2BPA2

Atomic structure of single-stranded dna bacteriophage phix174 and its functional implications
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
175
structure length
175
Chain Sequence
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*AP*AP*AP*C)-3')
publication title Atomic structure of single-stranded DNA bacteriophage phi X174 and its functional implications.
pubmed doi rcsb
source organism Enterobacteria phage phix174
molecule tags Virus/dna
total genus 26
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1991-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bpa200
1AR93 4N53B 1RUI1 1PO23 1HX6A 1CJDA 1RUD3 5FOJB 5AC91 1W39A 4GB31 2HWB2 4QPIA 1NCRC 4NWVA 1V9U2 1RUH2 2HWB3 2ZAHA 1ND2A 1POV0 4CDUA 1RUE2 1V9U3 4GMP3 2WFF1 1RUH3 1VRH1 3VBUC 4JGZA 1POV3 1R1A2 3JD72 4WM7A 1RUE3 4CDXC 1NA1A 1RVF1 5BNOA 4IV1B 2XBO2 1TMF1 5D8AB 1X36A 2RR11 1R1A3 5BNNA 3JD73 1BMV2 1AR72 1VBC1 2R061 5C4WA 2XBO3 4YVWC 4CDQC 3S6PA 1AR73 4WM8A 4PDWC 1QQP1 2HWE1 3VDDC 2RMU2 1BBT3 4CDWA 1BEV3 5DDJ2 1B35C 1ZBA2 3VBSA 2GSYA 5GKAC 4N43A 4CEYB 2WWSA 1PIV2 1EAH1 1QJX1 5ABJC 1B35B 3ZFEC 2RMU3 5K0UA 1VBB2 3ZFGA 4SBVA 1ZBA3 5L7OB 4IV3A 1PIV3 3DPRC 3ZFEB 1AL22 4RHV2 3VBFC 1VBB3 4YVSA 2FZ2A 1AYN2 1RMU3 1RUG3 4AEDB 1MEC1 1AL23 1QJU2 1R082 1ZBE1 4RHV3 1AYN3 4RQPB 2RS11 1QJY1 1RUJ1 5C9AC 1C8M1 2RM22 5CFCA 1QJU3 1R092 1RUC2 3VBRC 5C8CB 1H8TA 3VBOA 1VB4A 2MEV1 2RM23 4CEWA 1R093 2HWD1 4N53A 1RUC3 1D4M2 4GH4C 5A32B 1FOD1 1Z7S1 1PGW2 1AYM1 4RS5B 4GH4B 5A33B 3J8F1 1D4M3 1VB2A 5BNPC 1HRI2 2WZR1 1A6CA 1FPN2 1OOPA 5FMOL 2WLPA 1EV11 1HRI3 1NCQB 4RR3A 5CFDC 1FPN3 2BUKA 2X5IC 1HRV2 1MQTC 2HWF1 1PVC1 2PLV2 2Y26A 4Q4W1 3CJIC 1NY71 1HRV3 4IV1A 4Q4Y2 1GFF2 2WS92 1K5MC 2PLV3 5D8AA 5ACA2 1NCRB 2RR12 1PO12 1RB8G 1SMVA 1VBC2 1VBE2 4Q4Y3 4QPGC 2WS93 1FMD2 5ACA3 3TN91 2RR13 1AR91 4RFT0 2FZ1A 1PO13 1PO21 4QPGB 1C8NA 2R072 1VBC3 2XPJA 1PGL2 1VBE3 1ND3C 3VBUB 5JZGC 1FMD3 1VBA1 2BFUS 4EJRA 4CEYA 4CDXB 1ND3B 2R073 1EAH2 5JZGB 2R042 1M06G 1IHMA 4Q4V2 5L7OA 2HWB1 1EAH3 1DDLA 2R043 1AR62 1ASJ2 2RS51 3JBG2 4Q4V3 4YVWB 4CDUC 1V9U1 1VAKA 3FBMA 4GMP1 4AEDA 3ZFFA 4CDQB 1QJZA 1RUH1 1AR82 4PDWB 1MEC2 1F2NA 3VDDB 1AR63 1ASJ3 1ZBE2 4JGZC 3JBG3 1RUE1 2HWC2 4RQPA 3NAPC 4LLFA 5DDJ3 1QJY2 1AR83 4WM7C 1RUJ2 1NA1C 1RHI2 5BNOC 1C8M2 1MEC3 5FMOS 5ABJB 1R1A1 3VBHC 4Q4X2 1ZBE3 3JD71 3NAPB 5C8CA 2HWC3 3M8LA 4WM7B 5BNNC 2XBO1 1TME2 3DPRB 1RHI3 2MEV2 1C8M3 3VBHB 5A32A 4Q4X3 3VBFB 1BMV1 1HXS2 1AR71 4RS5A 1TME3 4WM8C 1BBT1 2RS32 1BEV1 1RUF2 5A33A 1COV2 1HXS3 1R083 2BPA2 4NWWA 3VBSC 4N43C 5C9AB 2RMU1 2RS33 1RUF3 1ZBA1 1COV3 3VBRB 5K0UC 1PIV1 3ZFGC 1NCQA 1RUI2 1VBD1 4IV3C 1F8VA 1RMU1 3ZFGB 1RUG1 4YVSC 4IV3B 5AC92 4GB32 1RUI3 4RHV1 4YVSB 1AYN1 5BNPB 5AC93 4GB33 2ZTNA 1QJU1 1NCRA 5CFCC 4FTBA 4FTSA 1H8TC 2RM21 2WFF2 5CFDB 1VRH2 5J98B 1R091 1RUC1 3TN92 4CEWC 2X5IB 1AL0G 1PO22 4N53C 5LK7B 4FSJA 3VBUA 1MQTB 2ZZQA 4JGYC 1RVF2 2WFF3 1VRH3 1VBA2 3TN93 1D4M1 1TMF2 3CJIB 4CDXA 1ND3A 1PGW1 5JZGA 4JGYB 1K5MB 2R062 1RVF3 3HAGA 1VBA3 1TMF3 1OOPC 2BBVA 1HRI1 4Y4YA 1HQNA 4Z92B 1FPN1 5J96B 2R063 4RR3C 1OOPB 4YVWA 1QQP2 1RUD1 2HWE2 2RS52 4GMP0 4CDQA 4PDWA 4RR3B 3VDDA 1QJX2 1B35A 1QQP3 1HRV1 2HWE3 2RS53 4QPIC 2PLV1 3IDEA 4IV1C 5ABJA 1OHFA 3ZFEA 3NAPA 1QJX3 4QPIB 5D8AC 1ND2C 4Q4Y1 2WS91 3DPRA 1NG0A 3VBHA 5ACA1 3VBFA 1POV1 1ND2B 1PO11 4CDUB 1VBE1 4BCUA 2RS12 1FMD1 1BBT2 1BEV2 3ZXAC 4JGZB 1NOVA 2R071 1PGL1 4CEYC 5C9AA 2RS13 1QJY3 1AUYA 1NA1B 4Y5Z0 5BNOB 1RUJ3 2VQ0A 3VBRA 5C4WC 2HWD2 5L7OC 5BNNB 2R041 1VBD2 1FOD2 1Z7S2 1AYM2 5C4WB 4Q4V1 2MEV3 4GH4A 1RMU2 1RUG2 2HWD3 3J8F2 3JB8A 4CDWC 4AEDC 3ZFFC 1VBD3 1FOD3 1AR61 1ASJ1 1AYM3 1CD3G 1Z7S3 2WZR2 4WM8B 3JBG1 3JB4C 5BNPA 5DDJ1 4CDWB 1AR81 3ZFFB 3J8F3 4RQPC 3VBSB 4N43B 1EV12 2WZR3 2HWC1 1VBB1 2QQPA 2BFUL 5K0UB 5C8CC 2GH8A 1RHI1 5CFDA 1EV13 2HWF2 1PVC2 4Q4X1 2X5IA 1AL21 4Q4W2 1X33A 2TBVA 1MQTA 1TME1 1NY72 4RS5C 1E57A 2HWF3 1PVC3 3CJIA 1HXS1 1R081 4Q4W3 2IZWA 4JGYA 3LOBA 2DF7A 1K5MA 2RS31 1RUF1 1COV1 5CFCB 1OPOA 3VBOC 1AR92 4FTEA 4QPGA 1H8TB 1NCQC 3VBOB 1WCDJ 1RUD2 4CEWB
chains in the Genus database with same CATH superfamily
2ZBJA 4N53B 2XKOA 3V65A 4CU6A 1NX9A 1LULA 1PO23 2GNBA 1HX6A 3NV3A 3WCSA 3OYWB 3NWKA 1ALYA 2WC2A 3N7JA 2ZA9A 2K46A 2VMCA 5AC91 3KV9A 4LA3A 1OKQA 2D6MA 3WT3A 4M01A 4QPIA 3WDVA 1H0BA 4D3WA 3EYPA 4M4RA 5B2GB 1O3QA 2LUWA 3E5XA 2Q8CA 1Q8SA 2P6HA 4NWVA 5A1FA 4L9BA 3IB3A 2CGNA 4A42A 5JSPA 4NHXA 2NMNA 5FYBA 1H8VA 2FDGA 1POV0 1C57A 3SCGA 1FNYA 4YFZA 4NE9A 3WUDA 4Y1XA 5C3SA 1JODA 1RUE2 1WBLA 2Y38A 1DQ6A 4GMP3 4QB2A 1WUVA 5BPXA 3S30A 1RUH3 5IVCA 4BQXA 4LKSA 5LB6A 3ZPOA 1DFQA 1HB4A 3RJRA 3VL8A 2OS2A 1KS4A 2CDPA 3BU0A 3IMNA 3MW2A 1GKBA 3KHCA 1R1A2 4MLOA 2VOKA 2Z69A 3SQOA 4TYSA 3IIIA 4O9EA 3ZSMA 4NPMA 1OA3A 2XJRA 3GBWA 4P9GA 4QB1A 3DUIA 3VZOA 1XNCA 2DVBA 5BNNA 1RXFA 3MUZ1 1UY1A 1VBC1 1ZRRA 2BDRA 5LASA 3ZXEA 5LW9A 1GV9A 3H3UA 3ZR5A 1UU6A 5FZFA 3VD7A 2WYFA 5FRAA 2C9AA 2GU9A 4RD7A 3POWA 4YM2A 3M1HA 1K3IA 2VUCA 2VZVA 3EXUA 1AR73 4WM8A 4A7KA 3ITQA 1QQP1 2P4EA 3EBRA 3WLUA 2ZOEB 1AX1A 5IATA 4K6BA 1BEV3 1DGLA 2NYYA 2BW8A 4KWUA 4HVRA 1W3XA 2FCUA 2BQPA 4K8RB 4XIKA 3ZLIA 1L3JA 5JMCA 1JZ8A 1PMIA 2GP3A 3AXEA 4IE6A 4PF5A 2RMU3 2W1WA 4LK6A 2VQUA 2ZX2A 2O1QA 4SBVA 2BGCA 1WCSA 1LHWA 3H7JA 3MPPG 4XURA 1W28A 4LMFA 3TOJA 2OXBA 3MW4A 3CJXA 1MS9A 3ZFEB 1F9KA 2PHLA 2H6CA 1Y9MA 3QCWA 2PHTA 3RZHA 5DG1A 2WNVB 3H0OA 4YVSA 4ATFA 4D69A 1PZ9A 2KXLA 1RUG3 3B01A 4NMIA 4UXAA 1JOPA 4AEDB 1RL3A 5EHDA 1CVNA 3I3BA 4AVCA 2VO5A 2OIIA 4RQPB 4Z8BA 4ZS3A 4U2AA 1H2MA 4MGYE 2MPFA 5C9AC 1R1ZA 4UAPA 5FXXA 3MYXA 5A7QA 4MZUA 5CEHA 1TNRA 1RUC2 1WMEA 4NJ4A 3VBRC 3OD0A 5C8CB 4QU2A 4XTMA 1H8TA 3WW2A 3ACHA 1AF9A 2B9VA 2VMEA 3IN9A 4I01A 4BQ4A 2EIBA 5JDBA 2PAKA 4CEWA 1TEIA 3BB6A 3PHMA 1QXRA 4GKYA 4XEZA 3RZLA 3HIFA 2HWD1 1JXNA 1VAMA 1D4M2 2VUAA 5A32B 3THCA 3HT2A 3O5SA 2F4LA 1UPSA 3ZXDA 5FOBB 2B46X 2JG9C 3ENRA 3ZN4A 3LPGA 1DZRA 2GC0A 4K21A 3FUQA 3NNFA 2A6VA 3BCWA 4ZZ5A 1HRI2 2I45A 1QJFA 1RIRA 1SDWA 1F5FA 4JC1A 4TTGA 1FPN2 4G9SB 3BIWE 1S0DA 3H50A 4YZ5A 1BXHA 2WLPA 2E63A 4R9AA 1DZQA 2RJKA 4GXLA 4L8QA 2JICA 1Z0HA 2W68A 2W87A 2WA3A 1DLLA 4MG2A 5CFDC 1UYZA 1Y9QA 3NRUA 1SEFA 4OMCA 4BH9A 4DXZA 5JXJA 1ACCA 2ZX0A 2HH9A 2HBUA 4CP1A 1PVC1 3WZ1A 3NJVA 1N3QA 4AW7A 4Q4W1 4IEXA 2QNKA 4AVVA 1YQ5A 1HRV3 1TNFA 1YO8A 3AKQA 4IV1A 4QB6A 5DG2A 2WN3A 1K5MC 2EAKA 2PLV3 5D8AA 5ACA2 1QKQA 2DCJA 2RR12 1GOFA 5A3OA 2OPWA 1PO12 1YJKA 3OTFA 4P14A 4XZPA 4PJYA 1GQPA 1U5YA 2VNVA 4QKFA 2E53A 1VBE2 1ULPA 2P34A 5HCFA 4AXOA 2WS93 2I07B 1FMD2 1L7LA 3CKHA 2B45X 1ZZ8A 3ZXFA 1UU4A 4FI9A 1AR91 3H1WA 3WF1A 5FY1A 4XZUG 4Z07A 2Y6FA 3VBUB 3BODA 1V00A 4E27A 5JZGC 4PIZA 4BA6A 3ZYPA 1S0EA 1W6OB 2UY8A 3FMGA 4CEYA 2LTNA 2Y64A 1CX1A 1ND3B 2ARAA 5IVEA 2R073 2WAAA 4P9IA 1M06G 3CU7A 3LPFA 1O4ZA 2J1SA 4QDSA 2Q8OA 4AQ6A 4JTOA 3N9MA 1ZX5A 5L7OA 3SMHA 1QDOA 4M0HA 4JQTA 4KWKA 1EAH3 1YQ2A 4COVA 2EIEA 2GNTA 5JCTA 1EY2A 1W99A 4RN5A 4LHKA 3AFKA 4Q4V3 4XQDA 4Y22A 4LEJA 4YVWB 3FBMA 3OOXA 3KSCA 5JVVA 4HKWA 1WD3A 3I49A 3GALA 2Q4SA 1LHNA 1MEC2 1F2NA 1PX4A 1UZVA 5H9RA 5KHHA 4EZ4A 3OBAA 3ZMOA 1BJQA 2VL4A 2HWC2 3VZKA 1O5UA 2N7GA 3HNMA 1W6QB 2J1UA 1JH5A 1YI9A 1D7PM 4CSWA 1GZTA 3VKFC 2BNNA 4XUOA 1WBFA 4U36A 1VRBA 1ZBE3 3JD71 4AI9A 3SH5A 3VHPA 4LO5B 1UZWA 1QH7A 4DIQA 3HPNA 3FN9A 2XBO1 4OHXA 4Q2FA 4GWMA 2Z42A 2UYAA 5A1AA 2JG8B 1RHI3 1W8FA 3VBHB 4EZHA 3EO6A 3VBFB 1OH4A 1HXS2 5EFUA 4RS5A 3VKMA 3W9AA 3FWEA 1TME3 5DQ0A 3ZDSA 3PIGA 4GD4A 5H9QA 4Z2AA 1RUF2 4H7MA 5A33A 3LA7A 3C7GA 1JYVA 5C8WA 1LTEA 1AVBA 1LGCA 1SHWB 3D6EA 4NWWA 5GLZA 4UW6A 3URFA 3ZMNA 4N43C 3APBA 3IBMA 4K40A 2OZ6A 2RS33 4CCCA 2P3IA 2A3XA 2AR6A 1O6UA 2XL9A 5DABA 4ASMB 3VDBA 4FAHA 3I97A 3RSJA 4JKKA 5K0UC 1PIV1 1J59A 4OHYA 3ZFGC 2J22A 5IWFA 2OX0A 5FP7A 3S7IA 4IV3C 1RTVA 1PK6B 5LY1A 3VUOA 4YW3A 4MGTA 3POYA 3WNOA 3SXWA 4LO6B 4WVMA 3UGGA 3WQ7A 4B1LA 2WSUA 5DAXA 3V0AA 2ZHKA 2X05A 3BUCA 4EWDA 1JZ6A 2TNFA 3VHNA 4Q0VA 3Q8EA 1U5IA 3PJYA 4GB32 3ZXKA 3I3MA 3PMEA 3T0AA 4ISQA 4MYEA 4XBQA 5FFOC 4QT6A 3Q9OA 1SZBA 4YVSB 4DOUA 1XSRA 3IDAA 1PVXA 2VGDA 2W95A 2VJXA 1I3HA 3PU3A 4XYXA 3W5MA 3C8XA 3HQXA 4CYDA 1LGNA 3ZXJA 5AC93 4DINB 2D3SA 2CAUA 4WZFA 4EQVA 5F9TA 4UI9L 2UWAA 1W2TA 5FPXA 3MZHA 3RYKA 3ZN6A 3HNBM 4YRDA 5JOZA 3AZYA 2YPDA 1O3SA 2VZTA 2B42B 1VRH2 1G9DA 4YGDA 1R091 1XU2A 3I3QA 2G9FA 4DO0A 1PO22 3H8RA 5GM0A 4N53C 1G9BA 1LECA 1KEXA 3MFCA 2FMYA 4JQRA 1J58A 1X7NA 4JGYC 1UMHA 5T5JA 2XDVA 2GALA 3TN93 3CJIB 5F3GA 2XLAA 3OJBA 4XFIA 3M3QA 5JZGA 5EYXA 3F95A 3PJQA 1UOJA 1YWKA 2NPIA 3D8CA 5A3MA 2IC1A 5IVFA 2QZ2A 1RYYA 4IGQA 1W03A 4Y4YA 5F2WA 3RDIA 4NOTA 1JZ2A 1HQNA 4I3PA 1ULFA 4KBBA 2JDZA 5LBEA 4CP9A 5FDBA 4RR3C 5FLIA 3SISA 1I5PA 2RS52 3VD4A 4FQZA 4CDQA 3LFIA 4HK8A 5FLHA 4NPRA 4F83A 2PTMA 1NQJA 2QQIA 5F32A 4URTA 4PDWA 3KT4A 2Z4FA 2ZGRA 3U14A 5FCCA 4EN9B 1QQP3 2P3JA 3IZOA 3NNMA 4P00B 4E9KA 1N1TA 1MVQA 1N1VA 5I8YA 4IEVA 3BU7A 3B9IA 4AHYA 5G05L 3IDEA 3ZR6A 2JDAA 1OHFA 2JWPA 2D5FA 3AYEA 3B94A 5D2AA 5ABJA 1XYPA 3WP3A 4FAGA 1QH6A 2W1UA 1YFYA 1DQ4A 4N7IA 1WMXA 1ND2C 2VMIA 2WA4A 4LBQB 2TEPA 1YLLA 1D0HA 1H9PA 1V6LA 2QQKA 2ZMNA 4Q4Y1 3RG0A 2NQYA 2RG4A 4L99A 3JCIA 2EXKA 5T5PA 4CDUB 2ZEXA 5FZBA 2XJSA 3VZMA 3J9SA 4DY5A 3B3QE 3I59B 4N7UA 2RS12 2WZPP 5A3PA 5J37A 2BWAA 4IE4A 4LKDA 4CCEA 4COYA 1BEV2 3ZXAC 2DTWA 2VOWA 3NW4A 1U12A 5FKBA 1CQ9A 1PGL1 3H1YA 1WKYA 4IL7A 2DYCA 5A3LA 1KS5A 1LU2A 1T6BX 1C4RA 1NUKA 1NA1B 2VZRA 4H7LA 5F2SA 4TSVA 2QFEA 1V6NA 1ZA4A 5C4WC 3MF9A 4QPWA 1V70A 2J1TA 3R6SA 3PVEA 3RNSA 2R041 1YJLA 1Z7S2 2MNGA 4HKOA 2VZ3A 2PELA 4XFHA 3GCWA 1JN2P 3WW1A 3FZ3A 5DUWA 3V0BA 1S4CA 2D98A 5FYHA 1RUG2 2WQZC 2HWD3 3J8F2 2WJSA 4AEDC 4QQHA 3CBNA 2E7QA 2WZR2 1ASJ1 1NZIA 1UMIA 5GZCA 4LBKA 5T52A 5GLVA 1GP6A 5B4NA 5BNPA 5CAZA 2HKXA 4CDWB 3UGHA 1AR81 2R32A 4RQPC 4M3CF 2DCKA 2FDFA 5K4LA 2YU2A 2P3YA 5LRRA 2A73B 3ZSJA 3N9NA 1ENQA 3PUAA 3ILFA 1I5ZA 5LY2A 4QDQA 4UFIA 2GN3A 4HKLA 4QGLA 4Y1VA 5C8CC 4TWTA 4AI1A 5L19A 4JAAA 4W4ZA 1UYPA 4A7ZA 5FZ1A 3KV6A 2YY1A 4QQ2A 3WP5A 2VXJA 1CAVA 2X5IA 5DUVA 1S0FA 4AK3A 2QQOA 2ZHMA 2TBVA 2OA2A 1R64A 1OLME 2A3WA 2VVFA 4LIUA 2V09A 1PVC3 1Q8QA 3H3LA 2GC2A 3AMPA 2V4AA 2Q5TA 3DYPA 4XCAA 2VE1A 4CCLA 4QXBA 3VZJA 4Q4W3 2L9LA 4JGYA 3FFQA 2AGSA 4OQ8A 1OUXA 2JE8A 4FPKA 4HZFA 3WX5A 4LUKA 4GA9A 4XDQA 3T08A 4MXVA 5CFCB 3BOPA 1OPOA 3PL0A 3VBOC 1OXCA 3HWJA 1PZ8A 2QDRA 3QD6A 4XJWA 4I0AA 1YC61 3VKOA 2D93A 2X53S 5IVVA 1W2UA 4JRAA 3A21A 3KQRA 3LGRA 2XJQA 4R4ZA 4XQ4A 1WCDJ 1GP4A 2J1RA 3F2ZA 1UMZA 2QUOA 2BYVE 1AR93 1OPMA 2VH9A 3UK9A 2ZX1A 2H0BA 4ZPIA 3PVNA 2WL1A 5DAVA 1BYHA 3KB5A 1Z78A 4E2QA 5F5IA 5IAXA 5SV5A 1DYOA 1EPZA 3W5NA 4Q29A 4IQPA 3M70A 3FLRA 5I91A 4H55A 2EA7A 3WF3A 1IOAA 2KM2A 2HWB2 5FK8A 3OPZA 3WP6A 3RPQA 4UBHA 5I0TA 3I8TA 2O14A 1KITA 1IKPA 5T54A 1V9U2 4PQ9A 5HI0A 5F1RA 2W5FA 2QTWB 2ZEYA 1UL9A 3E6BA 1C1LA 1ND2A 3P6BA 1Q8PA 3WQ0A 4FPEA 1X82A 3K48A 1ODNA 3ZN6B 2ZMLA 1IS6A 5IUQA 3MO4A 2EXJA 1JUIA 2WFF1 3LDBA 3FFZA 1NAEA 3VBUC 4BWOA 2O0OA 1DQ2A 1LRHA 3BALA 4JGZA 1POV3 3GZAA 5JOYA 3D82A 3DV8A 3IMMA 4WM7A 1RVF1 1UXXX 2OT7A 2WAOA 1IKQA 2XHNA 3FBYA 3PU8A 5BNOA 5FMDA 2R49A 4K9SA 1NE6A 3NJXA 1XOYA 5JI7A 2B39A 3JD73 1BMV2 3O0XA 3WY6A 3BOWA 3BKZA 3KF3A 2R061 5FZ9A 1UKGA 5C4WA 3E6CC 2XBO3 2IXJA 2QE3A 4QQOA 4AFBA 2WBKA 1MS0A 5ANNA 3ILRA 4YVWC 2A75A 4LNVA 2ZGSA 3W20A 1JZ5A 2AUYA 2ZX3A 2C24A 1ZVFA 4HVQA 1ZRIA 2W08A 4IEUA 1OI6A 4AFCA 5IT6A 1JYXA 3KLSA 5EJZB 1SLAA 2D44A 5IVYA 3O1MA 2G4IA 4XFFA 4L92A 1B35C 1VMFA 1ZBA2 1UAIA 2GSYA 4XF4A 3VBSA 2QKDA 4AI2A 2WWSA 2PHFA 3WDYA 1CESA 1EAH1 4G4FA 1NT0A 3ZYIB 5FY0A 3P3PA 1Y43B 1JYNA 2YUEA 4YG6A 2QQLA 2CGPA 1DGWX 4YFWA 1SPPA 3WG1A 1UZYA 5FYTA 1NKGA 1PIV3 3POSA 2XVGA 3Q8BA 4J1XA 2YZ4A 4J25A 2JG8C 3RGBA 1FYUA 3POGA 4YLZA 5B4XA 4CUGA 2YBKA 1AL22 5F5AA 4RHV2 3VBFC 2BRTA 1VBB3 2LROA 2GH2A 3RWNA 5JI9A 1LHVA 1WLWA 1AYN2 3I7DA 1ZZBA 3WDWA 2W9XA 4L97A 4M3CB 5CKQA 4F8AA 1WD4A 2P3KA 2ZKNA 3LOIA 5FKCA 5L7OB 1WMFA 5L73A 3U37A 1DYPA 1PX3A 1QJU2 2GAUA 2YXSA 1ZBE1 2ZABA 4FPOB 3VN4A 3AK0A 3VGIA 4Y1YA 2ZGKA 5F5QA 1QY4A 2Y6LA 1JOBA 4UFLA 3ZM8A 1RUJ1 1CAXA 2RM22 3N9OA 2D3PA 1LOAA 4LE4A 3AC0A 4I09A 3T30A 4EYUA 5FQ0A 5FZCA 1VMJA 1W04A 1H2KA 2OQ7A 4URAA 2UWCA 1PK6C 3VBOA 1Q5OA 2MEV1 2PMWB 4OLLA 2LM3A 4YNIA 4C91A 1R093 1XXNA 3FHQA 4GH4C 5I0RA 1CAUA 1FNZA 4BK5A 1ZREA 3W58A 1AYM1 5L9RA 4AFAA 1OVPA 1IPSA 2IVIB 3ILNA 4XJ9A 1BVP1 2ETEA 2JKBA 3OSDA 3POIA 3WNKA 5LWBA 3V0BB 2JXAA 2AREA 2WNUA 2EF6A 3OPTA 4CP0A 5HXVA 5A6XA 1HIXA 4QWNA 5ANQA 4FT8A 1HB1A 1VLNA 2QQVA 5J09A 1X9PA 1A6CA 3AMNA 1GZWB 1DU3D 4MHRA 1X8MA 1OOPA 3AM2A 4E4HA 3AMQA 2JD4A 3AYAA 2ZGQA 5FMOL 4LO8A 1ODMA 1EV11 1UU5A 4B7KA 5F6LB 4QX1A 4FBFA 1UF2C 2VUDA 3HD8B 3ZPYA 4MX3A 4YARA 3A7QA 3B02A 1ZRDA 3TYJA 4GZ9A 1UZZA 3JZVA 2VQTA 4YZ3A 2Q8EA 3LEIA 2FDIA 2Z2SB 1Q8OA 1KDMA 5A7OA 1CONA 4KG8A 4LHSA 3H7YA 1SLLA 4YM0A 5EV7A 1CAVB 1LHUA 2Q8DA 2VCCA 3A0NA 4S2DA 3T4VA 3PUQA 3CJIC 4KWLA 2J1VA 1EUTA 2A6YA 5FZOA 3RS6A 5JXIA 3OBTA 4MOAA 1KXGA 2E51A 5E1RA 1YI7A 1GFF2 1OFSA 2ARXA 1GUIA 4LHLA 3E5UA 1NCRB 3NKTA 3TEWA 4CA9A 1QNYA 2QZ3A 5DZFA 3MDPA 2XGXA 1VBC2 1A3KA 4Q4Y3 1UZ0A 4QPGC 5IHRA 1Y3TA 2OYZA 3USSA 2BEOA 5JWPA 3TN91 2DCZA 1W0OA 2D6PA 2DTYA 5LK5A 2OUHA 1ZZ7A 4RSUA 1DP0A 1MZFA 3SLIA 2VVEA 4CU8A 1UY0A 1XNTA 1SCSA 2VW1A 3SCFA 4A44A 4AGVA 4HANA 4DZGA 1GYKA 5CG9A 4W65A 2ES3A 4XIOA 5FIXA 2VCBA 1W9TA 3PVBB 4XFCA 4CDXB 4HSLA 4AGGA 3LE0A 3IDBB 4UYBA 2BWCA 5LEKA 3FLTA 2NMOA 1ZRCA 1OT5A 4LBLA 1HN0A 2R16A 3T3YA 3ASIA 4YYOA 5IYYA 3T2TA 4FFGA 4S2HA 2R043 1DDLA 1XBFA 5FR3A 4IE5A 4AGRA 1RUNA 3KV4A 1AR62 4Y4RA 1UY3A 4UW3A 3VHOA 2CGOA 3JBG2 4LA2A 4MXWB 5SV8A 4CDUC 1GMMA 4KI5M 3ZFFA 4OVEA 3P5BA 5EPAA 5C3PA 3OUHA 3RWKX 2WNOA 1W05A 3PTYA 3VDDB 1FV3A 1ASJ3 2PAMA 1YQCA 4PQQA 4LBNA 4UW4A 5EIYB 1RUE1 3AMMA 3OY8B 3NAPC 4NRMA 4BQWA 3SHRA 4FTEA 1AR83 2Y0OA 3LSDA 1D4VB 2ZX4A 4KGQA 4BDVB 3U11A 1REDA 1NA1C 1CAWA 1A8MA 5FMOS 5FK7A 2BERA 1R1A1 4Q4X2 1W6PB 3K3NA 3HMYA 3BIEA 2ZEZA 3M8LA 1HKDA 4EN6B 5FY7A 4WM7B 2VY0A 1B09A 5DDJ2 1WA6X 5DXDA 1H4HA 3FC0A 3DPRB 1C8M3 1W9YA 3ZXGA 3HN1A 2QQUA 2ILMA 2XG3A 4Q0UA 4Y1ZA 2RHPA 4NHMA 2VG9A 2WQ8A 3USUB 3D0SA 4LR4A 1HV1A 2CYFA 4N9IA 1COV2 1JU4A 3KF5A 1FAYA 4OUMA 3Q8FA 1WLCA 2J42A 2VM9A 3E5QA 4QGNA 4AYUA 1GQGA 3ATGA 1YFWA 1WA4A 2DVDA 5DUXA 1GBGA 1T2XA 2O8QA 1GWLA 1BQPA 3FJSA 4NUBA 4Q8KA 1NCQA 2YBSA 1JI6A 1RUI2 4RGKA 1YQ6A 4HK9A 4COUA 1C5HA 5T50A 1F8VA 3D0JA 4INDA 2HEVF 1A78A 1CIYA 3P3NA 2VBBA 3HT1A 3ZN5A 5FO9B 2VAUA 2XWBB 1QMJA 1RJ7A 4LOTA 1T6GC 3PUIA 1JZ4A 1SDDB 2Q1FA 1LGBA 1W6NA 3AKTA 3AP6A 2WT0A 1OFNA 5FUIA 3EQEA 2JDYA 2AENA 1MZ5A 5A3WA 4LKEA 2ZTNA 4FVVA 5IK4A 2VVDA 3UGFA 3U07A 5CFCC 5KC6A 2ADEA 4I02A 3GBFA 4FTBA 1EP0A 4R4XA 5DAWA 2XMLA 3RZGA 3PURA 3KM5A 4IXLA 2WT2A 4TN7A 2EICA 1YNAA 2JIJA 2W0XA 1GLHA 4H14A 5DZEA 2RDQA 1RUC1 2WABA 5LZ6A 3ZX7A 3NKGA 4AQ2A 2CSGA 4K7JA 5LK7B 1IPJA 3AKRA 1MQTB 2ZZQA 1UW8A 5C70A 2VBDA 2WFF3 3AYDA 5A1LA 3ORJA 3WF2A 4E4ZA 3U1XA 2EXHA 2XKPA 1D4M1 1O91A 1TMF2 2ET7A 2YV8A 2D5HA 4FXKB 3T2OA 4N90A 4XC9A 1CAUB 3H8UA 3HBKA 1QGLA 1IQDC 3T1MA 2WZEA 1RVF3 3HAGA 1IPKA 1VBA3 2WR9A 1W2AX 4KMQA 5E16A 2D40A 4M0NA 2J1EA 1HRI1 1YIPA 4X6QB 1V6JA 5M0TA 2C9KA 5FJKA 3WG4A 4Z92B 3KCCA 1FPN1 5J96B 2R063 3AP4A 3S7EA 2WQ4A 3MHZA 5K7PA 4OCTA 1OOPB 2HWE2 4BIFA 3IWZA 4GULA 4GMP0 1S0CA 2X10A 3PLQA 4UWDA 5BYNA 3I2OA 2W92A 1ZRFA 1HQLA 2WUHA 2JECA 1QEXA 1QJX2 1CR7A 2R30A 4P08A 4KNCA 2DVAA 2UWBA 2QVSB 3BTXA 2QDNA 4Y33A 4Y20A 4C8DA 2HLEA 4D6RA 4UOJA 4XXAA 3AP7A 3NAPA 4QPIB 4UF0A 5EJ3A 5LRSA 3JUUA 4BK4A 1REFA 1S0JA 1SLIA 3WNXA 4XHXA 2H0VA 2FCVA 1PM7A 2XUEA 4JHTA 3BTYA 1KFXL 2QCSB 1US2A 2RDNA 3DYOA 3HN3A 5ACA1 2CV6A 1J1LA 4GIQA 3J7NA 2BGOA 1POV1 1MS8A 1PO11 4B4QA 1GOHA 2JEMA 2PQSA 3RZJA 4LQRA 4Z82A 4OI0A 2K2SA 1VBE1 5T55A 2PFWA 3VDAA 4XAAA 1CZSA 4UBGA 3W59A 1JZ3A 1FMD1 2GN7A 1FV2A 5FY8A 2XLFA 4YZ2A 4LORA 1YYNA 2PHUA 4LXLA 3J4UH 3E97A 4JTNA 5FP9A 1CZVA 3O1PA 1PM4A 3T4HB 3O7OA 2R0HA 1OF4A 2P2KA 2GMPA 3LAGA 5C9AA 4Y5Z0 5FP8A 2ZGOA 1RUJ3 2C6SA 3G7DA 3N7MA 3VBRA 3MIDA 4FOQA 1JYIA 4YGBA 4BHPA 2VXRA 1NXD1 2NZ9A 4ZU7A 5BNNB 1QOTA 1FOD2 2OPKA 2PHWA 3KZ4C 1TVGA 1Y7BA 3DEMA 3OEAA 3HVDA 5FYCA 2MEV3 1S0GA 4BOWA 2W94A 4EWEA 1X8EA 4QHBA 2VECA 3I2KA 1VBD3 2JG9A 3AZXA 5C33A 4V2WA 1AYM3 4WM8B 5F37A 5LA1A 4DEQA 3UJQA 3JB4C 2WT1A 3LA2A 3VZLA 1UO9A 5FZHA 1A8DA 1CZTA 4FCAA 3ZFFB 4IEQA 1HJFA 2JB8A 1H4GA 4N9HA 1OLRA 5FYSA 5FAXA 4ZZ8A 2HWC1 4RA0A 2BV4A 1VBB1 2CAVA 2BFUL 2VZQA 5BV6A 2BOIA 4UFMA 2ZHNA 1JZ7A 1TG7A 1XRUA 3R4SA 1US3A 5A3NA 5CFDA 1EV13 1WW7A 5DZGA 2HWF2 4E8DA 1M4WA 4OI4A 1MS4A 2O8OA 2VULA 5I8TA 3NSTA 5KBFA 5FBZA 1NLQA 1C28A 1NY72 2D97A 3LSEA 3GZEA 1E57A 4KQ7A 4GJYA 4W8JA 1AJKA 2PHXA 1WMDA 1HXS1 1ST8A 1R081 2DBIA 2SBAA 5FXVA 2IZWA 4XUPA 4B4RA 3WSOA 5J7MA 3LOBA 3NMBA 1K5MA 4QDRA 4QQLA 4XTPA 3KGZA 1RUF1 2XUMA 4AZZA 3UL2A 3S0MA 3RZMA 4RL7A 1QXJA 2YHJA 2AC1A 3A0KA 5GZEA 1GANA 4C0BA 5L9VA 2QQMA 2RE9A 1H8TB 2K0GA 4FFIA 4Q0QA 1CPMA 1DZTA 3GJAA 2BZDA 1ULCA 4QHZA 4CEWB 4HN1A 5FY9A 2FDJA 4AOCA 2FDKA 4KU7A 3ZYJB 3MEPA 2QQWA 1O3RA 3IPVA 1LHOA 1LENA 2PN5A 1CJDA 5FYZA 1RUD3 5LATA 3UETA 1QNWA 4MHUA 4P9YA 3CF6E 3OBRA 2XONA 1QOSA 1QIQA 5APAA 4XPVA 1W39A 2DUOA 4GB31 1DIWA 5CIRA 2CTVA 2YDEA 1XC6A 4QMAA 3RI8A 4GALA 2A6WA 4OFGA 4WVVA 1NCRC 1UPIA 4CUBA 1W6MA 2QJVA 5I0UA 1AZDA 4P9WA 1OVSA 5KHJA 3AYCA 3ZIXA 1RUH2 3EJKA 3ZYFA 1QXPA 4AVAA 2PYTA 1KGYA 4META 1ZM1A 4AHZA 1HQWA 5CZKA 1HW5A 4HBNA 4D7YA 2QBXA 3HQUA 1W2OA 4QX2A 1W8OA 4EV0A 1VRH1 5L9BA 5FZ0A 4LLOA 3S5AA 1ONAA 4XDPA 2VUJA 1QHDA 4DS0A 1LEDA 3TBDA 2WO1A 2P17A 4L0PA 1RUE3 2JDKA 4CDXC 3U0ZA 2D7FA 5CKNA 4IV1B 2IUWA 2OKXA 4PIXA 3OF1A 3RZZA 2RJ2A 5D8AB 2ZXQA 4XJUA 1X36A 5C3OA 3UNPA 2VNGA 1R1A3 2WINB 2CHHA 2WO3A 4AFMA 2JKXA 4FPLA 1AR72 3CQOA 4K8FA 3B00A 2AH2A 4NPLA 2CU5A 1GNZA 1LNSA 1REEA 1W8HA 5GLWA 1W8UA 3LCPA 3ZKYA 2VTFA 3DXUA 3D3AA 3OEBA 3NNGA 4IESA 3S6PA 2V5YA 4LBJA 2JE7A 5EQUA 3ES4A 3HEIA 3VDDC 4Q26A 2RMU2 2YYOA 2J7MA 5GKAC 4CEYB 2XH6A 4N43A 3O1UA 4HMZA 4O65A 2WNEA 4SLIA 2W47A 2E32A 1YFXA 3ZXLA 4AF9A 2V73A 3ZFEC 3GZTB 5K0UA 1E5RA 3OG2A 1RXGA 3IDCB 1MACA 2ZGLA 3ZFGA 1AX2A 2JDUA 2A1XA 2WNVC 4QX3A 2CDOA 1OURA 4IV3A 4Y5SA 2ZGTA 4AWDA 4BISA 5F3EA 4BQ1A 4S2GA 4BQ2A 3DPRC 4J6GA 5IK8A 4NIGA 4IEPA 4Y5TA 3KT1A 2FZ2A 2V5DA 1AXYA 4OYUA 4Y22B 3MICA 5LBCA 2I2SA 1UX6A 4QX5A 1JYCA 1TQ5A 2BU9A 5FYYA 5FZ6A 4AVSA 5KXDA 4ES9A 4QGMA 2VTXA 2RS11 1QJY1 4TZDA 4QX8A 3BPSA 3N3HA 1NZCA 4Q1PA 4NO4A 1C8M1 5CU1A 4XHBA 1LOFC 1GWKA 1ULDA 1JHNA 4EN0A 2AZ5A 1XNAA 3POEA 2BBAA 4D7SA 4AI8A 1GZCA 1FI2A 4XF1A 1JOJA 2EALA 2VU9A 4DXTA 2VPVA 5I8SA 3C7HA 4BMBA 4HT1T 5FPBA 3MW3A 4DNYA 5HCAA 3TB0A 3LB9A 4N53A 1RUC3 3LF7A 4H2AA 1LEMA 3K4ZA 1W9FA 4N8MA 4JVAA 3K4AA 2ATFA 4NVPA 2EXIA 4QHOA 1Z7S1 1PGW2 3OYWA 4RS5B 4B3NA 4CCJA 5IFTA 4ITCA 1WW5A 2XWJB 5F3CA 3ZYHA 3ON7A 4DY3A 1UKRA 1JTZX 4Q0SA 4OHVA 4ES8A 5A33B 3J8F1 1G9CA 1D4M3 1VB2A 2W46A 3OCPA 3DGTA 2IFRA 1F4AA 1LOEA 1O7FA 3GZUC 2WZR1 1W0PA 3ZSKA 1ZYBA 2BNOA 5FO8B 3THDA 5LA9A 1H1MA 3TRSB 3M2MA 1WLDA 4FPJA 4FOWA 1HRI3 1MVEA 4P5YA 4QU1A 4R9BA 2LALA 4RR3A 4LITA 2JB4A 3B7MA 3VB9A 4AAPA 4BM8A 1FPN3 3O14A 1JBCA 3ACIA 1KQRA 4WVMB 5KXCA 1HRV2 1UOGA 2Y34A 3V0AB 4NHYA 1GP5A 2P6CA 2GDFA 3H8XA 1MQTC 3ACLA 2PLV2 2WLQA 4K1ZA 4MH0E 3WQ1A 4LBOA 1IS3A 1ZZ9A 3OPWA 5JIAA 5JOXA 1FT9A 1UYXA 3FHIB 3I2GA 2GZWA 2KR2A 3R05A 4BXSV 3TEXA 4E2SA 4S2FA 4XUTA 5IFPA 3M4FA 1WLTA 3WF4A 2WS92 1UIKA 4PI2A 5F5CA 2VZ1A 1RGSA 3PMSA 1KJRA 2PQQA 3AL5A 2DU1A 4X6RB 3PNAA 1KD7A 3WHUA 1YXWA 2ZS6B 5JMOA 5GZDA 1WGPA 4HOOA 1QU0A 3WVJA 1OSGA 4MO3M 5I93A 1OKOA 1W9SA 2WN2A 3N9LA 1UIJA 3O0WA 5ACA3 4OMDA 4XILA 2ADDA 1HJGA 2RR13 3CLPA 4RFT0 5G04L 2FZ1A 3SCHA 3KV5A 5CBLA 1GSLA 2PHDA 1PO13 3MFAA 3N9PA 4XABA 2RJLA 1C8NA 4IE0A 3UKNA 4CCOA 2R072 1SLBA 2XPJA 1VBE3 2Q30A 1ND3C 4X8PA 4OI1A 2WWUA 4YG3A 4W6YA 4ZHNA 1FMD3 1VBA1 3OGRA 4BYYA 3K4DA 4CZSA 2EIGA 4UFJA 2RDSA 1VIWB 2E7TA 5FUNA 3TEZA 1EPWA 1YIFA 5JR7B 1EAH2 5JZGB 3GNEA 3HNYM 5FYIA 5F39A 4BJ0A 3IIAA 2P37A 1Q56A 5TSWA 2DVFA 2NP0A 4BPZA 2P1BA 4Q4V2 5A7SA 3VD9A 2XJPA 5FP3A 4NROA 4P5HA 3TNPB 2HWB1 2E9QA 5FLJA 2ZGPA 3KQ4B 4DUWA 4D94A 1EUUA 2WNVA 4CP9B 2FD8A 3CMGA 3S57A 1V9U1 4P9JA 4AEDA 4CDQB 2VMDA 2DFCA 4EN8B 1G6NA 3BGAA 4PDWB 1FX5A 1MZEA 4NAOA 1ZBE2 2WYSA 3RQ0A 4FPGA 4YG0A 3POFA 2A6ZA 4RQPA 1G8WA 3WDTA 3WEZA 5KWRA 4JDNA 4LLFA 2MHFA 3ES1A 2CWMA 2I74A 1C1FA 1RUJ2 4OHWA 1ZZCA 1RHI2 1MEC3 4PLOA 5ABJB 5LA2A 5FZEA 3JQWA 1GWMA 3VBHC 1BK0A 5C8CA 2HWC3 4MSVA 3VHRA 4LBMA 3UV9A 4IE7A 4NIHA 5BNNC 3VKLA 1TME2 2UY9A 1IG3A 3QH7A 5DUUA 3WNLA 5KHKA 2Z5WA 2MEV2 4L2NA 3KCXA 1DCSA 3I3DA 5A32A 5A6QA 3WG3A 3HR9A 1BMV1 4I0BA 3S5QA 5C7GA 1HV0A 4OQ9A 1W8TA 1W8NA 2FHRA 5AVAA 1QF3A 4WM8C 1BBT1 2RS32 4IDZA 2E6VA 2VOXA 4QKNA 2DV9A 1G86A 2OQ6A 1HXS3 1SQ4A 1R083 1H2NA 2A70A 3MLJA 3EB7A 3ETQA 3ZOIA 2XQRA 2VZPA 1LB2A 4DXRA 2Y6JA 1W90A 1RUF3 1ZBA1 1K45A 1SACA 2R1DA 2YPJA 3LEMA 4D0QA 4BB3A 2RDRA 2H6BA 2VW2A 1UXZA 1JUHA 2EVXA 2ZJCA 5DAQA 1VBD1 3HBZA 4AFDA 4CCNA 4MGSA 1AHSA 3K46A 4CUAA 4FPYA 4H3WA 3TWIA 1XYOA 1RMU1 1V6OA 3H42B 4R8HA 3JU9A 3ZFGB 4YVSC 4D6QA 1E5SA 4IV3B 2XQXA 3GHMA 4WVZA 5AC92 2G1MA 4GWJA 2G19A 3KS7A 3NJZA 1YUDA 2VOVA 3GXUA 3UKVA 4RHV1 4AI0A 1ENXA 4AI3A 1DYKA 1I6XA 4DXSA 1AYN1 5K8SA 4YW4A 4HG6B 5BNPB 3MIBA 1S2BA 5FZAA 4QKDA 1CX4A 1PHMA 3JXSA 3K75B 3OB8A 4GB33 2XB6C 3FL7A 4NN0A 1YHFA 1QJU1 3NQHA 5JAXA 4AVTA 5JSOA 3KWVA 5FMBA 5FYVA 4FPCA 3UJOA 4PIYA 2SLIA 5LBFA 5A3UA 4LUMA 5FXWA 2WO7A 1BHGA 4EROA 4Z2WA 4FTSA 2Y33A 3R0RA 1H8TC 2RM21 2D6KA 5CVRA 2VR4A 5J98B 2OUJA 4MADA 2VQAA 3TN92 4CEWC 2X5IB 2WRAA 3LWCA 4NRQA 4B7EA 4A4AA 1AL0G 1OQ1A 4IGPA 1VMHA 4MVTA 4OUEA 4RFRB 3VBUA 4A6SA 4FSJA 5T5OA 1OD3A 2R6QA 3U78A 1GU3A 4QKBA 1W6OA 3M3CA 5JSRA 1VRH3 2VZUA 4I2OA 4Y26A 4ZXKA 3E6DA 2EIDA 3MV01 1Q3EA 5CNAA 4NHLA 5ISLA 3NNJA 1ND3A 4LO4B 3U10A 1UD1A 2A6XA 4JGYB 4FP3A 2R0FA 3MIHA 1O4YA 4XUNA 4CVUA 1UX7A 1W9WA 3MIEA 3NNLA 1W2NA 3L9JT 3AP9A 4PI0A 3ZYGA 2ZGMA 4O9GA 5A70A 2ZHLA 5I0SA 1S2KA 1CIWA 5IVJA 4YVWA 1QQP2 1GOGA 1RUD1 3FE5A 4BLIA 2UURA 1U5ZA 2WZ8A 1HN1A 4XF3A 3TEYA 3WUCA 4XJ8A 4NAMA 3B9CA 3OGGA 4RR3B 5HV0A 4CP2A 1B35A 2RS53 4GWNA 3ZIWA 5CB7A 2GC3A 3I2FA 1O5LA 1W6QA 5FV3A 5C3QA 4CPBD 2X29A 1RUOA 4XBNA 4PLNA 4IV1C 4OZOA 4Z1VA 2GNDA 5A3TA 5D8AC 1DGWA 4NIDA 3Q8CA 4C1WA 4AL9A 3FLPA 4BE3A 2JG8A 1WWYA 3DN7A 1NG0A 4PLMA 4TXWA 3VBHA 3U4SA 4ORFA 1I9RA 2Y6HA 3W21A 3NL1A 3VBFA 4JV4A 1ND2B 2GMEA 3NVCA 4D7TA 2YBPA 4YSFA 1N1YA 1NQDA 2B7YA 3E1F1 2FQPA 3JQXA 4AG4A 2YC2A 4KBZA 3OGVA 4LBQD 3WW4A 3DF0A 3G6JB 3R4UA 2EAAA 4BXFA 4LE3A 2ZACA 3AX4A 4JGZB 1NOVA 1ZZ6A 2YGMA 4JX0A 4CEYC 3O1OA 3MGUA 1FXZA 2RS13 4X8NA 1QJY3 4XVHA 5EP9A 2ZKLA 4AHWA 5BNOB 1ZA7A 4ZKTB 1H2LA 2VW0A 1ENRA 4LOSA 2VD7A 4XFBA 4C90A 4KGGA 2Q1ZB 3AZVA 3NV4A 4PBPA 4AVBA 5JPNB 4MGKE 4RYDA 5FPUA 2HWD2 5L7OC 3BI3A 1NXMA 5FWEA 4B29A 4Y1UA 1PK6A 3KHBA 1F15A 2ZAAA 5FP4A 2YFUA 5C4WB 4V1PA 4GH4A 5J1XA 1JU3A 1GR3A 3PVOA 5C5TA 5JR2A 4CDWC 4HL0A 3OUIA 5A7NA 4JDOA 4NHKA 1SFPA 3WW3A 1AR61 1Z7S3 3ZYRA 2D6NA 2D43A 3JBG1 1XSQA 5A6ZA 5K9YA 1APNA 5DDJ1 3WV6A 2DU0A 4QXKA 5FZLA 2DUQA 3J8F3 5A7PA 4MGIE 3T0BA 3VBSB 1TZOA 1VR3A 2YU1A 4WV8A 1HB2A 1UYYA 2WZR3 2HBTA 4QD2A 4IEWA 3ST7A 1LOGA 3X29B 1QDCA 4NIAA 2QQPA 2XOMA 4G3YC 2ZEWA 1SPPB 4Q27A 2GH8A 2VCAA 4OZXA 4UFHA 3J7HA 1AJOA 4DEVA 3RYRA 2GNMA 1PVC2 2G9ZA 4Q4X1 2JDPA 1K42A 2ZGUA 4XJAA 2JJ6A 3LA3A 2JX9A 4DRRA 4XQWA 4Q4W2 1F4HA 2IFWA 4XF0A 2ZCWA 3LZZA 2UYBA 4RS5C 3THTA 1OF3A 1XE0A 1KFUL 2Y8KA 3CJIA 3FHAA 2IXLA 3SKVA 5KHGA 3VDCA 4YM3A 1Y9GA 3AVSA 4ZU4A 4WBBA 1AXZA 2VMHA 3WCRA 1YFUA 4MGZE 3RRDA 3WOGA 1DQ1A 1ULEA 2DURA 5FREA 4OI2A 2IXCA 2YB7A 2YC4A 5AVPA 1VPHA 3OGSA 1CAXB 1COV1 3VD3A 3O1RA 2P5BA 4FFHA 1XE7A 4QM8A 1AR92 1J3PA 2WDBA 4QXCA 4QPGA 2W91A 2PAEA 5EWSA 4B4PA 1G9FA 3N7KA 2IXIA 3WQBA 5FQ0B 2DUPA 1VALA 5FZDA 5FZMA 1KJLA 1LJ7A 2JIGA 4HXCA 3VBOB 4BMEA 2GC1A 2HJIA 4CPBA 5AFBA 1OQDA 4V2VA 2B8MA 1RUI1 3ACFA 1GICA 5JXGA 5GALA 3WNPA 3VD5A 5JIUA 5H9PA 3ZSEA 1V6KA 4LTAA 4BQYA 3M3IA 3K51A 1ENSA 3C2UA 3MUY1 1G7YA 2GP5A 4BLJA 5FOJB 2WNUB 5FPLA 5IAVA 3MPBA 2XLGA 5E89A 1SFYA 4CE8A 4PT6A 4YW7A 1S0BA 2B9UA 1N3PA 4M4PA 2E7AA 4RGAA 2HYXA 3GJBA 1KDKA 3C7EA 3B93A 4LBQA 4OUSA 3VL9A 3WNMA 4NRPA 3PDQA 1D0GA 4FOVA 4W50A 2HWB3 5FZ3A 4E4SA 2ZAHA 1UY2A 4XJZA 4XOGA 5LEJA 4CDUA 3ABZA 4IEZA 3SITA 3MLKA 5J36A 5E8AA 5F8PA 3HOBA 2PHRA 3V56A 3I59A 5JPMB 1HB3A 1V9U3 4WVWA 5JOWA 3IT8A 1UWWA 4KH9A 2VZSA 4MGQA 4QQPA 1HLCA 2BJSA 3EMRA 4FFFA 4XAEA 4YGEA 1MS3A 3SH3A 3JD72 3ETPA 4ATEA 1WCKA 4DPNA 5FZOB 1NA1A 3FX3A 2XBO2 4C1XA 4M3CE 4Q8LA 3SKJE 1UCXA 1TMF1 1N47A 1MZ6A 1UNBA 2CNAA 3RJ2X 3NV2A 1PNFA 2RR11 2F17A 4AEMA 4XBLA 4MUVA 1JYTA 4IGOA 3PUSA 4LT5A 4CU7A 5GJ6A 3WXPA 1N1SA 3H1MA 4CDQC 5FMCA 1WW6A 3CHXA 4CUCA 5J48A 5L36A 2DCYA 1JS9A 2A3YA 4PDWC 2XJUA 2ERFA 2HWE1 2AEZA 1H30A 5F7UA 2HEWF 1E5HA 3U4XA 4CDWA 1BBT3 1L7QA 1H6XA 1JMUB 2NLRA 4QPYA 4FPHA 3I4IA 1PIV2 4A3XA 2A71A 5FZGA 1QJX1 1SBEA 4R9CA 3KD4A 4CXWA 5KC5A 5ABJC 1B35B 4HFSA 1VBB2 2DDUA 4B8EA 1ZBA3 3BPZA 1OD5A 3LIGA 3LDRA 5BY5A 3TNQA 1W8ZA 4IEYA 4ARYA 4HETA 3GF6A 2K9ZA 2ARCA 1O3TA 3POBA 4HSJA 1RMU3 4I3GA 4HN0A 1LAJA 2J1AA 1A34A 1S2EA 5A7WA 5T3NA 1MEC1 3H8OA 3POJA 4A2UA 1AL23 1IZ3A 1R082 4LK7A 4RHV3 1OA4A 3ECQA 3LD8A 3GBGA 4F7ZA 1DLCA 4QX7A 1AYN3 2W52A 2QQNA 1K12A 1D2SA 4QM9A 1O4TA 4Q5OA 1IG0A 5I0DA 1OMIA 2FCTA 5CFCA 3OGJA 1CAWB 2GMMA 1QJU3 1XJAA 1OBNA 1RC6A 1R092 1STMA 1CN1A 2VMFA 3QOPA 4CXXA 3WD5A 3KVAA 1BKZA 4YPJA 5FZIA 3PUHA 2ET1A 4JCKA 2WSVA 4KL1A 1VB4A 2RM23 4P9LA 1OC1A 4QAWA 4CCMA 2YMZA 2JDNA 5CA6A 3AB0A 3CDZB 1FOD1 3QLQA 4AEKA 3I2HA 2KA3A 2TUNA 3BYWA 3OD4A 2XXZA 4O7XA 4AEJA 2R7EB 5FO7B 4GH4B 4ARXA 1OLQA 2V4VA 4PF1A 3AXDA 4F3JA 4DQAA 4IERA 5BNPC 1H9WA 4KG0A 2Y60A 4YWAA 4KWJA 1RJ8A 1H1IA 3R4DB 4CTEA 3T09A 3KVBA 3UESA 2B5HA 1XPWA 4A6OA 3DKQA 2YROA 3I2JA 4A3ZA 2C26A 5FPAA 2Q0AA 3DYMA 2D6LX 2VCMA 4QX0A 1CPNA 4JKMA 5A6YA 1C5IA 1IGOA 2FBEA 1NCQB 3CEWA 3O12A 5LA0A 1CGPA 1SLTA 1O8PA 3WINE 2BUKA 1Q43A 2X5IC 4IUGA 2BNMA 3KCYA 2YG0A 2HWF1 2Y6KA 2W3JA 3RZKA 1GZ9A 2OVUA 2X09A 4GWIA 1NLRA 2Y26A 2BVBA 5IW0A 1NY71 1W6NB 4RGGA 3VLBB 2CWSA 3AMHA 2Z79A 3CL1A 5FWJA 4O61A 4Q4Y2 1DHKB 1WW4A 4FO9A 1J83A 3BTAA 4HLTA 4K3UA 5KXEA 4MV2A 2XJTA 4ZU5A 3NJYA 2Y0IA 4JZRA 5FPVA 5FYMA 2DVGA 3B69A 3V64A 3WHTA 3QBQA 4TLFA 3PTRB 4EN7B 4EWAA 1SMVA 5CADA 1RB8G 5HBAA 1URXA 4AE2A 1UOBA 2ORXA 3ZO0B 4BQ5A 3IM0A 4FQ4A 4GQ7A 1K5JA 1XNDA 2FDHA 1SCRA 4I30A 1WCQA 4UW5A 5E6HA 3SNMA 1P8JA 5GZFA 5CG8A 3RMYA 1PO21 3OBZA 4QPGB 3RI9A 2E31A 1VBC3 3N7LA 1PGL2 3Q8AA 1YQ8A 2G9GA 5E88A 4XETA 1BCXA 2BFUS 4CCKA 4EJRA 4BZ4A 2YGLA 3A23A 3AZWA 4FXGB 1GNYA 2R042 1DGRA 3LQCA 4JDMA 1IHMA 1CWPA 1XNBA 4A41A 2PXJA 3I2DA 2XR4A 2D3RA 2VMGA 2Q1MA 3AZZA 5D21A 3CIHA 3QH6A 1L7RA 3D4KA 5FXZA 4AHXA 2WFPA 3CO2A 3LKJA 3IKWA 5C5UA 1ASJ2 3DXTA 1Y4WA 2RS51 5KHIA 4XDOA 2KD7A 1U5XA 4FPFA 1VAKA 1X9TA 2FMDA 3ME2A 4GMP1 4ISRA 4M3CA 1QJZA 1RUH1 1UOFA 1AR82 1DF0A 5KXBA 5FTTC 4ZY9A 1O8SA 3NV1A 3WR0A 3GGLA 1CJPA 1LU1A 2AACA 3GHNA 1AR63 1W0NA 5BNQA 3T1LA 4JGZC 3JBG3 3MI8A 1LODA 1SBFA 4UFKA 5DDJ3 4DUVA 1QJY2 3O1SA 4FP2A 4WM7C 2BTVC 3LFMA 2JDHA 4Y20B 1S1AA 2B4KA 1C8M2 4JHZA 3SEPA 2XL7A 5BNOC 4LO7A 3WDUA 5J3UA 5IK7A 5BXXA 3NAPB 1IS5A 2AYHA 3O0VA 3AJZA 4UF0B 2YC0A 1C3HA 4KU8A 2ENRA 4PCRA 4XW3A 3WF0A 4CXYA 2XVLA 3BVCA 5BUVA 5FYUA 3T0DA 3LIHA 4COWA 3O1VA 3ALQA 4R9DA 4Q1RA 1BK1A 4L11A 4Q4X3 4YW6A 4XACA 1KRIA 1AR71 5GZGA 2Y6GA 1TE1B 2XHKA 1PMJX 4HPKA 3PIJA 3ZVXA 2IXKA 3DCQA 5HPOA 3J7MA 1LOCA 1BEV1 3UT0A 3EHKA 1SBDA 3H9AA 5LCWL 3FUOA 2BPA2 4XFAA 3VBSC 3RMXA 4DRVA 4A7YA 1GZWA 3WNNA 1QOOA 1RINA 2RMU1 5FZKA 5C9AB 1G9AA 1LESA 1AXKA 5DPNA 1W8WA 3KGLA 4B1MA 1COV3 3VBRB 1J84A 3CZUA 1H1AA 2IVJA 5HXMA 4DUXA 1PGSA 1U0AA 1SLCA 3ACGA 1X50A 2W1SA 4LHNA 3C7OA 4QXHA 1LKNA 2WO2A 4NIIA 1RUG1 1YCIA 3T2QA 3AVRA 1JHJA 5H9SA 3LDKA 3M3EA 1HDKA 1RUI3 2JG9B 3C3VA 1XQNA 1YRZA 3MF6A 2UU8A 1POQA 5FZ8A 5JXHA 3HJRA 5FJHA 4OULA 4D8MA 2ZMKA 1DQ5A 3MBWA 2LRPA 2VTXJ 5A7WB 1LCLA 2WIIB 1NCRA 3D5OA 5DMYA 2CL2A 2VOTA 5C3RA 1MS5A 4LIVA 3ZDVA 3WP4A 2NM1A 3O1TA 4I0WB 1GQHA 3KMHA 2IWGB 3WDXA 2W39A 4P02B 3AL6A 3N9QA 4YGCA 4Q0PA 5CYYA 4AAXA 3AFGA 1MPXA 2WFF2 4Y3OA 5FPZA 4ZXEA 3VZNA 5EYYA 5CFDB 2DWRA 2YFZA 3J7LA 1VJ2A 4Y24A 3RYPA 2W2IA 3M7AA 1RVF2 1OA2A 4GKXA 1VBA2 1ULGA 3I54A 5IJRA 3RFRA 3L2HA 5FBJA 5IK5A 4TLGA 4CDXA 3LEKA 2WNUC 4LULA 1PGW1 3MIFA 1SG3A 1E5IA 3U75A 2E26A 1MR5A 3I2IA 1VAVA 1K5MB 2R062 2WKKA 3K77A 4ASLA 3RVHA 1SFNA 4J1WA 1TMF3 1GNHA 2BGPA 1O59A 2BP6A 2WWJA 1OOPC 2BBVA 2RVAA 1UQXA 1V6MA 3K3OA 3M3OA 2RV9A 1W06A 3GYDA 5HCHA 1N3OA 5T5LA 3UYJA 3LEGA 5CKMA 1FATA 2E33A 4MXWA 3A22A 3C7FA 1XU1A 4E8CA 2HEYF 2W1QA 5KR7A 4AQSA 4FOYA 3TAYA 3N36A 1PNGA 2XJVA 3VDDA 4W6XA 2A7AA 3HQRA 3IPVB 4CU9A 3OY8A 1HRV1 1D2QA 2HWE3 2JDMA 2JE9A 2D6OX 3H3ZA 3MLLA 4QPIC 5FZ4A 2LW8A 4XXPA 4M00A 2PLV1 5EZWA 1S55A 4A45A 4LJHA 3ZFEA 1Q8VA 2PA7A 4BQ3A 1PMHX 1W6PA 1QJX3 3CNAA 4GJZA 4ZS2A 1JW6A 3T2PA 4E4DX 1WCUA 4LKFA 1W6MB 3GCXA 3WG2A 2WS91 1DBNA 1LOBA 1NE4A 3DPRA 1VP6A 3NO8A 1IS4A 4C0HA 4IW3A 2ARBA 3GDBA 4JKLA 4XUQA 4BCUA 2OZJA 2VNRA 3DECA 4YZ4A 2VZOA 4DFSA 2V72A 4UT5A 1IQAA 2DCTA 3USUA 3CZJA 1DQ0A 1XE8A 1BBT2 5HV4A 3KT7A 5FUPA 1PZ7A 5FZ7A 1J3QA 4CCDA 2C1FA 3BN6A 1I1EA 2BVVA 2R071 5DAPA 5JLVA 3MV11 3AJYA 2NN8A 1AUYA 1XNKA 1LOFA 1ZNPA 2ZPXA 2A5ZA 4PBOA 2VQ0A 5C71A 3UKTA 5GLUA 3GM8A 4OHZA 1V0AA 4JRLA 2DBNA 5ERLA 1VE0A 1BZWA 2C4XA 1XYNA 1RITA 4COZA 1OUSA 3DKWA 3ZSLA 1VBD2 4YZ1A 1J3RA 1AYM2 4PHZA 5C6CA 1QWRA 4Q4V1 5IVBA 4YW5A 5HCBA 4ET7A 3BTZA 1NYWA 1RMU2 5D1IA 3J26N 4IETA 5GLTA 4XMAA 3JB8A 2HYKA 2CY6A 3K2OA 2ID4A 2VC9A 3ZFFC 3INAA 4K1YA 2LS6A 1FOD3 4XMIA 1JYWA 3AKPA 1CD3G 5EXOA 4AR2A 3VV1A 3B5LB 4P9XA 3VKNA 3AP5A 1F35A 4ASKA 3N4MA 2ORZA 3N35A 2OW4A 4DMIA 3SC7X 5AFEA 1S0IA 3IAPA 1ULOA 4N43B 1EV12 2BOJA 2AEYA 2VNOA 1UY4A 1BVVA 4HVOA 4CRQA 4YM1A 1DGRN 1F31A 3P1IA 3SEEA 1H6YA 4BU2A 5K0UB 2F6BA 5A80A 2X8KA 1W3VA 4ONUA 4ZONA 1RHI1 3QACA 2XVKA 4LPLA 2JENA 3SH4A 4WZCA 5F3IA 2QQJA 3ZYBA 1QJEA 1EYBA 2R1BA 1AL21 5FY4A 1YEWA 2IXHA 1X33A 3MIGA 1MQTA 1TME1 5CISA 2C0ZA 4E2GA 3DL3A 4XE9A 4NR1A 4K20A 3IAQA 4D6SA 5JUVA 3THPA 2HWF3 4IEOA 4YW2A 5DN2A 1LR5A 3ZKUA 1NLSA 3ELNA 4DB5A 2VBPA 3I3EA 1F5JA 5EJ1B 2DF7A 4HPKB 3AKSA 2RS31 3ROUA 1WZXA 2ZZJA 1AX0A 1BLZA 5LBBA 4HONA 4BIOA 4EE2A 2DFBA 1DG6A 1OH3A 5FY5A 1OQEA 1MS1A 4XF9A 3A4UA 1J1TA 4W6WA 4YW1A 4AQTA 4R52A 1NCQC 2C5DA 1OLMA 1XB9A 4GAZA 2JD9A 4XFGA 3L2YA 1UN1A 1RUD2 2F4PA 4XCBA 1V6IA 5F6KA 3OUJA 2ZGNA
chains in the Genus database with same CATH topology
2ZBJA 4N53B 2XKOA 3V65A 1LULA 1PO23 2GNBA 1HX6A 3NV3A 3WCSA 3OYWB 3NWKA 1ALYA 2WC2A 3N7JA 2ZA9A 5AC91 4LA3A 1OKQA 2D6MA 3WT3A 4M01A 4QPIA 3WDVA 1H0BA 4D3WA 5B2GB 1O3QA 2LUWA 3E5XA 1Q8SA 4NWVA 4L9BA 2CGNA 5JSPA 2NMNA 1H8VA 1POV0 1C57A 3SCGA 1FNYA 4YFZA 3WUDA 4Y1XA 1RUE2 1WBLA 2Y38A 1DQ6A 4GMP3 3S30A 1WUVA 5BPXA 1RUH3 1DFQA 3RJRA 3VL8A 1KS4A 3IMNA 3MW2A 1GKBA 1R1A2 4MLOA 2VOKA 2Z69A 4TYSA 4O9EA 3ZSMA 1OA3A 2XJRA 3GBWA 4P9GA 3DUIA 3VZOA 1XNCA 2DVBA 5BNNA 1VBC1 1ZRRA 3ZXEA 1GV9A 3H3UA 1UU6A 5FRAA 2C9AA 2GU9A 4RD7A 3POWA 4YM2A 3M1HA 3EXUA 1AR73 4WM8A 4A7KA 1QQP1 3EBRA 3WLUA 2ZOEB 1AX1A 4K6BA 1BEV3 1DGLA 2NYYA 2BW8A 5DDJ2 4HVRA 5CG8A 5JMCA 2BQPA 4XIKA 1L3JA 1PMIA 3AXEA 4PF5A 2RMU3 2ZX2A 2O1QA 4SBVA 2BGCA 1WCSA 1LHWA 3H7JA 3MPPG 3TOJA 3MW4A 3CJXA 1MS9A 3ZFEB 1F9KA 2PHLA 2H6CA 3QCWA 2PHTA 5DG1A 2WNVB 3H0OA 4YVSA 4ATFA 4D69A 1PZ9A 2KXLA 1RUG3 3B01A 4UXAA 4AEDB 1RL3A 1CVNA 4AVCA 2OIIA 4RQPB 4Z8BA 4U2AA 1H2MA 4MGYE 2MPFA 5C9AC 1R1ZA 3MYXA 4MZUA 1TNRA 1RUC2 1WMEA 3VBRC 3OD0A 5C8CB 4QU2A 4XTMA 1H8TA 3WW2A 3IN9A 1AF9A 4I01A 5JDBA 2PAKA 4CEWA 1TEIA 3BB6A 3PHMA 1QXRA 4GKYA 4XEZA 3HIFA 2HWD1 1JXNA 1VAMA 1D4M2 2VUAA 5A32B 3HT2A 3O5SA 1UPSA 3ZXDA 5FOBB 2B46X 2JG9C 3ENRA 3ZN4A 1DZRA 2GC0A 4K21A 3FUQA 2A6VA 3BCWA 1HRI2 2I45A 1RIRA 1SDWA 1F5FA 4JC1A 1FPN2 4G9SB 3BIWE 1S0DA 3H50A 4YZ5A 1BXHA 2WLPA 2E63A 4R9AA 1DZQA 2RJKA 4GXLA 4L8QA 2JICA 1Z0HA 2W68A 2WA3A 1DLLA 5CFDC 1Y9QA 1SEFA 4BH9A 4DXZA 2ZX0A 4CP1A 1PVC1 3WZ1A 1N3QA 4AW7A 4Q4W1 4IEXA 2QNKA 4AVVA 1HRV3 1TNFA 1YO8A 3AKQA 4IV1A 5DG2A 1K5MC 2EAKA 2PLV3 5D8AA 5ACA2 1QKQA 2DCJA 2RR12 1PO12 1YJKA 3OTFA 4P14A 4XZPA 4PJYA 1U5YA 5HCFA 2E53A 1VBE2 2P34A 4AXOA 2WS93 2I07B 1FMD2 2B45X 1ZZ8A 3ZXFA 1UU4A 1AR91 3H1WA 4Z07A 3VBUB 3BODA 1V00A 4E27A 5JZGC 4PIZA 4BA6A 3ZYPA 1S0EA 1W6OB 2UY8A 3FMGA 4CEYA 2LTNA 1ND3B 2R073 4P9IA 1M06G 3CU7A 1O4ZA 2Q8OA 4AQ6A 4JTOA 5L7OA 1ZX5A 3SMHA 1QDOA 4M0HA 4KWKA 1EAH3 4COVA 2GNTA 5JCTA 1EY2A 4LHKA 3AFKA 4Q4V3 4XQDA 4Y22A 4LEJA 4YVWB 3FBMA 5JVVA 3KSCA 4HKWA 1WD3A 3GALA 2Q4SA 1LHNA 1MEC2 1F2NA 5H9RA 5KHHA 3ZMOA 1BJQA 2HWC2 3VZKA 1O5UA 2N7GA 1W6QB 1JH5A 1YI9A 3VKFC 2BNNA 1WBFA 4U36A 1ZBE3 3JD71 3SH5A 3VHPA 4LO5B 1QH7A 4Q2FA 2XBO1 4OHXA 4GWMA 2Z42A 2UYAA 2JG8B 1RHI3 3VBHB 3EO6A 3VBFB 1HXS2 5EFUA 4RS5A 3VKMA 3W9AA 3FWEA 1TME3 3ZDSA 5H9QA 1RUF2 4H7MA 5A33A 3LA7A 5C8WA 1LTEA 1AVBA 1LGCA 3D6EA 4NWWA 5GLZA 3ZMNA 4UW6A 4N43C 3APBA 3IBMA 4K40A 2OZ6A 2RS33 2P3IA 2A3XA 2AR6A 4ASMB 2XL9A 4FAHA 3RSJA 5K0UC 1PIV1 1J59A 4OHYA 3ZFGC 3S7IA 4IV3C 1RTVA 1PK6B 3VUOA 4YW3A 3POYA 3SXWA 4LO6B 4WVMA 3WQ7A 2WSUA 3V0AA 2ZHKA 4EWDA 2TNFA 3VHNA 4Q0VA 3ZXKA 1U5IA 3PJYA 4GB32 3PMEA 4ISQA 4MYEA 4XBQA 5FFOC 4QT6A 3Q9OA 4YVSB 4DOUA 1PVXA 2VGDA 1I3HA 4XYXA 3HQXA 4CYDA 1LGNA 3ZXJA 5AC93 4DINB 2D3SA 2CAUA 4WZFA 5F9TA 2UWAA 5FPXA 3MZHA 3RYKA 3ZN6A 4YRDA 5JOZA 3AZYA 1O3SA 2B42B 1VRH2 1G9DA 4YGDA 1R091 1XU2A 2G9FA 1PO22 5GM0A 4N53C 1G9BA 1LECA 3MFCA 4JQRA 2FMYA 1J58A 1X7NA 4JGYC 5T5JA 2GALA 3TN93 3CJIB 2XLAA 3OJBA 4XFIA 3M3QA 5JZGA 5EYXA 3PJQA 1YWKA 2NPIA 3D8CA 5A3MA 2IC1A 2QZ2A 4Y4YA 3RDIA 4NOTA 1HQNA 4I3PA 1ULFA 4KBBA 2JDZA 5FDBA 4RR3C 5FLIA 3SISA 2RS52 4FQZA 4CDQA 4HK8A 5FLHA 4NPRA 4F83A 2PTMA 1NQJA 4URTA 4PDWA 3KT4A 2ZGRA 5FCCA 4EN9B 1QQP3 2P3JA 4E9KA 1N1TA 1MVQA 1N1VA 5I8YA 4IEVA 3BU7A 3B9IA 4AHYA 3IDEA 5ABJA 1OHFA 2D5FA 3AYEA 3B94A 1XYPA 3WP3A 4FAGA 1QH6A 1YFYA 1DQ4A 4N7IA 4Q27A 1ND2C 2VMIA 2WA4A 4LBQB 2TEPA 1D0HA 1H9PA 1YLLA 1V6LA 2ZMNA 4Q4Y1 3RG0A 2NQYA 4L99A 3JCIA 2EXKA 5T5PA 4CDUB 2XJSA 3VZMA 3J9SA 4DY5A 3B3QE 3I59B 4N7UA 2RS12 2WZPP 5J37A 2BWAA 4COYA 1BEV2 3ZXAC 2DTWA 2VOWA 3NW4A 1U12A 1CQ9A 1PGL1 3H1YA 4IL7A 2DYCA 5A3LA 1KS5A 1LU2A 1C4RA 4H7LA 1NA1B 4TSVA 2QFEA 1V6NA 1ZA4A 5C4WC 3MF9A 1V70A 3R6SA 3PVEA 3RNSA 2R041 1YJLA 1Z7S2 2MNGA 4HKOA 2PELA 4XFHA 3WW1A 1JN2P 3V0BA 3FZ3A 5DUWA 2D98A 1RUG2 2WQZC 2HWD3 3J8F2 2WJSA 4AEDC 4QQHA 2E7QA 2WZR2 1ASJ1 5GZCA 4LBKA 5T52A 5GLVA 5BNPA 5CAZA 2HKXA 4CDWB 1AR81 2R32A 4RQPC 4M3CF 2DCKA 5LRRA 2A73B 3ZSJA 1ENQA 3ILFA 1I5ZA 2GN3A 4HKLA 4QGLA 4Y1VA 5C8CC 4TWTA 4AI1A 5L19A 4JAAA 4A7ZA 2YY1A 4QQ2A 3WP5A 2X5IA 1CAVA 5DUVA 1S0FA 4AK3A 2ZHMA 2TBVA 2OA2A 2A3WA 2VVFA 2V09A 1PVC3 1Q8QA 2GC2A 3AMPA 2Q5TA 3VZJA 4Q4W3 4JGYA 3FFQA 2AGSA 4FPKA 4HZFA 3WX5A 4LUKA 4GA9A 4XDQA 4MXVA 5CFCB 3BOPA 1OPOA 3VBOC 3HWJA 1PZ8A 2QDRA 3QD6A 4XJWA 4I0AA 3VKOA 2X53S 2D93A 1W2UA 4JRAA 3KQRA 3LGRA 2XJQA 4R4ZA 4XQ4A 1WCDJ 1UMZA 2QUOA 2BYVE 1AR93 1OPMA 2VH9A 3UK9A 2ZX1A 2H0BA 3PVNA 2WL1A 1BYHA 3KB5A 1Z78A 4E2QA 5SV5A 1EPZA 4Q29A 4IQPA 3M70A 3FLRA 5I91A 4H55A 2EA7A 1IOAA 2KM2A 2HWB2 3OPZA 3WP6A 3RPQA 4UBHA 5I0TA 3I8TA 1KITA 1IKPA 5T54A 1V9U2 4PQ9A 5HI0A 5F1RA 1UL9A 3E6BA 1C1LA 1ND2A 3WQ0A 1Q8PA 4FPEA 1X82A 3K48A 3ZN6B 2ZMLA 1IS6A 5IUQA 2EXJA 1JUIA 2WFF1 3FFZA 3VBUC 4BWOA 2O0OA 1DQ2A 1LRHA 3BALA 4JGZA 1POV3 3GZAA 5JOYA 3D82A 3DV8A 4WM7A 1RVF1 5BNOA 1IKQA 3FBYA 2R49A 4K9SA 1NE6A 5JI7A 2B39A 3JD73 1BMV2 3O0XA 3WY6A 3BOWA 2R061 1UKGA 5C4WA 3E6CC 2XBO3 2IXJA 2QE3A 4QQOA 4AFBA 1MS0A 3ILRA 4YVWC 2A75A 4LNVA 2ZGSA 2AUYA 2ZX3A 1ZVFA 4HVQA 4IEUA 2W08A 1OI6A 4AFCA 5IT6A 3KLSA 1SLAA 2D44A 2G4IA 4XFFA 4L92A 1B35C 1ZBA2 1UAIA 2GSYA 4XF4A 3VBSA 2QKDA 4AI2A 2WWSA 2PHFA 3WDYA 1CESA 1EAH1 4G4FA 3ZYIB 3P3PA 1Y43B 2YUEA 4YG6A 2CGPA 1DGWX 4YFWA 3WG1A 1UZYA 1PIV3 3POSA 4J1XA 2XVGA 2YZ4A 2JG8C 1FYUA 4YLZA 1AL22 4RHV2 3VBFC 1VBB3 3RWNA 2GH2A 5JI9A 1LHVA 1WLWA 1AYN2 3I7DA 1ZZBA 3WDWA 4L97A 4M3CB 4F8AA 1WD4A 2P3KA 2ZKNA 3LOIA 1WMFA 5L73A 1DYPA 1QJU2 2GAUA 2YXSA 1ZBE1 2ZABA 4FPOB 3VN4A 3AK0A 3VGIA 4Y1YA 2ZGKA 5F5QA 1QY4A 1RUJ1 1CAXA 2RM22 2D3PA 1LOAA 4LE4A 4I09A 5FQ0A 1H2KA 2UWCA 1PK6C 3VBOA 1Q5OA 2MEV1 4OLLA 2LM3A 4YNIA 4C91A 1R093 1XXNA 4GH4C 5I0RA 1CAUA 1FNZA 1ZREA 3W58A 1AYM1 4AFAA 3ILNA 4XJ9A 1BVP1 2ETEA 2JKBA 3V0BB 2JXAA 2AREA 2WNUA 2EF6A 4CP0A 5HXVA 1HIXA 4FT8A 1VLNA 5J09A 1A6CA 3AMNA 1GZWB 1DU3D 1X8MA 1OOPA 3AM2A 3AMQA 2JD4A 3AYAA 2ZGQA 5FMOL 4LO8A 1EV11 1UU5A 4B7KA 5F6LB 4FBFA 1UF2C 3ZPYA 3HD8B 4MX3A 4YARA 1ZRDA 3B02A 3TYJA 1UZZA 3JZVA 4YZ3A 2Z2SB 1Q8OA 1KDMA 1CONA 4KG8A 3H7YA 1SLLA 4YM0A 5EV7A 1CAVB 1LHUA 3A0NA 4S2DA 3CJIC 4KWLA 2A6YA 3RS6A 3OBTA 1KXGA 2E51A 5E1RA 1YI7A 1GFF2 1OFSA 2ARXA 4LHLA 3E5UA 1NCRB 3NKTA 1QNYA 2QZ3A 5DZFA 3MDPA 2XGXA 1VBC2 1A3KA 4Q4Y3 4QPGC 1Y3TA 2OYZA 3USSA 2BEOA 5JWPA 3TN91 2DCZA 1W0OA 2D6PA 2DTYA 5LK5A 2OUHA 1ZZ7A 4RSUA 1MZFA 3SLIA 2VVEA 1SCSA 2VW1A 3SCFA 4AGVA 4DZGA 4HANA 1GYKA 5CG9A 4W65A 2ES3A 4XIOA 3PVBB 4XFCA 4CDXB 4HSLA 4AGGA 3IDBB 2BWCA 5LEKA 3FLTA 2NMOA 1ZRCA 4LBLA 2R16A 3ASIA 4YYOA 3T2TA 1DDLA 4S2HA 2R043 4AGRA 1RUNA 1AR62 4UW3A 3VHOA 2CGOA 3JBG2 4LA2A 4MXWB 5SV8A 4CDUC 3ZFFA 4OVEA 3PTYA 3VDDB 1FV3A 1ASJ3 2PAMA 4UW4A 4LBNA 1RUE1 3AMMA 3OY8B 3NAPC 3SHRA 1AR83 2Y0OA 3LSDA 1D4VB 2ZX4A 4KGQA 3U11A 1REDA 1NA1C 1CAWA 1A8MA 5FMOS 1R1A1 4Q4X2 1W6PB 3HMYA 3M8LA 1HKDA 4EN6B 4WM7B 2VY0A 1B09A 5DXDA 1H4HA 3FC0A 3DPRB 1C8M3 3ZXGA 3HN1A 2ILMA 2XG3A 4Q0UA 4Y1ZA 2RHPA 4NHMA 2VG9A 3USUB 3D0SA 4LR4A 1HV1A 2CYFA 4N9IA 1COV2 1FAYA 4OUMA 1WLCA 3E5QA 4QGNA 4AYUA 1GQGA 3ATGA 1YFWA 1WA4A 2DVDA 5DUXA 1GBGA 2O8QA 1BQPA 3FJSA 4Q8KA 1NCQA 1RUI2 4HK9A 4COUA 1C5HA 5T50A 1F8VA 3D0JA 4INDA 2HEVF 1A78A 3P3NA 3HT1A 3ZN5A 5FO9B 2XWBB 1QMJA 1RJ7A 1T6GC 1LGBA 1W6NA 3AKTA 3AP6A 2WT0A 1OFNA 3EQEA 2AENA 1MZ5A 2ZTNA 4FVVA 5IK4A 2VVDA 3U07A 5CFCC 5KC6A 4I02A 4FTBA 3GBFA 1EP0A 4R4XA 4IXLA 3KM5A 2WT2A 1YNAA 2W0XA 1GLHA 4H14A 5DZEA 1RUC1 3ZX7A 3NKGA 4AQ2A 5LK7B 4K7JA 1IPJA 3AKRA 1MQTB 2ZZQA 1UW8A 2WFF3 3AYDA 4E4ZA 2EXHA 2XKPA 1D4M1 1O91A 1TMF2 2ET7A 2YV8A 2D5HA 4FXKB 4N90A 1CAUB 3H8UA 1QGLA 3T1MA 1RVF3 3HAGA 1IPKA 1VBA3 5E16A 2D40A 4M0NA 1HRI1 1YIPA 4X6QB 1V6JA 3WG4A 4Z92B 3KCCA 1FPN1 5J96B 2R063 3AP4A 3S7EA 2WQ4A 5K7PA 1OOPB 2HWE2 4BIFA 3IWZA 4GULA 4GMP0 1S0CA 3PLQA 5BYNA 1ZRFA 1HQLA 2JECA 1QJX2 2R30A 1CR7A 4KNCA 2DVAA 2UWBA 2QVSB 2QDNA 4Y20A 4XXAA 3AP7A 3NAPA 4QPIB 5EJ3A 5LRSA 3JUUA 1REFA 1S0JA 1SLIA 3WNXA 4XHXA 2H0VA 1PM7A 1KFXL 2QCSB 5ACA1 2CV6A 1J1LA 4GIQA 1POV1 1MS8A 1PO11 4B4QA 2JEMA 4Z82A 4OI0A 2K2SA 1VBE1 5T55A 2PFWA 4UBGA 3W59A 1FMD1 2GN7A 1FV2A 4YZ2A 2XLFA 1YYNA 2PHUA 3J4UH 3E97A 4JTNA 3O7OA 2R0HA 2P2KA 2GMPA 3LAGA 5C9AA 4Y5Z0 2ZGOA 1RUJ3 3G7DA 3N7MA 3VBRA 3MIDA 4FOQA 1JYIA 4YGBA 4BHPA 2VXRA 1NXD1 2NZ9A 4ZU7A 5BNNB 1QOTA 1FOD2 2OPKA 2PHWA 3KZ4C 1Y7BA 2MEV3 1S0GA 4BOWA 4EWEA 1X8EA 4QHBA 2VECA 1VBD3 2JG9A 3AZXA 4WM8B 1AYM3 3UJQA 3JB4C 2WT1A 3LA2A 3VZLA 1A8DA 4FCAA 3ZFFB 4IEQA 1H4GA 4N9HA 1OLRA 5FAXA 2HWC1 4RA0A 1VBB1 2CAVA 2BFUL 5BV6A 2ZHNA 1XRUA 3R4SA 5CFDA 1EV13 1WW7A 5DZGA 2HWF2 1M4WA 4OI4A 1MS4A 2O8OA 2VULA 5I8TA 3NSTA 5FBZA 1C28A 1NY72 2D97A 3LSEA 1E57A 4KQ7A 1AJKA 2PHXA 1WMDA 1HXS1 1R081 2SBAA 2IZWA 5J7MA 4B4RA 3LOBA 1K5MA 4QQLA 4XTPA 3KGZA 1RUF1 2XUMA 3UL2A 3S0MA 4RL7A 1QXJA 2YHJA 3A0KA 5GZEA 1GANA 4C0BA 2RE9A 1H8TB 2K0GA 4Q0QA 1CPMA 1DZTA 1ULCA 4CEWB 4HN1A 4KU7A 3ZYJB 3MEPA 1O3RA 3IPVA 1LHOA 1LENA 2PN5A 1CJDA 1RUD3 1QNWA 4P9YA 3CF6E 3OBRA 1QOSA 4XPVA 1W39A 2DUOA 4GB31 1DIWA 5CIRA 2CTVA 2YDEA 4QMAA 3RI8A 4GALA 2A6WA 4OFGA 4WVVA 1NCRC 1UPIA 1W6MA 2QJVA 5I0UA 1AZDA 4P9WA 5KHJA 3AYCA 3ZIXA 1RUH2 3EJKA 1QXPA 4AVAA 2PYTA 4META 1ZM1A 4AHZA 1HQWA 1HW5A 4HBNA 4D7YA 4EV0A 1VRH1 4LLOA 1ONAA 2VUJA 1QHDA 4DS0A 1LEDA 3TBDA 2P17A 1RUE3 4CDXC 3U0ZA 2D7FA 4IV1B 4PIXA 3OF1A 3RZZA 5D8AB 4XJUA 1X36A 2VNGA 1R1A3 2WINB 4AFMA 4FPLA 1AR72 4K8FA 3B00A 2AH2A 1GNZA 1REEA 5GLWA 3LCPA 4IESA 3S6PA 2V5YA 4LBJA 2JE7A 3ES4A 3VDDC 4Q26A 2RMU2 2YYOA 5GKAC 4CEYB 2XH6A 4N43A 4HMZA 2WNEA 4SLIA 1YFXA 3ZXLA 4AF9A 2V73A 3ZFEC 3GZTB 5K0UA 3IDCB 1MACA 2ZGLA 3ZFGA 1AX2A 5L7OB 2WNVC 4AWDA 4IV3A 2ZGTA 4BQ1A 4S2GA 3DPRC 4J6GA 5IK8A 4IEPA 3KT1A 2FZ2A 1AXYA 4Y22B 3MICA 2I2SA 1UX6A 4QX5A 1JYCA 1TQ5A 4AVSA 5KXDA 4ES9A 4QGMA 2RS11 1QJY1 4TZDA 3N3HA 1NZCA 4Q1PA 4NO4A 1C8M1 5CU1A 4XHBA 1LOFC 1ULDA 1JHNA 4EN0A 2AZ5A 4D7SA 1GZCA 1FI2A 4XF1A 1JOJA 2EALA 2VU9A 2VPVA 5I8SA 4BMBA 4HT1T 3MW3A 4DNYA 5HCAA 3TB0A 3LB9A 4N53A 1RUC3 1LEMA 4JVAA 4NVPA 2ATFA 4B3NA 2EXIA 1Z7S1 1PGW2 3OYWA 4RS5B 4ITCA 1WW5A 2XWJB 4DY3A 1UKRA 1JTZX 4Q0SA 4OHVA 4ES8A 5A33B 3J8F1 1G9CA 1D4M3 1VB2A 3OCPA 3DGTA 2IFRA 1LOEA 1O7FA 3GZUC 3ZSKA 2WZR1 1W0PA 5FO8B 1ZYBA 2BNOA 1H1MA 3TRSB 3M2MA 1WLDA 4FPJA 4FOWA 1HRI3 1MVEA 4R9BA 4BM8A 2LALA 4RR3A 3B7MA 1FPN3 3O14A 1JBCA 1KQRA 4WVMB 5KXCA 1HRV2 3V0AB 2GDFA 1MQTC 3ACLA 2PLV2 2WLQA 4K1ZA 4MH0E 3WQ1A 4LBOA 1IS3A