TB 3NCJH 5ENWB 5D2NA 4NT6B 5E9DB 1QSED 1NL0H 3PWJA 4UAOC 1PX4A 2I25N 4K8RL 3WUWB 4WIQA 5F70A 5I1CH 25C8L 4YFEA 4WI9A 1FL3A 5C0JB 4MNQB 4K7PH 4YGVB 2OZ4A 5KSUA 3WLWD 2NQCA 4KRPC 4M1DH 3FT4B 4FQPA 4U6HA 2VLJA 1HWHB 4XC3H 4DFIA 3BH8B 5D7LE 3BH9B 1BVKB 2IQ9L 1MFAL 1UZ8A 2CRYA 2XTJD 4G42B 2XG5A 3MRCB 1X5XA 1RUML 2VZVA 4QHLA 4ISVB 4EOWH 4YHML 1ZGLA 2DQHH 3O0RL 4N0YL 5EOTA 2OP4L 1E4WH 4UQ2B 4FQJL 4M93C 5LQBL 5E99H 5BVJB 3AS1A 3TBWA 5J3HC 2ESVD 1WBXB 3V0WL 5F1OB 5SV3A 1WCBB 2B0SH 1ETZA 4AENA 4E0RA 1AIFA 5LGJA 4EXKA 1DCLA 4KJWD 1MLCB 5J6GB 4Q2ZA 5K93A 4U1JA 1S5HB 2G5RA 3QFDA 2GJ6E 2APWA 3WHXA 3SJVB 3GSWA 4ZNCD 1IGFH 4FNLH 3TA3D 4HEME 1I3UA 5C08B 4ZFFA 4P2RB 4GFTB 4GO6B 3TBTA 3E6HB 1GZPA 3O2DA 1NAML 5EWIL 3NFNB 5DRWA 3VXUA 5INCA 1A6TA 5AAWA 2X4NB 2AJSL 1MY7A 3QQ4B 3P11H 4F7TB 1DUZA 2QQQA 4PRHD 1NFIA 5GHWL 2FZ3B 1H3VA 5EZLB 1G7HA 5IVNA 3PUCA 3JV5A 2CLVB 3DX7A 4PJ8B 1KPVA 3MRQB 1LEGB 5DJ8B 3SEPA 1VHPA 3GBNL 3KPTA 2Z31C 1Q0XL 2QEJA 4PJIA 3IDJA 3LS5H 2VDKH 2J8UB 1C1EL 3TPUA 3ZKXC 1G7QB 2XWBB 3VXMB 3DVGB 2VSDA 4GG8A 4ENED 3O45B 4TPRL 3CXDL 3IRZA 3LN4A 4KHTL 2CRMA 4MJ5A 4UT6H 3HG1E 3RDTC 4GLRH 5BV7C 4FTVA 1DN2A 3RWIB 1NFKA 4P23B 2R2HA 2BVPB 1VACB 4OCSL 4PJBB 1JNHB 1KLGB 4O9HH 4LSVL 3NA9L 1LP9E 5JUEH 1FYTB 3QG7H 5DDHB 4HUKB 2GQHA 5D2LF 1U8IB 5D7LB 2NW2A 1R3LA 3DO3A 3VFVB 3BZEA 3EZ8A 3G6DH 1GL4B 1MAML 4NRXA 5H37G 1IAII 4ZTPL 5FAAA 3TA3C 3BKMH 2HJFA 5JIIA 2UYLB 1SY6A 1LP9A 4IDJH 3CH1A 4PY7B 3CJJA 4ODSL 2X4OA 4MAYC 4OV6F 3HTLX 3KLHD 1FJ1A 2D4FA 4Y8DC 2XQYG 1NCCL 4KJWC 3HFMH 1CGVA 3C5ZD 4G9FA 1TCRA 3ARPA 5CGYD 1FQ9C 3GB7B 2VLKE 3D5OF 3DMMC 3TT1H 1SJVA 3MRJA 5IWLC 1B0GB 3O8XD 1T03H 4BK4A 2FJGA 3MRGA 4Y4FD 2VDNL 4QRSB 4Y4HC 2AS5M 1LD9A 3IFLH 4UQ3A 1PY4A 1WAAE 2E7MA 2V2TB 4M6AA 4XPHH 4BM7A 4OIIL 5E2JA 1MRFH 1FHGA 3RTQD 3ULVF 5HHOE 3T77A 2WP3T 5IM7B 5CSBA 1DBJL 3FFDA 1T0MB 4PG2C 4WHTB 4R97C 1LO5A 3AM8A 3ZT5A 3TIDA 4NJ9L 2VN4A 4M03A 1T22B 2W0FB 1NANH 1RJZA 4NKDB 3VW3H 4MA7L 1IC5H 1TJGH 5HI5D 3F12A 2PO6C 3CFBB 4LASH 2HLFD 3K0WA 5AD0B 2GJ6A 3O0RH 5FUZH 2RB8A 4PTUB 1CBVL 4NO0D 3QFJB 1RIHH 5D1QB 3WJJA 5IJKA 4JFYB 3WIFA 2UY7A 2GFBB 5I16B 2EECA 5AZEH 5C0AA 4B5EA 3BGFB 4UDUB 3IF1A 1KTRL 5C08E 4MNGA 5LCVH 4F7CB 1W8OA 1A7BA 1IEAB 2B2XH 5KOMC 1JWMA 1FZMA 3RA7L 4U05A 5INDB 3O8XA 4MAYB 2J6EL 5B39G 2Z8SA 4MD5B 1MI5A 1E4XL 1M6OB 2P1YA 2XY2A 4ZYKA 2DTMH 1P7KB 4L4VD 1GJIA 3OX8B 1IMHC 3O4OC 4AH2B 1KCUL 3EAKA 4N68A 1MFDH 5E4IA 3U6RB 5C0CE 2LVEA 4ETYA 4JQXA 5CGMA 1I8IA 3EFFB 3HI1B 1CGSH 2L0DA 1OAXH 1A7NH 1UA6H 2HT2C 2JK5B 4ESKA 2YA0A 1P53A 3OR7B 1ZGLP 1IJ9A 5C0FA 4LAQH 2Q86A 3JTSB 5GGSB 2CLRA 4X80H 2EYTA 1BP3B 4U0QB 2EDYA 3VWKC 5EN2B 2ZUWA 5SWSB 4ZUSA 3QXAA 4NWTL 3FQWB 3KYMB 3LRSB 1M05A 3OR6B 4JFFE 4TVPL 2B0SL 3KLDA 3T2NL 3N9GL 1MRDH 2ORBH 3T0VA 3KPSE 2BSRB 1K6QL 4NCDA 4GG6B 4D9RD 4LLDA 1ND0B 1CFNA 4XCCH 2W38A 5JHDB 5BXFA 4MB5A 1T4KB 4AL8H 1QRNB 4OCXL 2FSEA 3WIHH 3MNWA 4LLWA 3INUH 5J6HA 2A1WL 3ARRA 3UTTB 4XPBL 1A7PL 3ZE2F 3EYQD 3MREA 1SYVA 4HC1L 1FNEA 2AQ2A 4G5ZL 4QHMB 4Y4KA 3RWEA 5MENA 1S9WA 4P46A 1LEIA 5SWSD 4JY4B 3PL6D 4P2RD 3SGKA 4R3SB 3IDXH 1AXSB 5MEND 2IALA 4FOMA 1U8LB 3O41B 1EJOH 5I17B 4HFWA 2Z31B 1IAMA 1K8DA 5I30L 4HWEH 3V4UL 3T0EE 1KEML 4NZUH 4MCZA 2IG2L 4XPGH 2X4TB 5E2VL 2YWZA 2A77H 2VN7A 3VXQB 4KK8C 1T7VA 3G5ZB 3S35H 4PRIE 3R1GL 5EPMB 4DUXA 1XCQA 4Y1AB 3VGEA 2BDNH 4YEFA 2A6DA 2CPCA 2NZ9D 3MGTB 1A4KA 2ZZUT 1RZGB 2P45B 3VXUE 1N3NA 3UTQA 3STLA 5D7IA 4L5FH 3TCLA 1QD0A 1DEDA 2B8OT 4MYWB 8FABA 4F3FA 1PGRB 1CLZL 4F7PB 4NQEB 2FDBP 3T65B 2APFA 2NX5E 4J3OC 4E41E 4PB0H 2X4NA 3U82B 1GZQB 1KCUH 1NSNL 2WWKO 3H3PL 4KUZL 2BMKA 5IBLD 4WUUD 1UH3A 1HHHB 5GJTH 1IC4H 3EUUA 5TFSH 4U1SA 5M94B 1EFQA 1ADQL 4BZ2L 1X5JA 4GRWE 4PGCB 1CL7L 1CLOL 4I48B 3VXMA 4AMKH 5C71A 1KN4H 3VH8G 3FRPA 4X4ZA 3B9KB 1MFCL 3MCG1 3QI9D 1C5BL 3WUWG 5D6CB 3EDDA 5I1LB 5J9PB 2O61B 3FQRB 4WW2A 1YEHH 4JG1H 2J8OA 3V4UH 3WD5H 2GUOB 4KI1A 4JZJA 5JOEA 5DHVH 2AXHA 4X6FB 3EHBC 4KGJA 4QLRA 1CG9B 3AU1B 5BV7H 4YDKH 2P4AB 4FQ2L 3GMNA 5E00A 4DUWA 5KVDH 1AO7E 1ZOXA 1AD0B 2OK0H 1GC1C 5CSZA 5D6DA 2VERN 1JGUH 2LFGA 3WIHL 2OQJB 1VGEH 3MNZB 1X3DA 3LY6A 2BCKB 3M17B 5E8EB 1BMGA 3PGDA 3U48A 3ZTJH 5HHQA 1MCWM 4LPCA 5GRUH 4HC1H 1GH7A 3MRJB 1DBMH 3ZYZA 5HYJA 4OSUH 4XP6L 3ARXA 3EW3B 4JVWA 2HRPL 3BDXA 4KI5E 4X7SL 4DGVL 1U8OB 4ZFOA 3I2CL 5KVMC 3VXPB 5HJ3B 4LASL 4X7DC 4Y5VB 2OTUB 5FV1L 3RVVD 3QEGH 5DA0B 1YN6A 1Z9MA 5F7KC 1W8NA 4XNQA 3Q3GA 3GSVB 1QSFE 4JANA 2CDFB 4U1HB 2AJVL 4JCLA 5IKCB 2EDKA 1SEBB 2A6IA 3IJHB 4DUVA 2V17L 1NMBH 3Q2CA 3HR6A 2XY1A 4JFFD 2XXMB 4MMXC 2IH1B 2GJ6B 5CJOH 2DQGL 4HUNB 4KVCH 4R9HA 4CL7A 4OKVB 4OFPA 4Y2DA 3KLAB 3MLSH 3QDGB 2GFBA 1RZ7L 2Z35A 4ZODA 3N85L 2NY6C 4KRPB 1MJJA 4X6EB 3W39A 4Y19B 4K94H 1W72L 3L3HB 1JRHL 4WI2A 3SDAB 2VC2H 1I9JL 5D1XB 5C8JB 2BNRA 5F1NB 3HMXH 3EOTH 4QXUL