2BR2A

Rnase ph core of the archaeal exosome
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Archaeal Exosome Core is a Hexameric Ring Structure with Three Catalytic Subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
total genus 79
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2br2A01
4NBQA 2BR2A 5JEAF 2JEAA 5C0XC 2PO1A 2NN6D 2C38B 2NN6A 1UDSA 5K36E 2BA0D 4IFDF 4IFDD 5K36F 5JEAB 4BA2A 2WNRA 2JEBB 4BA1B 1OYPA 4OO1B 2WP8B 3U1KA 1E3HA 5C0XB 3L7ZA 4OO1A 4AM3A 1UDQA 2PO0B 1R6MA 5JEAA 3KRNA 2JE6B 2NN6E 3HKMA 2NN6B 2NN6F 2PO2A 3GMEA 2JE6A 1R6LA 2JEAB 5K36A 1UDNA 1OYSA 5C0XF 3CDIA 4BA2B 1UDOA 2WNRB 4IFDC 4BA1A 1E3PA 3GLLA 1OYRA 2BA1G 3B4TA 3H1CA 2PNZB 5JEAE 5K36B 3M85D 4IFDB 2C37B 4AIDA 2PNZA 2C39B 4AIMA 2NN6C 3M7NG 2BR2B 5C0XD 5C0XE 4OO1E 5C0XA 3GCMA 2WP8A 5K36D 4OO1D 2BA0G 2C39A 2C38A 2PO2B 5JEAC 4IFDA 2C37A 2BA1D 4OO1C 5K36C 2PO1B 3CDJA 3DD6A 4IFDE 3L7ZB 3M85G 5JEAD 2PO0A 4OO1F 3M7ND 2JEBA
chains in the Genus database with same CATH superfamily
4DV3I 2V2QA 4LFCE 4DR1I 4GKKE 3JAMC 2PO1A 1MG7A 1ZXNA 4LCHA 4M1KA 4QNJA 1UDSA 2ZM6E 5K36E 2HKEA 4LF4E 4JI0E 4USKA 2UUAE 2F4VE 4X64E 2UUBI 4LF8I 1EI1A 1OYPA 4FWGA 5LMNI 4JI1E 3B8HA 4OO1B 3J7AG 4JI8E 3B78A 3J80Q 2UXDE 1H7SA 4FWDA 1FJGE 1N33I 1K47A 1Z0WA 4LPFA 4OO1A 4DXLA 4AM3A 4N3OA 4USMA 4LF9I 2JE6B 4FWHA 4DV4E 4XTJA 4ED4A 2NN6B 4I3HA 2HHHI 2PO2A 3GMEA 1R6LA 4FW7A 1U2RA 2PNMA 4DR1E 4GKKI 4DR2I 4MYUA 4NXMI 5C0XF 2CZ9A 4DV2I 3QT5A 1DARA 2Z5BA 3U1YA 1UDOA 2WNRB 5DRQA 1E3PA 2UXBI 2PNZB 3ZKDA 1Z0VA 1KTVA 1N36I 2C37B 3ZZ0A 4AIDA 1HR0I 4JYAE 1IBME 5GMEA 4Z7YA 2PNZA 1N32E 2C39B 4AIMA 1ZM3A 4DR6E 1ZM9A 2O1TA 2V8PA 1XMQI 4DV0E 1RR9A 4IZKB 2UU9E 2BR2B 2AJ4A 5C0XE 2BM1A 3HJCA 4IZJA 1XMOE 4LFAI 4PU9A 5C0XA 3F0NA 4MU0A 5EKWA 2IOPA 3Q1QA 4MDTA 1N34I 2PO2B 3WU3A 2GQ0A 3P3EA 4IFDA 1N0VC 4DV3E 1PVGA 3T1YI 3PS2A 4ZVIA 1NHHA 3L7ZB 4AQYE 4J3DA 2IERA 4LF4I 1HNWE 3P3GA 4NXNI 3WU5A 5C0XB 4JV5E 4K0KE 5IT9Q 1Z59A 4R1FA 2UXDI 2Z5CB 4DUZE 3LTOA 4OKGA 4YHHI 2X36A 1I94E 4IFDD 5LL6R 4FW9A 4LF9E 2WNRA 1Z5BA 4BA1B 2LJPA 5DNXA 1FI4A 2WP8B 2GO3A 1MX0A 2O1WA 1E3HA 2GS8A 4WUBA 3U1KA 2HHHE 1S4EA 1B62A 1EA6A 3L7ZA 4MU4A 1XXEA 1UDQA 1HNZI 1XNRE 2PO0B 1ELOA 4AQYI 2UUAI 4JI5E 1R6MA 1NZ0A 3J80C 2NN6E 3HKMA 4HY1A 4DUYE 4DV2E 4JI1I 1J5EE 4JI2I 4U3DA 4B3SE 3T1HE 2BM0A 2JEAB 4DV1E 2Z5CA 1Y4UA 4JI4E 3QT8A 4DV5I 4DPUA 1N32I 4FW3A 4X66I 4DR4I 5IWAE 3CDIA 2HK3A 2UU9I 4BA2B 4X65I 2O1VA 3J7AM 2BA1G 2V2ZA 3B4TA 5K36B 4B3TI 4IFDB 1VI7A 1FWKA 2OI2A 4DU7A 1Z5CA 4JI6I 4U3BA 4LFCI 3PYEA 2NN6C 1HNXI 1VISA 3T1YE 4OO1E 2HKJA 4HACA 2BV3A 2WP8A 5K36D 3GONA 2IESA 5LMUE 1IBMI 2BA0G 4JI3E 3ZM7A 4JI4I 4KQVA 1USVA 2WW4A 4DV0I 4LF7I 3K17A 4LF6I 1D6TA 4DV5E 4DPWA 1MU5A 2BA1D 1OJ4A 4DV6I 5IWAI 3CDJA 4IFDE 4DUZI 2UXCE 1RHYA 2HK2A 4OZEA 4DR5E 2J65A 2Q2EB 2Z5BB 4DPTA 4P52A 1FKAE 3PYGA 1Y4SA 4NBQA 2VQFE 3CWVA 5JEAF 4IS9A 3K1JA 1XHKA 2NN6D 2CVEA 4YY3I 2NN6A 4OX9I 2BA0D 4IFDF 1HNZE 1XNRI 5A2QC 2ZBKB 5K36F 4NXNE 5JEAB 4BA2A 4B3RI 3J81C 4LF5E 5LMUI 2JEBB 2UXBE 3LPSA 4WUDA 4K0KI 4GKJI 4B3MI 4FW6A 1HR0E 3ZKBA 3K85A 2CGEA 1H72C 4MU1A 2IOQA 1S16A 4MYTA 4HXZA 2PNLA 1NHJA 4X62I 4LOMA 4PRXA 1PIEA 5DROA 1FNMA 1IBLI 5JEAA 1XMOI 1IBKE 1YH8A 2UUCI 4WUCA 3M6AA 3OTOI 4DV7E 2V34A 1ZXMA 4KHPI 4JI7I 5K36A 1UDNA 4LCGA 4DR7I 3LNUA 1ZM2A 1NHIA 1Z0BA 2DEIA 1PKPA 2JT2A 4URLA 3WU4A 1J5EI 4JI2E 5DNLA 2E5LE 4IFDC 2F4VI 3QT6A 4BA1A 4LFBE 3V2UC 2DEJA 3GLLA 2CG9A 3P06A 3H1CA 1Z0EA 3T1HI 5JEAE 4DR3I 4B3ME 3H4LA 3UHMA 1USUA 1BKNA 2X7IA 3Q6NA 2F1DA 5ELWA 2O3ZA 1Y6ZA 1KVKA 3P76A 5DRPA 3WU6A 3M7NG 5C0XD 2R42A 5IT9C 4HYMA 4YHHE 1I94I 2VQEE 1UEKA 2A2CA 4FW5A 2UUCE 1B63A 4OO1D 1XNQE 2O1UA 4DR7E 4RPFA 2R3VA 1KKHA 4EMDA 4OO1C 5K36C 2PO1B 1YHCA 2E5LI 2VF3A 2HFSA 5JEAD 4OX9E 4MU3A 2ZM6I 1Z0TA 1H73A 3PS3A 4IZJB 5GMDA 4JI3I 4OO1F 3PRYA 3M7ND 4LF6E 4ISAA 4Z7CA 5LMNE 2BR2A 4IZKA 5FLXQ 4DV6E 2JEAA 4UTGA 5C0XC 4PRVA 1ZM4A 2UXCI 2C38B 4LFAE 5BR8E 2HFUA 4FN5A 1WUUA 3PYFA 3JAMQ 1XNQI 2VQFI 4B3TE 3ZZTA 4KHPE 2E1RA 3Q6MA 4JI6E 4JI7E 1Y5YA 1HNXE 4DR2E 4X64I 2AE8A 3KRNA 2UUBE 1H74A 4LF8E 3PYDA 1RREA 2A2DA 3ZZUA 2V2VA 2NN6F 4JI8I 4MQYA 3V5RA 2ZITA 4LFBI 2JE6A 1FJGI 3HULA 4P7AA 1N33E 4JG4A 3QT7A 3J81Q 1OYSA 1N36E 4LF7E 2EFGA 1FWLA 4IZJD 1IBLE 4HACB 1IBKI 5EL9A 1Z0GA 1Y60A 3OTOE 4DV7I 1N0UA 3PS1A 1OYRA 3B82A 3D4JA 4DR5I 1Z5AA 3M85D 4NXME 1P42A 2VESA 1N34E 4GQUA 3P3CA 1HK7A 4DPYA 4JI5I 4YY3E 4UT4A 5DRRA 4DUYI 4DR3E 4JI0I 1A6FA 2XEXA 3GCMA 5FWKA 4B3RE 5A2QQ 4LF5I 4B3SI 2GO4A 5FLXC 4DU8A 4JYAI 4GKJE 2Z5EA 5L3JA 4DV1I 1HNWI 4DR6I 2C39A 4LCFA 1XMQE 2C38A 5JEAC 4FW4A 4JV5I 2C37A 2VQEI 4X66E 1Z0CA 4DR4E 3DD6A 3NZKA 2J7KA 4X62E 3M85G 4X65E 1QZRA 4QNKA 1KIJA 2PO0A 4DV4I 1H7UA 2NPFA 4DPXA 5BR8I 2JEBA
chains in the Genus database with same CATH topology
4NBQA 2BR2A 5JEAF 2JEAA 5C0XC 2PO1A 2NN6D 2C38B 2NN6A 1UDSA 5K36E 2BA0D 4IFDF 4IFDD 5K36F 5JEAB 4BA2A 2WNRA 2JEBB 4BA1B 1OYPA 4OO1B 2WP8B 3U1KA 1E3HA 5C0XB 3L7ZA 4OO1A 4AM3A 1UDQA 2PO0B 1R6MA 5JEAA 3KRNA 2JE6B 2NN6E 3HKMA 2NN6B 2NN6F 2PO2A 3GMEA 2JE6A 1R6LA 2JEAB 5K36A 1UDNA 1OYSA 5C0XF 3CDIA 4BA2B 1UDOA 2WNRB 4IFDC 4BA1A 1E3PA 3GLLA 1OYRA 2BA1G 3B4TA 3H1CA 2PNZB 5JEAE 5K36B 3M85D 4IFDB 2C37B 4AIDA 2PNZA 2C39B 4AIMA 2NN6C 3M7NG 2BR2B 5C0XD 5C0XE 4OO1E 5C0XA 3GCMA 2WP8A 5K36D 4OO1D 2BA0G 2C39A 2C38A 2PO2B 5JEAC 4IFDA 2C37A 2BA1D 4OO1C 5K36C 2PO1B 3CDJA 3DD6A 4IFDE 3L7ZB 3M85G 5JEAD 2PO0A 4OO1F 3M7ND 2JEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBQ A;  2BR2 A;  5JEA F;  2JEA A;  5C0X C;  2PO1 A;  2NN6 D;  2C38 B;  2NN6 A;  1UDS A;  5K36 E;  2BA0 D;  4IFD F;  4IFD D;  5K36 F;  5JEA B;  4BA2 A;  2WNR A;  2JEB B;  4BA1 B;  1OYP A;  4OO1 B;  2WP8 B;  3U1K A;  1E3H A;  5C0X B;  3L7Z A;  4OO1 A;  4AM3 A;  1UDQ A;  2PO0 B;  1R6M A;  5JEA A;  3KRN A;  2JE6 B;  2NN6 E;  3HKM A;  2NN6 B;  2NN6 F;  2PO2 A;  3GME A;  2JE6 A;  1R6L A;  2JEA B;  5K36 A;  1UDN A;  1OYS A;  5C0X F;  3CDI A;  4BA2 B;  1UDO A;  2WNR B;  4IFD C;  4BA1 A;  1E3P A;  3GLL A;  1OYR A;  2BA1 G;  3B4T A;  3H1C A;  2PNZ B;  5JEA E;  5K36 B;  3M85 D;  4IFD B;  2C37 B;  4AID A;  2PNZ A;  2C39 B;  4AIM A;  2NN6 C;  3M7N G;  2BR2 B;  5C0X D;  5C0X E;  4OO1 E;  5C0X A;  3GCM A;  2WP8 A;  5K36 D;  4OO1 D;  2BA0 G;  2C39 A;  2C38 A;  2PO2 B;  5JEA C;  4IFD A;  2C37 A;  2BA1 D;  4OO1 C;  5K36 C;  2PO1 B;  3CDJ A;  3DD6 A;  4IFD E;  3L7Z B;  3M85 G;  5JEA D;  2PO0 A;  4OO1 F;  3M7N D;  2JEB A; 
#chains in the Genus database with same CATH topology
 4DV3 I;  2V2Q A;  4LFC E;  4DR1 I;  4GKK E;  3JAM C;  2PO1 A;  1MG7 A;  1ZXN A;  4LCH A;  4M1K A;  4QNJ A;  1UDS A;  2ZM6 E;  5K36 E;  2HKE A;  4LF4 E;  4JI0 E;  4USK A;  2UUA E;  2F4V E;  4X64 E;  2UUB I;  4LF8 I;  1EI1 A;  1OYP A;  4FWG A;  5LMN I;  4JI1 E;  3B8H A;  4OO1 B;  3J7A G;  4JI8 E;  3B78 A;  3J80 Q;  2UXD E;  1H7S A;  4FWD A;  1FJG E;  1N33 I;  1K47 A;  1Z0W A;  4LPF A;  4OO1 A;  4DXL A;  4AM3 A;  4N3O A;  4USM A;  4LF9 I;  2JE6 B;  4FWH A;  4DV4 E;  4XTJ A;  4ED4 A;  2NN6 B;  4I3H A;  2HHH I;  2PO2 A;  3GME A;  1R6L A;  4FW7 A;  1U2R A;  2PNM A;  4DR1 E;  4GKK I;  4DR2 I;  4MYU A;  4NXM I;  5C0X F;  2CZ9 A;  4DV2 I;  3QT5 A;  1DAR A;  2Z5B A;  3U1Y A;  1UDO A;  2WNR B;  5DRQ A;  1E3P A;  2UXB I;  2PNZ B;  3ZKD A;  1Z0V A;  1KTV A;  1N36 I;  2C37 B;  3ZZ0 A;  4AID A;  1HR0 I;  4JYA E;  1IBM E;  5GME A;  4Z7Y A;  2PNZ A;  1N32 E;  2C39 B;  4AIM A;  1ZM3 A;  4DR6 E;  1ZM9 A;  2O1T A;  2V8P A;  1XMQ I;  4DV0 E;  1RR9 A;  4IZK B;  2UU9 E;  2BR2 B;  2AJ4 A;  5C0X E;  2BM1 A;  3HJC A;  4IZJ A;  1XMO E;  4LFA I;  4PU9 A;  5C0X A;  3F0N A;  4MU0 A;  5EKW A;  2IOP A;  3Q1Q A;  4MDT A;  1N34 I;  2PO2 B;  3WU3 A;  2GQ0 A;  3P3E A;  4IFD A;  1N0V C;  4DV3 E;  1PVG A;  3T1Y I;  3PS2 A;  4ZVI A;  1NHH A;  3L7Z B;  4AQY E;  4J3D A;  2IER A;  4LF4 I;  1HNW E;  3P3G A;  4NXN I;  3WU5 A;  5C0X B;  4JV5 E;  4K0K E;  5IT9 Q;  1Z59 A;  4R1F A;  2UXD I;  2Z5C B;  4DUZ E;  3LTO A;  4OKG A;  4YHH I;  2X36 A;  1I94 E;  4IFD D;  5LL6 R;  4FW9 A;  4LF9 E;  2WNR A;  1Z5B A;  4BA1 B;  2LJP A;  5DNX A;  1FI4 A;  2WP8 B;  2GO3 A;  1MX0 A;  2O1W A;  1E3H A;  2GS8 A;  4WUB A;  3U1K A;  2HHH E;  1S4E A;  1B62 A;  1EA6 A;  3L7Z A;  4MU4 A;  1XXE A;  1UDQ A;  1HNZ I;  1XNR E;  2PO0 B;  1ELO A;  4AQY I;  2UUA I;  4JI5 E;  1R6M A;  1NZ0 A;  3J80 C;  2NN6 E;  3HKM A;  4HY1 A;  4DUY E;  4DV2 E;  4JI1 I;  1J5E E;  4JI2 I;  4U3D A;  4B3S E;  3T1H E;  2BM0 A;  2JEA B;  4DV1 E;  2Z5C A;  1Y4U A;  4JI4 E;  3QT8 A;  4DV5 I;  4DPU A;  1N32 I;  4FW3 A;  4X66 I;  4DR4 I;  5IWA E;  3CDI A;  2HK3 A;  2UU9 I;  4BA2 B;  4X65 I;  2O1V A;  3J7A M;  2BA1 G;  2V2Z A;  3B4T A;  5K36 B;  4B3T I;  4IFD B;  1VI7 A;  1FWK A;  2OI2 A;  4DU7 A;  1Z5C A;  4JI6 I;  4U3B A;  4LFC I;  3PYE A;  2NN6 C;  1HNX I;  1VIS A;  3T1Y E;  4OO1 E;  2HKJ A;  4HAC A;  2BV3 A;  2WP8 A;  5K36 D;  3GON A;  2IES A;  5LMU E;  1IBM I;  2BA0 G;  4JI3 E;  3ZM7 A;  4JI4 I;  4KQV A;  1USV A;  2WW4 A;  4DV0 I;  4LF7 I;  3K17 A;  4LF6 I;  1D6T A;  4DV5 E;  4DPW A;  1MU5 A;  2BA1 D;  1OJ4 A;  4DV6 I;  5IWA I;  3CDJ A;  4IFD E;  4DUZ I;  2UXC E;  1RHY A;  2HK2 A;  4OZE A;  4DR5 E;  2J65 A;  2Q2E B;  2Z5B B;  4DPT A;  4P52 A;  1FKA E;  3PYG A;  1Y4S A;  4NBQ A;  2VQF E;  3CWV A;  5JEA F;  4IS9 A;  3K1J A;  1XHK A;  2NN6 D;  2CVE A;  4YY3 I;  2NN6 A;  4OX9 I;  2BA0 D;  4IFD F;  1HNZ E;  1XNR I;  5A2Q C;  2ZBK B;  5K36 F;  4NXN E;  5JEA B;  4BA2 A;  4B3R I;  3J81 C;  4LF5 E;  5LMU I;  2JEB B;  2UXB E;  3LPS A;  4WUD A;  4K0K I;  4GKJ I;  4B3M I;  4FW6 A;  1HR0 E;  3ZKB A;  3K85 A;  2CGE A;  1H72 C;  4MU1 A;  2IOQ A;  1S16 A;  4MYT A;  4HXZ A;  2PNL A;  1NHJ A;  4X62 I;  4LOM A;  4PRX A;  1PIE A;  5DRO A;  1FNM A;  1IBL I;  5JEA A;  1XMO I;  1IBK E;  1YH8 A;  2UUC I;  4WUC A;  3M6A A;  3OTO I;  4DV7 E;  2V34 A;  1ZXM A;  4KHP I;  4JI7 I;  5K36 A;  1UDN A;  4LCG A;  4DR7 I;  3LNU A;  1ZM2 A;  1NHI A;  1Z0B A;  2DEI A;  1PKP A;  2JT2 A;  4URL A;  3WU4 A;  1J5E I;  4JI2 E;  5DNL A;  2E5L E;  4IFD C;  2F4V I;  3QT6 A;  4BA1 A;  4LFB E;  3V2U C;  2DEJ A;  3GLL A;  2CG9 A;  3P06 A;  3H1C A;  1Z0E A;  3T1H I;  5JEA E;  4DR3 I;  4B3M E;  3H4L A;  3UHM A;  1USU A;  1BKN A;  2X7I A;  3Q6N A;  2F1D A;  5ELW A;  2O3Z A;  1Y6Z A;  1KVK A;  3P76 A;  5DRP A;  3WU6 A;  3M7N G;  5C0X D;  2R42 A;  5IT9 C;  4HYM A;  4YHH E;  1I94 I;  2VQE E;  1UEK A;  2A2C A;  4FW5 A;  2UUC E;  1B63 A;  4OO1 D;  1XNQ E;  2O1U A;  4DR7 E;  4RPF A;  2R3V A;  1KKH A;  4EMD A;  4OO1 C;  5K36 C;  2PO1 B;  1YHC A;  2E5L I;  2VF3 A;  2HFS A;  5JEA D;  4OX9 E;  4MU3 A;  2ZM6 I;  1Z0T A;  1H73 A;  3PS3 A;  4IZJ B;  5GMD A;  4JI3 I;  4OO1 F;  3PRY A;  3M7N D;  4LF6 E;  4ISA A;  4Z7C A;  5LMN E;  2BR2 A;  4IZK A;  5FLX Q;  4DV6 E;  2JEA A;  4UTG A;  5C0X C;  4PRV A;  1ZM4 A;  2UXC I;  2C38 B;  4LFA E;  5BR8 E;  2HFU A;  4FN5 A;  1WUU A;  3PYF A;  3JAM Q;  1XNQ I;  2VQF I;  4B3T E;  3ZZT A;  4KHP E;  2E1R A;  3Q6M A;  4JI6 E;  4JI7 E;  1Y5Y A;  1HNX E;  4DR2 E;  4X64 I;  2AE8 A;  3KRN A;  2UUB E;  1H74 A;  4LF8 E;  3PYD A;  1RRE A;  2A2D A;  3ZZU A;  2V2V A;  2NN6 F;  4JI8 I;  4MQY A;  3V5R A;  2ZIT A;  4LFB I;  2JE6 A;  1FJG I;  3HUL A;  4P7A A;  1N33 E;  4JG4 A;  3QT7 A;  3J81 Q;  1OYS A;  1N36 E;  4LF7 E;  2EFG A;  1FWL A;  4IZJ D;  1IBL E;  4HAC B;  1IBK I;  5EL9 A;  1Z0G A;  1Y60 A;  3OTO E;  4DV7 I;  1N0U A;  3PS1 A;  1OYR A;  3B82 A;  3D4J A;  4DR5 I;  1Z5A A;  3M85 D;  4NXM E;  1P42 A;  2VES A;  1N34 E;  4GQU A;  3P3C A;  1HK7 A;  4DPY A;  4JI5 I;  4YY3 E;  4UT4 A;  5DRR A;  4DUY I;  4DR3 E;  4JI0 I;  1A6F A;  2XEX A;  3GCM A;  5FWK A;  4B3R E;  5A2Q Q;  4LF5 I;  4B3S I;  2GO4 A;  5FLX C;  4DU8 A;  4JYA I;  4GKJ E;  2Z5E A;  5L3J A;  4DV1 I;  1HNW I;  4DR6 I;  2C39 A;  4LCF A;  1XMQ E;  2C38 A;  5JEA C;  4FW4 A;  4JV5 I;  2C37 A;  2VQE I;  4X66 E;  1Z0C A;  4DR4 E;  3DD6 A;  3NZK A;  2J7K A;  4X62 E;  3M85 G;  4X65 E;  1QZR A;  4QNK A;  1KIJ A;  2PO0 A;  4DV4 I;  1H7U A;  2NPF A;  4DPX A;  5BR8 I;  2JEB A; 
#chains in the Genus database with same CATH homology
 4NBQ A;  2BR2 A;  5JEA F;  2JEA A;  5C0X C;  2PO1 A;  2NN6 D;  2C38 B;  2NN6 A;  1UDS A;  5K36 E;  2BA0 D;  4IFD F;  4IFD D;  5K36 F;  5JEA B;  4BA2 A;  2WNR A;  2JEB B;  4BA1 B;  1OYP A;  4OO1 B;  2WP8 B;  3U1K A;  1E3H A;  5C0X B;  3L7Z A;  4OO1 A;  4AM3 A;  1UDQ A;  2PO0 B;  1R6M A;  5JEA A;  3KRN A;  2JE6 B;  2NN6 E;  3HKM A;  2NN6 B;  2NN6 F;  2PO2 A;  3GME A;  2JE6 A;  1R6L A;  2JEA B;  5K36 A;  1UDN A;  1OYS A;  5C0X F;  3CDI A;  4BA2 B;  1UDO A;  2WNR B;  4IFD C;  4BA1 A;  1E3P A;  3GLL A;  1OYR A;  2BA1 G;  3B4T A;  3H1C A;  2PNZ B;  5JEA E;  5K36 B;  3M85 D;  4IFD B;  2C37 B;  4AID A;  2PNZ A;  2C39 B;  4AIM A;  2NN6 C;  3M7N G;  2BR2 B;  5C0X D;  5C0X E;  4OO1 E;  5C0X A;  3GCM A;  2WP8 A;  5K36 D;  4OO1 D;  2BA0 G;  2C39 A;  2C38 A;  2PO2 B;  5JEA C;  4IFD A;  2C37 A;  2BA1 D;  4OO1 C;  5K36 C;  2PO1 B;  3CDJ A;  3DD6 A;  4IFD E;  3L7Z B;  3M85 G;  5JEA D;  2PO0 A;  4OO1 F;  3M7N D;  2JEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...