2BR2A

Rnase ph core of the archaeal exosome
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title The Archaeal Exosome Core is a Hexameric Ring Structure with Three Catalytic Subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 79
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2br2A01
5C0XF 2WNRB 5C0XA 3DD6A 5K36C 5C0XB 2JE6A 3M7ND 4OO1E 2NN6D 5JEAE 2BR2A 1UDNA 2PO0B 2JEAA 2BR2B 4OO1D 2JEAB 2JEBB 2C37A 3M85G 2BA0G 2NN6E 5C0XD 4BA2A 2C37B 4BA2B 1E3PA 3B4TA 5K36F 3L7ZA 5K36A 4AIDA 3L7ZB 5K36B 1OYPA 1R6MA 5C0XE 2PO0A 4IFDF 4IFDC 2PO1A 2BA1D 2JEBA 4IFDB 5JEAC 3GCMA 2PO1B 1OYRA 3GLLA 1UDOA 3CDIA 5K36D 4NBQA 1R6LA 2C39A 2PNZA 3M7NG 3KRNA 2NN6C 2C39B 2PNZB 1UDQA 1E3HA 4BA1B 4IFDA 5K36E 4OO1C 4OO1F 3H1CA 5JEAF 5JEAA 3M85D 5C0XC 2BA0D 4OO1B 4AIMA 1OYSA 5JEAB 3CDJA 2PO2A 4IFDE 2C38A 2JE6B 2PO2B 2C38B 3U1KA 3HKMA 2NN6F 2NN6A 4AM3A 2WP8A 1UDSA 2NN6B 4BA1A 2WP8B 4IFDD 2BA1G 4OO1A 2WNRA 5JEAD 3GMEA
chains in the Genus database with same CATH superfamily
4LF8I 5C0XF 2PNMA 2WNRB 4DR3I 4GQUA 1HNWI 3UHMA 3J7AM 4X62E 4DR2I 2GO4A 2A2DA 5IT9Q 2GQ0A 4R1FA 3M7ND 1NHIA 2GS8A 3ZZTA 5JEAE 4LF6I 1KIJA 4NXNI 4KHPI 4DPWA 2BR2B 4USMA 2WW4A 4YHHI 1S4EA 1J5EE 1XMQI 4DR5E 2C37A 4IZJB 2UU9I 1N32I 1MX0A 5IWAE 4NXME 2DEJA 2Z5EA 3CWVA 3L7ZA 4DV1I 3ZM7A 1IBMI 2Z5CA 4DR6I 3QT8A 1Z5CA 4DV5E 4JV5I 4HACB 2PO0A 2JT2A 2J7KA 4WUDA 2UUBI 4X65E 1XNQI 1Z0BA 2O1WA 4AQYI 2BA1D 4DR1E 1USUA 1XHKA 1USVA 2PO1B 4JI7I 2CVEA 4USKA 4LF5I 5LMUE 4OKGA 2X7IA 1H72C 3LPSA 5K36D 4B3MI 1NHHA 1EA6A 1IBKI 2C39A 5FLXQ 2R3VA 3M7NG 3KRNA 4HYMA 2UXBE 3PYDA 1Z5AA 2IERA 2R42A 4P7AA 1Z0TA 3QT6A 5K36E 4OO1C 1I94I 4MU4A 4LF9E 4JI0I 4I3HA 5JEAF 2BA0D 1UEKA 3P06A 1U2RA 4MQYA 1EI1A 1K47A 4X62I 1PKPA 2PO2A 3H4LA 1PVGA 4FW5A 4LFBE 4IZKA 3HKMA 5DRRA 2WP8A 1HR0E 5FWKA 2BA1G 4OO1A 3ZKBA 2WNRA 4B3TE 4DR5I 3PS2A 3GMEA 3DD6A 2F1DA 5IWAI 4NXMI 5DRPA 4DUZE 3JAMQ 1HNZE 5C0XB 2JE6A 3K1JA 4OO1E 3ZZUA 2NN6D 2VQEE 2BR2A 3GONA 4DV7E 2ZM6E 5GMEA 2E5LE 3U1YA 5L3JA 3ZKDA 4IZJA 5DROA 4LF4E 2V2QA 1N33E 1Y5YA 1Z0VA 5LMNI 4X66E 2BA0G 2NN6E 3V2UC 4URLA 1Z0GA 3OTOE 4GKJE 4BA2B 1VISA 4DV3E 2CGEA 5K36F 3WU3A 2OI2A 4HACA 4JG4A 2X36A 1BKNA 4IS9A 1FJGE 2UUAE 3ZZ0A 2HK3A 4JI1I 4IFDC 2V2VA 2PO1A 1N0VC 2JEBA 3GCMA 4JYAE 1XNRI 3J81C 4XTJA 4PU9A 1N34E 1WUUA 2A2CA 2Z5BB 4LCGA 1FWLA 4LFCE 4NBQA 1R6LA 1IBLI 4HXZA 1RREA 1Y6ZA 1QZRA 1HNXE 3F0NA 5ELWA 4JI3E 4EMDA 4IFDA 4X64E 4OO1F 4JI4I 5LL6R 4B3TI 3PYFA 3M85D 5C0XC 4OX9E 4MU0A 3J7AG 4FWDA 5JEAB 3P3CA 4K0KE 4DUZI 1HNZI 4B3SE 4IFDE 1H7UA 3Q6MA 4JI6E 1ELOA 4LCHA 2VQFE 2NN6F 4FW6A 4KQVA 4DR7I 1Y4SA 4WUBA 4YY3E 4BA1A 4JI8E 1KKHA 3T1YE 1XMOI 1NZ0A 4JI2E 2V2ZA 2O1TA 4ED4A 4RPFA 5DRQA 2UUCE 4DV4E 4LF7I 1N33I 4J3DA 4LOMA 4DV0I 4JI5E 4DUYE 4B3RE 4LF8E 5C0XA 2GO3A 1HK7A 1N36E 3OTOI 2UXCE 3V5RA 1OJ4A 3B8HA 1Y60A 3WU6A 4ZVIA 4DPXA 4LF6E 1B62A 3J81Q 1NHJA 1UDNA 5IT9C 4KHPE 1A6FA 4OZEA 1ZXNA 2PO0B 2Q2EB 4YHHE 1ZM4A 1XMQE 2JEAB 1FI4A 4JYAI 4OO1D 1J5EI 2UU9E 1N32E 4QNKA 3M85G 1S16A 4BA2A 4UTGA 2XEXA 2UXDE 4LFCI 2DEIA 1RHYA 5K36B 1OYPA 1D6TA 3QT5A 4P52A 1MU5A 4DV5I 2UUBE 1RR9A 1ZXMA 2HHHE 4IFDF 2BM0A 4X65I 1KVKA 4AQYE 2HK2A 4DR1I 4DPUA 4MYUA 5JEAC 1B63A 5BR8E 1OYRA 4MDTA 4LF5E 4OX9I 3P76A 1UDOA 4K0KI 5LMUI 3CDIA 5EL9A 4B3ME 3LNUA 3WU5A 2CG9A 4LCFA 1IBKE 4DXLA 4MU1A 4DV6E 4JI6I 2PNLA 2PNZB 1Z59A 1UDQA 5DNXA 2UXBI 4JI8I 4U3BA 5DNLA 1Z0EA 3K85A 2CZ9A 1I94E 3K17A 2UUCI 4DV4I 4LF9I 4DUYI 4B3RI 5JEAA 4OO1B 4ISAA 4AIMA 2O1UA 3B82A 1N36I 2IOQA 4LFAE 3CDJA 4DPTA 4DU8A 2UXCI 4GKKE 2JE6B 1Z5BA 2F4VE 1ZM2A 3M6AA 3T1HE 4UT4A 4LFBI 3PYGA 2C38B 3U1KA 1P42A 5A2QC 4AM3A 2LJPA 1UDSA 3HJCA 1HR0I 2NN6B 4FW4A 3Q1QA 1MG7A 4IFDD 3QT7A 4FW3A 3P3GA 4M1KA 3NZKA 1PIEA 2ZBKB 5EKWA 4Z7YA 4DR4E 3P3EA 4DPYA 2UXDI 5K36C 3WU4A 2O3ZA 1N0UA 2AE8A 2AJ4A 3JAMC 2VQEI 1KTVA 1H74A 4N3OA 3J80C 3PRYA 2HHHI 2HFSA 4Z7CA 2JEAA 1FNMA 1H73A 4DV2E 2ZM6I 4DV7I 2E5LI 2E1RA 2JEBB 4LF4I 4QNJA 5LMNE 5BR8I 3B78A 1ZM9A 5GMDA 4MU3A 5C0XD 4X66I 4DR3E 1HNWE 2C37B 2IOPA 4DR2E 2NPFA 4GKJI 1E3PA 3B4TA 3LTOA 5K36A 4AIDA 4DV3I 4DV6I 4FWGA 3L7ZB 2ZITA 2HFUA 4FN5A 3HULA 4WUCA 1R6MA 2Z5CB 4JI1E 1FJGI 2J65A 1YH8A 3PS1A 5C0XE 2UUAI 4NXNE 4IFDB 4PRXA 1XNRE 1XXEA 4MYTA 5A2QQ 3GLLA 1Z0WA 2V34A 1N34I 4LFAI 1H7SA 4GKKI 4DU7A 1VI7A 1IBLE 4DV1E 2F4VI 2O1VA 2PNZA 3T1HI 1IBME 3PS3A 2NN6C 2C39B 4DR6E 4JV5E 1FKAE 1E3HA 4LPFA 1XNQE 1HNXI 2BM1A 4BA1B 4JI3I 1FWKA 3D4JA 4X64I 3Q6NA 4JI4E 4HY1A 2BV3A 4IZJD 1ZM3A 4FWHA 4U3DA 3H1CA 4JI7E 4DR4I 2Z5BA 2HKEA 1OYSA 1Z0CA 3J80Q 4FW7A 4B3SI 2C38A 2IESA 2PO2B 1YHCA 4FW9A 4PRVA 4DR7E 2NN6A 2VQFI 4IZKB 1XMOE 2VESA 3PYEA 2VF3A 4YY3I 2V8PA 1Y4UA 2WP8B 3T1YI 5FLXC 4DV2I 4JI2I 1DARA 4LF7E 2HKJA 2EFGA 4DV0E 4JI0E 5JEAD 4JI5I
chains in the Genus database with same CATH topology
5C0XF 2WNRB 5C0XA 3DD6A 5K36C 5C0XB 2JE6A 3M7ND 4OO1E 2NN6D 5JEAE 2BR2A 1UDNA 2PO0B 2JEAA 2BR2B 4OO1D 2JEAB 2JEBB 2C37A 3M85G 2BA0G 2NN6E 5C0XD 4BA2A 2C37B 4BA2B 1E3PA 3B4TA 5K36F 3L7ZA 5K36A 4AIDA 3L7ZB 5K36B 1OYPA 1R6MA 5C0XE 2PO0A 4IFDF 4IFDC 2PO1A 2BA1D 2JEBA 4IFDB 5JEAC 3GCMA 2PO1B 1OYRA 3GLLA 1UDOA 3CDIA 5K36D 4NBQA 1R6LA 2C39A 2PNZA 3M7NG 3KRNA 2NN6C 2C39B 2PNZB 1UDQA 1E3HA 4BA1B 4IFDA 5K36E 4OO1C 4OO1F 3H1CA 5JEAF 5JEAA 3M85D 5C0XC 2BA0D 4OO1B 4AIMA 1OYSA 5JEAB 3CDJA 2PO2A 4IFDE 2C38A 2JE6B 2PO2B 2C38B 3U1KA 3HKMA 2NN6F 2NN6A 4AM3A 2WP8A 1UDSA 2NN6B 4BA1A 2WP8B 4IFDD 2BA1G 4OO1A 2WNRA 5JEAD 3GMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X F;  2WNR B;  5C0X A;  3DD6 A;  5K36 C;  5C0X B;  2JE6 A;  3M7N D;  4OO1 E;  2NN6 D;  5JEA E;  2BR2 A;  1UDN A;  2PO0 B;  2JEA A;  2BR2 B;  4OO1 D;  2JEA B;  2JEB B;  2C37 A;  3M85 G;  2BA0 G;  2NN6 E;  5C0X D;  4BA2 A;  2C37 B;  4BA2 B;  1E3P A;  3B4T A;  5K36 F;  3L7Z A;  5K36 A;  4AID A;  3L7Z B;  5K36 B;  1OYP A;  1R6M A;  5C0X E;  2PO0 A;  4IFD F;  4IFD C;  2PO1 A;  2BA1 D;  2JEB A;  4IFD B;  5JEA C;  3GCM A;  2PO1 B;  1OYR A;  3GLL A;  1UDO A;  3CDI A;  5K36 D;  4NBQ A;  1R6L A;  2C39 A;  2PNZ A;  3M7N G;  3KRN A;  2NN6 C;  2C39 B;  2PNZ B;  1UDQ A;  1E3H A;  4BA1 B;  4IFD A;  5K36 E;  4OO1 C;  4OO1 F;  3H1C A;  5JEA F;  5JEA A;  3M85 D;  5C0X C;  2BA0 D;  4OO1 B;  4AIM A;  1OYS A;  5JEA B;  3CDJ A;  2PO2 A;  4IFD E;  2C38 A;  2JE6 B;  2PO2 B;  2C38 B;  3U1K A;  3HKM A;  2NN6 F;  2NN6 A;  4AM3 A;  2WP8 A;  1UDS A;  2NN6 B;  4BA1 A;  2WP8 B;  4IFD D;  2BA1 G;  4OO1 A;  2WNR A;  5JEA D;  3GME A; 
#chains in the Genus database with same CATH topology
 4LF8 I;  5C0X F;  2PNM A;  2WNR B;  4DR3 I;  4GQU A;  1HNW I;  3UHM A;  3J7A M;  4X62 E;  4DR2 I;  2GO4 A;  2A2D A;  5IT9 Q;  2GQ0 A;  4R1F A;  3M7N D;  1NHI A;  2GS8 A;  3ZZT A;  5JEA E;  4LF6 I;  1KIJ A;  4NXN I;  4KHP I;  4DPW A;  2BR2 B;  4USM A;  2WW4 A;  4YHH I;  1S4E A;  1J5E E;  1XMQ I;  4DR5 E;  2C37 A;  4IZJ B;  2UU9 I;  1N32 I;  1MX0 A;  5IWA E;  4NXM E;  2DEJ A;  2Z5E A;  3CWV A;  3L7Z A;  4DV1 I;  3ZM7 A;  1IBM I;  2Z5C A;  4DR6 I;  3QT8 A;  1Z5C A;  4DV5 E;  4JV5 I;  4HAC B;  2PO0 A;  2JT2 A;  2J7K A;  4WUD A;  2UUB I;  4X65 E;  1XNQ I;  1Z0B A;  2O1W A;  4AQY I;  2BA1 D;  4DR1 E;  1USU A;  1XHK A;  1USV A;  2PO1 B;  4JI7 I;  2CVE A;  4USK A;  4LF5 I;  5LMU E;  4OKG A;  2X7I A;  1H72 C;  3LPS A;  5K36 D;  4B3M I;  1NHH A;  1EA6 A;  1IBK I;  2C39 A;  5FLX Q;  2R3V A;  3M7N G;  3KRN A;  4HYM A;  2UXB E;  3PYD A;  1Z5A A;  2IER A;  2R42 A;  4P7A A;  1Z0T A;  3QT6 A;  5K36 E;  4OO1 C;  1I94 I;  4MU4 A;  4LF9 E;  4JI0 I;  4I3H A;  5JEA F;  2BA0 D;  1UEK A;  3P06 A;  1U2R A;  4MQY A;  1EI1 A;  1K47 A;  4X62 I;  1PKP A;  2PO2 A;  3H4L A;  1PVG A;  4FW5 A;  4LFB E;  4IZK A;  3HKM A;  5DRR A;  2WP8 A;  1HR0 E;  5FWK A;  2BA1 G;  4OO1 A;  3ZKB A;  2WNR A;  4B3T E;  4DR5 I;  3PS2 A;  3GME A;  3DD6 A;  2F1D A;  5IWA I;  4NXM I;  5DRP A;  4DUZ E;  3JAM Q;  1HNZ E;  5C0X B;  2JE6 A;  3K1J A;  4OO1 E;  3ZZU A;  2NN6 D;  2VQE E;  2BR2 A;  3GON A;  4DV7 E;  2ZM6 E;  5GME A;  2E5L E;  3U1Y A;  5L3J A;  3ZKD A;  4IZJ A;  5DRO A;  4LF4 E;  2V2Q A;  1N33 E;  1Y5Y A;  1Z0V A;  5LMN I;  4X66 E;  2BA0 G;  2NN6 E;  3V2U C;  4URL A;  1Z0G A;  3OTO E;  4GKJ E;  4BA2 B;  1VIS A;  4DV3 E;  2CGE A;  5K36 F;  3WU3 A;  2OI2 A;  4HAC A;  4JG4 A;  2X36 A;  1BKN A;  4IS9 A;  1FJG E;  2UUA E;  3ZZ0 A;  2HK3 A;  4JI1 I;  4IFD C;  2V2V A;  2PO1 A;  1N0V C;  2JEB A;  3GCM A;  4JYA E;  1XNR I;  3J81 C;  4XTJ A;  4PU9 A;  1N34 E;  1WUU A;  2A2C A;  2Z5B B;  4LCG A;  1FWL A;  4LFC E;  4NBQ A;  1R6L A;  1IBL I;  4HXZ A;  1RRE A;  1Y6Z A;  1QZR A;  1HNX E;  3F0N A;  5ELW A;  4JI3 E;  4EMD A;  4IFD A;  4X64 E;  4OO1 F;  4JI4 I;  5LL6 R;  4B3T I;  3PYF A;  3M85 D;  5C0X C;  4OX9 E;  4MU0 A;  3J7A G;  4FWD A;  5JEA B;  3P3C A;  4K0K E;  4DUZ I;  1HNZ I;  4B3S E;  4IFD E;  1H7U A;  3Q6M A;  4JI6 E;  1ELO A;  4LCH A;  2VQF E;  2NN6 F;  4FW6 A;  4KQV A;  4DR7 I;  1Y4S A;  4WUB A;  4YY3 E;  4BA1 A;  4JI8 E;  1KKH A;  3T1Y E;  1XMO I;  1NZ0 A;  4JI2 E;  2V2Z A;  2O1T A;  4ED4 A;  4RPF A;  5DRQ A;  2UUC E;  4DV4 E;  4LF7 I;  1N33 I;  4J3D A;  4LOM A;  4DV0 I;  4JI5 E;  4DUY E;  4B3R E;  4LF8 E;  5C0X A;  2GO3 A;  1HK7 A;  1N36 E;  3OTO I;  2UXC E;  3V5R A;  1OJ4 A;  3B8H A;  1Y60 A;  3WU6 A;  4ZVI A;  4DPX A;  4LF6 E;  1B62 A;  3J81 Q;  1NHJ A;  1UDN A;  5IT9 C;  4KHP E;  1A6F A;  4OZE A;  1ZXN A;  2PO0 B;  2Q2E B;  4YHH E;  1ZM4 A;  1XMQ E;  2JEA B;  1FI4 A;  4JYA I;  4OO1 D;  1J5E I;  2UU9 E;  1N32 E;  4QNK A;  3M85 G;  1S16 A;  4BA2 A;  4UTG A;  2XEX A;  2UXD E;  4LFC I;  2DEI A;  1RHY A;  5K36 B;  1OYP A;  1D6T A;  3QT5 A;  4P52 A;  1MU5 A;  4DV5 I;  2UUB E;  1RR9 A;  1ZXM A;  2HHH E;  4IFD F;  2BM0 A;  4X65 I;  1KVK A;  4AQY E;  2HK2 A;  4DR1 I;  4DPU A;  4MYU A;  5JEA C;  1B63 A;  5BR8 E;  1OYR A;  4MDT A;  4LF5 E;  4OX9 I;  3P76 A;  1UDO A;  4K0K I;  5LMU I;  3CDI A;  5EL9 A;  4B3M E;  3LNU A;  3WU5 A;  2CG9 A;  4LCF A;  1IBK E;  4DXL A;  4MU1 A;  4DV6 E;  4JI6 I;  2PNL A;  2PNZ B;  1Z59 A;  1UDQ A;  5DNX A;  2UXB I;  4JI8 I;  4U3B A;  5DNL A;  1Z0E A;  3K85 A;  2CZ9 A;  1I94 E;  3K17 A;  2UUC I;  4DV4 I;  4LF9 I;  4DUY I;  4B3R I;  5JEA A;  4OO1 B;  4ISA A;  4AIM A;  2O1U A;  3B82 A;  1N36 I;  2IOQ A;  4LFA E;  3CDJ A;  4DPT A;  4DU8 A;  2UXC I;  4GKK E;  2JE6 B;  1Z5B A;  2F4V E;  1ZM2 A;  3M6A A;  3T1H E;  4UT4 A;  4LFB I;  3PYG A;  2C38 B;  3U1K A;  1P42 A;  5A2Q C;  4AM3 A;  2LJP A;  1UDS A;  3HJC A;  1HR0 I;  2NN6 B;  4FW4 A;  3Q1Q A;  1MG7 A;  4IFD D;  3QT7 A;  4FW3 A;  3P3G A;  4M1K A;  3NZK A;  1PIE A;  2ZBK B;  5EKW A;  4Z7Y A;  4DR4 E;  3P3E A;  4DPY A;  2UXD I;  5K36 C;  3WU4 A;  2O3Z A;  1N0U A;  2AE8 A;  2AJ4 A;  3JAM C;  2VQE I;  1KTV A;  1H74 A;  4N3O A;  3J80 C;  3PRY A;  2HHH I;  2HFS A;  4Z7C A;  2JEA A;  1FNM A;  1H73 A;  4DV2 E;  2ZM6 I;  4DV7 I;  2E5L I;  2E1R A;  2JEB B;  4LF4 I;  4QNJ A;  5LMN E;  5BR8 I;  3B78 A;  1ZM9 A;  5GMD A;  4MU3 A;  5C0X D;  4X66 I;  4DR3 E;  1HNW E;  2C37 B;  2IOP A;  4DR2 E;  2NPF A;  4GKJ I;  1E3P A;  3B4T A;  3LTO A;  5K36 A;  4AID A;  4DV3 I;  4DV6 I;  4FWG A;  3L7Z B;  2ZIT A;  2HFU A;  4FN5 A;  3HUL A;  4WUC A;  1R6M A;  2Z5C B;  4JI1 E;  1FJG I;  2J65 A;  1YH8 A;  3PS1 A;  5C0X E;  2UUA I;  4NXN E;  4IFD B;  4PRX A;  1XNR E;  1XXE A;  4MYT A;  5A2Q Q;  3GLL A;  1Z0W A;  2V34 A;  1N34 I;  4LFA I;  1H7S A;  4GKK I;  4DU7 A;  1VI7 A;  1IBL E;  4DV1 E;  2F4V I;  2O1V A;  2PNZ A;  3T1H I;  1IBM E;  3PS3 A;  2NN6 C;  2C39 B;  4DR6 E;  4JV5 E;  1FKA E;  1E3H A;  4LPF A;  1XNQ E;  1HNX I;  2BM1 A;  4BA1 B;  4JI3 I;  1FWK A;  3D4J A;  4X64 I;  3Q6N A;  4JI4 E;  4HY1 A;  2BV3 A;  4IZJ D;  1ZM3 A;  4FWH A;  4U3D A;  3H1C A;  4JI7 E;  4DR4 I;  2Z5B A;  2HKE A;  1OYS A;  1Z0C A;  3J80 Q;  4FW7 A;  4B3S I;  2C38 A;  2IES A;  2PO2 B;  1YHC A;  4FW9 A;  4PRV A;  4DR7 E;  2NN6 A;  2VQF I;  4IZK B;  1XMO E;  2VES A;  3PYE A;  2VF3 A;  4YY3 I;  2V8P A;  1Y4U A;  2WP8 B;  3T1Y I;  5FLX C;  4DV2 I;  4JI2 I;  1DAR A;  4LF7 E;  2HKJ A;  2EFG A;  4DV0 E;  4JI0 E;  5JEA D;  4JI5 I; 
#chains in the Genus database with same CATH homology
 5C0X F;  2WNR B;  5C0X A;  3DD6 A;  5K36 C;  5C0X B;  2JE6 A;  3M7N D;  4OO1 E;  2NN6 D;  5JEA E;  2BR2 A;  1UDN A;  2PO0 B;  2JEA A;  2BR2 B;  4OO1 D;  2JEA B;  2JEB B;  2C37 A;  3M85 G;  2BA0 G;  2NN6 E;  5C0X D;  4BA2 A;  2C37 B;  4BA2 B;  1E3P A;  3B4T A;  5K36 F;  3L7Z A;  5K36 A;  4AID A;  3L7Z B;  5K36 B;  1OYP A;  1R6M A;  5C0X E;  2PO0 A;  4IFD F;  4IFD C;  2PO1 A;  2BA1 D;  2JEB A;  4IFD B;  5JEA C;  3GCM A;  2PO1 B;  1OYR A;  3GLL A;  1UDO A;  3CDI A;  5K36 D;  4NBQ A;  1R6L A;  2C39 A;  2PNZ A;  3M7N G;  3KRN A;  2NN6 C;  2C39 B;  2PNZ B;  1UDQ A;  1E3H A;  4BA1 B;  4IFD A;  5K36 E;  4OO1 C;  4OO1 F;  3H1C A;  5JEA F;  5JEA A;  3M85 D;  5C0X C;  2BA0 D;  4OO1 B;  4AIM A;  1OYS A;  5JEA B;  3CDJ A;  2PO2 A;  4IFD E;  2C38 A;  2JE6 B;  2PO2 B;  2C38 B;  3U1K A;  3HKM A;  2NN6 F;  2NN6 A;  4AM3 A;  2WP8 A;  1UDS A;  2NN6 B;  4BA1 A;  2WP8 B;  4IFD D;  2BA1 G;  4OO1 A;  2WNR A;  5JEA D;  3GME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...