2BPA2

Atomic structure of single-stranded dna bacteriophage phix174 and its functional implications
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
175
structure length
175
Chain Sequence
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of single-stranded DNA bacteriophage phi X174 and its functional implications.
pubmed doi rcsb
source organism Enterobacteria phage phix174
molecule tags Virus/dna
molecule keywords DNA (5'-D(*AP*AP*AP*AP*C)-3')
total genus 26
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1991-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bpa200
4CDQB 1VBC1 1PGL1 1AYN3 2R073 2R043 1X33A 1HRI2 4CDUA 3VBRB 1AL23 2WFF2 3JB4C 1OOPC 1FPN2 3LOBA 2BBVA 2HWB2 4RS5B 5C9AC 2WS92 5K0UB 1RUC2 1ND2A 5AC93 1CJDA 4JGYA 1GFF2 1F8VA 1RUH3 4CDXA 3J8F3 2DF7A 1AYM2 2HWF1 5DDJ3 2WZR2 1PO23 5C9AB 1HXS2 3DPRC 4QPGA 1QJX3 1HRV3 1IHMA 1DDLA 4RQPC 5C8CB 2RS32 4N43C 1BEV1 4PDWA 3IDEA 1HRI1 1RUI3 3JD73 3VBUC 5JZGB 2R062 4JGZB 4WM7A 1AR81 5BNOA 1RUF2 4Q4W2 3ZFEB 5BNPC 1R1A2 1RUJ3 1TMF2 3HAGA 1QJY3 5C8CC 4EJRA 1AR61 4Q4V1 1C8M1 1R082 2PLV2 4CEYC 1Z7S1 1RUE2 2WWSA 1BMV2 4YVWB 5ABJA 1NCRC 5C4WA 1FOD2 5A32A 1B35C 5BNOC 5ABJB 1D4M1 4RR3B 1K5MC 2RR13 2WS91 1AR83 1NY71 4WM7C 1VBB1 4AEDC 1AR73 4Q4Y2 2RMU3 1SMVA 3VBOC 4CDUB 5ACA1 2X5IB 4N53A 2RMU2 1H8TB 5ABJC 1NCQA 4IV1A 4RS5C 1R081 2PLV1 1WCDJ 5GKAC 3JBG1 4YVSC 1VRH2 2HWE3 1TME1 1RMU2 1AR82 2Y26A 4RR3C 2RR12 1PGW1 2IZWA 5BNOB 4Q4Y1 1TMF1 5LK7B 3NAPC 4CDQA 3VBSB 5ACA2 3M8LA 5CFDC 1VBD2 5DDJ1 1QQP2 4IV3B 1ASJ1 1VBE2 1OOPA 2HWD3 1R083 2PLV3 4CEYA 4GMP3 4RQPB 1H8TA 1EAH1 3ZFGC 1NA1C 4BCUA 4RS5A 1NCRA 2RS51 1R1A3 1MQTB 1HXS1 3JD72 4FTEA 1RUI2 1RHI1 1AL21 2RS33 1RUC1 2ZAHA 5C4WB 1QJX2 5K0UA 4GB32 1RUF1 3DPRA 4QPGC 1PIV2 1A6CA 2WZR3 1PO13 4QPIC 4LLFA 1FMD2 4Q4W1 4WM8C 4CDUC 1AYM3 2FZ1A 3J8F2 5BNNC 4RHV1 1AR92 1V9U3 1VRH1 5AC92 4JGYB 3VBFA 1ZBE1 2RS31 2WS93 4Y4YA 2MEV2 1QJX1 1HX6A 1FPN3 1RUD1 5JZGA 2FZ2A 3NAPA 3JD71 1HRI3 1FMD1 1RUI1 4WM8B 3VBOB 1AYN2 1VAKA 2R042 2R072 4Q4X1 1AYM1 3VDDC 1AL0G 1PVC3 2RS12 3VBHB 5L7OA 4RQPA 2RS52 1ZBA2 2BPA2 4N43B 1QJY1 1E57A 1QJU3 2RM22 1COV2 3VBFC 5CFDB 1ASJ2 1RHI2 3ZFEC 4N53C 1RUH1 3ZFGA 1VBC2 4JGZC 1RUD2 3VBRA 1X36A 3VBSC 1B35B 4CEWB 1RUD3 3VBOA 1VBC3 1ND2B 1RHI3 5L7OC 1PGL2 5BNPA 2RR11 1VB2A 2BUKA 1OPOA 2RM23 5J98B 5CFCA 3TN93 1TME2 1POV3 1VBE1 2RS13 2TBVA 1RUG3 1EV12 1K5MA 2HWC1 2X5IC 2R061 5AC91 1AR71 1MQTC 1B35A 2HWF2 1NA1B 5FMOL 4GH4A 1VBA1 1ND3C 3CJIC 1ZBA1 1AR63 2MEV3 2RM21 1MEC3 1R092 3TN91 1VBB2 3JBG3 2BFUS 2HWE1 4N43A 4PDWC 1V9U2 1AR93 1H8TC 3JB8A 1MQTA 1BEV3 1D4M2 1FMD3 1PO12 1PIV3 5J96B 1COV1 1VBA3 4NWWA 4GB33 5K0UC 2VQ0A 2ZZQA 4CEYB 5D8AB 4Z92B 1BBT3 1NG0A 3J8F1 1EAH3 4CDXC 5CFCB 2WFF1 4IV3A 3VBRC 1AR91 5A33B 4FTSA 4CDWA 1NCRB 4NWVA 3FBMA 4GMP0 5CFDA 2XBO3 2HWD2 3VBFB 5D8AC 3DPRB 1VBE3 1QQP3 1VBD3 5BNPB 5ACA3 2WZR1 2WLPA 1PO11 4N53B 1RUJ1 3VBUB 5JZGC 2ZTNA 1ND3A 3CJIA 1RVF1 1RMU3 4IV1C 1NCQC 2HWE2 1VRH3 1ZBE3 1Z7S2 4Q4V3 2HWD1 1RVF2 4CDWB 2XBO1 3ZFEA 4Q4X2 4JGYC 4RFT0 1OOPB 5BNNA 1FOD1 1PGW2 2RS11 1RUG1 4WM8A 4QPIA 5A32B 2QQPA 5BNNB 2GSYA 1RB8G 4Q4Y3 1AR72 4Q4X3 1F2NA 4YVWA 1CD3G 1RVF3 4Q4V2 1Z7S3 1ZBE2 4IV1B 1BBT1 1QJU1 1ND3B 3CJIB 4WM7B 3S6PA 2XPJA 1MEC1 1NA1A 5FOJB 1HQNA 4GH4C 4FTBA 4QPIB 1K5MB 1FOD3 3ZFFA 4CEWC 2X5IA 5C8CA 1W39A 1AUYA 1RUE3 1NY72 5C9AA 1HRV1 1VB4A 5D8AA 1NOVA 2XBO2 3VBHA 4GB31 5L7OB 1POV1 1QJY2 1RUJ2 1TMF3 4SBVA 4RR3A 1ND2C 4Q4W3 1RUF3 4CDQC 2R063 4JGZA 3ZFFB 4GH4B 3VBSA 4CDXB 5CFCC 1EAH2 1QJZA 5FMOS 1C8NA 1V9U1 1BBT2 1HRV2 4YVSB 4IV3C 1VBA2 1HXS3 4GMP1 1FPN1 1PO22 3VDDA 3NAPB 1NCQB 1D4M3 2BFUL 1BEV2 1VBD1 5DDJ2 3ZXAC 1EV11 1PO21 3VBUA 4PDWB 1RUH2 1BMV1 3JBG2 4CDWC 1VBB3 1RUC3 1PIV1 4AEDB 1R093 4YVSA 1MEC2 4QPGB 2HWB3 1RMU1 1OHFA 1AR62 5C4WC 1POV0 2GH8A 1AL22 2WFF3 2HWF3 3ZFFC 4CEWA 1M06G 5A33A 1EV13 1C8M3 1RUG2 4Y5Z0 1RUE1 2MEV1 1TME3 1R091 3TN92 2HWB1 1AYN1 2R071 2R041 2HWC3 4AEDA 1QQP1 4FSJA 4RHV2 3VBHC 3VDDB 4YVWC 4RHV3 3ZFGB 1ASJ3 2HWC2 1COV3 1PVC1 1QJU2 1ZBA3 1R1A1 2RS53 2RMU1 1PVC2 1C8M2
chains in the Genus database with same CATH superfamily
4PQQA 2D97A 5EQUA 1GLHA 4QM8A 4JX0A 1WD4A 1REFA 1LGBA 1OUSA 2K2SA 3PUQA 3ZXKA 2D5HA 4BMBA 1RUNA 2BWAA 4CDUA 4Y20B 4E2GA 4MXWA 1AL23 3FHQA 1R1ZA 1WBFA 3JB4C 4GWMA 3C2UA 1JZ5A 4LIVA 1UXZA 1LGNA 4QQPA 5FY4A 4W6WA 2VW2A 1GV9A 4KGGA 2BBVA 1TNRA 1GZWA 1ULDA 2JE9A 3RMXA 1I9RA 3NJYA 2EXJA 3JQWA 3K2OA 1JTZX 4L2NA 2XJVA 4UYBA 5C9AC 1ENQA 1GWLA 1DQ1A 5FO9B 1KS4A 1Q8OA 2XL7A 1RTVA 4FBFA 5K7PA 1W99A 2K0GA 2FDIA 4FFHA 4JGYA 3CZJA 1O8PA 5J1XA 4XAEA 1H4HA 2ZMKA 1BVVA 1H1IA 2ZGNA 1HV0A 1W8NA 4RA0A 2BNOA 2QFEA 1AYM2 2ZX1A 3POFA 4NIHA 3GBGA 1C1FA 2OUJA 4IGQA 5F6KA 3T08A 2WZR2 5FMCA 1JXNA 4CP0A 4Y1VA 5FWJA 4M01A 4Y26A 4LUMA 5FYMA 2SLIA 1DZTA 1QJX3 5ISLA 3ZXLA 3ZYJB 5DUWA 3FUOA 4LJHA 3I2KA 1F5FA 1V6LA 2ZGLA 3WR0A 2RS32 5SV5A 1LHOA 1HRI1 3DYOA 2OVUA 3I2HA 3K77A 1HLCA 3POIA 4JGZB 2QQWA 5JMOA 1Q8SA 3OUIA 2BNNA 4UWDA 4XF1A 4YGEA 2VBPA 5FPLA 2OQ6A 5KXEA 1R1A2 5G04L 3BTZA 3NNMA 3VDBA 1QJY3 2ILMA 4Z82A 2ADEA 4MVTA 4EJRA 2FMYA 5FDBA 3ZIXA 4BU2A 4JKLA 1OFNA 2ZOEB 2WAOA 3HBKA 2GNBA 4JDNA 2WWSA 3ACFA 4N9HA 2WT1A 1REDA 1UOGA 1N3PA 1WLWA 3O0VA 5DPNA 4A7YA 5ABJA 1J84A 3H1MA 4XC9A 4XDQA 3I3MA 1QXJA 1N1VA 4UW6A 5A3OA 5LBFA 4RR3B 4CVUA 5CAZA 2RR13 1GOHA 3EMRA 1XE0A 4LXLA 4UFMA 2PQQA 2PAMA 2CWMA 2V5DA 4E2QA 4AFDA 1VBB1 4LIUA 5LA0A 2D3PA 3DCQA 1G6NA 4XBNA 5FOBB 1RGSA 2VTXA 4CCJA 1Q56A 3NV3A 1Y43B 4UFHA 1AR73 2NMOA 3CO2A 4Q4Y2 3IB3A 1SMVA 1G8WA 1OLMA 2WQZC 3VBOC 3SH4A 4X6QB 4XF4A 1X50A 4N53A 5DMYA 4AHZA 3EXUA 1H8TB 1WLDA 2GDFA 3WF1A 3FMGA 4AYUA 1EUTA 4RS5C 2PHDA 1N3OA 1MS8A 4TSVA 1YCIA 1WMDA 4FI9A 5GKAC 4XMAA 4E2SA 3O1TA 1YFYA 4FXKB 1JN2P 5FKCA 2A6WA 1GU3A 2CNAA 3T2PA 3BCWA 2X29A 5CA6A 5A3MA 2OT7A 1BK1A 2IZWA 5BNOB 1NLQA 1CAWB 2QQLA 3MIFA 1ALYA 1PGSA 1S55A 1XYPA 3CL1A 3NAPC 4K6BA 4L99A 1W8UA 2NMNA 2JX9A 5ACA2 1H2MA 1WCQA 4QDSA 5JI7A 1WBLA 3BTXA 2JDHA 1PHMA 1QQP2 1TG7A 4IV3B 1IKQA 4K8RB 4D6SA 5C8WA 3UT0A 1ULCA 3WF0A 2Z79A 3KQRA 4OYUA 5BXXA 4CEYA 4LBJA 4GMP3 3PU8A 1H8TA 5F5IA 3ZFGC 5FZ8A 1NCRA 5B4XA 3THTA 5JIUA 1KS5A 1MQTB 1QF3A 1U5XA 1DLCA 1ZM1A 3OY8B 3AKTA 3FZ3A 5LA2A 5ANNA 3D5OA 2PXJA 1RUI2 4QX0A 3ETQA 3T30A 4EWDA 3WW2A 3B69A 4J6GA 1LEMA 3WNKA 4V2WA 3ZVXA 4BMEA 3HIFA 3BB6A 3NJXA 4CUGA 3JXSA 5IK7A 2VZPA 5C4WB 2P17A 5HXMA 4AEKA 4QB6A 5K0UA 1S0GA 2IXIA 2W9XA 4GB32 2EVXA 2ZGKA 5FYCA 5SV8A 4AF9A 3DPRA 4AZZA 3H1WA 5IAXA 2O8QA 4XBLA 1PIV2 1OH4A 4AVSA 1FX5A 1UYYA 2P3JA 5DQ0A 3BIWE 2ZEYA 5JR2A 3BI3A 4BYYA 4WM8C 5FZCA 3OPZA 3R4SA 3LA3A 3WUDA 1XU2A 1IG0A 3C3VA 3WDVA 5AC92 4XE9A 4IEZA 3ZSKA 4OMCA 3VBFA 1DQ6A 1Q43A 4M3CE 1TZOA 2OA2A 4FPYA 2WS93 5HXVA 4Y4YA 4QGMA 3I2FA 1HIXA 4ZS3A 3AKSA 5D1IA 1W8TA 1NX9A 4AG4A 1QJX1 3VZLA 3KLSA 4S2DA 3KD4A 3LEGA 4QQ2A 3BKZA 1HX6A 1FPN3 1APNA 5JZGA 5AFEA 4RSUA 1H2LA 4R9DA 1RUI1 3AMQA 1AYN2 2BWCA 4LO7A 3VBOB 4URTA 3WNOA 4AVVA 3POSA 5DAPA 4DO0A 2H6CA 4LHKA 5CYYA 1QIQA 1YQ8A 4UF0A 4OULA 2IXJA 5T54A 3AZWA 1W2NA 2ZGUA 3TEXA 2JDPA 4QT6A 3L2HA 2DFBA 3EYPA 3RS6A 4J25A 4FAHA 1COV2 2DFCA 3NVCA 2WL1A 4QGNA 3WNLA 4D7YA 3ZSMA 4CUBA 3ZFEC 1KXGA 4EN9B 4N53C 3ZPOA 2YBPA 3ZFGA 2AACA 1TQ5A 3WP6A 4BQWA 5F9TA 3N7JA 3VBOA 1GNYA 2VTXJ 4I2OA 1URXA 4KU8A 2A1XA 1KDMA 1X7NA 1UN1A 4AAPA 2GALA 2PAEA 1GWMA 4EWEA 4ITCA 2RM23 2FCVA 3OGGA 5J98B 1H9PA 4DY5A 2GH2A 1JYWA 4HVRA 2VOVA 4XTPA 5KHJA 3LEMA 1SEFA 3JU9A 1V0AA 1Y3TA 4YM0A 1O3TA 2YPDA 2D40A 2RS13 3BODA 3W5NA 4EYUA 2O1QA 1KEXA 2GNMA 2IXHA 4WV8A 1EV12 5I8YA 4KMQA 2HWC1 4IETA 3RYRA 3RFRA 1PX3A 2VNRA 5LBEA 4AAXA 1NA1B 5IVFA 5FMOL 1OD5A 2Q4SA 4GH4A 1SQ4A 1NE4A 4HPKA 4S2GA 3WP4A 4JHTA 1ND3C 2C26A 1SLAA 3N36A 4XVHA 1FATA 1PK6B 1V6KA 1MEC3 1CZTA 2WJSA 4NHYA 5F2WA 4NHKA 3WD5A 4AGVA 1WMEA 5L7OA 3JBG3 2ADDA 3P1IA 4WZCA 4P9LA 2OPKA 1FV3A 2W87A 2F4LA 4Y33A 3ITQA 4DRRA 2CGOA 2DCJA 3JB8A 4R4XA 1WGPA 3U10A 1MQTA 1BHGA 3OBAA 4BH9A 4TN7A 3WF4A 3LAGA 5JOXA 1D4M2 1FMD3 4QU2A 1PO12 1YWKA 1X9PA 1ZRRA 2XH6A 4CCCA 5DABA 1OMIA 4BQ1A 1FV2A 1QDCA 1IS5A 2HEVF 3KGLA 5I8SA 3OEBA 3MBWA 1BBT3 4JC1A 4F3JA 3FHAA 2F17A 2DURA 3M3CA 3MW4A 4HOOA 1EAH3 4P5HA 4CDXC 2WO2A 2F6BA 3AZXA 4IV3A 3NRUA 4XABA 2C0ZA 4R4ZA 2ZHKA 2Q1MA 3KT4A 4LO8A 5GZDA 3A4UA 2P3IA 3H8RA 4Q1PA 2HH9A 4EN0A 2JE8A 4QB2A 1SCSA 5DG2A 1C5IA 4ZXKA 5F37A 3B5LB 2WQ8A 4IE7A 5FQ0A 1WA4A 4XJ9A 1O7FA 4NRMA 1VBD3 2NP0A 3SCHA 3CJXA 2CAVA 1DGRN 5BNPB 3DV8A 2JG8A 1CJPA 1G9DA 3CF6E 4YZ5A 1J3RA 1DBNA 2WT2A 4GA9A 1DP0A 1IPSA 2WNOA 1DFQA 4N53B 1QH6A 3AYDA 3WY6A 3VBUB 5BNQA 2ZTNA 4RGGA 3OPTA 4HZFA 1T2XA 3D82A 4IV1C 4XZUG 2UWCA 3CZUA 1NCQC 2J1AA 2WNEA 2BQPA 1TEIA 2VNGA 2W46A 3WG3A 2UY8A 2B39A 4XPVA 1RVF2 4WVMA 5GZGA 4ZHNA 2C6SA 4D94A 1OQDA 1ZX5A 4JGYC 2ET1A 3GBFA 2GMMA 3RRDA 4GJYA 1FOD1 1PGW2 1ULEA 4L92A 3T2OA 4CE8A 2GSYA 2JB4A 4JRAA 4KI5M 4M3CF 3ALQA 5ERLA 3U78A 1DZQA 3O5SA 4Q4X3 1F2NA 3OY8A 5I0TA 1CD3G 5LB6A 3AMHA 1RVF3 3FBYA 3NQHA 1XQNA 1UYXA 3ABZA 3RWKX 3J7NA 5F6LB 4E4ZA 1W9WA 3ZXDA 2Q1ZB 2VMCA 3ETPA 1CONA 2JDKA 3OB8A 4R9BA 2GN7A 4EN7B 1W8FA 3T0AA 5HCAA 1O3QA 5GZFA 4MGZE 4QQOA 4CCOA 4QXHA 2OX0A 4LULA 4AL9A 4GULA 1JYNA 1JYCA 2HYXA 4MXVA 4DB5A 1PNFA 2BVBA 2Y34A 4AI9A 1D0HA 3VL9A 4NUBA 4WVZA 1LOFA 3WHUA 1RUE3 4FQ4A 1V70A 1O6UA 2A5ZA 2IWGB 5D8AA 4ZPIA 2KM2A 4MGTA 5IK5A 1Q3EA 3VKLA 5FZMA 2YUEA 3H9AA 1BQPA 3J7MA 1POV1 4XURA 2D5FA 3J7HA 1TMF3 4H2AA 3W5MA 1BKZA 1DGRA 4SBVA 3WG1A 1ST8A 1Z78A 4Q4W3 2FDFA 1QNWA 4XF0A 3ZYPA 1H30A 3SHRA 4ES8A 4JGZA 5F32A 2YZ4A 3M3OA 3RZLA 1LU2A 1W0PA 4TYSA 1AHSA 5FMDA 2DUQA 1EAH2 3RYKA 3ATGA 1XYNA 1IOAA 1C8NA 3D4KA 2ZAAA 4OUMA 3LGRA 5FMOS 5FY8A 1BBT2 1PX4A 3WDTA 3T0DA 4YVSB 3OBZA 1DCSA 1OKQA 1JODA 4Q5OA 1YI7A 4FCAA 4CCNA 2VUJA 4IV3C 2VBBA 4R8HA 3MI8A 2OZJA 4GMP1 4DXTA 4AHYA 3C7GA 3O1SA 3GM8A 1PO22 1GZWB 4YZ2A 2RE9A 2ZZJA 3WQ7A 3NAPB 3R0RA 3U4SA 5A3PA 1HB3A 1D4M3 2BFUL 2BJSA 1VBD1 4O61A 4YNIA 4AI1A 2KXLA 4D6RA 4PDWB 3ORJA 4XUOA 1DGWA 1JS9A 3TBDA 2EIEA 4NROA 3JBG2 1JH5A 1VBB3 3LQCA 2N7GA 3ZLIA 4YVSA 1MEC2 2JKBA 1UMHA 2VMGA 4QPGB 5HCHA 1HV1A 4A6SA 1ODNA 2QQUA 3ES1A 3WDYA 3U4XA 2GU9A 2OYZA 2B8MA 4BJ0A 3WNPA 3SH5A 1CAUB 3ECQA 3FE5A 5FY1A 1W6OA 2GH8A 4NO4A 4B7EA 4XFGA 3SITA 4BWOA 2Z2SB 4JDMA 4OI4A 2ZS6B 3ZFFC 3U0ZA 1M06G 3LDBA 3S5QA 1W8ZA 2Y0OA 3IPVA 4HLTA 1LEDA 4OMDA 1EV13 4XAAA 4Y5TA 2WSVA 5J36A 1HN1A 5E1RA 5T3NA 4LOTA 5DAVA 1GYKA 4YSFA 1RUE1 2ZGSA 4PLMA 4Y22A 5JAXA 1MVEA 2DBNA 2W68A 4NPMA 4NPLA 3NO8A 1NQJA 2PAKA 2VR4A 2Y33A 4LT5A 2ERFA 3DGTA 1X82A 4HFSA 1TNFA 1RYYA 2HWC3 5CU1A 1YO8A 4L97A 3OGVA 1OA4A 4NN0A 4RHV2 4I0BA 3HN3A 5DUXA 5JOZA 4P08A 2ARAA 2W3JA 3MUY1 1RITA 5IWFA 2B42B 1FI2A 3M4FA 1LHUA 1LNSA 3BPZA 4LO6B 4OZOA 3ZFGB 5F5QA 4YFWA 1XSRA 1J58A 1DYOA 1VP6A 1QJU2 2AENA 4YW3A 1OKOA 1R1A1 1W6PA 5EJ3A 4DEQA 5CISA 2WNUB 1OF3A 2AUYA 4ATEA 4CCDA 5G05L 2K46A 2IXCA 2JECA 1C8M2 1SFNA 2G9ZA 2WINB 1U5YA 1ONAA 1OQEA 3ES4A 1VBC1 1PGL1 1PZ7A 2R073 2R043 1X33A 5FUIA 4KGQA 3VBRB 5LBBA 2WFF2 3HQRA 2D6NA 2Y6JA 1QOSA 4OZXA 2R30A 1D2SA 2O0OA 1GWKA 5A7SA 1KD7A 2HWB2 2GAUA 4K40A 4RS5B 5FIXA 2AC1A 1S2BA 5DZEA 3ZIWA 2UURA 4GWNA 1G7YA 4LBQA 1UZYA 2ZHMA 3RDIA 2JE7A 1GFF2 3H50A 4YRDA 3BTAA 4COYA 2ZMLA 3ZN4A 5F2SA 1AJKA 2W95A 3IDCB 2WZPP 3BN6A 5EPAA 4W65A 2P2KA 2DDUA 4F83A 4XJAA 2BZDA 3AZVA 4XQDA 1AZDA 3N9PA 3OBTA 1PMIA 1W6MA 5C9AB 4LHNA 1O5LA 4BXFA 1HRV3 1IHMA 3NW4A 2SBAA 2Z42A 4D7TA 5I0SA 2CU5A 1UYPA 4N43C 4PDWA 2QNKA 2R16A 4ZU7A 1JZ2A 4IEPA 3VBUC 5C6CA 1IZ3A 3QACA 2ZEXA 4WM7A 3KWVA 4XFFA 2VPVA 4R52A 4AQSA 4OHYA 1AXKA 3VHPA 5BNPC 4KNCA 5FZIA 1EPZA 1SLLA 4L11A 1ULOA 1C8M1 3MV01 2PLV2 4XFIA 2TEPA 3SKJE 2A71A 1CR7A 5D2AA 4CEYC 5FO7B 4COWA 2W47A 4KWUA 2FDKA 4IE0A 4KWKA 3E5UA 1HB4A 3N3HA 3VDAA 4BOWA 4AVTA 4BZ4A 2LTNA 2NQYA 4AFBA 1JZ4A 4FPJA 4PF5A 1VAVA 2ZGMA 2ZX2A 4PCRA 1KFXL 1FOD2 2Z69A 5A32A 1B35C 2Q8OA 2YDEA 3VL8A 1D4M1 3UKVA 1K5MC 3Q8BA 2XUEA 1XNAA 4FQZA 3UYJA 1VMFA 3O1MA 4CXYA 2WS91 5HPOA 1C1LA 3URFA 1UKGA 4B4RA 2FBEA 4QAWA 3ZMNA 3BVCA 3K51A 4OHXA 2E33A 3AL5A 4PT6A 1YFXA 2VQUA 3R4UA 1CVNA 1UL9A 4EROA 3UKNA 1KQRA 1JHJA 3Q8FA 2VZ3A 4A45A 3WP3A 1PMJX 4JKKA 3OOXA 3SH3A 4CDUB 4YYOA 1VJ2A 1E5RA 3I3DA 5FJHA 2HLEA 3WP5A 2PHFA 1LGCA 5BV6A 1LHVA 2JIJA 3DYPA 1IQDC 4IV1A 5FP4A 1UO9A 5A7NA 2PLV1 3PIGA 3USUB 3HVDA 4RGKA 1HQWA 4UFJA 3UL2A 2FDGA 5A7PA 2Q8EA 4XEZA 3AB0A 1Z0HA 2YG0A 4JTNA 4QKBA 2HWE3 3G6JB 3LFMA 3ROUA 1MACA 2EIGA 4FPEA 3SEPA 3KCCA 4Z8BA 4DRVA 2ZKLA 1W2AX 4HBNA 5FAXA 1OA3A 5LK7B 2ZGPA 2NYYA 4IEQA 4CDQA 2YMZA 5C9AA 4YFZA 5CIRA 2FDJA 1F4AA 2YYOA 4V1PA 1DQ0A 1LHNA 3SXWA 3KSCA 1AJOA 1K3IA 1LJ7A 4I0AA 4FOWA 1H6YA 3WHTA 5CFDC 5L9BA 4R9AA 1ASJ1 1VBE2 4C0HA 5EJZB 1OOPA 1YXWA 3CKHA 2VO5A 3LEIA 2PLV3 4PIXA 2EA7A 2D6LX 1CPMA 4MOAA 4BCUA 4RS5A 5LA1A 5LBCA 1R1A3 2YC2A 4FXGB 2XJQA 5FY9A 3A0KA 1HXS1 2VL4A 3OYWB 4LK7A 1HDKA 4YG6A 3HEIA 4P9YA 4S2FA 1YIPA 2YFZA 4CU9A 4ZU5A 5FP9A 2XWBB 1RC6A 2VMEA 2WA3A 1RHI1 1AL21 3DXTA 4EZHA 3NKTA 2PHRA 3LOIA 1K5JA 4WVMB 3UK9A 3VZNA 1XU1A 5K9YA 4Q0UA 2ZAHA 4IUGA 4Q0VA 3UKTA 4EN6B 1J3QA 2VZOA 2Q5TA 1QJX2 2ZHLA 4OUEA 5GLZA 4DXSA 1DQ2A 4M00A 4P5YA 4LEJA 2Y6LA 3AZYA 1RUF1 2BRTA 4IERA 4QQHA 1CX1A 4NAMA 2W91A 3ZDVA 2WYSA 2XVLA 5FZ6A 3E6CC 4Z07A 2WKKA 1AYM3 2ZX3A 2FCTA 4M3CA 5BNNC 1AR92 3GZTB 2YC0A 1MS3A 1LULA 3S5AA 3ZKYA 2E7QA 5FK7A 4L9BA 5CB7A 4LA2A 3RJ2X 4SLIA 3H7JA 5DXDA 1GQPA 2A6YA 2C24A 4D69A 3IIIA 3I8TA 2MEV2 2RJLA 4CXXA 1QJFA 2XHNA 1UY3A 1N1YA 1UWWA 5EHDA 1W03A 4CU8A 4ISQA 2W5FA 3H3ZA 2LUWA 5EIYB 4FPGA 5DUUA 4E8DA 2DVFA 1LOGA 1XE8A 4HMZA 4JDOA 5C3SA 2Y6FA 2FZ2A 1FMD1 2VVDA 1RINA 1ZYBA 3Q8AA 4WM8B 1CPNA 2R042 2R072 4Q4X1 3AMMA 2WO3A 2PHXA 3AP6A 4QWNA 1AYM1 1CIWA 4Y1XA 5FZFA 5BUVA 5JCTA 4Q1RA 4LBLA 3NKGA 3VBHB 3VD5A 4FFGA 5FK8A 4A6OA 3OGRA 4AI3A 2JDYA 1XE7A 4GXLA 3ZN6A 4MHUA 4N43B 1E57A 1QJU3 5L9VA 2WZEA 1XNDA 3T0BA 4XILA 4A41A 3IIAA 3VBFC 2A7AA 1L3JA 3I49A 4YGDA 1RHI2 3D0JA 3HT1A 1RIRA 5IK8A 1F4HA 2PQSA 3R6SA 5DG1A 1RUD2 3LD8A 3VBSC 3VBRA 2P3KA 4ASLA 5A80A 3N9OA 5IVVA 3LWCA 1VBC3 4MX3A 2GP5A 5FY5A 4MYEA 4H55A 4AI2A 2UWBA 3I2GA 2RR11 1VB2A 4ZU4A 1JYIA 4META 1UIKA 2QQMA 2XOMA 4FP3A 1UU4A 4XUNA 1J59A 5KHKA 1DG6A 5FZLA 2Y6GA 4RYDA 1GMMA 2C4XA 2XL9A 1ZZCA 2VJXA 3ILRA 4F7ZA 1K5MA 4LE3A 1SFPA 3LDKA 2R061 1AR71 1AX2A 5A6XA 4WBBA 4PLNA 5JDBA 4KU7A 3OD0A 1LR5A 1LOFC 1UKRA 2D3RA 2JDAA 2R1DA 4QMAA 1BK0A 4Q2FA 1I5ZA 1FT9A 2ZKNA 3NV4A 2DCZA 2WWJA 1BXHA 1I3HA 1QKQA 5F8PA 3OPWA 1Q5OA 5EWSA 3H8UA 4L0PA 4QX3A 5ANQA 2YU2A 2ZPXA 5A1LA 5A7WB 4CP9B 2XB6C 4AQ6A 1VBB2 3WDXA 2WO7A 4MLOA 2BFUS 4NE9A 3POBA 3DXUA 2DTYA 4N43A 4PDWC 2RDRA 3GCWA 3MZHA 1H8TC 5I0DA 1UU6A 4H7MA 5IFPA 4TWTA 2XONA 2Z4FA 3PVEA 4QPWA 4LR4A 3B9IA 4ES9A 1JYTA 2EF6A 4HANA 4JQTA 2GC3A 3QD6A 2B9UA 5FZDA 4AFAA 2P34A 3BALA 5J96B 4O7XA 1VBA3 1MZ6A 1DHKB 2BOJA 2YBKA 5K0UC 4GKYA 5GALA 2MNGA 4CCKA 5D8AB 4Z92B 1JW6A 5C71A 5J09A 5JI9A 5LW9A 2ZMNA 2DVBA 2FHRA 1SPPB 3H42B 1O91A 4M3CB 3VDCA 4CUCA 4ZZ8A 5FBJA 3LF7A 4EZ4A 4UF0B 2RDSA 2O14A 1AR91 3KT7A 1F9KA 2ARCA 3MW3A 2YV8A 1OQ1A 3AFGA 5A33B 3RSJA 3ELNA 2X10A 4I02A 4FTSA 1D2QA 3I4IA 3THDA 4NWVA 5FWEA 4Z1VA 4P14A 4GMP0 1JBCA 2XQXA 4YG3A 2CAUA 2HWD2 2EALA 4RFRB 3V0BA 2WQ4A 4K3UA 2XJUA 3DPRB 5A3TA 1VBE3 2A6XA 4B1MA 4UW3A 4BQYA 1S4CA 4D6QA 4QX7A 3WQBA 2BGCA 5HI0A 2WZR1 2YXSA 1PO11 1RUJ1 1LOCA 1Y9QA 5FP3A 5CG8A 1ZRDA 1RVF1 2WLQA 5IATA 1N1TA 2EXIA 1QXRA 4LITA 2BYVE 4BM8A 1H2KA 1LODA 3JZVA 1W6QB 1U0AA 1US2A 5C5UA 1UCXA 1YEWA 5L73A 3VD7A 4A7KA 3MF6A 2JKXA 3DUIA 1VLNA 4Q4X2 1LRHA 3NNJA 3OF1A 1OOPB 5BNNA 3N9MA 4BLIA 3E5QA 1N47A 1J83A 1UY4A 1RUG1 3X29B 4HONA 4QHBA 4N7IA 4HVOA 2R49A 2B45X 2YHJA 1W6OB 4Y1YA 3VZJA 4IGPA 1EY2A 3LCPA 4YVWA 2CDOA 1WW6A 1WLCA 3HMYA 1OPMA 3POJA 2BBAA 4COZA 1V6NA 2Y38A 4IV1B 4XJUA 4OLLA 4HXCA 1ND3B 5JXIA 2XPJA 1MEC1 4YZ4A 4K7JA 4BDVB 4QKNA 4Y20A 4GH4C 3AXEA 5FYVA 5LASA 3TNPB 1QOTA 2PFWA 3S30A 1WW4A 3M70A 2R7EB 1K5MB 3T1LA 1FOD3 3CNAA 1Y9GA 4CEWC 1GANA 1SDDB 1NE6A 3P6BA 3IBMA 5C8CA 5A7WA 4BHPA 1NY72 4IE6A 1VB4A 3QCWA 3N7LA 4DIQA 5DUVA 1UQXA 5GZEA 2ZBJA 3VZKA 1ZRCA 1QDOA 2VUAA 3V0AB 2J22A 2QCSB 3J7LA 4GB31 4BK4A 1A8MA 5K8SA 1RUJ2 2TNFA 3OCPA 3KF5A 2B7YA 4M0HA 4UI9L 4XTMA 1Q8PA 1RUF3 5JOWA 2BGPA 2DCKA 1YJLA 3FX3A 4QDQA 2VW0A 3KM5A 1MS9A 5BY5A 4FPOB 2R063 4GH4B 4JAAA 5IAVA 2PHLA 3SQOA 4CDXB 3FLRA 4NAOA 4NPRA 2VZQA 2VAUA 1QJZA 2X53S 3ON7A 2UYAA 1JOJA 4B4PA 4B1LA 2ENRA 2ATFA 1HRV2 1NLSA 1GUIA 2D98A 3RYPA 3VHOA 1CZVA 1HXS3 2W92A 5A6QA 1H6XA 2CV6A 4PI0A 2VZSA 4HKLA 5HV4A 5BPXA 4OHZA 4TXWA 1CX4A 2MPFA 1NCQB 1S0EA 4KBBA 4XQ4A 1KDKA 4IQPA 2OPWA 5IW0A 1W28A 1EV11 1BCXA 4QD2A 3VGIA 4CCEA 3H1YA 3E6DA 1RUH2 2A73B 1BMV1 1HW5A 3OGSA 1H0BA 1NZCA 4JRLA 3PJQA 1CESA 1OLME 4W8JA 3GZEA 3M3QA 3T4HB 4BQ2A 3GALA 3MPPG 1W6PB 4LMFA 3AMNA 4DFSA 4XBQA 2GZWA 2HWB3 4HN1A 1OHFA 2G19A 1WA6X 5T5LA 2XVGA 4MGIE 5FXVA 2BGOA 4MO3M 5LATA 3RZHA 1POV0 5LK5A 4L8QA 1DF0A 4XXPA 2XXZA 1YNAA 1CQ9A 2A3YA 2HWF3 3IMNA 2V5YA 5E88A 1UU5A 4EQVA 2QQVA 1JU4A 2QQOA 1VIWB 1C8M3 3PLQA 1NUKA 1CAVA 2HKXA 1XYOA 3IAPA 2WN3A 3WW3A 2OS2A 3HNBM 2WIIB 2WNUC 4JHZA 1TME3 2D6KA 2HYKA 3SEEA 1W6QA 5T5JA 2ID4A 4RGAA 1AYN1 4CUAA 2ORXA 3PVOA 1XOYA 4IEYA 4AEDA 1GP4A 1UZZA 2RHPA 4M4PA 2D7FA 3NV2A 2OQ7A 1IS4A 1YUDA 3VDDB 2AZ5A 2WNVC 1SLBA 2ZGOA 1S0JA 2ARXA 3CLPA 4LO5B 4XQWA 1OBNA 3UGGA 4OI0A 1ASJ3 1TE1B 1DQ4A 2MHFA 2HWC2 4XFAA 4YARA 5FZEA 2J1RA 2ZGQA 1COV3 5FYIA 5A1AA 3C8XA 4JZRA 3I2OA 3RZMA 3LIHA 3T4VA 3F95A 3POYA 4U36A 5FUPA 4O9GA 4GWJA 1H8VA 3PMEA 2VD7A 3GZUC 2VY0A 2V4AA 4LUKA 1PK6C 2AYHA 1AYN3 4KWJA 5K4LA 3UESA 3VZMA 3O1VA 3AP9A 1JZ7A 1YFUA 4XUTA 2PTMA 1FPN2 1LU1A 1PVXA 4UFKA 2I45A 3MIDA 4MUVA 4Z2WA 1Y7BA 3LSEA 3PNAA 4QPYA 4IESA 2IVIB 3PTYA 1UMZA 2JG9C 2RV9A 5T52A 4CPBD 3A23A 3KCXA 5T5OA 2WS92 1QGLA 4D0QA 4Y22B 1NZIA 4FPFA 1UZ0A 5JIAA 1ND2A 3H3UA 1JUIA 1UXXX 5AC93 1ZNPA 2DVDA 4UXAA 3HJRA 2WO1A 3FC0A 1F8VA 1RUH3 4CDXA 5I8TA 2DF7A 1C28A 4EE2A 4O65A 4ZY9A 5IK4A 2CWSA 2QQKA 1PM7A 3WSOA 3D0SA 4BPZA 4CA9A 1NYWA 1HJFA 1ZZ8A 3WUCA 1S0FA 2L9LA 3E97A 1HXS2 2QBXA 2VOWA 4FP2A 4QPGA 4LBKA 1UIJA 1J3PA 1W06A 4XIKA 4DQAA 1WCKA 2AEYA 4LKEA 4RQPC 2NPIA 1SBDA 4GIQA 1W3XA 3HD8B 5APAA 2NN8A 3TWIA 4QGLA 5C8CB 4AQTA 4ISRA 1JU3A 1RUI3 4CYDA 3KCYA 2R062 1LENA 3Q8CA 3S7IA 3I3EA 2E63A 1W0OA 3W59A 5BNOA 2VOTA 2OXBA 1RUF2 1I6XA 5F5AA 5F3EA 2R0FA 4A7ZA 2XQRA 4IEUA 2BVVA 2Y6HA 1RUJ3 3HAGA 4IGOA 3ZYFA 5IFTA 3HNYM 3ZYRA 5C8CC 4BE3A 4PBPA 5F3CA 5DAWA 4KBZA 3J9SA 3CIHA 2QKDA 2D43A 3SCGA 1FNZA 4A2UA 2VECA 2VZVA 4BQXA 5A7OA 4JQRA 4YPJA 5JXGA 1BMV2 4YVWB 1G86A 2VMIA 4YW4A 2DU0A 3OGJA 4Y5SA 2VTFA 5AVPA 3MIGA 4DEVA 1JYXA 5BNOC 4Q0PA 3TYJA 5J37A 1W6NB 3ZXGA 3WG4A 2GNDA 3ZPYA 3B02A 1UYZA 4BQ4A 3VD9A 1MS4A 1T6GC 1OXCA 1NY71 4NRQA 1O4YA 1UD1A 4AHWA 1CN1A 2DVGA 3LDRA 3KVBA 3AVSA 1MPXA 3KGZA 4LE4A 1G9AA 2YC4A 3FL7A 5FPXA 4XHBA 1V00A 3QH6A 4CSWA 5FLHA 5F1RA 1W9SA 1CGPA 5FYZA 5E16A 2D44A 4I30A 5ACA1 3WLUA 2X5IB 4Q0SA 3WNMA 1YI9A 2RMU2 3R05A 2VZTA 2JDZA 5ABJC 4A3XA 1KFUL 5FZ3A 4LBMA 1S2KA 4LK6A 1WCDJ 4JV4A 4CU6A 4ONUA 3JBG1 1DQ5A 4YVSC 3GJBA 2OZ6A 1WLTA 4I09A 1DYKA 4GJZA 3FLTA 5FLIA 2Y26A 4RR3C 5FZGA 2RR12 3ACHA 1D0GA 1WUVA 2GC1A 5GZCA 3RG0A 4IW3A 4Y3OA 1TMF1 4MZUA 2A75A 5FY7A 1MVQA 4LPLA 4FPLA 2Q1FA 2UY9A 4S2HA 4AVAA 3M8LA 1SG3A 3NL1A 5FYBA 3V65A 5DDJ1 3WNXA 5GJ6A 2I74A 2EAAA 1OD3A 5T50A 4PLOA 1MS1A 1RJ7A 3AFKA 2RG4A 3BOPA 3I2JA 1D7PM 2HWD3 1E5SA 4LQRA 4YG0A 1NA1C 1PM4A 4EN8B 2Y0IA 3ZOIA 1S0BA 1UAIA 3TEWA 2B5HA 4XW3A 1OF4A 2H0VA 5FKBA 3V56A 2VXRA 1GP6A 1O3RA 1NXMA 3K3OA 3JD72 4FTEA 1IPKA 3EQEA 5JMCA 4D8MA 2RS33 4QU1A 4AOCA 4ORFA 4DUVA 1A3KA 3VB9A 1GNZA 4XUQA 5A3NA 2ZX0A 4DZGA 5LY2A 2J42A 1QXPA 1VALA 2YY1A 3N9QA 1JZ6A 3VHNA 5KR7A 4YGCA 1OC1A 5FPUA 3WW1A 2IC1A 1UZVA 1C5HA 4GKXA 4C90A 1FAYA 1NAEA 1VRBA 2WZR3 4IEXA 2RVAA 2D6MA 3G7DA 1PO13 1BLZA 3OUHA 4QPIC 1NXD1 2D6PA 5FYHA 4LLFA 3RGBA 1C4RA 3DEMA 4CDUC 5FYUA 2W0XA 2WUHA 3ZXEA 4RHV1 2CSGA 1YHFA 4LHSA 4Y1UA 4UBHA 3NJZA 1MR5A 2BERA 4JGYB 4QB1A 2Y64A 1ZBE1 4NOTA 2JWPA 3OD4A 1US3A 2YGMA 1Y9MA 3J4UH 3LE0A 4MGSA 4PIZA 3HR9A 1ZVFA 2JG8C 4A42A 3PUAA 1N1SA 1LECA 1X9TA 2ZGRA 4NR1A 3WCSA 3A7QA 3OTFA 5LEJA 1RUD1 4LBQD 3NAPA 5EV7A 2ZEZA 1AXYA 2ZX4A 4B3NA 2VOKA 4DOUA 4W50A 1Q8QA 4QKFA 3LIGA 3SC7X 1PVC3 1GICA 1TVGA 2RS52 3KV5A 1X8EA 1ZBA2 3GBWA 2BPA2 1D4VB 1QJY1 4E9KA 4NIDA 5C3OA 1REEA 3DF0A 2ES3A 2LRPA 2DYCA 1HN0A 3WQ1A 4AI8A 4HETA 2A70A 4X6RB 3ZDSA 1LCLA 1F5JA 3AP4A 3W20A 1VBC2 2XLAA 4XFHA 1RJ8A 3ZX7A 4HK8A 4QXKA 2P4EA 5GLVA 4CEWB 1RUD3 3P5BA 1UZWA 4QHZA 1ND2B 1RHI3 5L7OC 1ENRA 2ORZA 4H7LA 1B09A 1YJKA 2BUKA 3H3LA 5FJKA 1IPJA 1OA2A 5CFCA 3DECA 2P3YA 4FPCA 4EWAA 4IEOA 3E1F1 3AKPA 3UJOA 2TBVA 1RUG3 4YGBA 3MFCA 1UPSA 1G9CA 1CAXB 5IVCA 2X5IC 1ZA7A 1GQGA 1MQTC 2HEYF 3CDZB 4I0WB 4B29A 1GQHA 2AGSA 2JD9A 4TTGA 3J26N 5FCCA 2LROA 5EFUA 1LAJA 1VBA1 2QQNA 2BDRA 1HKDA 5FR3A 5IVYA 2DWRA 2MEV3 4KG8A 1R092 3TN91 5E8AA 1UMIA 3PU3A 2HWE1 2CGPA 1BZWA 1AR93 2B9VA 2GNTA 4AVBA 1WCSA 2PN5A 3IKWA 2R0HA 3U75A 5FYTA 3QOPA 4Q26A 4N9IA 5KC5A 5JSRA 4M4RA 5FXXA 2CHHA 5FZ7A 1PIV3 2WSUA 3OSDA 3OEAA 4GB33 3T1MA 2JICA 4TZDA 2VQ0A 4AVCA 1OI6A 1DU3D 3ENRA 1NG0A 2QJVA 4N8MA 4NIGA 4NIIA 3J8F1 3AJYA 2XKPA 1A78A 1QWRA 3KZ4C 5CFCB 3K3NA 2OKXA 4UW5A 5FMBA 2B4KA 2WFF1 1HJGA 1DIWA 3CQOA 5LA9A 3PJYA 1M4WA 1O4TA 3AYEA 1XNTA 1V6OA 4RD7A 3U1XA 1NCRB 4QM9A 1JI6A 3N7KA 3V0BB 5CFDA 3RI9A 2QVSB 2WRAA 1SACA 3FHIB 2VH9A 4G9SB 2E31A 5E89A 4CPBA 5JPNB 2XBO3 2ZHNA 3VBFB 4QDRA 3ZXFA 4K21A 3PIJA 5D8AC 5CVRA 2J1VA 2QTWB 3P3PA 1OURA 3ASIA 1H4GA 3KS7A 5H9SA 1QQP3 2VVEA 2W39A 5A3WA 4G3YC 2VUCA 1S2EA 3VUOA 1NLRA 5ACA3 4HK9A 5CNAA 2WNVB 4Q8LA 2BEOA 1CZSA 4XCBA 2JB8A 5JZGC 3POWA 1GSLA 4FFIA 4MADA 1ZRIA 3WT3A 3CJIA 1UNBA 1IGOA 4XXAA 3TRSB 3EJKA 4IEVA 2HWE2 3UV9A 4UAPA 1ZBE3 1DZRA 1Z7S2 4XIOA 4Q4V3 5FQ0B 4LKDA 2XBO1 4XJ8A 2XMLA 3ZFEA 5C7GA 3WXPA 2J1TA 2VMDA 2IFWA 5FYYA 3RPQA 1GZCA 2LW8A 2RS11 4LKSA 4NHLA 5HCFA 4WM8A 4QPIA 5A32B 5FUNA 5BNNB 5KXCA 2WC2A 1RB8G 1YQ2A 2JJ6A 4MG2A 2QDRA 3NMBA 1VMHA 4KL1A 4Q4Y3 5FZ1A 4IL7A 1AR72 2JG8B 4FOQA 4QKDA 3E5XA 3AX4A 2F4PA 4CRQA 3OG2A 1YFWA 2G9FA 5JUVA 4BA6A 4LNVA 4X8PA 2XJPA 5GM0A 3USSA 5IT6A 3N7MA 3IM0A 3MIHA 2K9ZA 2VZ1A 3CJIB 3I7DA 4XFCA 3S6PA 1OT5A 3NNGA 3FWEA 3KMHA 3CU7A 1NA1A 2VCMA 1W05A 1HQNA 1X8MA 2NLRA 2XDVA 3H7YA 4RL7A 3WZ1A 1CIYA 4QPIB 1IKPA 4YM3A 3DKWA 4H3WA 1V6JA 5GLUA 4FOYA 5EYXA 3RI8A 1H1MA 1WKYA 1W04A 3MFAA 4FO9A 2XGXA 1AUYA 4I01A 1LOBA 4EV0A 5LRSA 3P3NA 2XWJB 4B8EA 2VVFA 2DVAA 1NOVA 2XBO2 2G4IA 3VBHA 5L7OB 1XNKA 2XLFA 2LS6A 4NJ4A 1LESA 3FJSA 4RR3A 2BP6A 3M1HA 4OHWA 1SLCA 4YW7A 5J7MA 2WDBA 3WV6A 5EXOA 4A3ZA 1S0CA 4JCKA 3TNQA 1BJQA 2P37A 3U07A 1OUXA 2BOIA 3VBSA 3TEYA 4PJYA 5D21A 2W1UA 4LTAA 5IVEA 3FN9A 3FFZA 4BLJA 3D3AA 4B7KA 1G9FA 3I59B 2A3XA 4Q0QA 3VHRA 5C3PA 1W9TA 1VPHA 1LOEA 1E5HA 2ZA9A 3AM2A 5JR7B 1XXNA 2W1QA 3I3QA 4AE2A 1W8HA 5JOYA 4WVVA 1FPN1 4XF9A 3C7FA 4XUPA 4YZ1A 1OLRA 3THPA 3VDDA 2IXLA 2E26A 1WW5A 2IXKA 2WABA 5DZFA 3ZO0B 3L2YA 1BEV2 2XG3A 3IMMA 3ZXAC 2D93A 2V73A 5L9RA 2CL2A 3FUQA 3KV4A 4J1XA 3O1RA 1ODMA 2JEMA 4BXSV 2Q8DA 5I0RA 4E4SA 1PIV1 3S7EA 1R093 5DAXA 1YC61 2W1SA 1UPIA 2CYFA 2KR2A 2AREA 1RMU1 3RNSA 2GC0A 5KWRA 5KXDA 1AR62 5FLJA 1XJAA 2ZCWA 5LCWL 1UY2A 4GALA 1SDWA 3MDPA 4HT1T 1F35A 3WEZA 2VGDA 2WFF3 3NNLA 4CEWA 2I2SA 2VCBA 5A33A 3AXDA 2VXJA 4X8NA 1GZTA 3TAYA 3H8OA 3ZSEA 1RUG2 5T5PA 2Y8KA 3AZZA 4QX1A 2QZ3A 1Q8VA 1QNYA 3C7HA 4PIYA 3RZKA 2A6VA 5FPVA 1R091 3TN92 3I59A 1PMHX 1OLQA 4TLGA 5AVAA 2W52A 2R071 2R041 2LM3A 4DY3A 5A3UA 1QQP1 3MHZA 5FP8A 4MHRA 1V6IA 1A8DA 2VZUA 1YIFA 1W9YA 2QE3A 4YVWC 4IDZA 2KD7A 2OIIA 3IAQA 4RHV3 5FY0A 5LRRA 3AYCA 4G4FA 4GAZA 4HKWA 3LPGA 1KJLA 2PYTA 4GZ9A 3ACLA 3LB9A 3ZR6A 2XHKA 4HL0A 5FXWA 2VW1A 4AK3A 3MPBA 4ARYA 1I1EA 5GLTA 4Q8KA 1RUOA 2AEZA 3VKMA 4DXZA 1ZBA3 2YU1A 2RS53 5DN2A 2RMU1 3WQ0A 2VBDA 1PVC2 4UW4A 3Q9OA 4CP1A 1K42A 4DUXA 3S57A 4Z2AA 4CDQB 4TLFA 4E4DX 5FPBA 1O8SA 1HRI2 2IUWA 1SCRA 1ENXA 4W4ZA 2B46X 4COVA 4IE4A 1OOPC 3ZYHA 1HQLA 3LOBA 2AR6A 2LALA 1DLLA 3W21A 3GDBA 1CWPA 1SBFA 2D6OX 3ZM8A 3TEZA 4BQ5A 3LA7A 3WNNA 3B7MA 4Y4RA 2E51A 5K0UB 4P00B 1RUC2 4YLZA 5FYSA 2PMWB 2H6BA 1PK6A 4GQ7A 3UETA 1CJDA 3BYWA 5GLWA 3BPSA 3POGA 4DXRA 3PVNA 3B9CA 2TUNA 2WN2A 3J8F3 3KB5A 3GHNA 3IPVB 4INDA 4CTEA 1JOPA 2HWF1 5DDJ3 4U2AA 2VM9A 5LWBA 2EICA 2DUPA 2EXKA 3KVAA 1QOOA 4IXLA 1PO23 4AQ2A 2XR4A 3GCXA 1WCUA 3UGHA 3DPRC 3LZZA 1UY1A 2AH2A 2DCYA 4QXBA 2J1SA 3KHBA 3LPFA 2E7TA 1DDLA 3QLQA 2C9KA 1SBEA 1VMJA 4URAA 1YQ5A 4P9JA 3VLBB 1KITA 1BEV1 3HWJA 2QDNA 3IDEA 5M0TA 1W2OA 4KQ7A 2WNVA 3JD73 5JZGB 3MLJA 5E6HA 2XJRA 3GXUA 4LA3A 3HOBA 2JENA 1AR81 2EAKA 1PNGA 4UFIA 5CKQA 3ZFEB 4Q4W2 4D7SA 2HJIA 1YYNA 1TMF2 4I3GA 1E5IA 3THCA 3VKNA 1V6MA 5J48A 4Y1ZA 1AR61 2Y60A 1U5IA 4Q4V1 1R082 4FVVA 1EYBA 1Z7S1 1YRZA 4LHLA 5FBZA 4CCMA 2UWAA 1QH7A 1RUE2 2XVKA 3PL0A 3AC0A 3WW4A 2BTVC 1NCRC 5C4WA 1W2UA 3RVHA 3I54A 1GOGA 4PI2A 3GF6A 3MUZ1 4UBGA 5ABJB 3UGFA 4C8DA 3UNPA 5A1FA 3M2MA 3L9JT 1AR83 1A34A 1UOBA 4Q27A 2VULA 4WZFA 3W58A 4WM7C 1XB9A 3M3EA 3RMYA 3U11A 3HN1A 5CKMA 3O0WA 4AEDC 3BIEA 4P9WA 3BOWA 5CADA 2VC9A 3I3BA 2FQPA 2RMU3 1OFSA 2E53A 1DGLA 2UYBA 4MSVA 3HQUA 4MV2A 4LO4B 5IUQA 3WVJA 4C91A 3OBRA 4XJZA 2VU9A 2GMEA 3CMGA 4K20A 4XFBA 5F3IA 4DUWA 1NCQA 2QUOA 4HG6B 4XOGA 5JLVA 4MGKE 2CTVA 1L7QA 1O59A 4BB3A 5KHGA 1R081 2JG9B 1MZEA 2P6CA 4DMIA 2VZRA 4R9CA 5FFOC 3IWZA 1VRH2 2P5BA 1ENSA 2P6HA 1TME1 3S0MA 4DS0A 1RMU2 3MO4A 5JPMB 1AR82 3O1UA 5FREA 2KA3A 4XDPA 3WOGA 5A6ZA 1PGW1 2ZEWA 3B94A 4Q4Y1 1O3SA 5H9PA 4QX2A 1EUUA 2VMFA 3VBSB 1GKBA 2Q30A 3WG2A 2Z5WA 1DGWX 3WINE 1VBD2 2X8KA 4LKFA 1C3HA 4A44A 3VKOA 2CDPA 2FMDA 3LEKA 2YPJA 1R083 5J3UA 4RQPB 1LTEA 2RJKA 1EAH1 4AI0A 4FPHA 3VD3A 2RS51 2WFPA 2ZXQA 2J7MA 2D3SA 3USUA 2J1UA 3FLPA 4PF1A 1GZ9A 5FZ0A 4ZZ5A 3MEPA 2ZGTA 5IVJA 2VQTA 5C5TA 1YQCA 4BK5A 4QX8A 4P02B 5B2GB 1UX6A 3LKJA 3C7EA 3ME2A 4K1ZA 4PQ9A 1J1LA 5FV3A 1CAUA 1QJEA 1AF9A 2Q8CA 1RUC1 3VN4A 1UW8A 1F31A 1CAXA 2VMHA 5IYYA 2VUDA 1XC6A 1LHWA 1WD3A 3PURA 1WZXA 3CBNA 1MZFA 1H2NA 1GOFA 2OW4A 3CEWA 4UFLA 5FRAA 4QPGC 1XPWA 1G9BA 1A6CA 3ZMOA 4JVAA 2H0BA 3N35A 5FZAA 1OH3A 3LSDA 4E8CA 2XUMA 5TSWA 2W94A 1FMD2 4Q4W1 5CEHA 2YGLA 4QHOA 4RN5A 4YW1A 4ASMB 3KV9A 3DKQA 4HVQA 2FZ1A 3J8F2 1CAWA 4UT5A 5F39A 4YW2A 3BTYA 1V9U3 3JCIA 3PUHA 4OHVA 3SLIA 1VRH1 4AFMA 2IFRA 3DN7A 4CCLA 4V2VA 1PZ8A 2RS31 3NJVA 3ZN6B 2XLGA 1BVP1 1VR3A 2V72A 3MIBA 3BGAA 5A3LA 4OCTA 4BISA 2GC2A 3H0OA 5DAQA 1SZBA 1STMA 4P9IA 3GZAA 2JDNA 4W6YA 2G9GA 1F15A 5FP7A 5FZKA 3WDUA 3JD71 1HRI3 3M3IA 4ATFA 5IHRA 1NT0A 5LEKA 1VAKA 2E9QA 3OUJA 4NHXA 5I0UA 5C33A 3MF9A 4GD4A 3VDDC 1AL0G 1WW7A 3HT2A 1VE0A 2RS12 4MGQA 2P1BA 4RQPA 2R6QA 4OFGA 1ZRFA 2PA7A 2G1MA 4QX5A 2X09A 5C3RA 2DUOA 2FD8A 1W9FA 5FPZA 3DYMA 2C1FA 1AXZA 2RM22 4ASKA 3MGUA 4HKOA 4AGGA 2RDQA 5CFDB 5FTTC 1ASJ2 4A4AA 4IEWA 4XJWA 1RUH1 4GWIA 5CKNA 3EHKA 1ZZ7A 4JGZC 3K46A 3EBRA 3SKVA 1X36A 4WVWA 1BYHA 4JTOA 1B35B 1VAMA 5LZ6A 1PZ9A 2ZJCA 4LBQB 3T3YA 1ULFA 1PGL2 5BNPA 4CU7A 4FPKA 1OPOA 3K4AA 4OQ9A 1SFYA 4DPNA 5JXHA 3TN93 5I91A 2NM1A 2R1BA 1ACCA 1TME2 4AEJA 1POV3 2JG9A 3QBQA 1XNCA 1YLLA 1VBE1 4B4QA 5FZ4A 2E7AA 4LBOA 3A0NA 1POQA 4MXWB 2GN3A 4AXOA 4K9SA 1CAVB 5L36A 2PHTA 2V4VA 5JVVA 4UOJA 2V09A 3ZYBA 3QH7A 1O4ZA 2VNVA 1B35A 3RQ0A 3O12A 5AC91 3GHMA 5CBLA 2HWF2 4PHZA 2NZ9A 1HB2A 5A7QA 1LB2A 4YW6A 3APBA 3KT1A 3O1PA 3AVRA 5HBAA 1ZZ6A 3BU7A 2BU9A 2VCAA 5LY1A 1L7RA 3CJIC 3EB7A 3B93A 1SPPA 1ZBA1 2WT0A 5A70A 1EPWA 3SMHA 1AR63 3K4ZA 4E27A 2RM21 4Q29A 2WWUA 1K12A 1T6BX 4OUSA 4P9GA 1P8JA 4YM2A 4AFCA 1U5ZA 4HSLA 3V64A 1V9U2 2A3WA 1R64A 3W9AA 3MIEA 5FO8B 5EYYA 1HB1A 1GP5A 1BEV3 1UOFA 4H14A 4COUA 2W1WA 2IVJA 4C0BA 2ARBA 3MLLA 5F7UA 1WWYA 3KHCA 3ZYGA 2FCUA 4O9EA 5FZOA 2PHWA 5IVBA 1COV1 4OQ8A 1FXZA 4NWWA 4N7UA 1NQDA 5EP9A 3AJZA 2JDUA 2VQAA 1I5PA 2ZZQA 2ET7A 4CEYB 1DYPA 5EZWA 1MS0A 1S0IA 1QY4A 2HBUA 3VD4A 3PTRB 5JSOA 3A22A 4YW5A 4E4HA 2ZACA 1JUHA 4KWLA 4LLOA 3RZJA 1W3VA 4BIOA 3VBRC 3MYXA 4OI1A 1SLTA 2W2IA 2GMPA 2W08A 4YWAA 4FAGA 2GP3A 3ACGA 1IQAA 4NHMA 5B4NA 4CDWA 1UF2C 5JWPA 3GYDA 3FBMA 2JDMA 3RZGA 4D3WA 2XJSA 4QXCA 5C3QA 3ACIA 3AK0A 3D6EA 3FFQA 1JYVA 2R32A 3AP7A 3ST7A 2XKOA 1LOAA 1RL3A 1H9WA 3NNFA 1MS5A 3NSTA 2JIGA 2YFUA 3AMPA 5KHHA 3N9NA 2JD4A 2WLPA 3I97A 1QMJA 3RZZA 4C1XA 4DNYA 4F8AA 3O7OA 2BNMA 2PELA 1YQ6A 2CY6A 1ZZBA 2VE1A 2XJTA 3AKQA 3SISA 3T09A 3MLKA 1ND3A 3V0AA 1RMU3 1OSGA 2YROA 1W0NA 3ZSLA 5I93A 4CP9A 5L19A 5F5CA 2WAAA 1VRH3 1IG3A 1JZ3A 4K8FA 1WMXA 1AX0A 2HWD1 1JHNA 1W90A 1W8WA 2YBSA 5FZOB 4CDWB 3D8CA 1ULGA 3GGLA 3WF3A 1EP0A 1U12A 1OVSA 4HPKB 4NMIA 5FZ9A 4RFT0 4I3PA 1L7LA 3SCFA 3F2ZA 3KV6A 1ULPA 5KXBA 3IDBB 2QQPA 3U37A 3ZR5A 3A21A 1IS6A 1LKNA 3C7OA 4MH0E 3BUCA 3OYWA 5FZHA 1RXFA 3TOJA 4Q4V2 3R4DB 1Z7S3 5JXJA 1ZBE2 2WR9A 1C57A 2YB7A 1BBT1 3KQ4B 1Y4WA 1QEXA 3ZXJA 1GBGA 1QJU1 4WM7B 3BU0A 3ILFA 3POEA 5FXZA 3NWKA 1XNBA 3PHMA 4KG0A 5FOJB 4NRPA 2EIDA 2RJ2A 1OVPA 4HSJA 3U14A 3WX5A 1ZREA 4FTBA 2VOXA 1UY0A 1FYUA 3Q8EA 3ZFFA 5A6YA 4XMIA 2BW8A 2X5IA 2OUHA 2WA4A 1W39A 1MZ5A 3HNMA 1S0DA 1NKGA 5H9QA 2HBTA 1S1AA 1SLIA 1JOBA 1W6MB 1HRV1 3B00A 3DL3A 3I2IA 4OVEA 4XF3A 4XCAA 1IS3A 4ZXEA 3ZN5A 4BIFA 5C70A 1XRUA 1KGYA 3UJQA 3EO6A 1QJY2 3SNMA 3KF3A 3K75B 1ZA4A 2WZ8A 1W8OA 1XSQA 3VV1A 1ND2C 4W6XA 4P9XA 5FZBA 4CDQC 1K45A 3INAA 4XYXA 5JSPA 3AKRA 2C5DA 1GNHA 3K4DA 2DU1A 3JUUA 4LOSA 3ZFFB 3B3QE 1J1TA 5T55A 2DCTA 4K1YA 5CFCC 3WDWA 3MICA 2WBKA 3HBZA 3PDQA 2Q0AA 5CZKA 4C1WA 4ZKTB 4ZONA 2JXAA 3VZOA 1V9U1 4N90A 1W2TA 3T2TA 2UU8A 3M7AA 2ZABA 1JMUB 3MW2A 3LA2A 1VBA2 1UOJA 1W6NA 3AYAA 4OI2A 4IE5A 5IJRA 4AGRA 3IDAA 5DZGA 4HN0A 2QQJA 2VG9A 3PMSA 1N3QA 3TB0A 2J1EA 3OJBA 3ZYIB 4BQ3A 5DDJ2 3K48A 5BYNA 3RWNA 1PO21 3VBUA 2QZ2A 4AW7A 1KRIA 5KC6A 4YZ3A 3E6BA 4XACA 3GNEA 3WCRA 1JZ8A 2WYFA 4Y24A 4CDWC 1RUC3 2Y6KA 4AEDB 4XETA 1SHWB 3O0XA 4NIAA 3WF2A 2FDHA 2WNUA 3I2DA 5KBFA 3IZOA 3O1OA 5HCBA 2PHUA 4AHXA 4AEMA 2E32A 5C4WC 3B01A 4LORA 4ARXA 2X05A 1QHDA 3AP5A 5HV0A 2DBIA 4YM1A 4AR2A 1AL22 2I07B 4MGYE 3T2QA 1RXGA 4LBNA 4AWDA 4NVPA 3PVBB 3IT8A 3NV1A 5F3GA 4ZS2A 2CGNA 1XBFA 3HPNA 4FOVA 1O5UA 2VNOA 2ETEA 3PUIA 4XDOA 4Y5Z0 3ZKUA 3MV11 4CXWA 2RDNA 3LFIA 4DINB 1WMFA 1KJRA 4QQLA 3CHXA 5KHIA 2A6ZA 4J1WA 5EJ1B 4CP2A 2BV4A 2MEV1 2QQIA 4CZSA 3ZSJA 1QU0A 2HWB1 3AL6A 1AVBA 5AFBA 1GR3A 2O8OA 5FPAA 2E6VA 2DV9A 4FSJA 3VBHC 3HQXA 2C9AA 4JKMA 3PUSA 2EXHA 1AX1A 2EIBA 3O14A 3GJAA 4M0NA 4XHXA 4FFFA 2DTWA 5CG9A 5H9RA 4XZPA 1FNYA 2HEWF 3JQXA 4KH9A 3IN9A 1PVC1 1UX7A 2VCCA 3VKFC 3ILNA 3N9LA 1H1AA 3H8XA 4FT8A 3RJRA 1ZZ9A 4ET7A 4PBOA 3N4MA
chains in the Genus database with same CATH topology
2D97A 1GLHA 4QM8A 4BMBA 1WD4A 1REFA 1LGBA 2K2SA 3ZXKA 1RUNA 2D5HA 2BWAA 4CDUA 4Y20B 4E2GA 4MXWA 1AL23 1R1ZA 1WBFA 3JB4C 4GWMA 3C2UA 1LGNA 4QQPA 4W6WA 2VW2A 1GV9A 4KGGA 2BBVA 1TNRA 1GZWA 1ULDA 2JE9A 3RMXA 1I9RA 2EXJA 3JQWA 1JTZX 4L2NA 2XJVA 5C9AC 5FO9B 1ENQA 1DQ1A 1KS4A 1Q8OA 2XL7A 1RTVA 4FBFA 5K7PA 2K0GA 4JGYA 1H4HA 2ZMKA 1BVVA 1H1IA 2ZGNA 1HV0A 4RA0A 2BNOA 2QFEA 1AYM2 2ZX1A 3GBGA 1C1FA 2OUJA 5F6KA 2WZR2 1JXNA 4CP0A 4Y1VA 4M01A 4Y26A 4LUMA 2SLIA 1DZTA 1QJX3 3ZXLA 3ZYJB 5DUWA 3FUOA 1F5FA 1V6LA 2ZGLA 3WR0A 2RS32 5SV5A 1LHOA 1HRI1 2OVUA 1HLCA 4JGZB 1Q8SA 2BNNA 4XF1A 4YGEA 5KXEA 1R1A2 1QJY3 2ILMA 4Z82A 4MVTA 4EJRA 2FMYA 5FDBA 3ZIXA 1OFNA 2ZOEB 2GNBA 4JDNA 2WWSA 4A7YA 4N9HA 2WT1A 1REDA 1WLWA 1N3PA 3O0VA 5ABJA 3H1MA 4XDQA 1QXJA 1N1VA 4UW6A 4RR3B 5CAZA 2RR13 2PQQA 2PAMA 2CWMA 4E2QA 4AFDA 1VBB1 2D3PA 1G6NA 4XBNA 5FOBB 1RGSA 1Q56A 3NV3A 1Y43B 1AR73 2NMOA 3CO2A 4Q4Y2 1SMVA 1G8WA 3VBOC 2WQZC 3SH4A 4X6QB 4XF4A 1X50A 4N53A 4AHZA 3EXUA 1H8TB 1WLDA 2GDFA 3FMGA 4AYUA 4RS5C 2PHDA 1N3OA 1MS8A 4TSVA 1YCIA 1WMDA 5GKAC 4E2SA 4XMAA 1YFYA 4FXKB 1JN2P 2A6WA 2CNAA 3BCWA 2X29A 5CA6A 5A3MA 1BK1A 2IZWA 5BNOB 1CAWB 4L99A 3MIFA 1ALYA 1PGSA 1S55A 1XYPA 3CL1A 3NAPC 4K6BA 5J37A 2NMNA 2JX9A 5ACA2 1H2MA 5JI7A 1WBLA 1PHMA 1QQP2 4IV3B 1IKQA 5C8WA 1ULCA 2Z79A 3KQRA 5BXXA 4CEYA 4LBJA 4GMP3 1H8TA 3ZFGC 1NCRA 3THTA 5JIUA 1KS5A 1MQTB 1QF3A 1U5XA 1ZM1A 3OY8B 3AKTA 3FZ3A 3D5OA 1RUI2 3ETQA 4EWDA 3WW2A 3B69A 4J6GA 1LEMA 3ZVXA 4BMEA 3HIFA 3BB6A 5IK7A 5C4WB 2P17A 4AEKA 5K0UA 1S0GA 2IXIA 5SV8A 4GB32 2EVXA 2ZGKA 4AF9A 3DPRA 3H1WA 2O8QA 4XBLA 1PIV2 4AVSA 1FX5A 2P3JA 3BIWE 4BYYA 4WM8C 3OPZA 3R4SA 3LA3A 3WUDA 1XU2A 3C3VA 3WDVA 5AC92 4XE9A 4IEZA 3ZSKA 3VBFA 1DQ6A 1Q43A 4M3CE 2OA2A 4FPYA 5HXVA 2WS93 4Y4YA 4QGMA 1HIXA 3AKSA 5D1IA 4AG4A 1QJX1 3VZLA 3KLSA 4S2DA 3KD4A 4QQ2A 1HX6A 1FPN3 1APNA 5JZGA 5AFEA 4RSUA 1H2LA 4R9DA 1RUI1 3AMQA 1AYN2 2BWCA 4LO7A 3VBOB 4URTA 4AVVA 3POSA 2H6CA 4LHKA 4OULA 2IXJA 5T54A 3AZWA 2ZGUA 4QT6A 4FAHA 3L2HA 2DFBA 3RS6A 1COV2 2DFCA 3NVCA 2WL1A 4QGNA 4D7YA 3ZSMA 3ZFEC 1KXGA 4EN9B 4N53C 3ZFGA 1TQ5A 3WP6A 5F9TA 3N7JA 3VBOA 4I2OA 1URXA 4KU8A 1KDMA 1X7NA 1UN1A 2GALA 2PAEA 4EWEA 4ITCA 2RM23 3OGGA 5J98B 1H9PA 4DY5A 2GH2A 4HVRA 2VOVA 4XTPA 5KHJA 1SEFA 3JU9A 1Y3TA 4YM0A 1O3TA 2D40A 2RS13 3BODA 2O1QA 2GNMA 2IXHA 4WV8A 1EV12 5I8YA 2HWC1 4IETA 3RYRA 2VNRA 1NA1B 5FMOL 1OD5A 2Q4SA 4GH4A 1SQ4A 1NE4A 4HPKA 4S2GA 3WP4A 1ND3C 1SLAA 3N36A 1FATA 1PK6B 1V6KA 1MEC3 3WD5A 2WJSA 4NHKA 4AGVA 1WMEA 3JBG3 4WZCA 4P9LA 2OPKA 1FV3A 4DRRA 2CGOA 2DCJA 3JB8A 4R4XA 1WGPA 3U10A 1MQTA 4BH9A 3LAGA 5JOXA 1D4M2 1FMD3 4QU2A 1PO12 1YWKA 1ZRRA 2XH6A 1OMIA 4BQ1A 1FV2A 1QDCA 1IS5A 2HEVF 3KGLA 5I8SA 1BBT3 4JC1A 4F3JA 2DURA 3M3CA 3MW4A 1EAH3 4P5HA 4CDXC 2F6BA 3AZXA 4IV3A 2C0ZA 4R4ZA 2ZHKA 2Q1MA 3KT4A 4LO8A 5GZDA 3A4UA 2P3IA 4Q1PA 4EN0A 5DG2A 1SCSA 1C5IA 4ZXKA 3B5LB 5FQ0A 1WA4A 4XJ9A 1O7FA 1VBD3 2NP0A 3SCHA 3CJXA 2CAVA 1DGRN 5BNPB 3DV8A 2JG8A 1CJPA 1G9DA 3CF6E 4YZ5A 1J3RA 1DBNA 2WT2A 4GA9A 4N53B 1DFQA 1QH6A 3AYDA 3WY6A 3VBUB 5BNQA 2ZTNA 4RGGA 4HZFA 3D82A 4IV1C 2UWCA 1NCQC 2WNEA 1TEIA 2BQPA 2VNGA 3WG3A 2UY8A 2B39A 4XPVA 1RVF2 4WVMA 5GZGA 4D94A 1OQDA 1ZX5A 4JGYC 2ET1A 3GBFA 2GMMA 3RRDA 1FOD1 1PGW2 1ULEA 4L92A 2GSYA 4JRAA 4M3CF 3ALQA 1DZQA 3O5SA 4Q4X3 1F2NA 3OY8A 5I0TA 1CD3G 3AMHA 1RVF3 3FBYA 1XQNA 4E4ZA 5F6LB 3ZXDA 2Q1ZB 1CONA 4R9BA 2GN7A 4EN7B 5HCAA 1O3QA 5GZFA 4MGZE 4QQOA 4LULA 4GULA 1JYCA 4MXVA 4DB5A 1PNFA 2BVBA 1D0HA 3VL9A 4WVZA 3WHUA 1LOFA 1RUE3 4FQ4A 1V70A 2A5ZA 2IWGB 5D8AA 2KM2A 5IK5A 1Q3EA 3VKLA 2YUEA 3H9AA 1BQPA 1POV1 2D5FA 1TMF3 1BKZA 1DGRA 4SBVA 3WG1A 1Z78A 4Q4W3 1QNWA 4XF0A 3ZYPA 1H30A 3SHRA 4ES8A 4JGZA 2YZ4A 3M3OA 1LU2A 1W0PA 4TYSA 1AHSA 2DUQA 1EAH2 3RYKA 3D4KA 3ATGA 1XYNA 1IOAA 1C8NA 2ZAAA 4OUMA 3LGRA 5FMOS 1BBT2 3WDTA 4YVSB 1OKQA 1YI7A 4FCAA 2VUJA 4IV3C 4R8HA 3MI8A 2OZJA 4GMP1 4AHYA 1PO22 1GZWB 4YZ2A 2RE9A 2ZZJA 3WQ7A 3NAPB 3R0RA 1D4M3 2BFUL 4AI1A 1VBD1 4YNIA 2KXLA 4PDWB 1DGWA 3TBDA 3JBG2 1JH5A 1VBB3 2N7GA 4YVSA 2VMGA 1MEC2 2JKBA 4QPGB 1HV1A 3WDYA 3ES1A 3U4XA 2GU9A 2OYZA 2B8MA 3SH5A 1CAUB 3ECQA 3FE5A 1W6OA 2GH8A 4NO4A 4B7EA 4XFGA 3SITA 4BWOA 2Z2SB 4JDMA 4OI4A 2ZS6B 3ZFFC 3U0ZA 1M06G 2Y0OA 3IPVA 4HLTA 1LEDA 5J36A 1EV13 2WSVA 5E1RA 5T3NA 1GYKA 4YSFA 2ZGSA 1RUE1 4PLMA 4Y22A 5JAXA 1MVEA 2W68A 3NO8A 1NQJA 2PAKA 4LT5A 2ERFA 3DGTA 1X82A 4HFSA 1TNFA 2HWC3 5CU1A 1YO8A 4L97A 1OA4A 4NN0A 4RHV2 4I0BA 5DUXA 5JOZA 1RITA 2B42B 1FI2A 3M4FA 1LHUA 4LO6B 3BPZA 3ZFGB 5F5QA 4YFWA 1J58A 1VP6A 1QJU2 2AENA 4YW3A 1R1A1 5EJ3A 1W6PA 2WNUB 2AUYA 4ATEA 2IXCA 2JECA 2WINB 1C8M2 1SFNA 1U5YA 1ONAA 1OQEA 3ES4A 1VBC1 1PGL1 1PZ7A 2R073 2R043 1X33A 4KGQA 3VBRB 2WFF2 2D6NA 1QOSA 4OZXA 2R30A 1D2SA 2O0OA 1KD7A 2HWB2 2GAUA 4K40A 4RS5B 1S2BA 5DZEA 3ZIWA 2UURA 4GWNA 1G7YA 4LBQA 1UZYA 2ZHMA 3RDIA 2JE7A 1GFF2 3H50A 4YRDA 3BTAA 4COYA 2ZMLA 3ZN4A 1AJKA 3IDCB 2WZPP 4W65A 2P2KA 4F83A 4XJAA 3AZVA 4XQDA 1AZDA 3OBTA 1PMIA 1W6MA 5C9AB 4LHNA 1O5LA 1HRV3 1IHMA 3NW4A 2SBAA 2Z42A 4D7TA 5I0SA 4N43C 4PDWA 2QNKA 2R16A 4ZU7A 4IEPA 3VBUC 5C6CA 1IZ3A 3QACA 4WM7A 4XFFA 2VPVA 4R52A 4AQSA 4OHYA 1AXKA 3VHPA 5BNPC 4KNCA 1EPZA 1SLLA 4L11A 4XFIA 1C8M1 2PLV2 2TEPA 2A71A 1CR7A 4CEYC 4COWA 5FO7B 4KWKA 4BZ4A 3E5UA 3N3HA 4BOWA 4AVTA 2LTNA 2NQYA 4AFBA 4FPJA 4PF5A 1VAVA 2ZGMA 2ZX2A 4PCRA 1KFXL 1FOD2 2Z69A 5A32A 1B35C 2Q8OA 2YDEA 3VL8A 1D4M1 3UKVA 1K5MC 4FQZA 2WS91 1C1LA 3URFA 1UKGA 4B4RA 2FBEA 3ZMNA 3K51A 4OHXA 1YFXA 3R4UA 1CVNA 1UL9A 4EROA 3UKNA 1KQRA 3WP3A 3SH3A 4CDUB 4YYOA 1VJ2A 3WP5A 2PHFA 1LGCA 5BV6A 1LHVA 4IV1A 2PLV1 3USUB 1HQWA 3UL2A 4XEZA 3AB0A 1Z0HA 4JTNA 2HWE3 3G6JB 3ROUA 1MACA 2EIGA 4FPEA 3KCCA 4Z8BA 4DRVA 2ZKLA 4HBNA 5FAXA 1OA3A 5LK7B 2ZGPA 2NYYA 4IEQA 4CDQA 2YMZA 4YFZA 5CIRA 2YYOA 4V1PA 1DQ0A 1LHNA 3SXWA 3KSCA 1AJOA 4I0AA 1LJ7A 5CFDC 4FOWA 3WHTA 4C0HA 4R9AA 1ASJ1 1VBE2 1OOPA 1YXWA 2PLV3 4PIXA 2EA7A 2D6LX 1CPMA 4BCUA 4RS5A 1R1A3 4FXGB 2XJQA 3A0KA 1HXS1 3OYWB 4YG6A 1HDKA 4P9YA 4S2FA 1YIPA 4ZU5A 2XWBB 1RC6A 2WA3A 1RHI1 1AL21 3NKTA 2PHRA 3LOIA 4WVMB 3UK9A 3VZNA 1XU1A 5K9YA 4Q0UA 2ZAHA 4Q0VA 3UKTA 4EN6B 1J3QA 2Q5TA 1QJX2 2ZHLA 5GLZA 1DQ2A 4M00A 4LEJA 3AZYA 1RUF1 4IERA 4QQHA 2XVLA 3E6CC 4Z07A 2WKKA 1AYM3 2ZX3A 4M3CA 5BNNC 1AR92 3GZTB 2YC0A 1MS3A 1LULA 2E7QA 4L9BA 5CB7A 4LA2A 3RJ2X 4SLIA 3H7JA 5DXDA 2A6YA 4D69A 3I8TA 2MEV2 2RJLA 1N1YA 4ISQA 3H3ZA 2LUWA 4FPGA 5DUUA 2DVFA 1LOGA 1XE8A 4HMZA 4JDOA 2FZ2A 1FMD1 2VVDA 1RINA 1ZYBA 4WM8B 1CPNA 2R042 2R072 4Q4X1 3AMMA 2PHXA 3AP6A 4Y1XA 1AYM1 1CIWA 5BUVA 5JCTA 4Q1RA 4LBLA 3NKGA 3VBHB 4AI3A 5L7OA 1XE7A 4GXLA 3ZN6A 4N43B 1E57A 1QJU3 1XNDA 4XILA 3IIAA 3VBFC 2A7AA 1L3JA 4YGDA 1RHI2 3D0JA 3HT1A 1RIRA 5IK8A 3R6SA 5DG1A 1RUD2 3VBRA 3VBSC 2P3KA 4ASLA 3LWCA 1VBC3 4MX3A 4MYEA 4H55A 4AI2A 2UWBA 2RR11 1VB2A 4ZU4A 1JYIA 4META 1UIKA 4FP3A 1UU4A 1J59A 5KHKA 1DG6A 2XL9A 1ZZCA 3ILRA 4F7ZA 1K5MA 4LE3A 2R061 1AR71 1AX2A 4WBBA 4PLNA 5JDBA 4KU7A 3OD0A 1LR5A 1LOFC 1UKRA 2D3RA 2R1DA 4QMAA 4Q2FA 1I5ZA 1FT9A 2ZKNA 3NV4A 2DCZA 1BXHA 1I3HA 1QKQA 1Q5OA 5EWSA 3H8UA 2ZPXA 2XB6C 4AQ6A 1VBB2 3WDXA 4MLOA 2BFUS 2DTYA 4N43A 4PDWC 3MZHA 1H8TC 1UU6A 4H7MA 4TWTA 3PVEA 4LR4A 3B9IA 4ES9A 2EF6A 4HANA 2GC3A 3QD6A 2B9UA 4AFAA 2P34A 3BALA 5J96B 1VBA3 1MZ6A 1DHKB 5K0UC 4GKYA 5GALA 2MNGA 5D8AB 4Z92B 1JW6A 5J09A 5JI9A 2ZMNA 2DVBA 2FHRA 4M3CB 1O91A 1AR91 3KT7A 1F9KA 3MW3A 2YV8A 1OQ1A 3AFGA 5A33B 3RSJA 3ELNA 4I02A 4FTSA 1D2QA 3I4IA 4NWVA 4Z1VA 4P14A 4GMP0 1JBCA 4YG3A 2CAUA 2HWD2 2EALA 3V0BA 2WQ4A 4K3UA 2XJUA 3DPRB 1VBE3 2A6XA 4UW3A 2BGCA 5HI0A 2WZR1 2YXSA 1PO11 1RUJ1 1LOCA 1Y9QA 5CG8A 1ZRDA 1RVF1 2WLQA 1N1TA 2EXIA 1QXRA 2BYVE 4BM8A 1H2KA 1LODA 3JZVA 1W6QB 1U0AA 1UCXA 5L73A 4A7KA 3MF6A 3DUIA 1VLNA 4Q4X2 1LRHA 3OF1A 1OOPB 5BNNA 4BLIA 3E5QA 1N47A 1RUG1 3X29B 4QHBA 4N7IA 4HVOA 2R49A 2B45X 2YHJA 1W6OB 4Y1YA 3VZJA 1EY2A 3LCPA 4YVWA 1WW6A 1WLCA 3HMYA 1OPMA 4COZA 1V6NA 2Y38A 4IV1B 4XJUA 4OLLA 1ND3B 2XPJA 1MEC1 4YZ4A 4K7JA 4Y20A 4GH4C 3AXEA 3TNPB 1QOTA 2PFWA 3S30A 1WW4A 3M70A 1K5MB 3T1LA 1FOD3 3CNAA 4CEWC 1GANA 1NE6A 3IBMA 5C8CA 4BHPA 1NY72 1VB4A 3QCWA 3N7LA 5DUVA 5GZEA 3VZKA 2ZBJA 1QDOA 2VUAA 3V0AB 2QCSB 4GB31 1A8MA 5K8SA 1RUJ2 2TNFA 3OCPA 4XTMA 2B7YA 4M0HA 1Q8PA 1RUF3 5JOWA 3FX3A 2DCKA 1YJLA 2VW0A 3KM5A 1MS9A 5BY5A 4FPOB 2R063 4GH4B 4JAAA 2PHLA 4CDXB 3FLRA 4NPRA 1QJZA 2X53S 2UYAA 1JOJA 4B4PA 2ENRA 1HRV2 2ATFA 1NLSA 2D98A 3RYPA 3VHOA 1HXS3 2CV6A 4HKLA 5BPXA 4OHZA 1CX4A 1NCQB 1S0EA 2MPFA 4KBBA 4XQ4A 1KDKA 4IQPA 1EV11 1BCXA 4QD2A 3VGIA 3H1YA 3E6DA 1RUH2 2A73B 1BMV1 1HW5A 4JRLA 1H0BA 1NZCA 3PJQA 1CESA 3M3QA 3GALA 3MPPG 1W6PB 3AMNA 4DFSA 4XBQA 2GZWA 2HWB3 4HN1A 1OHFA 5T5LA 2XVGA 4MGIE 1POV0 5LK5A 4L8QA 1DF0A 4XXPA 1YNAA 1CQ9A 2A3YA 2HWF3 3IMNA 2V5YA 5E88A 1UU5A 1VIWB 1C8M3 3PLQA 2HKXA 1CAVA 1XYOA 3WW3A 2WIIB 2WNUC 1TME3 2D6KA 2HYKA 1W6QA 5T5JA 4RGAA 1AYN1 4IEYA 3PVOA 4AEDA 1UZZA 2RHPA 2D7FA 3NV2A 1IS4A 1YUDA 3VDDB 2AZ5A 2WNVC 1SLBA 2ZGOA 1S0JA 2ARXA 3CLPA 4LO5B 4XQWA 4OI0A 1ASJ3 1TE1B 1DQ4A 2MHFA 2HWC2 4XFAA 4YARA 2ZGQA 1COV3 4U36A 3POYA 4O9GA 1H8VA 3PMEA 3GZUC 2VY0A 4LUKA 1PK6C 2AYHA 1AYN3 4KWJA 3VZMA 3AP9A 1YFUA 2PTMA 1FPN2 1LU1A 1PVXA 2I45A 3MIDA 4MUVA 4Z2WA 1Y7BA 3LSEA 3PNAA 4QPYA 4IESA 3PTYA 1UMZA 2JG9C 5T52A 3KCXA 5T5OA 2WS92 1QGLA 4Y22B 4FPFA 5JIAA 1ND2A 3H3UA 1JUIA 5AC93 1ZNPA 2DVDA 4UXAA 3FC0A 1F8VA 1RUH3 4CDXA 5I8TA 2DF7A 1C28A 5IK4A 2CWSA 1PM7A 3D0SA 1NYWA 1ZZ8A 3WUCA 1S0FA 3E97A 1HXS2 2VOWA 4FP2A 4QPGA 4LBKA 1UIJA 1J3PA 4XIKA 4DQAA 1WCKA 4RQPC 2NPIA 1SBDA 4GIQA 3HD8B 2NN8A 3TWIA 4QGLA 5C8CB 4AQTA 4ISRA 1RUI3 4CYDA 3KCYA 2R062 1LENA 3S7IA 2E63A 1W0OA 3W59A 5BNOA 1RUF2 1I6XA 2R0FA 4A7ZA 4IEUA 2BVVA 1RUJ3 3HAGA 3ZYRA 5C8CC 4BE3A 4PBPA 3J9SA 2QKDA 2D43A 3SCGA 1FNZA 4A2UA 2VECA 4JQRA 1BMV2 4YVWB 1G86A 2VMIA 4YW4A 2DU0A 3OGJA 5AVPA 3MIGA 5BNOC 4Q0PA 3TYJA 1W6NB 3ZXGA 3WG4A 2GNDA 3ZPYA 3B02A 1MS4A 1T6GC 1NY71 1O4YA 1UD1A 4AHWA 1CN1A 2DVGA 3KGZA 4LE4A 1G9AA 5FPXA 4XHBA 1V00A 3QH6A 5FLHA 5F1RA 1CGPA 5E16A 2D44A 4I30A 5ACA1 3WLUA 2X5IB 4Q0SA 1YI9A 2RMU2 3R05A 2JDZA 5ABJC 4A3XA 1KFUL 4LBMA 1S2KA 1WCDJ 4JV4A 4ONUA 3JBG1 1DQ5A 4YVSC 2OZ6A 1WLTA 4I09A 1DYKA 3FLTA 5FLIA 2Y26A 4RR3C 2RR12 1D0GA 1WUVA 2GC1A 5GZCA 3RG0A 1TMF1 4MZUA 2A75A 1MVQA 4FPLA 2UY9A 4S2HA 4AVAA 3M8LA 3NL1A 3V65A 5DDJ1 3WNXA 5GJ6A 2I74A 2EAAA 5T50A 4PLOA 1MS1A 1RJ7A 3AFKA 3BOPA 2HWD3 4YG0A 1NA1C 4EN8B 2Y0IA 1S0BA 1UAIA 2B5HA 4XW3A 2H0VA 3V56A 2VXRA 1O3RA 1NXMA