2BQPA

The structure of the pea lectin-d-glucopyranose complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
234
structure length
228
Chain Sequence
TETTSFLITKFSPDQQNLIFQGDGYTTKEKLTLTKAVKNTVGRALYSSPIHIWDRETGNVANFVTSFTFVINAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSAEYDKTTQTVAVEFDTFYNAAWDPSNRDRHIGIDVNSIKSVNTKSWKLQNGEEANVVIAFNAATNVLTVSLTYPNVTSYTLSDVVSLKDVVPEWVRIGFSATTGAEYAAHEVLSWSFHSELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEA LECTIN)
publication title The Structure of Pea Lectin-D-Glucopyranose Complex at a 1.9 A Resolution
pubmed rcsb
molecule tags Sugar binding protein
total genus 51
structure length 228
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bqpA00
1FNYA 2P34A 2W39A 2A71A 3MPPG 4GKXA 4YM0A 3PVNA 4XOGA 2ERFA 1HLCA 1GZWB 2VW0A 4XXPA 3ZYPA 1Q8VA 1F5FA 1AZDA 4M3CA 2D7FA 4NOTA 2ES3A 3ZVXA 3USUA 1W6MB 1OKQA 2VXRA 3AP7A 1D0HA 4YM1A 1GV9A 3N7JA 4KBBA 3WG3A 1KRIA 4WZFA 1SLBA 1VAMA 2ZABA 2AUYA 1JUIA 1GYKA 2YROA 1N1YA 3M3OA 1WW7A 3ENRA 5T5OA 2VUAA 2VW1A 2GNTA 3VKLA 4GKYA 4C1WA 2PHXA 1LOCA 1LU2A 4XBQA 4WVWA 2BQPA 2AR6A 1RINA 3D6EA 4Y26A 2VU9A 4L8QA 1SLIA 3ZXKA 1CESA 2DTYA 3SH5A 3V0BB 4OZXA 4DS0A 2D3RA 4W65A 4ZKTB 4XJZA 1FX5A 1GZWA 2D6OX 3WDTA 4YGBA 4GXLA 2R1DA 1AXZA 2P2KA 1UMZA 5DG2A 5T52A 5KXBA 4P9YA 1AX2A 3QCWA 2A3YA 1W6MA 1FAYA 2EAKA 2UWAA 3D5OA 3WUCA 2CNAA 1WUVA 3WNXA 3JU9A 1NLSA 4Q26A 1YIFA 1V6OA 1AF9A 1LECA 3M3CA 4BLJA 1LOBA 3RMXA 2D3PA 1LGCA 1MS3A 1YYNA 4JC1A 1O4YA 4ISRA 4FPYA 1W6PB 3FBYA 1LOFA 1A78A 1IKPA 1W0PA 4YW3A 3V0BA 2ZKNA 3MW4A 1S0JA 1YXWA 5KXDA 1IKQA 4R9AA 3N35A 5KXEA 2W68A 1UN1A 1WW4A 2ZAAA 5DUXA 3VV1A 3RRDA 2WSUA 4H55A 1IOAA 3H0OA 5CAZA 2D6LX 2NYYA 1DQ6A 3OY8B 2ZHMA 1LHOA 2DU1A 1IS6A 1DBNA 3POSA 2RHPA 1S1AA 1LOFC 1QNWA 1MVEA 2A70A 4FOWA 2ZGTA 4JRAA 5T5JA 1R1ZA 1QOTA 4XXAA 3ZXLA 2XG3A 4Q8KA 1BYHA 3AXDA 1LULA 3FUOA 1FYUA 5EXOA 2DV9A 1KITA 4AWDA 2DU0A 1U0AA 1W6PA 1APNA 3SH3A 3LSDA 5CBLA 4AVTA 5T5PA 1KJRA 4M01A 5H9QA 1GBGA 3I8TA 1G7YA 3WOGA 1IS5A 1C4RA 1DQ0A 3OPZA 3D4KA 1S0FA 1C1LA 4WV8A 4FPKA 5JOXA 4K1YA 2JJ6A 1JW6A 2ZACA 2NMOA 1QU0A 4FPLA 1F31A 1A8DA 1DLLA 2OVUA 3OY8A 1X50A 5IK5A 2PHFA 1SBEA 3ATGA 1S0BA 3O0XA 4CTEA 4YM2A 5E89A 2R1BA 1YI7A 3M3QA 1KQRA 4YG3A 1G9DA 4Q1PA 2WT2A 2YMZA 4M3CB 2AH2A 4U2AA 2JE7A 3OBTA 2DUPA 1SFYA 1DHKB 5HCFA 1S0CA 2P3KA 4XTPA 1HKDA 1Q8PA 1WLCA 1YRZA 3HMYA 3PVOA 2GDFA 4GALA 5IK7A 1WLWA 2VY0A 1G9BA 1JHNA 1W0OA 3M3EA 4FOYA 3M1HA 3MW3A 2ZHLA 5L73A 4YFZA 4NO4A 1W6OB 1LEMA 1UPSA 3RG0A 2PHUA 2R49A 2A75A 2D6KA 3INAA 3B69A 4FQ4A 2A7AA 2CWMA 3DUIA 1LOEA 4GWMA 5GZDA 1I1EA 4ATEA 1ULEA 4K20A 3ZXEA 3V64A 4XHXA 2SLIA 1QOOA 2ZBJA 1CPNA 2A6YA 2P3JA 3ASIA 2GALA 1QF3A 1A3KA 3CNAA 5GZGA 2JD4A 4HANA 1Z78A 3PVEA 1G8WA 4ZXKA 1LHWA 1HQLA 1N3QA 1QMJA 1QOSA 2ZGSA 4FPCA 4YGEA 1B09A 2ZGQA 3FLPA 4M00A 4PF5A 3SNMA 4XJWA 1CJPA 2ZGUA 5EYXA 5IK4A 3AP9A 3QLQA 1HQWA 1VLNA 1IS4A 4ISQA 4ASMB 3W58A 1BJQA 1W6OA 3V0AB 1CPMA 2WLQA 3SH4A 1N3OA 2EALA 2EIGA 5BYNA 1VAVA 3AK0A 5GZEA 3HN1A 2A3WA 2PHWA 3POWA 3T1MA 2E53A 3HR9A 4Q8LA 1ENRA 4YZ5A 1LENA 1QDCA 4BLIA 3VKMA 1LOAA 2C9AA 3BOPA 1URXA 1WBFA 2ZGPA 2LTNA 4FOVA 4M3CF 2DTWA 2LALA 1H9WA 1S0IA 5T50A 2GNDA 1EPWA 1LESA 4LBQA 4Z8BA 1SCRA 5GZFA 4XJAA 4FOQA 4UW5A 5H9SA 2WJSA 4XILA 1FV3A 1WD3A 2DUOA 5T54A 3WDXA 2GMEA 2JKBA 3V0AA 2FHRA 3VKFC 2UWCA 4BMBA 4YGDA 1GKBA 2NMNA 4YW5A 1V6KA 4AVSA 1N1SA 4FP2A 1MACA 3UJQA 1RIRA 4DPNA 1G9FA 4P14A 4FVVA 4YW2A 3FUQA 3UL2A 3WVJA 5JLVA 5DUVA 1GZCA 2D6NA 4XMAA 2WQZC 3AYDA 1D2SA 1PZ9A 1BQPA 2NN8A 1DQ4A 2ZHKA 3LCPA 4ITCA 3WLUA 1V6NA 2CL2A 3A0KA 4Q1RA 2WT1A 1MZ6A 3O12A 5JMCA 1G9AA 4Y1ZA 1KDKA 1N47A 4SLIA 3VKNA 1G9CA 4Y22B 2CYFA 2ZGOA 3AZZA 2VH9A 1MS8A 3WDVA 1MVQA 2UURA 5H9PA 1PZ8A 1LODA 1LCLA 1SBFA 2TEPA 3OBRA 4UW4A 4BMEA 4Y1YA 3ILFA 1XQNA 3SLIA 2CY6A 1AX0A 1V6JA 3I4IA 3LSEA 1WCSA 2KM2A 2EF6A 1WW5A 1Z0HA 2JE9A 3PMEA 4YFWA 1JXNA 3R4SA 3AP6A 5F9TA 3WZ1A 2ZGKA 3GNEA 3AYCA 4BPZA 4XDQA 4FPFA 4XIOA 1AX1A 3V65A 1CONA 2EXHA 1YO8A 3ZSJA 3AXEA 1DYPA 2Q5TA 4K21A 4FPHA 4R9CA 2UWBA 3NWKA 1ULCA 3RQ0A 3SISA 5JOYA 3O0VA 4Y1XA 2UU8A 4Y22A 3BIWE 1UL9A 2B7YA 3ILNA 4XJ8A 1JYCA 4LBJA 3WDYA 5GLVA 3TAYA 4PBPA 3BODA 1CR7A 2A6WA 4Q27A 1BKZA 1DZQA 1UAIA 3UJOA 1JN2P 4YGCA 3VKOA 2V73A 4LBLA 1FATA 1ONAA 2D3SA 4DQAA 1C57A 3B00A 3L2YA 4K1ZA 4BM8A 1S0GA 5DZGA 3WG1A 3JUUA 1JYIA 1MR5A 1N1TA 1ZM1A 2YY1A 5GZCA 2ZGNA 4PCRA 4YW1A 4RA0A 2FMDA 5CA6A 4I30A 4D69A 4Y24A 1SACA 2ZMNA 2EXKA 4CRQA 2D43A 2SBAA 1V00A 5DZFA 5HCAA 1I3HA 4FPOB 5T5LA 3NV2A 3BTAA 5GLZA 4P9XA 1S0DA 3AYEA 1GICA 2AREA 3N36A 2OUHA 4YZ3A 4WVVA 3R05A 2ZMKA 5CNAA 1QDOA 1BZWA 1KJLA 1TEIA 1VALA 2W52A 2Z42A 1LHUA 3O0WA 1AVBA 5GLUA 1UKGA 2ARBA 1MS9A 4LBKA 3WHUA 2DVAA 3AJYA 2PELA 1J1TA 5GLWA 4FPGA 1UZYA 4MYEA 5SV8A 5LK5A 1ULGA 3WCRA 4XBNA 4Y20B 5JVVA 4LBQB 1W6NA 5AVAA 2A6VA 4XJUA 3A0NA 2XB6C 5DUUA 4C1XA 2ZMLA 4UW3A 4YG0A 4AYUA 1ENSA 3ZSMA 1FNZA 1RITA 4AVVA 4TYSA 4R9BA 2E7QA 3PJQA 1UZZA 1AXKA 1Q56A 5KXCA 1O4ZA 3WCSA 1BXHA 2DVGA 3O5SA 1SLCA 1W6QB 1H30A 3T2TA 5H9RA 1ULDA 2ZHNA 5EYYA 5HCBA 2AENA 2WNEA 2GMMA 2A5ZA 2NP0A 1V6IA 4XTMA 4FPEA 4FQZA 1C1FA 3N7KA 4R9DA 4BQ1A 3MEPA 1DFQA 1DQ2A 1SLAA 3NV1A 1Q8QA 5T55A 1DQ5A 3B3QE 5IT6A 2R16A 4LBMA 5GJ6A 3WV6A 3ZSLA 2ZGRA 4YG6A 4DRVA 1JOJA 1DYKA 3N7MA 2ZGLA 5F5QA 4Y20A 3AYAA 2D6MA 2AGSA 3IMNA 3Q9OA 3WDWA 1WW6A 1QNYA 4AGVA 4U36A 1MS0A 5E88A 1ENQA 1QKQA 4BOWA 4AGGA 2WT0A 2ZA9A 1OFSA 1Q8SA 1KDMA 1W6QA 5DG1A 3N7LA 1S0EA 5DUWA 2OUJA 3N3HA 3SITA 3OYWB 4YZ4A 2D44A 2E7TA 1LHNA 2A6XA 2V5YA 2YZ4A 2I2SA 1N3PA 3KQRA 5DZEA 1VIWB 1GANA 3IN9A 3OGGA 4GA9A 5JOZA 5IUQA 1LEDA 2G4IA 2WKKA 2CTVA 3AJZA 1ZA4A 3KM5A 2P3IA 5IK8A 3IPVB 2EXJA 2PHTA 2GN7A 3DGTA 1AJOA 1GSLA 3A4UA 3AX4A 2R0FA 4Q2FA 4XMIA 4XYXA 3ZPYA 2H0BA 4AGRA 1AJKA 1CVNA 3B9CA 1PZ7A 4P9WA 4UW6A 4GWNA 3TB0A 1WBLA 2EXIA 2R0HA 3IKWA 4LBOA 4LBQD 2PHRA 1MS4A 5GLTA 4YZ2A 4YW4A 1V6MA 3OYWA 3RS6A 1DIWA 2DYCA 2YV8A 1LHVA 3AZYA 2DUQA 3R4UA 2C5DA 2D6PA 1Y7BA 2ZZJA 2DVFA 4FPJA 5EWSA 3M2MA 1LGBA 2E6VA 2JDZA 3W59A 3T1LA 1LU1A 2DVBA 4DRRA 4XIKA 2A3XA 4Y1UA 1WLDA 2OW4A 5GM0A 3WDUA 5JOWA 3U4XA 2E51A 3C2UA 2A6ZA 3POYA 2GNMA 2AYHA 3FLRA 1CN1A 2DVDA 4XJ9A 1ULFA 4Y1VA 3AFKA 5FREA 4F83A 3IPVA 1Q8OA 4IQPA 1LTEA 3NV4A 4HL0A 3APBA 4XE9A 1G86A 5DXDA 1JBCA 5GALA 4CZSA 2GN3A 3ZSKA 1SLTA 3OJBA 1LGNA 2W08A 4PBOA 1CIWA 3WHTA 1W6NB 2HYKA 1H9PA 1CQ9A 2JECA 3RMYA 1V6LA 3GALA 4YZ1A 3UK9A 1GLHA 1QGLA 2ARXA 3B01A 4DFSA 1WD4A 1GZ9A 1MS1A 4FP3A 4LBNA 2WSVA 1AXYA 1GNHA 1DQ1A 3AP4A 5E8AA 2ZGMA 3VUOA 4TZDA 3WUDA 1SBDA 4XHBA 2YXSA 1N1VA 2DWRA 1SCSA 5JDBA 1FV2A 3IM0A 1F9KA 1OQ1A 3USUB 3ZXJA 4XZPA 3WG2A 3NV3A 4YLZA 4JCKA 4XBLA 5CB7A 4RL7A 2P37A 4M3CE 3ZXFA 4YM3A 1MS5A 2CWSA 2ENRA 2GMPA 2NM1A 3MW2A 2DURA 5FRAA 2NZ9A 1GNZA 4PQ9A 3RSJA 1IS3A 2GNBA 4ATFA 1NXD1 1SLLA 1LOGA 3FLTA 2VW2A 3WG4A 3AP5A 1UX6A 3AZWA 3FFZA 3AZXA 1MZ5A 1LJ7A 3AZVA 3ILRA 3ZYRA 1HDKA 1DGLA
chains in the Genus database with same CATH superfamily
5F8PA 3WEZA 4YVSC 1NY72 4D94A 4BK4A 1CZSA 4XOGA 1EAH3 4MXWB 2DCTA 1GZWB 1LRHA 5FZKA 3S5QA 2PQSA 4NWWA 2QFEA 4PI2A 3KHBA 4R4ZA 2D7FA 1C3HA 5CFCA 4SBVA 1PIV3 2X10A 2FDJA 1W6MB 5G04L 3SEPA 2Z2SB 1BHGA 3G6JB 3H1MA 1HXS3 1GV9A 4LMFA 4OHXA 3N7JA 3WG3A 4YARA 3H8UA 1SLBA 4LO7A 1JS9A 4CE8A 1PO23 1JUIA 2YROA 4H7MA 1N1YA 5FY8A 1WW7A 3ENRA 3ZOIA 1NQDA 3NAPC 4OULA 2RM22 3LD8A 1STMA 2GNTA 4CCCA 4JHTA 3VKLA 3BCWA 5DAWA 5CKNA 2PHXA 2W1UA 4DY5A 1T2XA 2MEV2 4WVWA 1W2NA 4QDRA 3MIHA 1JYNA 4Y26A 2VU9A 4L8QA 1SLIA 3ZXKA 2DTYA 4UYBA 3SH5A 4DS0A 1EP0A 1RMU2 3CHXA 4XJZA 4CDWC 3CBNA 3WDTA 3B7MA 2P2KA 1UMZA 5T52A 4BQXA 5A6ZA 2Y6LA 3ACHA 4YVWC 5D8AB 4L11A 1SPPB 3VBSC 5D2AA 1WUVA 5FK8A 1YCIA 1XNAA 3WNXA 3LEMA 5SV5A 3WF3A 4N90A 4YWAA 4FFIA 3K2OA 3WD5A 2XONA 1AF9A 3M3CA 4XDPA 5LASA 4CDQA 1PVC1 2Y60A 3POFA 5FMCA 1MEC1 4ZZ8A 1ZZ6A 1MS3A 1YYNA 4JC1A 4QGMA 2Y8KA 4LTAA 1W9WA 1VB4A 5IVJA 4C0BA 1W6PB 3KHCA 1V9U3 4IUGA 2W9XA 3GJAA 4CCLA 1A78A 1IKPA 2G19A 1IGOA 1OVSA 3MIBA 1S0JA 1YXWA 3VBHB 5J96B 5JSRA 1AR81 2FZ2A 2F17A 1Q43A 2Y26A 3VV1A 4Q4W2 5C9AA 4H55A 3H0OA 3ZKUA 1S2KA 1LHOA 2QQKA 1RUE1 2XVGA 3EQEA 3IBMA 1GMMA 4WM7A 2GH8A 4AG4A 3CMGA 4LITA 1W9YA 1MVEA 3LA7A 4MLOA 2DFBA 3RWKX 3UETA 4QB2A 4LK7A 3W21A 2BVVA 1OI6A 5FZBA 3WY6A 3VZLA 4XPVA 5KR7A 4IV1C 4BJ0A 1SDDB 4PIYA 1NQJA 3PLQA 4QU1A 5A1LA 1FOD2 1JYVA 5C5TA 5HXVA 3BIEA 2JIGA 2ZEWA 3TN92 2PFWA 2R30A 4LO6B 4M01A 4Q29A 5H9QA 3I8TA 3FZ3A 4CP0A 3WOGA 1C4RA 1DQ0A 3OPZA 3ETPA 1JH5A 1S0FA 4WM8B 1H1MA 2IVJA 3QH7A 1RHI2 2BWCA 3HPNA 2ZTNA 3WNOA 4CYDA 1RVF2 1A8DA 5LZ6A 2ZX1A 2C1FA 4B4PA 1SBEA 3ATGA 5A80A 1VBB3 3TNQA 4Q4Y3 4OI0A 5B4NA 4B3NA 4GIQA 4RQPC 4HT1T 4CTEA 1W8FA 2R1BA 2VNOA 2Q8EA 4CXYA 1S2BA 4L2NA 1KQRA 1W2TA 4QX0A 3PU8A 4QQ2A 4YG3A 3N4MA 1B35C 1LAJA 2WT2A 4MADA 2YMZA 1DZRA 2AH2A 2Q1FA 4G3YC 2RS32 3BGAA 3H1YA 2DUPA 3JBG2 3OBTA 4QXCA 5FZ3A 3ITQA 4AFBA 1S0CA 2VZ3A 4K40A 5A7WB 3O14A 4Q4V1 4LHSA 3K4ZA 4JKKA 1YRZA 1U12A 1YFYA 2P6HA 1EYBA 4GALA 1WLWA 4HVOA 5LATA 3T0AA 2HWD3 4RHV2 4RR3A 4AHZA 4ZZ5A 4FOYA 1W28A 3MW3A 1J58A 2W1SA 4CEYB 1A34A 1UZVA 2DCYA 1PMJX 2D6KA 3INAA 3K48A 4GWMA 2VUDA 1Z7S1 1ULEA 3RVHA 4GMP3 3T30A 4BQ2A 1GWKA 2SLIA 1QOOA 1YC61 4GB33 1OUXA 4J1XA 5F6LB 4GH4A 4KNCA 5K9YA 1QXJA 3ME2A 2WQ8A 3ASIA 2GALA 1QH6A 1QF3A 2WYSA 3ORJA 1YHFA 4N43B 4AFMA 3C7OA 3NAPA 3U14A 3AFGA 1RUG2 5I0UA 4CU9A 2BGPA 5CKQA 5JIUA 3OEAA 1LHWA 3NJXA 4FPCA 3VBOB 5I0SA 3DECA 3FLPA 4M00A 5FZ1A 1CJPA 2RVAA 4GWJA 4XFHA 1ZBE1 2QTWB 5EYXA 4ZU4A 4AEDC 4GMP0 5IK4A 5L7OA 1FMD2 1VLNA 2WLPA 5LBBA 2RS13 3POIA 4CDWA 1VBE2 2BWAA 1CPMA 1N3OA 1H1IA 3AK0A 1W8WA 3IZOA 1OT5A 1QJX3 2PHWA 3POWA 3T1MA 1EAH2 4IERA 1F5JA 4OHVA 2EIBA 2PN5A 4FBFA 1QDCA 2VCBA 3VKMA 1PGL2 1PIV2 2C9AA 4QPWA 4UXAA 1URXA 2KR2A 4QKNA 2HWB3 4D7TA 3C3VA 5IFTA 1UU5A 4HKLA 4LBQA 4LJHA 4BCUA 2FBEA 1PO22 4DXTA 1W9SA 2Y0IA 1H2LA 1J59A 4PIZA 4NIIA 4XILA 2DUOA 3O1OA 1OQEA 1WCQA 4A41A 2UWCA 1V70A 4P5HA 5FYUA 3RYRA 1N1SA 1MACA 3UJQA 5LA1A 2OIIA 4DPNA 3CDZB 1VBA1 3E6CC 3CEWA 5JXIA 1GZCA 5FBZA 4CP9B 3WLUA 1DQ4A 3ELNA 4Q1RA 1KFUL 2WT1A 3C7FA 1HN0A 3MI8A 3O12A 1G9AA 4TLGA 2IVIB 1KDKA 5ERLA 5J09A 1VMFA 3KWVA 4AW7A 2UURA 1X82A 2Y64A 4IGPA 1LODA 1PZ8A 1OMIA 2WA4A 2ZS6B 4BMEA 2VBPA 1O91A 3BN6A 2XLAA 3ILFA 5JXJA 1XQNA 2GH2A 1ODMA 1IQDC 1GOGA 3SLIA 3LPFA 3I4IA 1NE4A 1AR83 1OXCA 2ZEZA 3QACA 4L97A 1GWMA 1V9U2 3BYWA 4QX8A 4IESA 4LLFA 1WCSA 3HQRA 2EF6A 1WW5A 5ABJB 3OOXA 4RQPA 3MO4A 3SCGA 1WMEA 1YLLA 1RUE3 4LUKA 4BPZA 4UAPA 2WO7A 4DQAA 4HPKB 1SG3A 4XIOA 1B35A 1AX1A 3P1IA 3V65A 4N7IA 1CONA 2EXHA 4CU7A 3ZSJA 4GZ9A 1HB1A 1DYPA 3NWKA 3UGGA 3O0VA 1OQDA 5C3PA 4MSVA 4PDWA 4MH0E 5L36A 1UL9A 2IXCA 4AXOA 3WXPA 4XJ8A 4JVAA 2B9VA 1FXZA 5GLVA 1SMVA 3FHIB 3BODA 1SHWB 4LA2A 4Q27A 1UAIA 5BNOC 3KCCA 4NE9A 1JN2P 1GP4A 1OURA 2RJKA 2IXLA 3U07A 2VCMA 4LBLA 1FATA 2D3SA 1H8TB 4ZPIA 3L2YA 1O4TA 2VZUA 4KG0A 2WBKA 3UESA 1EV11 1FI2A 5ISLA 2XH6A 1ULOA 4UFJA 5LB6A 5FDBA 3BU0A 2WNOA 5CA6A 4I30A 5IWFA 3VZKA 2EXKA 1OA2A 4D8MA 5I8TA 2WQ4A 5DZFA 4ASLA 1I3HA 1QJY1 1H2KA 1DLCA 3DYOA 1VBB2 4CUAA 1Q5OA 2G9ZA 1PGW1 1GICA 2OUHA 4BQ4A 1PX3A 1WCKA 1OOPC 5CNAA 2ZOEB 2RMU3 4XFGA 2RR11 3PURA 3LFMA 4Q4V3 4XCBA 1TEIA 4M0NA 1IG3A 5A3NA 3MHZA 5JLVA 1LHUA 3O0WA 1UCXA 2O1QA 1ND2B 2HKXA 4LHNA 5C4WC 3K51A 4MOAA 3P6BA 4IE4A 4CEWC 3LEGA 1J1TA 1IPJA 2K0GA 2JB8A 2XHKA 4QPIB 5K4LA 1W6NA 1Z7S3 2WL1A 5FYHA 3A23A 5FKCA 1QIQA 1LB2A 4XJUA 1HN1A 2EVXA 3ON7A 3F95A 5DUUA 3MICA 2VMCA 2VMFA 3CJIA 3MLKA 4UW3A 3ZSMA 2XJTA 1RITA 2JG8B 2C4XA 2E7QA 2WWJA 2YGLA 4LO5B 3ACIA 5FZ7A 3WCSA 5A7SA 1CZVA 3O5SA 4GB32 4RGKA 4YNIA 3ZDSA 3ZN4A 3VD9A 4ZHNA 5I8SA 4A2UA 1NKGA 2CGPA 3OF1A 5H9RA 2JDMA 4IE6A 2LUWA 2JG9B 3R4DB 1ZRRA 3ZSEA 1OA3A 1V6IA 3I2GA 3LDBA 4MHUA 4XTMA 1JOPA 1XJAA 3JCIA 4LXLA 4MGQA 1C5HA 1DQ5A 3P3NA 4LBMA 4I0AA 2CGOA 2ZGRA 4AEKA 2UYBA 3N7MA 4N8MA 4HSLA 4OLLA 2RS12 4Y20A 2WA3A 2ZX3A 1VAKA 1OLME 3E5UA 3IMNA 4W4ZA 4QXBA 1QNYA 4AGVA 3P3PA 1MS0A 4P5YA 4Y5Z0 5C5UA 3RZJA 2XR4A 1OD3A 2ADEA 3ZFGC 1L7LA 3EMRA 1XBFA 4JDNA 4AVCA 2QQVA 3AKTA 4BOWA 5GKAC 3T2PA 4A7ZA 2AACA 3ETQA 5FTTC 1JZ6A 1QJX2 3DYMA 4DNYA 3AMQA 5CYYA 2X09A 1K3IA 2PAMA 2XPJA 3S30A 4JTOA 1PGSA 1DGWX 2AEYA 2ZEXA 1CGPA 2E7TA 2AEZA 2P5BA 2QBXA 4HZFA 5I0DA 3A22A 1N3PA 1ULPA 2HWB2 2H0VA 1VIWB 4GQ7A 3OGGA 2OPWA 4CXXA 4LE3A 5IUQA 2R061 5JOZA 1PNFA 2G4IA 3VHNA 4P9JA 5DAVA 1J83A 1ZA4A 1L7QA 3KM5A 4G9SB 3VL8A 4Z1VA 1R091 1VBA3 4Y4YA 4LT5A 5IK8A 3IPVB 2EXJA 3ZMOA 3VDCA 2IUWA 2YC0A 1AJOA 3AX4A 2LS6A 4IETA 1OC1A 1XYPA 1HV1A 3L2HA 3OGVA 1AJKA 1F4AA 3AM2A 1PZ7A 3H1WA 1T6GC 3I2DA 4GWNA 4L9BA 1NCQC 1UNBA 3OTFA 4P9WA 4OHYA 2R0HA 1REFA 5FUNA 5GLTA 2D5FA 1GFF2 3OUJA 4Q4X1 5BNOA 5D8AA 3RS6A 3WF0A 4D6QA 1F4HA 2DUQA 4UBGA 2C5DA 3GGLA 3O1PA 1Y7BA 1QWRA 1QJU1 2ZZJA 3T0BA 3VBFB 2B4KA 3M2MA 2OA2A 1LGBA 2K2SA 1MZEA 1YFUA 2JDZA 3MV11 5FZGA 1TZOA 3T08A 3I2IA 1W9TA 3Q8FA 5FO7B 4IGOA 1PMHX 4JGYB 3VD3A 3WDUA 3U4XA 2J1UA 3C2UA 2A6ZA 1VJ2A 3FLRA 1CN1A 1YQ8A 2HBUA 3ZXGA 4UFIA 4F83A 1AYN1 1WA4A 2BRTA 4XE9A 1BMV2 4CZSA 5IVEA 4ZY9A 2C6SA 1T6BX 1D7PM 2JWPA 2QDRA 3I3EA 3FC0A 1SLTA 1COV1 1RUE2 1ALYA 1QQP3 1LGNA 5HI0A 3HEIA 1RUJ1 3LIGA 3WW4A 2DFCA 4CU6A 3USSA 1QGLA 2BFUS 1K42A 1YEWA 2V5DA 2XQRA 1MS1A 2Z79A 1UYYA 2W87A 4LBNA 1GNHA 2RDNA 4UF0A 1DQ1A 2WNVB 5C4WA 4CEWA 4TXWA 1W2OA 4LKFA 5FYSA 3WUDA 4NWVA 5HCHA 1TME1 3PJYA 1RGSA 5JDBA 1Y9GA 1EV13 5FBJA 1YFXA 3RYPA 2O14A 1W90A 3RZMA 3MGUA 2YB7A 4N53C 5LBFA 3SKJE 4E4DX 3WG2A 4ES9A 2Y6JA 3LEKA 4S2FA 2BOJA 4XBLA 5A3TA 3WW1A 1UZWA 3ZXFA 5BNPC 1MS5A 5G05L 1XNDA 2WZR1 1QJY3 1VRBA 5FLJA 2NZ9A 1GNZA 2Y33A 4WM8A 1VBD1 4ATFA 3SCHA 3FLTA 5FYBA 3I2KA 1RUH2 5FZDA 1UX6A 3AZWA 3FN9A 3FFZA 3NKGA 4NAOA 4G4FA 2BGOA 3AZVA 3H7JA 3KT7A 1NA1C 3GCXA 3RZLA 1BEV1 3AKRA 1FNYA 1HX6A 5F39A 3E6BA 2W39A 4COWA 4XQWA 3WF1A 4BQYA 5BY5A 4EN6B 2QQUA 2A71A 1EUUA 4BQ5A 3K4AA 4YM0A 5AVPA 3OPTA 2BUKA 2RMU2 4Q4V2 4IEQA 2PMWB 2QQPA 3HNMA 3PUQA 1US2A 2VGDA 2WFF1 2XBO1 5FY0A 2ES3A 3TEWA 5T3NA 3ZVXA 3USUA 1CX4A 4EN8B 5C7GA 1XYNA 4OHWA 1OKQA 2VXRA 3AP7A 1D4M1 2BNNA 5A7WA 3ZFGA 5A70A 3MUY1 3FBMA 4MO3M 1Y3TA 2VTFA 5ANNA 1KRIA 4IV3B 3KMHA 1TMF3 1Z7S2 2ZABA 2VQ0A 5FYYA 5BNNB 1GYKA 3OUIA 3FFQA 2VUAA 2VW1A 5J3UA 3PU3A 1XC6A 4GKYA 4C1WA 1GQGA 5CFCC 1LU2A 3OD4A 4NPRA 2XUMA 1OH4A 4IXLA 2NQYA 5FXXA 3DKWA 4OQ9A 3WQBA 1A6CA 4A7KA 3WQ7A 3AC0A 3K75B 3V0BB 4B1LA 1UU6A 2W1WA 4N43A 3SHRA 2WFPA 1FX5A 2D6OX 3HVDA 1XE7A 3M4FA 1AXZA 2BYVE 1JYXA 5KXBA 1NLQA 1UO9A 2EAKA 3D5OA 1X8MA 2XKPA 5FYCA 1OUSA 3JU9A 1RUF3 1NLSA 1JZ5A 1OLMA 5EPAA 1V6OA 4HKWA 5KHJA 4P02B 3RMXA 4LE4A 2QQOA 3OB8A 2QE3A 1LGCA 2XDVA 3TEYA 4BE3A 5ACA2 4FPYA 1CAWA 1LOFA 5EZWA 3GZAA 4GAZA 3SC7X 1O5LA 3CL1A 1W0PA 5B2GB 2Q4SA 5KHHA 1IZ3A 1HIXA 2ZKNA 3BOWA 3LWCA 3MW4A 3N35A 3U75A 1O59A 2W68A 3DKQA 3IB3A 2FD8A 2KXLA 1W2AX 2R063 1BBT3 4IE0A 1I9RA 5CAZA 3GF6A 2JDPA 4C91A 5J48A 1DQ6A 1GU3A 3AKQA 3SXWA 2ORZA 3I49A 1NX9A 2R6QA 1K5JA 3IIAA 4QPGB 2RHPA 1RJ7A 1R093 5F6KA 5FY5A 4BK5A 5LW9A 4PJYA 4JRAA 3IDEA 4DUWA 4B7KA 4AFCA 1VBA2 4Q8KA 2Q0AA 1POQA 1BYHA 2J1SA 1LULA 3FUOA 2VNVA 3B9IA 2WNUA 3PNAA 4KH9A 1UY1A 5EXOA 4AWDA 5HBAA 4HN1A 3LSDA 4NHXA 1TE1B 4Q4X3 5CIRA 4AVTA 1JU3A 4QQLA 1RUOA 1GBGA 2VMIA 4Z92B 4JGZB 1IS5A 2LRPA 3JQXA 5FO9B 3ZYFA 5JOXA 2QVSB 2O8QA 1JW6A 1OD5A 2ZACA 3ZLIA 4EYUA 5JWPA 2YPDA 2XOMA 4N53A 1DLLA 1YQCA 3OY8A 3VBUB 2PHFA 3KV6A 5BNPA 3NMBA 3PDQA 5FMBA 5E89A 1AYN3 4W6XA 5FP3A 1HJFA 4XCAA 3MF6A 1YQ5A 4Q1PA 1W3XA 4AI0A 1COV3 5JAXA 1X8EA 4RS5B 2BEOA 1NA1A 3WT3A 5C8WA 4CDXC 5HCFA 1SZBA 4QB6A 1H2MA 2B46X 4AFAA 1QQP2 4HN0A 3HMYA 4OHZA 3UV9A 3CLPA 2VY0A 3WNNA 1G9BA 1JHNA 3M3EA 4X6QB 4AI1A 5L73A 1LNSA 2Y6FA 4O65A 1W6OB 5K0UB 4FQ4A 1CAXB 2IWGB 1HRV1 2F6BA 2A7AA 3LFIA 5GZDA 1S55A 4CUGA 5L9VA 1I1EA 4A44A 3ZXEA 4K20A 1CAVA 4XACA 1K5MC 3EHKA 4B8EA 2PLV1 2ZBJA 4WVMA 2BZDA 3I3BA 4CU8A 1HB3A 1A3KA 1EV12 1VP6A 3VBRB 4YRDA 2JD4A 3RPQA 2WZR3 4RR3C 4D0QA 1VRH1 1G8WA 1SFPA 1VBD3 1H8TA 1IQAA 4CCJA 2XL9A 2ZGSA 4YGEA 4HKOA 2AZ5A 2JE8A 4PF5A 5FAXA 4XJWA 2DF7A 2ZGUA 1QJY2 1PK6B 5FV3A 3QLQA 1BEV3 3I59B 5HPOA 4GH4C 4ISQA 4FAHA 1PGW2 3MYXA 5IVCA 2HEVF 1W8ZA 1W0NA 2Y38A 4LUMA 2FCVA 3J8F1 4QWNA 1ZRIA 3SH4A 1IHMA 1XU1A 3GBGA 3JXSA 5HXMA 5K8SA 4QQOA 1VAVA 2WFF3 2X5IC 2ZXQA 5FZOB 2XBO3 2YBSA 3HN1A 3O1RA 1AL0G 2A3WA 4NHKA 4OVEA 4PI0A 4K7JA 4QM8A 4CA9A 3ZN6B 2XUEA 1ENRA 2VMDA 5L7OC 4O61A 2OQ7A 5LCWL 5DAPA 4BLIA 5EHDA 1LOAA 1J1LA 4EWDA 2Q30A 1ND2A 5AC92 4AI3A 2NPIA 1W8HA 2WAOA 4M3CF 2DTWA 4NRQA 5T50A 4QPIA 2BU9A 1EPWA 1LESA 1TMF2 5FLIA 3G7DA 5TSWA 3U1XA 3ZIXA 4E8CA 2Q1ZB 3IAQA 3J7NA 2LM3A 1FV3A 1PO13 2F4PA 4HK9A 5LBEA 5T54A 1J3RA 2JKBA 2BDRA 2JG8A 3V0AA 4E8DA 4BMBA 2ETEA 5LWBA 1GKBA 2B8MA 2HWF1 3TYJA 4YW5A 1V6KA 4FP2A 4UOJA 1RIRA 4BB3A 4P14A 4FAGA 3FUQA 3EXUA 3VD5A 1BQPA 1PZ9A 2NN8A 2Y0OA 5A7PA 4D7YA 2FQPA 4E2GA 1NZCA 4IEUA 4Y3OA 1MZ6A 1F15A 4OMCA 1ASJ2 4AEJA 1FT9A 4Y1ZA 1RUF2 3VKNA 1JODA 1UYXA 2IFWA 2CYFA 4HOOA 1S2EA 5JR2A 3ZXDA 1LCLA 1RXFA 1SBFA 2TEPA 4PHZA 3TEZA 1Y9MA 3PUHA 1OBNA 2D5HA 2R041 2CY6A 1UY4A 1V6JA 2EIEA 4MHRA 3UT0A 3WW2A 5J7MA 2JDNA 2ZEYA 2HJIA 5FZMA 3THPA 4A3XA 1Z0HA 2WINB 3PMEA 4LIUA 1JXNA 5FYVA 5F9TA 2XJQA 2E9QA 2ZGKA 3VHOA 4KQ7A 4I3GA 3NNMA 4Q5OA 1H4GA 5CG8A 2R071 1MZFA 2VXJA 1BBT2 4D7SA 4DEVA 1YO8A 4JHZA 1RUC1 3U4SA 4BA6A 1SQ4A 4ZONA 3AXEA 4QKFA 4YW6A 1RC6A 2Q5TA 4K21A 4R9CA 4CDXA 1R092 4CUBA 4B1MA 1OF4A 4Y1XA 3AL6A 3ZYHA 2RV9A 4Y22A 3WX5A 3NW4A 3KGZA 4AVBA 2WC2A 3BIWE 4V2VA 1NYWA 2B7YA 4CVUA 3QD6A 4AL9A 2WR9A 1ODNA 2A6WA 4XFCA 5KHIA 4LA3A 2VG9A 3VKOA 2V73A 1SEFA 5FY9A 1S0GA 3WG1A 1K5MA 5FWJA 3K77A 1MR5A 1N1TA 2JENA 3H3UA 4PDWC 4PCRA 2PA7A 2VMGA 1SACA 1J3QA 3KS7A 2D43A 3KF3A 3VBFA 5GLZA 2V09A 1S0DA 3OGRA 1JZ8A 2W47A 3GZUC 5CU1A 1AYN2 2GC1A 2IXKA 2VZTA 3DL3A 3NSTA 4I0BA 2JEMA 4W6WA 2QDNA 4O9GA 5JIAA 5A3UA 5IHRA 2QQMA 1COV2 3UKNA 2GU9A 3AKPA 4BIFA 1AVBA 5GLUA 4A45A 2ARBA 2BBAA 2IC1A 2UYAA 1MS9A 4IEPA 3WHUA 5CFDB 2X5IA 5SV8A 1UZYA 1HRV3 3NQHA 1X33A 5A1FA 5DPNA 5LY1A 2V4VA 2A6VA 3C8XA 2BFUL 3T0DA 1NCRC 3AMHA 2ZMLA 5C3QA 2C0ZA 1UIKA 4YG0A 4AYUA 4J1WA 3DPRC 4LNVA 4M4RA 4R9BA 3PJQA 1UZZA 1AR92 1Q56A 3ROUA 3HWJA 3M8LA 4K6BA 1VRH3 1XXNA 2VE1A 4KWJA 3T2TA 2WIIB 3NRUA 4R4XA 3MFCA 2VUCA 4LOTA 2GP3A 4E2QA 3BTZA 2WZR2 3Q8EA 3O1TA 3NKTA 2NP0A 5JZGC 3IDBB 3JD71 4FPEA 1VBD2 4XAEA 1C1FA 1ND3B 1DFQA 1DQ2A 3CJIC 5DDJ1 4WZCA 2VECA 1JZ2A 3S0MA 5A7QA 5IT6A 5GJ6A 1HXS2 3J8F3 4DRVA 1DGRN 1JOJA 2ZGLA 3KV9A 3AYAA 4F3JA 1W9FA 3WP6A 3EO6A 4M0HA 3WDWA 4AHXA 3LE0A 2ZCWA 5E88A 3WINE 4CCMA 5FQ0A 3I2JA 1QKQA 1REDA 4C8DA 2WFF2 5C3SA 3UGHA 5J1XA 2ZA9A 1RUNA 2VO5A 5KBFA 2E32A 1KDMA 1W6QA 2OPKA 2CDOA 2GZWA 2YDEA 3K3OA 2YG0A 4FT8A 3T3YA 3ZFFB 3SITA 4QPYA 4LO4B 1KXGA 4AI9A 2RE9A 3DN7A 3IT8A 3LAGA 5FUIA 5BPXA 3S7IA 5IYYA 4CDUB 1KS5A 4QKDA 2V5YA 2YZ4A 4MGYE 3TEXA 2VZOA 1PVC3 4HSJA 4QAWA 3OD0A 1MEC3 1GANA 3IN9A 3A7QA 3U78A 2ZX2A 4A6SA 2HWF3 4RN5A 1KD7A 2CTVA 2DDUA 1PO12 1O3SA 5FYZA 3AMPA 3LQCA 1OHFA 2OXBA 2ZKLA 1R1A1 4NROA 2GN7A 1GSLA 2W91A 2ID4A 3A4UA 5A33A 3VB9A 2WABA 3ECQA 4Q0UA 3KLSA 1C5IA 1EUTA 2IXIA 4P08A 2W95A 1IG0A 1WBLA 4UW6A 3VDDB 3IKWA 4LBQD 1RL3A 1AR71 1XE0A 1HB4A 1MS4A 3IWZA 1UWWA 2P3YA 3OGSA 4YW4A 5IJRA 3SEEA 1JZ3A 3OYWA 4EZ4A 4HBNA 5CG9A 3AZYA 2YV8A 1LHVA 2NLRA 1C28A 2E31A 3POJA 4JQRA 4COYA 4LO8A 4CUCA 2R043 4EWEA 5JSPA 1QJZA 1ZX5A 3W59A 1AR61 3T1LA 4DRRA 4XIKA 2A3XA 4HMZA 4BQWA 3HT1A 3POYA 3VDBA 2AYHA 4AZZA 2DVDA 5FREA 4GJZA 5D8AC 2FDGA 3NV4A 1W2UA 4P9GA 2R073 3APBA 1G86A 5FPVA 1JBCA 4BXSV 2JKXA 4BQ3A 1F35A 1ZBA1 1RUC3 1GQHA 2HWC1 2ZJCA 3OJBA 2W08A 4R52A 5C8CB 5F1RA 5F3CA 5FZEA 1CIWA 4DUXA 1M4WA 2HYKA 2XGXA 3WR0A 2JECA 3RI8A 3RMYA 1V6LA 3WQ0A 3UK9A 5F32A 2DBIA 4QHBA 4OUMA 5FCCA 2VVFA 5FOJB 3B5LB 4TWTA 3OCPA 3AP4A 2ZGMA 4E4ZA 4Q4Y2 1E5IA 1SBDA 2FMYA 4F8AA 5C33A 1ZRDA 1N1VA 2GP5A 4IEOA 3VBHC 2W5FA 4LHLA 1FV2A 5IFPA 2EIDA 3RNSA 1NY71 5F5AA 3RYKA 1NCRA 3T4VA 3ZXJA 3Q8BA 5C3OA 3GHMA 3E5XA 2X05A 1CD3G 3DPRA 3KF5A 3NV3A 4DB5A 1CZTA 2FDFA 4B29A 4RL7A 4I0WB 2P37A 3HNBM 3QH6A 4PIXA 2ENRA 2CWSA 4QD2A 2XLGA 4JGZA 4S2GA 4A4AA 1HJGA 1WMFA 2NM1A 2W94A 1LR5A 3MW2A 5FRAA 3VD4A 3KB5A 4B7EA 2QQIA 3DEMA 4QGNA 3AL5A 2DBNA 1K12A 1HB2A 1LOGA 4AQSA 2HWD2 3WG4A 3AP5A 2KD7A 5FXWA 3KD4A 4LORA 1MZ5A 4RGAA 3VBUA 3ZPOA 1DGLA 1O3RA 4KWUA 2RM21 5IVFA 4MGZE 3RGBA 3PVNA 5F5IA 1NE6A 1WZXA 4XXPA 1Q8VA 1UMHA 4WM8C 1UU4A 5BV6A 1TNRA 5FOBB 4TN7A 1GP6A 4NOTA 1ZBE3 3HN3A 1W8TA 5FZ6A 3ZFEB 3BVCA 1RMU1 5JXHA 1VMJA 1D0HA 5EJZB 4YM1A 2VBBA 4KBBA 4QM9A 2JD9A 4WZFA 1DU3D 4EROA 4O7XA 2VZSA 5E1RA 4CDQB 2Y6HA 3O1UA 5T5OA 5K0UA 3AVRA 2EAAA 3MIFA 4UT5A 5EJ1B 3BB6A 5EQUA 5J37A 1WGPA 5FPUA 1YJLA 2F4LA 5FKBA 4PT6A 1E5HA 1XSQA 4NRPA 1VRH2 3JD73 2AR6A 3D6EA 2YPJA 2ZAHA 4GD4A 4OZXA 2D3RA 3CIHA 4MXWA 2L9LA 1GZWA 4YGBA 3MLJA 3MLLA 4XFAA 5DG2A 4CEYC 2VMHA 3PUSA 3CO2A 1XE8A 4E2SA 4P9YA 1AX2A 1UYPA 3QCWA 1W6MA 2UWAA 4WM7B 4LIVA 1WA6X 3J8F2 4Q4W1 3H42B 4XZUG 2ET7A 1JYTA 4QHZA 1YIFA 3MF9A 1LECA 1O6UA 4KU7A 1C8M1 4N43C 1DDLA 2D3PA 5IVYA 5K7PA 3FHAA 1KEXA 1O4YA 3NVCA 4QDSA 4XEZA 5DAQA 3VBOC 1UOJA 4OYUA 3GBWA 5KHKA 1FOD1 1UZ0A 4NAMA 1W39A 1MQTB 2Q8CA 3TN91 4YPJA 5KXEA 1UN1A 1PM4A 1UOFA 1WW4A 2WSUA 1WMDA 1VBC1 2D6LX 2XVLA 2ZHMA 2DU1A 3S7EA 4A7YA 4YM3A 5A3MA 1PVC2 1SPPA 1MEC2 4I01A 2XXZA 1S1AA 1LOFC 1QNWA 2A70A 2VULA 5FLHA 2HWF2 4FOWA 1PX4A 2B5HA 4ONUA 4DXRA 4JTNA 3BUCA 2XL7A 5T5JA 5EFUA 1YQ2A 1QOTA 2MHFA 4XXAA 2A1XA 2XG3A 3ZXLA 2HWE1 5LEKA 3N9PA 1BCXA 2DV9A 1AR73 1AR82 1U0AA 1W6PA 4FXKB 3SH3A 4YVSB 4XVHA 2KA3A 1DCSA 2QQLA 2WRAA 3LKJA 3POBA 1G7YA 3E6DA 2RS31 3U0ZA 3JBG1 3VBHA 2XKOA 1C1LA 3KT4A 4H7LA 5FZ4A 2JJ6A 3DV8A 3IMMA 4LKSA 1AR63 4N9IA 1QU0A 3KVBA 1F31A 2K46A 4NIGA 3E5QA 4LKEA 1O8PA 2WNUC 2CDPA 4HK8A 3HBZA 2R042 3O0XA 4WBBA 5LEJA 1QH7A 1O3TA 2HH9A 1DG6A 5IVVA 3S5AA 4AQ2A 5KC5A 3NAPB 5KC6A 1G9DA 3AMMA 3MIEA 1ZBA3 2P4EA 4RFT0 4M3CB 3UNPA 3N9NA 5FMOS 2R072 1DHKB 3CKHA 1JZ4A 3EYPA 1S4CA 3RZZA 3WSOA 1RUC2 4FTSA 1BVP1 2N7GA 3UYJA 4W50A 2YHJA 2GC2A 4CDWB 1AHSA 2QKDA 3M1HA 4QDQA 1UPSA 3RG0A 2R49A 4YVWB 1OSGA 1FMD1 4BYYA 1QHDA 5IW0A 2CWMA 3DUIA 1LOEA 3VBSB 4YZ2A 2RR13 4XHXA 1NAEA 3BI3A 5ABJC 4EV0A 2TUNA 1JU4A 2A6YA 2P3JA 3DCQA 1ZZBA 4NJ4A 2TNFA 1X9PA 3KT1A 4XFFA 5GZGA 5F5CA 1R64A 3GDBA 3KCXA 3PVEA 2E7AA 4ZXKA 1HQLA 4QHOA 1QOSA 4N9HA 4I09A 1B09A 4LKDA 4XUPA 2D98A 3Q8CA 3AP9A 1HV0A 3HAGA 4KWKA 3ZDVA 4BH9A 2G9GA 1IS4A 4GWIA 2RM23 4PF1A 3O1VA 3W58A 2GAUA 4IEZA 5FJHA 2E33A 4CEYA 1O7FA 5FP7A 2WLQA 2EIGA 5BYNA 1BK1A 1H8TC 4OUSA 5CISA 2FZ1A 5A3OA 1YI9A 3CQOA 5GZEA 4YW7A 1TNFA 4FFFA 1E57A 4LLOA 4OI2A 3VN4A 1ZVFA 5FPBA 1ACCA 4YZ5A 4IV1B 3K46A 1LENA 4S2DA 5L9BA 3OSDA 1ZBE2 5B4XA 5CFDA 4Q0QA 3BOPA 5I91A 3ACFA 4V1PA 3VBOA 2ZGPA 2BERA 2LTNA 4FOVA 2LALA 1H9WA 1S0IA 2QNKA 3IDCB 2GNDA 5C3RA 1WKYA 3WP3A 1SCRA 2VVEA 2XJSA 5M0TA 3ZO0B 3W9AA 2BOIA 4XJAA 3LIHA 5H9SA 1ST8A 2WJSA 1DP0A 2WWSA 4RGGA 3WDXA 2LW8A 1XB9A 5EIYB 3BPZA 4YGDA 1ND2C 2NMNA 3FMGA 2JB4A 3JD72 2VC9A 4AFDA 4RQPB 2JDYA 4OCTA 3K3NA 4FVVA 2H6CA 4JKMA 4QPIC 4YW2A 5LA2A 1H0BA 3VHRA 4L92A 5DUVA 1W8OA 3WVJA 3RRDA 1B35B 2WQZC 1D2SA 3AYDA 4ITCA 4Q4W3 4DMIA 3LCPA 4QQHA 1V6NA 2CL2A 2Y34A 4X8NA 1C8M3 1W99A 3C7HA 3DXUA 5JMCA 2JG8C 1PVXA 5KHGA 3NNFA 2XWBB 5CADA 3AZZA 3ALQA 3WDVA 4NR1A 4D3WA 2LROA 4OQ8A 4E4SA 5LA0A 4JAAA 3OBRA 4META 4UW4A 2JG9C 3I2FA 4AVAA 1POV1 1AYM1 2PAKA 1YIPA 4HFSA 1AX0A 2G9FA 3TN93 2I45A 3LSEA 1CJDA 2KM2A 3ZXAC 2JE9A 5APAA 2ZX0A 1F2NA 4YFWA 3R4SA 1SFNA 1VBC3 1RB8G 1NT0A 3GNEA 3AYCA 4H2AA 2VJXA 1QJU3 3C7EA 2QZ2A 5FK7A 4CP9A 5BUVA 3PIGA 2H6BA 5JPMB 4MGSA 3ZKYA 4CDUA 3O1MA 4JDOA 4AI2A 4FPHA 2IZWA 2UWBA 4CCNA 1NOVA 1RUD1 2HWE3 3RQ0A 2UU8A 3T09A 4DUVA 4AEDB 3NL1A 4FCAA 5KWRA 4XUQA 3ILNA 1NLRA 4HETA 3MZHA 1JYCA 2VCCA 3HNYM 4NIHA 1KGYA 3PTRB 4PBPA 4AI8A 3UJOA 5CKMA 1DZQA 4K8FA 4UFKA 3RZKA 1XPWA 3I2OA 4QKBA 2X53S 1ZZCA 3I3MA 2DCJA 1RUJ3 4OMDA 3I3DA 4UWDA 1C57A 3POEA 4N7UA 1VMHA 4K1ZA 3GCWA 3QOPA 3JUUA 5ABJA 4BU2A 1ZM1A 2XHNA 5GZCA 1Y9QA 5JI9A 1JTZX 5BNQA 4DXZA 4URAA 5A1AA 4QT6A 4D69A 4Y24A 4HPKA 1ZA7A 1W8NA 1AR62 4BDVB 3BALA 3VZMA 2SBAA 1V00A 5HCAA 1GZTA 5FMDA 3H9AA 4AF9A 4FPOB 4LULA 3MFAA 1TME3 1OH3A 4LHKA 1GOFA 4P9XA 3N36A 2AREA 4KBZA 1JYWA 2AC1A 4EN7B 4WVVA 4C90A 5JSOA 2ZMKA 1QDOA 1RUI1 1V0AA 1BZWA 1C8NA 1KJLA 2W52A 2VZQA 2Z42A 4XUOA 4UFHA 5F37A 1YQ6A 2OKXA 4XUNA 4LBKA 4XF1A 2VNRA 2DVAA 3VBFC 2V72A 3L9JT 3RDIA 3ZYGA 2PELA 1U5XA 1FMD3 4FPGA 5LK5A 3WCRA 4XBNA 4Y20B 2QQNA 5JVVA 1OLRA 3LGRA 1D2QA 1H8VA 4AQTA 1W05A 4JGYC 2BW8A 4C1XA 4IEXA 1PHMA 2VTXA 2Q8DA 2RS11 4AVVA 5FYIA 3OGJA 4TYSA 4TLFA 2RR12 1AXKA 1YFWA 1O4ZA 3SCFA 5FY1A 1BXHA 2DVGA 3GM8A 1L3JA 4CSWA 3SQOA 1HQNA 1ULDA 2ZHNA 5HCBA 1D4M3 2WS91 3LA3A 1UPIA 4ZU5A 3R0RA 5HV4A 2A5ZA 2QJVA 1QJX1 3HQXA 1QEXA 5A6YA 4FQZA 2W0XA 3SKVA 3N7KA 5JZGB 5FUPA 3OG2A 5T55A 3WNPA 2J1AA 3B3QE 3VGIA 4A6OA 3H7YA 1HRI1 2WNVC 3HOBA 4QX3A 3WV6A 4YG6A 2I74A 4PLNA 4Q0VA 2ZZQA 4MG2A 1DYKA 2GSYA 3AVSA 5D1IA 2D6MA 3TNPB 3Q9OA 2HWB1 1WW6A 2VMEA 3LDKA 1DYOA 3KVAA 4IEYA 3JB8A 1AUYA 2RDRA 4UBHA 4J25A 4EWAA 3OPWA 5FP9A 1OFSA 2ORXA 1Q8SA 2PYTA 5A32B 2VR4A 2YBPA 3QBQA 3ZN5A 4DO0A 5JCTA 1KFXL 5DG1A 3N7LA 1S0EA 1U5YA 2P1BA 1OVPA 2XVKA 5DUWA 1ZZ7A 3R6SA 2JG9A 3AB0A 3KV4A 4ET7A 5BNOB 4YZ4A 1I6XA 2D44A 2WAAA 4INDA 1UD1A 4JDMA 3ZFEA 1LHNA 5IVBA 3FE5A 2JICA 2VQAA 4QMAA 2I2SA 2VZVA 3KQRA 5DZEA 2BP6A 3TWIA 4ES8A 2VVDA 5FXZA 1NZIA 5C6CA 5DAXA 2X8KA 4RFRB 5DABA 1XNTA 5IAVA 2YYOA 2WKKA 5LY2A 5F3EA 3OUHA 1O8SA 4R8HA 2P3IA 1M06G 3LA2A 3RI9A 2PHTA 5FJKA 1WLTA 4AHYA 4IW3A 4AGRA 2YGMA 4COUA 1OF3A 3B9CA 4IV3C 3TB0A 3H8RA 3I3QA 1OOPB 2EXIA 2XQXA 3WF2A 1BMV1 4QQPA 4K3UA 2PHRA 3VZJA 1FPN1 3N9MA 2W1QA 1V6MA 2CSGA 1C8M2 1RXGA 2R062 3F2ZA 1GQPA 3LOIA 3R4UA 4UF0B 5C4WB 1ZNPA 4CEWB 1POV3 1AYM3 5EWSA 3THDA 4H3WA 2HLEA 4COVA 2E6VA 3W20A 3H3ZA 1LU1A 4HVRA 3J7MA 1RTVA 2DVBA 4XURA 2W46A 5E16A 4GJYA 3KQ4B 1KS4A 3FL7A 3I97A 4Y1UA 2OW4A 5AFEA 2D93A 5JOWA 2E51A 4XJ9A 2BNMA 2B39A 3IPVA 1Q8OA 4HONA 1RYYA 3VL9A 1QXRA 5A6QA 1VBC2 2HEWF 3ZSKA 4Q4X2 2PXJA 1MQTA 1RJ8A 2Z5WA 1POV0 2BPA2 4I02A 5FPZA 3ZYIB 5C9AC 1RUD3 5F7UA 1CQ9A 1H6XA 1QJU2 2PQQA 3GALA 5D21A 5DMYA 3EJKA 4PLOA 1GLHA 3VD7A 1ZREA 4AAXA 3B01A 3D0JA 1WD4A 1GZ9A 2YUEA 4OZOA 2VL4A 4FP3A 4NMIA 4UFLA 4DFSA 2J1VA 1AXYA 2HWE2 4JKLA 4IDZA 1RUH1 1UIJA 5E8AA 2UY9A 3VUOA 4TZDA 2ATFA 2DWRA 4YYOA 1VB2A 3IM0A 3J7HA 2VTXJ 4ZS2A 4JGYA 4EZHA 1JI6A 3USUB 1F8VA 4FFGA 3ZFGB 5IATA 3TBDA 5A7NA 1RUJ2 2RMU1 4UFMA 4YLZA 2BV4A 3H3LA 3OBAA 4YVSA 5CEHA 4D6RA 1UW8A 4QPGC 5A3LA 1U5IA 4QXHA 4X6RB 2WN3A 2OZ6A 2XJRA 5LRSA 1X9TA 1XRUA 1D4VB 3PMSA 4PQ9A 3IDAA 3GBFA 5FPLA 3RSJA 1IS3A 1OA4A 4M4PA 3TRSB 4AQ6A 1SLLA 5L19A 2VW2A 4NIDA 3MUZ1 2FCUA 2W92A 4QX7A 2PLV3 3AZXA 3PHMA 2CAUA 3HIFA 1RUI3 3ILRA 3NO8A 1TME2 3ZYRA 3CZJA 1HDKA 2VM9A 2P34A 4XUTA 1QXPA 5FPAA 2WNVA 5A7OA 4O9EA 2OT7A 3MPPG 4GKXA 4Z07A 1H4HA 2ERFA 1UMIA 1HLCA 2HEYF 3ABZA 2VW0A 4JGZC 2YBKA 3ZYPA 1F5FA 1AZDA 4IE5A 5FZ9A 4M3CA 2VZRA 4EN0A 3DF0A 3O1SA 4AEMA 5FMOL 5LRRA 1R081 2OQ6A 2VBDA 3VBUC 4DY3A 4K8RB 1NCQB 3HD8B 1VAMA 2RG4A 2AUYA 2ARCA 3M3OA 1BEV2 4XDOA 1AL21 1GUIA 1Y4WA 2D97A 4MX3A 2J42A 4YVWA 1EY2A 3VBSA 4XFIA 1LOCA 2IXJA 4XBQA 1CAWB 2WS93 4RS5C 3AMNA 1YJKA 2BQPA 2PTMA 2RJ2A 1RINA 3MV01 2RS51 2XBO2 3GYDA 1CESA 5ACA1 4IEWA 4W65A 4ZKTB 1D4M2 1HRI3 2A73B 3POGA 4NN0A 5FZ8A 3N9QA 4GXLA 2R1DA 4KGGA 2WZPP 2QQJA 4COZA 5A6XA 4NHMA 3LEIA 5K0UC 2VD7A 3FWEA 4Z2WA 2A3YA 3HQUA 3WUCA 1FAYA 2VZ1A 3GXUA 1PNGA 1W06A 2CNAA 3UKVA 4A42A 4CCKA 1DF0A 2K9ZA 2X29A 1BK0A 4Q26A 4IV3A 3KSCA 5F3IA 2CU5A 4BLJA 3RFRA 5EP9A 3BKZA 5F2SA 1LOBA 5FZHA 2CGNA 3VBRC 4QX1A 4Y4RA 3BU7A 3RZGA 2WNUB 2YFUA 4ISRA 5E6HA 3FBYA 4TTGA 3TOJA 5DN2A 1XNCA 4YW3A 3V0BA 1PK6C 5DQ0A 4B4QA 5KXDA 1IKQA 4IV1A 3U37A 4QX2A 4R9AA 1X7NA 2ZAAA 5DUXA 4LEJA 4IE7A 1REEA 4NHYA 1IOAA 3ACLA 4N53B 4DEQA 2NYYA 3DYPA 3OY8B 1CX1A 1CAUB 1IS6A 1DBNA 3M7AA 3POSA 5BNPB 1I5PA 1E5SA 3FX3A 2XWJB 3D0SA 4NIAA 3GHNA 2ZGTA 2RDQA 3WF4A 2W2IA 1O5UA 1R1ZA 3CJXA 1UOGA 4TSVA 4NPMA 3AXDA 4FO9A 1FYUA 1NA1B 1KITA 4QGLA 3RJRA 2DU0A 3ZYJB 4IL7A 1FPN3 1APNA 5CBLA 3ST7A 5T5PA 1KJRA 1UF2C 3LPGA 1OKOA 2E26A 2J1TA 3D4KA 3MIGA 4WV8A 4BXFA 4FPKA 4K1YA 2JDHA 2VQTA 3P5BA 1QQP1 2NMOA 4KGQA 4FPLA 4MVTA 3EB7A 1J84A 5IK5A 2FDKA 1OFNA 2OVUA 1X50A 2HBTA 3SMHA 1CAVB 1AYM2 1QY4A 1S0BA 3AKSA 4QPGA 5A3WA 3EBRA 3X29B 2WYFA 2JDKA 4WVMB 4YM2A 3PUIA 1YI7A 1UYZA 1HW5A 3JB4C 3M3QA 5FO8B 2VAUA 1I5ZA 2UY8A 3I2HA 4L0PA 3D82A 4DZGA 1JHJA 5CFCB 4U2AA 3DXTA 2JE7A 3VZOA 1SFYA 3NNGA 4XABA 5FZAA 3I7DA 2P3KA 4XTPA 5FFOC 4V2WA 1HKDA 1Q8PA 1WLCA 4Y5SA 4MGIE 3PVOA 2GDFA 2JX9A 1RUD2 4Z82A 1NXMA 1W0OA 1RUH3 3OEBA 5FXVA 1XU2A 2ZHLA 4AR2A 4NO4A 4YFZA 1JOBA 2OS2A 1XYOA 1LEMA 2PHUA 5ANQA 2A75A 2WDBA 3B69A 2WO2A 4KI5M 4EN9B 4ATEA 3V64A 4CPBA 2QCSB 4AEDA 3PL0A 4JQTA 1CPNA 4IGQA 4PQQA 2MPFA 3A21A 3CNAA 4MXVA 2MEV1 1H2NA 2WWUA 4HANA 5I0RA 5FZLA 1BLZA 1Z78A 1EPZA 1N3QA 1QMJA 1IPKA 2E63A 2WN2A 4RS5A 5AFBA 2ZGQA 1GR3A 3SNMA 4AAPA 1W8UA 1QJEA 1H6YA 1UXZA 1HQWA 1HRV2 5AC91 3BTXA 1UQXA 2JXAA 4ASMB 3NJYA 1L7RA 2PLV2 1BJQA 1W6OA 1TMF1 3E97A 4D6SA 1RUI2 4MGKE 4EQVA 3V0AB 1CAXA 2EALA 5FP4A 5JI7A 3UGFA 2IXHA 3UKTA 1D0GA 4XF9A 4FSJA 4I3PA 2FCTA 5FWEA 5JPNB 3LB9A 4DINB 1R083 3BPSA 1CWPA 2E53A 3HR9A 4Q8LA 5DDJ3 1X36A 2V4AA 2Q8OA 3VBRA 5J98B 2IFRA 2YC2A 2ILMA 3W5NA 4CP2A 5C9AB 2EA7A 3VHPA 1UXXX 2I07B 1AL23 4KG8A 2Y6KA 3ZMNA 1WBFA 3S57A 3D8CA 3ZYBA 4CPBD 1JMUB 3B93A 4Z8BA 2VZPA 1PK6A 2XJVA 3C7GA 4HLTA 4XETA 5GZFA 2BNOA 3I59A 3JZVA 1ASJ1 4FOQA 1RUF1 4UW5A 3RJ2X 2RS53 2BVBA 1WWYA 1WD3A 4ZU7A 5ACA3 5C71A 1ZZ8A 3I54A 5CZKA 2GMEA 2WS92 1G6NA 1TG7A 2FHRA 3VKFC 1A8MA 5L9RA 5CFDC 4NRMA 3J9SA 3IAPA 4AVSA 4DOUA 5FZOA 3W5MA 4UI9L 3VZNA 1G9FA 1VR3A 2XJPA 2JDUA 3UL2A 1HRI2 2GC3A 1LKNA 2XJUA 4XMAA 2D6NA 4FI9A 5EJ3A 5FY7A 3WP4A 3ZN6A 4BHPA 2ZHKA 4P9LA 2HYXA 3NJVA 4W6YA 3A0KA 3N9OA 5JZGA 2ZPXA 3ZSLA 1WCUA 2RDSA 2VOXA 4CDXB 4JV4A 4JRLA 1N47A 4SLIA 1G9CA 2R32A 5EV7A 1BBT1 4Y22B 5FR3A 2ZGOA 2VH9A 1MS8A 4H14A 1RHI1 1MVQA 1XNKA 2JDAA 1MPXA 1R1A3 5H9PA 3MDPA 1RVF1 1TVGA 2O8OA 4LR4A 3LF7A 4Y1YA 4CCOA 1YWKA 1ND3C 4CXWA 5A32A 1K5MB 1XOYA 3U11A 1GWLA 3AP6A 5FYTA 2CV6A 4XW3A 3WZ1A 1O3QA 2PAEA 4XDQA 1IPSA 4J6GA 4XFBA 3ZR6A 4FPFA 4RR3B 3K4DA 4RSUA 1JZ7A 3NJZA 3PUAA 5FP8A 4XF0A 1K45A 4CCDA 2YU1A 3E1F1 4NUBA 1JUHA 1ULCA 1W3VA 1YUDA 1PMIA 2J1RA 3MPBA 4RHV1 3SISA 5A3PA 4URTA 3KV5A 2OZJA 5FZCA 3THCA 4GH4B 4DIQA 3J26N 5FYMA 4LBJA 3WDYA 2TBVA 2WZ8A 3TAYA 2VCAA 1CR7A 2Y6GA 3ZFFC 1BKZA 4B4RA 1UKRA 2BGCA 5F3GA 4FTBA 2HWC3 2C26A 3LDRA 5CVRA 2PHLA 4YGCA 1ONAA 1FPN2 4QB1A 3VDAA 4CDUC 2WO3A 2X5IB 3B00A 3JQWA 3WQ1A 4AOCA 4BM8A 5DZGA 3J4UH 2ET1A 4E9KA 1OOPA 1RUG1 1JYIA 1E5RA 2YY1A 4AHWA 2WZEA 2ZGNA 4YW1A 5L7OB 3H8OA 4RA0A 2FMDA 2ZMNA 1XSRA 4CRQA 2CAVA 2YC4A 3NNLA 2EICA 4FFHA 3PTYA 2O0OA 3WNMA 2J7MA 4XC9A 3ZX7A 4QU2A 5FPXA 5T5LA 3J7LA 3NV2A 5LK7B 2JIJA 4FXGB 3BTAA 3FJSA 4LK6A 5C70A 3AYEA 1Y43B 3Q8AA 4MV2A 4XQ4A 3LOBA 4Z2AA 1VBE1 1J3PA 5J36A 3VLBB 3H8XA 4YZ3A 1UX7A 3R05A 2W3JA 4ORFA 3GZEA 1ZZ9A 4XAAA 2J22A 3VDDC 3CZUA 1CIYA 1AR91 1VALA 5BNNC 4IEVA 4EE2A 3CU7A 4MUVA 3PIJA 5LA9A 1UKGA 3ES1A 1EAH1 3IIIA 4ARYA 2FDIA 4BIOA 2BBVA 3LZZA 3AJYA 5GLWA 3V56A 4CP1A 4MYEA 3ZIWA 3ES4A 1ULGA 4LBQB 3ZR5A 3M3IA 1PIV1 4ZXEA 5AVAA 1PGL1 1XNBA 2WUHA 4BISA 1UY3A 1HXS1 2DCKA 3A0NA 2XB6C 1ENXA 2MNGA 2Q1MA 5FY4A 5FQ0B 2QUOA 1ENSA 1W03A 2VUJA 1FNZA 1WCDJ 1SDWA 2MEV3 1PO21 5HV0A 1P8JA 5KXCA 1NUKA 1SLCA 3B94A 1UOBA 1H30A 1W6QB 4LPLA 4P9IA 1OLQA 5C8CC 4QX5A 2OX0A 5EYYA 4KMQA 1RMU3 2AENA 3N9LA 2WNEA 2GMMA 5IK7A 4RYDA 1H1AA 5AC93 4W8JA 1UY2A 4QXKA 4R9DA 4BQ1A 3MEPA 3NV1A 1SLAA 4HVQA 1Q8QA 4E27A 4I2OA 2R16A 3O7OA 4JZRA 5I93A 2BTVC 2BJSA 4MGTA 5F5QA 3FHQA 2AGSA 4Y33A 2ZX4A 4U36A 1GOHA 3OBZA 4BWOA 1ENQA 3S6PA 3THTA 5A33B 4XF3A 4AGGA 5JXGA 2WT0A 1PO11 4F7ZA 4AE2A 4ARXA 3GZTB 1R082 4OI4A 2YU2A 1YNAA 3D3AA 1WMXA 5DDJ2 5JUVA 2B45X 3MBWA 2OUJA 1V9U1 2WO1A 3N3HA 3OYWB 5FZ0A 3HT2A 4JX0A 3T2OA 1AL22 1ASJ3 1ND3A 2A6XA 2P17A 5I0TA 2YFZA 1VPHA 3RZHA 3MIDA 2Z69A 5I8YA 4GA9A 1NCQA 4NVPA 2FDHA 3GJBA 1LEDA 2C9KA 1BVVA 4PDWB 4DXSA 2QQWA 1DGRA 4FTEA 3KCYA 3KGLA 4KL1A 2RS52 3AJZA 3ZM8A 2Z4FA 1GNYA 3M70A 3RWNA 1DZTA 1FOD3 3WNKA 3ZFEC 1VE0A 3NNJA 4RD7A 3DGTA 4OUEA 4Q2FA 4XYXA 2R0FA 4XMIA 4XQDA 3ZPYA 2H0BA 4ASKA 2ARAA 4S2HA 1CVNA 5FIXA 4YSFA 3PVBB 4HG6B 1QJFA 4LBOA 4CDQC 3BTYA 1Q3EA 1RHI3 2VPVA 1ZYBA 3ZFFA 2VOVA 1DIWA 2DYCA 1ZRCA 1RVF3 2XLFA 2D6PA 2D40A 2DVFA 4FPJA 5FZIA 2G1MA 2B42B 1DGWA 1GP5A 1R1A2 4K9SA 2QZ3A 4OI1A 1WLDA 5GM0A 4P00B 4Q0SA 2J1EA 1NCRB 1VBB1 5FZFA 4Q4Y1 2GNMA 5JOYA 4Y1VA 1ULFA 3AFKA 4WVZA 3DPRB 3T4HB 2RS33 4IQPA 1LTEA 4HL0A 3JBG3 4WM7C 5DXDA 5GALA 1AR72 2GN3A 5BXXA 2B9UA 4MZUA 4OFGA 5IAXA 4PBOA 3VDDA 2DCZA 3WHTA 3URFA 2P6CA 1W6NB 2VOKA 1H9PA 4Q0PA 1US3A 4RHV3 1TQ5A 2ADDA 4XF4A 2VOTA 4PLMA 5F2WA 1W04A 2OYZA 4YZ1A 5BNNA 4L99A 2ARXA 1CAUA 4X8PA 4GULA 3CJIB 1OPMA 4LOSA 1ZRFA 1NG0A 2WSVA 3KZ4C 3T2QA 2XMLA 2HWD1 4EJRA 2CHHA 3B02A 3ACGA 4CCEA 3CF6E 4XHBA 2GC0A 2YXSA 1MQTC 1SCSA 4AK3A 3U10A 2RJLA 4GMP1 1RUG3 1F9KA 2R7EB 1OQ1A 1ZBA2 4NHLA 4A3ZA 2HWC2 4GB31 3H50A 2PHDA 4XZPA 4KWLA 4JCKA 4ZS3A 5LBCA 5CB7A 3HBKA 4M3CE 1UY0A 2VQUA 4Y5TA 4LQRA 2GMPA 2DURA 1U5ZA 2VNGA 5C8CA 4BZ4A 2GNBA 3HJRA 1OPOA 1NXD1 3WW3A 3WP5A 2VOWA 1VBE3 4E4HA 1PM7A 4NPLA 5JR7B 4C0HA 2C24A 5JMOA 4KU8A 1LJ7A 3WNLA 4HXCA 1AR93
chains in the Genus database with same CATH topology
4YVSC 1NY72 4D94A 4XOGA 1EAH3 4MXWB 2DCTA 1GZWB 1LRHA 4NWWA 2QFEA 4R4ZA 2D7FA 1C3HA 5CFCA 4SBVA 1PIV3 1W6MB 2Z2SB 3G6JB 3H1MA 1HXS3 1GV9A 4OHXA 3N7JA 3WG3A 4YARA 3H8UA 1SLBA 4LO7A 1PO23 1JUIA 2YROA 4H7MA 1N1YA 1WW7A 3ENRA 1NQDA 3NAPC 4OULA 2RM22 2GNTA 3VKLA 3BCWA 2PHXA 4DY5A 2MEV2 4WVWA 3MIHA 4Y26A 2VU9A 4L8QA 1SLIA 3ZXKA 2DTYA 3SH5A 4DS0A 1EP0A 1RMU2 4XJZA 4CDWC 3WDTA 3B7MA 2P2KA 1UMZA 5T52A 4YVWC 5D8AB 4L11A 3VBSC 1WUVA 1YCIA 3WNXA 5SV5A 4N90A 3WD5A 1AF9A 3M3CA 4CDQA 1PVC1 1MEC1 1ZZ6A 1MS3A 1YYNA 4JC1A 4QGMA 4LTAA 1VB4A 4C0BA 1W6PB 1V9U3 1A78A 1IKPA 1IGOA 3MIBA 1S0JA 1YXWA 3VBHB 5J96B 5JSRA 1AR81 2FZ2A 2Y26A 1Q43A 3VV1A 4Q4W2 5C9AA 4H55A 3H0OA 1S2KA 1LHOA 2XVGA 1RUE1 3EQEA 4AG4A 3IBMA 4WM7A 2GH8A 1MVEA 3LA7A 4MLOA 2DFBA 2BVVA 1OI6A 3WY6A 3VZLA 4XPVA 4IV1C 4PIYA 1NQJA 3PLQA 1FOD2 5HXVA 3TN92 2PFWA 2R30A 4LO6B 4M01A 4Q29A 5H9QA 3I8TA 3FZ3A 4CP0A 3WOGA 1C4RA 1DQ0A 3OPZA 1JH5A 1S0FA 4WM8B 1H1MA 3QH7A 1RHI2 2BWCA 2ZTNA 4CYDA 1RVF2 1A8DA 2ZX1A 2C1FA 4B4PA 1SBEA 3ATGA 1VBB3 3TNQA 4Q4Y3 4OI0A 4B3NA 4GIQA 4RQPC 4HT1T 4CTEA 2R1BA 2VNOA 1S2BA 4L2NA 1KQRA 4QQ2A 4YG3A 3N4MA 1B35C 2WT2A 2YMZA 1DZRA 2AH2A 4G3YC 2RS32 3H1YA 3OBTA 2DUPA 3JBG2 4AFBA 1S0CA 4K40A 3O14A 4Q4V1 1YRZA 1U12A 1YFYA 4GALA 1EYBA 4AHZA 1WLWA 4HVOA 5IK7A 2HWD3 4RHV2 4RR3A 4FOYA 3MW3A 1J58A 4CEYB 2DCYA 3INAA 2D6KA 3K48A 4GWMA 1Z7S1 1ULEA 4GMP3 2SLIA 1QOOA 4GB33 4J1XA 5F6LB 5K9YA 4GH4A 4KNCA 1QXJA 3ME2A 3ASIA 2GALA 1QH6A 1QF3A 4N43B 1YHFA 4AFMA 3NAPA 3AFGA 1RUG2 5I0UA 5JIUA 1LHWA 4FPCA 3VBOB 5I0SA 3FLPA 4M00A 1CJPA 4ZU4A 4XFHA 5EYXA 1ZBE1 5IK4A 4AEDC 4GMP0 5L7OA 1FMD2 1VLNA 2WLPA 2RS13 4CDWA 1VBE2 2BWAA 1CPMA 1N3OA 1H1IA 3AK0A 1QJX3 2PHWA 3POWA 3T1MA 1EAH2 4IERA 1F5JA 4OHVA 2PN5A 4FBFA 1QDCA 3VKMA 1PGL2 1PIV2 2C9AA 4UXAA 1URXA 2HWB3 4D7TA 3C3VA 1UU5A 4HKLA 4LBQA 4BCUA 2FBEA 1PO22 2Y0IA 1H2LA 1J59A 4PIZA 4XILA 2DUOA 1OQEA 2UWCA 1V70A 4P5HA 3RYRA 1N1SA 1MACA 3UJQA 2OIIA 4DPNA 1VBA1 3E6CC 3CEWA 1GZCA 5FBZA 3WLUA 1DQ4A 3ELNA 4Q1RA 1KFUL 2WT1A 3MI8A 3O12A 1G9AA 1KDKA 5J09A 4AW7A 2UURA 1X82A 1LODA 1PZ8A 1OMIA 2WA4A 2ZS6B 4BMEA 1O91A 3ILFA 2XLAA 1XQNA 2GH2A 3SLIA 3I4IA 1NE4A 1AR83 5JZGC 3QACA 4L97A 1V9U2 4IESA 4LLFA 1WCSA 2EF6A 1WW5A 5ABJB 4RQPA 3SCGA 1WMEA 1YLLA 1RUE3 4LUKA 4BPZA 4HPKB 4XIOA 1B35A 1AX1A 3V65A 4N7IA 1CONA 2EXHA 3ZSJA 1DYPA 3NWKA 3O0VA 1OQDA 4MSVA 4PDWA 4MH0E 5L36A 1UL9A 2IXCA 4AXOA 3WXPA 4XJ8A 4JVAA 1FXZA 5GLVA 1SMVA 3FHIB 3BODA 4LA2A 4Q27A 1UAIA 5BNOC 3KCCA 1JN2P 3U07A 2RJKA 2IXLA 4LBLA 1FATA 2D3SA 1H8TB 3L2YA 1O4TA 4KG0A 1EV11 1FI2A 2XH6A 5FDBA 5CA6A 4I30A 3VZKA 2EXKA 1OA2A 5I8TA 2WQ4A 5DZFA 4ASLA 1I3HA 1QJY1 1H2KA 1VBB2 1Q5OA 1PGW1 1GICA 2OUHA 1WCKA 1OOPC 5CNAA 2ZOEB 2RMU3 4XFGA 2RR11 4Q4V3 1TEIA 4M0NA 1LHUA 3O0WA 1UCXA 2O1QA 1ND2B 2HKXA 4LHNA 5C4WC 3K51A 4CEWC 1J1TA 1IPJA 2K0GA 2XHKA 4QPIB 1W6NA 1Z7S3 2WL1A 1LB2A 4XJUA 2EVXA 5DUUA 3MICA 3CJIA 3MLKA 4UW3A 3ZSMA 2XJTA 1RITA 2JG8B 2E7QA 2YGLA 4LO5B 3WCSA 4GB32 3O5SA 4YNIA 3ZDSA 3ZN4A 2CGPA 5I8SA 4A2UA 3OF1A 5H9RA 2LUWA 2JG9B 3R4DB 1ZRRA 3ZSEA 1OA3A 1V6IA 4XTMA 3JCIA 1C5HA 1DQ5A 3P3NA 4LBMA 4I0AA 2CGOA 2ZGRA 4AEKA 2UYBA 3N7MA 4HSLA 4OLLA 2RS12 4Y20A 2WA3A 2ZX3A 1VAKA 3E5UA 3IMNA 1QNYA 4AGVA 3P3PA 1MS0A 4Y5Z0 3ZFGC 4BOWA 4JDNA 4AVCA 3AKTA 5GKAC 4A7ZA 3ETQA 5FTTC 1QJX2 4DNYA 3AMQA 2PAMA 2XPJA 3S30A 4JTOA 1PGSA 1DGWX 1CGPA 2E7TA 4HZFA 1N3PA 2HWB2 2H0VA 1VIWB 4GQ7A 3OGGA 5JOZA 4LE3A 5IUQA 2R061 1PNFA 2G4IA 3VHNA 4P9JA 1ZA4A 3KM5A 4G9SB 4LT5A 3VL8A 4Z1VA 1R091 1VBA3 4Y4YA 5IK8A 3IPVB 2EXJA 3ZMOA 2YC0A 1AJOA 3AX4A 4IETA 3L2HA 1XYPA 1HV1A 1AJKA 3AM2A 1PZ7A 3H1WA 1T6GC 3I2DA 4GWNA 4L9BA 1NCQC 4P9WA 3OTFA 4OHYA 2R0HA 1REFA 5GLTA 2D5FA 1GFF2 4Q4X1 5BNOA 5D8AA 3RS6A 2DUQA 4UBGA 2C5DA 1Y7BA 1QWRA 1QJU1 2ZZJA 3VBFB 3M2MA 2OA2A 2K2SA 1LGBA 1MZEA 1YFUA 2JDZA 5FO7B 4JGYB 3WDUA 3U4XA 3C2UA 2A6ZA 1VJ2A 3FLRA 1CN1A 3ZXGA 4F83A 1AYN1 1WA4A 4XE9A 1BMV2 4CZSA 2QDRA 3FC0A 1SLTA 1COV1 1RUE2 1ALYA 1QQP3 1LGNA 5HI0A 1RUJ1 3WW4A 2DFCA 3USSA 1QGLA 2BFUS 1MS1A 2Z79A 4LBNA 1GNHA 5C4WA 1DQ1A 2WNVB 4CEWA 3WUDA 4NWVA 1TME1 3PJYA 1RGSA 5JDBA 1EV13 1YFXA 3RYPA 3MGUA 4N53C 4E4DX 3WG2A 4ES9A 4S2FA 4XBLA 3WW1A 3ZXFA 5BNPC 1MS5A 2WZR1 1XNDA 1QJY3 5FLJA 2NZ9A 1GNZA 4WM8A 1VBD1 4ATFA 3SCHA 3FLTA 1RUH2 1UX6A 3AZWA 3FFZA 3NKGA 4G4FA 3AZVA 3H7JA 3KT7A 1NA1C 1BEV1 3AKRA 1FNYA 1HX6A 4COWA 3E6BA 2W39A 5BY5A 4XQWA 4EN6B 2A71A 4YM0A 5AVPA 2BUKA 2RMU2 4Q4V2 4IEQA 2QQPA 2VGDA 2WFF1 2XBO1 2ES3A 5T3NA 3ZVXA 3USUA 1CX4A 4EN8B 1XYNA 4OHWA 1OKQA 2VXRA 3AP7A 1D4M1 2BNNA 3ZFGA 3FBMA 1Y3TA 1KRIA 4IV3B 3KMHA 1TMF3 1Z7S2 2ZABA 2VQ0A 1GYKA 3FFQA 2VUAA 2VW1A 5J3UA 4GKYA 4C1WA 1GQGA 5CFCC 1LU2A 3OD4A 4NPRA 2XUMA 4IXLA 2NQYA 3DKWA 1A6CA 4A7KA 3WQ7A 3V0BB 1UU6A 4N43A 3SHRA 2WFPA 1FX5A 2D6OX 3M4FA 1XE7A 1AXZA 2BYVE 5KXBA 2EAKA 3D5OA 1X8MA 2XKPA 3JU9A 1RUF3 1NLSA 1V6OA 4HKWA 5KHJA 3RMXA 4LE4A 2QE3A 1LGCA 4BE3A 5ACA2 4FPYA 1CAWA 1LOFA 5EZWA 3GZAA 1O5LA 3CL1A 1W0PA 5B2GB 2Q4SA 5KHHA 1IZ3A 1HIXA 2ZKNA 3BOWA 3LWCA 3MW4A 3N35A 2W68A 2KXLA 2R063 1BBT3 1I9RA 5CAZA 3GF6A 4C91A 5J48A 1DQ6A 3AKQA 3SXWA 2R6QA 3IIAA 5F6KA 4QPGB 2RHPA 1RJ7A 1R093 4PJYA 4JRAA 3IDEA 4B7KA 4AFCA 1VBA2 4Q8KA 2Q0AA 1BYHA 3FUOA 1LULA 3PNAA 3ZYGA 3B9IA 2WNUA 4KH9A 5EXOA 4AWDA 5C9AC 5HBAA 4HN1A 3LSDA 4Q4X3 1TE1B 5CIRA 4AVTA 4QQLA 1RUOA 1GBGA 2VMIA 4Z92B 4JGZB 1IS5A 3JQXA 5FO9B 5JOXA 2QVSB 2O8QA 1JW6A 1OD5A 2ZACA 5JWPA 4N53A 1DLLA 3OY8A 3VBUB 2PHFA 5BNPA 5E89A 1AYN3 4W6XA 3MF6A 4Q1PA 4AI0A 1COV3 5JAXA 1X8EA 4RS5B 2BEOA 1NA1A 3WT3A 5C8WA 4CDXC 5HCFA 1H2MA 2B46X 4AFAA 1QQP2 4HN0A 3HMYA 4OHZA 3UV9A 3CLPA 2VY0A 1G9BA 1JHNA 3M3EA 4X6QB 4AI1A 5L73A 1W6OB 5K0UB 4FQ4A 1CAXB 2IWGB 1HRV1 2F6BA 2A7AA 5GZDA 1S55A 1I1EA 3ZXEA 4K20A 1CAVA 1K5MC 3EHKA 4B8EA 2PLV1 2ZBJA 4WVMA 1A3KA 1EV12 1VP6A 3VBRB 4YRDA 2JD4A 3RPQA 2WZR3 4RR3C 1VRH1 1G8WA 1VBD3 1H8TA 1IQAA 2XL9A 2ZGSA 4YGEA 4HKOA 2AZ5A 4PF5A 5FAXA 4XJWA 2DF7A 2ZGUA 1QJY2 1PK6B 3QLQA 1BEV3 3I59B 4GH4C 4ISQA 4FAHA 1PGW2 3MYXA 2HEVF 2Y38A 4LUMA 3J8F1 3SH4A 1IHMA 1XU1A 3GBGA 5K8SA 4QQOA 1VAVA 2WFF3 2X5IC 2XBO3 3HN1A 1AL0G 2A3WA 4NHKA 4OVEA 4K7JA 4QM8A 3ZN6B 1ENRA 5L7OC 4BLIA 1LOAA 1J1LA 4EWDA 2Q30A 1ND2A 5AC92 4AI3A 2NPIA 4M3CF 2DTWA 5T50A 4QPIA 5TSWA 1EPWA 1LESA 1TMF2 5FLIA 3G7DA 3ZIXA 2Q1ZB 2LM3A 1FV3A 1PO13 2F4PA 4HK9A 5T54A 1J3RA 2JKBA 2JG8A 3V0AA 4BMBA 2ETEA 1GKBA 2B8MA 2HWF1 3TYJA 4YW5A 1V6KA 4FP2A 1RIRA 4P14A 4FAGA 3FUQA 3EXUA 1BQPA 1PZ9A 2NN8A 2Y0OA 4D7YA 2FQPA 4E2GA 1NZCA 4IEUA 1MZ6A 4AEJA 1ASJ2 1FT9A 4Y1ZA 1RUF2 3VKNA 2IFWA 2CYFA 3ZXDA 1LCLA 1SBFA 2TEPA 2D5HA 2R041 2CY6A 1V6JA 3WW2A 5J7MA 2HJIA 3THPA 4A3XA 1Z0HA 2WINB 3PMEA 1JXNA 5F9TA 2XJQA 2E9QA 2ZGKA 3VHOA 4KQ7A 4I3GA 5CG8A 1H4GA 2R071 1MZFA 1BBT2 4D7SA 1YO8A 1RUC1 4BA6A 1SQ4A 3AXEA 4CDXA 1RC6A 2Q5TA 4K21A 4R9CA 1R092 4Y1XA 4Y22A 3WX5A 3NW4A 3KGZA 4AVBA 2WC2A 3BIWE 1NYWA 2B7YA 3QD6A 2A6WA 4XFCA 5KHIA 4LA3A 2VG9A 3VKOA 2V73A 1SEFA 1S0GA 3WG1A 1K5MA 1MR5A 1N1TA 2JENA 3H3UA 4PDWC 4PCRA 2PA7A 2VMGA 1SACA 1J3QA 3KS7A 2D43A 3VBFA 5GLZA 2V09A 1S0DA 5CU1A 3GZUC 1AYN2 2GC1A 2IXKA 3NSTA 3DL3A 4I0BA 4W6WA 2JEMA 5JIAA 2QDNA 4O9GA 1COV2 3UKNA 2GU9A 3AKPA 4BIFA 1AVBA 5GLUA 2ARBA 4IEPA 2IC1A 2UYAA 1MS9A 3WHUA 5CFDB 2X5IA 5SV8A 1UZYA 1HRV3 1X33A 2A6VA 2BFUL 1NCRC 3AMHA 2ZMLA 2C0ZA 1UIKA 4YG0A 4AYUA 4J1WA 3DPRC 4LNVA 4R9BA 3PJQA 1UZZA 1AR92 1Q56A 3ROUA 3HWJA 3M8LA 4K6BA 1VRH3 1XXNA 4KWJA 3T2TA 2WIIB 4R4XA 3MFCA 4E2QA 2WZR2 3NKTA 2NP0A 3IDBB 3JD71 4FPEA 1VBD2 1C1FA 1ND3B 1DFQA 1DQ2A 3CJIC 5DDJ1 4WZCA 2VECA 3S0MA 5IT6A 5GJ6A 1HXS2 3J8F3 4DRVA 1DGRN 1JOJA 2ZGLA 3AYAA 4F3JA 3WP6A 3EO6A 4M0HA 3WDWA 4AHXA 2ZCWA 5E88A 3WINE 5FQ0A 1QKQA 1REDA 2WFF2 2ZA9A 1RUNA 5KBFA 1KDMA 1W6QA 2OPKA 2GZWA 2YDEA 4FT8A 3ZFFB 3SITA 4QPYA 4LO4B 1KXGA 2RE9A