2BPRA

Nmr structure of the substrate binding domain of dnak, 25 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
173
structure length
173
Chain Sequence
SIEGRVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNAK
publication title NMR solution structure of the 21 kDa chaperone protein DnaK substrate binding domain: a preview of chaperone-protein interaction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Molecular chaperone
total genus 21
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 1998-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 2bprA00
4F01A 1DKXA 3C7NA 4R5GA 4JN4A 4R5LA 4EZXA 1U00A 1Q5LA 4FL9A 4R5IA 4EZNA 5E84A 4HYBA 3QNJA 4JWIA 2KHOA 4WV5A 3D2FA 4JWEA 4EZPA 2V7YA 4JWCA 3N8EA 3DOBA 4HY9A 4R5JA 4JWDA 4EZWA 3DPPA 1CKRA 4EZTA 4EZUA 4E81A 4EZVA 4JNFA 4JNEA 1DKYA 4EZRA 4PO2A 4EZZA 3DQGA 4R5KA 4EZSA 3D2EA 7HSCA 2QXLA 3DPQA 4B9QA 1DKZA 4EZOA 2OP6A 3C7NB 4F00A 3H0XA 2BPRA 5TKYA 4EZQA 3DPOA 1DG4A 4EZYA 1YUWA 4WV7A 1BPRA
chains in the Genus database with same CATH superfamily
4F01A 1DKXA 3C7NA 4R5GA 4ILHB 4JN4A 4R5LA 3SBTB 1U00A 4EZXA 1Q5LA 4FL9A 4R5IA 4EZNA 5E84A 4HYBA 3QNJA 4JWIA 2KHOA 4WV5A 3D2FA 4JWEA 4ILIA 4EZPA 2V7YA 4ILGA 4JWCA 3N8EA 3DOBA 4HY9A 4R5JA 4JWDA 4EZWA 3DPPA 1CKRA 4EZTA 4I43A 4EZUA 4E81A 4EZVA 4JNFA 4JNEA 1DKYA 4EZRA 4PO2A 4EZZA 3DQGA 4R5KA 4EZSA 3D2EA 7HSCA 2QXLA 3DPQA 4MQDA 4B9QA 1DKZA 4EZOA 2OP6A 3C7NB 4F00A 3H0XA 2BPRA 5TKYA 4EZQA 3DPOA 3ZEFA 1DG4A 4EZYA 1YUWA 4WV7A 3SBSA 1BPRA
chains in the Genus database with same CATH topology
4F01A 1DKXA 3C7NA 4R5GA 4ILHB 4JN4A 4R5LA 3SBTB 1U00A 4EZXA 1Q5LA 4FL9A 4R5IA 4EZNA 5E84A 4HYBA 3QNJA 4JWIA 2KHOA 4WV5A 3D2FA 4JWEA 4ILIA 4EZPA 2V7YA 4ILGA 4JWCA 3N8EA 3DOBA 4HY9A 4R5JA 4JWDA 4EZWA 3DPPA 1CKRA 4EZTA 4I43A 4EZUA 4E81A 4EZVA 4JNFA 4JNEA 1DKYA 4EZRA 4PO2A 4EZZA 3DQGA 4R5KA 4EZSA 3D2EA 7HSCA 2QXLA 3DPQA 4MQDA 4B9QA 1DKZA 4EZOA 2OP6A 3C7NB 4F00A 3H0XA 2BPRA 5TKYA 4EZQA 3DPOA 3ZEFA 1DG4A 4EZYA 1YUWA 4WV7A 3SBSA 1BPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F01 A;  1DKX A;  3C7N A;  4R5G A;  4JN4 A;  4R5L A;  4EZX A;  1U00 A;  1Q5L A;  4FL9 A;  4R5I A;  4EZN A;  5E84 A;  4HYB A;  3QNJ A;  4JWI A;  2KHO A;  4WV5 A;  3D2F A;  4JWE A;  4EZP A;  2V7Y A;  4JWC A;  3N8E A;  3DOB A;  4HY9 A;  4R5J A;  4JWD A;  4EZW A;  3DPP A;  1CKR A;  4EZT A;  4EZU A;  4E81 A;  4EZV A;  4JNF A;  4JNE A;  1DKY A;  4EZR A;  4PO2 A;  4EZZ A;  3DQG A;  4R5K A;  4EZS A;  3D2E A;  7HSC A;  2QXL A;  3DPQ A;  4B9Q A;  1DKZ A;  4EZO A;  2OP6 A;  3C7N B;  4F00 A;  3H0X A;  2BPR A;  5TKY A;  4EZQ A;  3DPO A;  1DG4 A;  4EZY A;  1YUW A;  4WV7 A;  1BPR A; 
#chains in the Genus database with same CATH topology
 4F01 A;  1DKX A;  3C7N A;  4R5G A;  4ILH B;  4JN4 A;  4R5L A;  3SBT B;  1U00 A;  4EZX A;  1Q5L A;  4FL9 A;  4R5I A;  4EZN A;  5E84 A;  4HYB A;  3QNJ A;  4JWI A;  2KHO A;  4WV5 A;  3D2F A;  4JWE A;  4ILI A;  4EZP A;  2V7Y A;  4ILG A;  4JWC A;  3N8E A;  3DOB A;  4HY9 A;  4R5J A;  4JWD A;  4EZW A;  3DPP A;  1CKR A;  4EZT A;  4I43 A;  4EZU A;  4E81 A;  4EZV A;  4JNF A;  4JNE A;  1DKY A;  4EZR A;  4PO2 A;  4EZZ A;  3DQG A;  4R5K A;  4EZS A;  3D2E A;  7HSC A;  2QXL A;  3DPQ A;  4MQD A;  4B9Q A;  1DKZ A;  4EZO A;  2OP6 A;  3C7N B;  4F00 A;  3H0X A;  2BPR A;  5TKY A;  4EZQ A;  3DPO A;  3ZEF A;  1DG4 A;  4EZY A;  1YUW A;  4WV7 A;  3SBS A;  1BPR A; 
#chains in the Genus database with same CATH homology
 4F01 A;  1DKX A;  3C7N A;  4R5G A;  4ILH B;  4JN4 A;  4R5L A;  3SBT B;  1U00 A;  4EZX A;  1Q5L A;  4FL9 A;  4R5I A;  4EZN A;  5E84 A;  4HYB A;  3QNJ A;  4JWI A;  2KHO A;  4WV5 A;  3D2F A;  4JWE A;  4ILI A;  4EZP A;  2V7Y A;  4ILG A;  4JWC A;  3N8E A;  3DOB A;  4HY9 A;  4R5J A;  4JWD A;  4EZW A;  3DPP A;  1CKR A;  4EZT A;  4I43 A;  4EZU A;  4E81 A;  4EZV A;  4JNF A;  4JNE A;  1DKY A;  4EZR A;  4PO2 A;  4EZZ A;  3DQG A;  4R5K A;  4EZS A;  3D2E A;  7HSC A;  2QXL A;  3DPQ A;  4MQD A;  4B9Q A;  1DKZ A;  4EZO A;  2OP6 A;  3C7N B;  4F00 A;  3H0X A;  2BPR A;  5TKY A;  4EZQ A;  3DPO A;  3ZEF A;  1DG4 A;  4EZY A;  1YUW A;  4WV7 A;  3SBS A;  1BPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...