2BR2A

Rnase ph core of the archaeal exosome
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Archaeal Exosome Core is a Hexameric Ring Structure with Three Catalytic Subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
total genus 79
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2br2A01
2BR2A 4IFDA 2WP8A 2PO1B 4OO1F 5K36A 5C0XB 2BA0D 3GLLA 3M85G 2NN6C 4OO1A 5C0XD 3DD6A 3B4TA 2WP8B 3L7ZB 3L7ZA 1R6MA 2JEBA 3CDIA 3M7NG 5C0XF 4BA2A 5K36F 4BA1A 3M85D 4OO1E 2BR2B 4AIDA 5C0XC 2JE6B 2JE6A 1OYRA 4NBQA 5JEAF 2PNZA 2C38A 5K36B 2PO2B 1E3HA 2PNZB 2PO0A 1UDQA 2C37A 5JEAC 3HKMA 2WNRB 3U1KA 2C39B 1OYSA 5JEAE 2WNRA 2BA1D 1UDSA 1UDNA 2NN6B 5K36C 4IFDD 4IFDC 5K36D 2C37B 5C0XA 5K36E 2JEAB 2C39A 4IFDF 2C38B 2NN6E 2JEBB 2JEAA 2BA1G 2NN6D 5JEAB 4OO1D 1OYPA 3GCMA 1E3PA 4BA1B 4IFDB 4AIMA 2NN6A 4OO1C 1R6LA 3CDJA 3KRNA 2PO0B 5C0XE 2PO1A 2PO2A 2BA0G 4OO1B 4AM3A 3H1CA 4BA2B 3M7ND 5JEAA 3GMEA 1UDOA 5JEAD 4IFDE 2NN6F
chains in the Genus database with same CATH superfamily
4LF4I 1N33E 2BR2A 4DR7E 2PO1B 3LTOA 1ZM9A 1J5EE 4DPXA 4U3DA 2BA0D 3PS3A 3P06A 3B4TA 4K0KE 2NPFA 1RHYA 2JEBA 4IZKB 4PRVA 5IWAI 1NHIA 1Z0EA 4DV0E 5GMDA 4DV1E 4OKGA 5A2QC 5K36F 3OTOI 2BR2B 2O1TA 4DV7E 4AIDA 3F0NA 4DR2I 2JE6B 1XMOE 4NXMI 2JE6A 2AE8A 2HFSA 4YY3I 4DUYI 1XNRE 4DU8A 1HR0I 2PO2B 4OX9I 1FNMA 2X36A 4IZKA 5IT9Q 5FLXQ 3PS1A 3Q6MA 4DV5I 4MU1A 2UXCE 2R42A 4JI0I 1OJ4A 1HNZE 2A2CA 4LF6E 3J81C 1XXEA 2WNRA 4MYUA 1Z5AA 3M6AA 3K1JA 4DR2E 1EA6A 1N32E 2J65A 1HNWI 1I94I 4IFDD 4X62E 2Z5BB 4DV3I 1P42A 5K36E 4DR6E 3QT7A 2UXBE 4P52A 4JI8E 4B3TI 3ZZUA 2BM0A 2JEBB 2UU9I 2NN6D 1Y4UA 4MU3A 1OYPA 2VQFE 1E3PA 5DRRA 2V2ZA 4MU0A 4IFDB 1I94E 2F4VE 3HULA 3K85A 1U2RA 1HNXE 3J7AM 4B3RI 1RREA 2HHHI 2OI2A 1ZM2A 2ZM6I 2PO1A 5LMNE 2PO2A 2BA0G 4IZJB 4FWGA 4XTJA 3WU3A 4LPFA 4GKKE 1PIEA 2O3ZA 1BKNA 4JV5E 3H1CA 1IBLE 4GKJI 1FKAE 3CWVA 1KTVA 4ZVIA 4OZEA 1FWLA 4NXNI 1PVGA 1UDOA 4I3HA 1Y6ZA 4B3RE 4YHHI 5ELWA 4IFDA 4DR5E 2UXDE 3B78A 5C0XB 2O1VA 3ZKDA 4DUZI 3M85G 1ZM4A 3GONA 1EI1A 2F1DA 1XMOI 2BV3A 4DR3E 1FJGE 3L7ZB 5L3JA 1R6MA 4DV0I 4GKJE 3V5RA 3CDIA 4JG4A 4USKA 5BR8I 4LCGA 4JI4E 2A2DA 2HK2A 4OO1E 4JI1E 4LF9E 4YHHE 1XHKA 1HK7A 4NXME 3Q1QA 4FWDA 5A2QQ 4LF8I 4MYTA 4HACB 4JI7I 5JEAF 2PNZA 1A6FA 3PYEA 2Z5BA 4B3ME 3B8HA 1HNWE 1N32I 2PO0A 2HKJA 2C37A 3HKMA 5BR8E 2WNRB 3U1KA 4X66I 1Z0CA 5FWKA 4LF9I 1MX0A 1MU5A 2Z5CB 2BA1D 1B63A 1KKHA 1UDNA 2NN6B 4WUBA 5DRQA 1H7UA 4JI7E 3P3GA 4IS9A 3T1HE 5DNXA 1K47A 2Q2EB 4LFAE 2HKEA 2JEAB 2C38B 2UU9E 1KIJA 1NZ0A 2HHHE 4JI6E 1J5EI 3JAMQ 4U3BA 4LF7I 5DNLA 3GCMA 4AQYI 5GMEA 4BA1B 3T1YE 1RR9A 4HXZA 1Z59A 2NN6A 4LCHA 3T1HI 1R6LA 3CDJA 2JT2A 1FI4A 2J7KA 1N0VC 2VQEE 4OO1B 2AJ4A 3PRYA 3WU4A 4QNJA 3P76A 1USUA 2O1WA 4DV4I 2R3VA 4LCFA 4LF5I 2PNMA 4NXNE 4DR3I 4BA2B 1FJGI 3T1YI 4J3DA 4DV5E 1D6TA 1B62A 4IFDE 4X64I 1N36E 1H7SA 1HNZI 4LF6I 4JI4I 3WU6A 5IT9C 4IZJD 2WP8A 2GO4A 4OO1F 1Z0BA 1H72C 2NN6C 2GQ0A 3DD6A 1Z5CA 2E1RA 3PS2A 2HFUA 1IBKI 3LPSA 4KHPE 1KVKA 4DV6E 1ZM3A 5C0XF 4JI1I 4BA1A 3M85D 1UEKA 4LOMA 2CVEA 2LJPA 4X65I 1IBME 2IOQA 4WUDA 1OYRA 4B3MI 2Z5EA 5EKWA 4HACA 2PNZB 5JEAC 2ZM6E 1QZRA 1Y4SA 3K17A 1OYSA 3P3CA 4MU4A 4DR7I 3H4LA 5JEAE 3P3EA 2X7IA 1S4EA 4JV5I 4FWHA 1IBMI 5K36C 3QT5A 4DPWA 4LFAI 4IFDC 5C0XA 3PYGA 3ZZTA 4USMA 2WW4A 2CG9A 4LFBI 4DV7I 2UXDI 2JEAA 2VESA 4DR1E 4DPYA 4DV2I 4OO1D 4DUYE 1XNRI 4JYAI 1HR0E 5LMUE 4OX9E 4FW7A 1XMQI 4OO1C 3J7AG 1Z5BA 2GO3A 3KRNA 1ZXNA 2EFGA 3PYFA 2UXCI 2VQEI 4JI2I 4LFCI 3PYDA 4WUCA 1VISA 4Z7YA 4FW6A 2CZ9A 2DEIA 4LF8E 4DR4E 4DV4E 1XNQE 1WUUA 4LF5E 1Y5YA 1N34E 4FW3A 1PKPA 1Z0VA 2V2VA 5LMUI 2UUAI 3M7ND 4X64E 1N36I 3GMEA 4DV3E 3V2UC 4JI5E 4RPFA 1N0UA 2UXBI 4JI3I 4FW9A 4IZJA 4LF4E 1NHJA 2ZBKB 5K36A 4PU9A 4KQVA 3GLLA 5DROA 4OO1A 2DEJA 5C0XD 2WP8B 3L7ZA 1IBKE 4K0KI 4N3OA 2VF3A 4DV6I 3M7NG 3Q6NA 4DU7A 1N33I 2UUAE 1HNXI 1DARA 4BA2A 4HY1A 5EL9A 1NHHA 4JI6I 2V34A 4JI3E 3UHMA 4LF7E 5C0XC 4URLA 4AQYE 4GKKI 4MQYA 2UUCI 4NBQA 1H73A 2PNLA 2C38A 5K36B 1E3HA 4ISAA 4FW4A 3J81Q 1FWKA 3ZKBA 2HK3A 4DPUA 1UDQA 4ED4A 3QT6A 2IERA 1YHCA 3OTOE 4DXLA 3J80Q 1USVA 2C39B 5LL6R 3LNUA 3D4JA 4YY3E 2E5LE 2ZITA 2BM1A 4DR5I 4LFBE 2GS8A 1UDSA 4M1KA 4DUZE 4FW5A 3HJCA 2UUBI 4DR1I 2UUCE 5FLXC 4DV2E 4B3SI 2V8PA 5K36D 2C37B 3ZM7A 1Z0GA 4X62I 4JI0E 4P7AA 2C39A 4MDTA 4IFDF 4EMDA 4DR6I 2NN6E 4FN5A 4B3TE 1Z0TA 2BA1G 1VI7A 4UT4A 4LFCE 5JEAB 2E5LI 4HYMA 4JYAE 2V2QA 2UUBE 1ZXMA 1Z0WA 2O1UA 3B82A 3QT8A 2VQFI 1XMQE 4DR4I 4R1FA 4AIMA 1YH8A 4KHPI 4Z7CA 4B3SE 4JI8I 2Z5CA 4PRXA 2F4VI 1ELOA 2XEXA 4JI2E 2PO0B 2CGEA 5C0XE 4UTGA 3ZZ0A 1H74A 4X66E 3NZKA 4GQUA 2IESA 3WU5A 4QNKA 4X65E 4JI5I 4AM3A 1XNQI 1N34I 5DRPA 5IWAE 3J80C 1S16A 1IBLI 4DPTA 4DV1I 3JAMC 5JEAA 3U1YA 5LMNI 1Y60A 2IOPA 5JEAD 2NN6F 1MG7A
chains in the Genus database with same CATH topology
2BR2A 4IFDA 2WP8A 2PO1B 4OO1F 5K36A 5C0XB 2BA0D 3GLLA 3M85G 2NN6C 4OO1A 5C0XD 3DD6A 3B4TA 2WP8B 3L7ZB 3L7ZA 1R6MA 2JEBA 3CDIA 3M7NG 5C0XF 4BA2A 5K36F 4BA1A 3M85D 4OO1E 2BR2B 4AIDA 5C0XC 2JE6B 2JE6A 1OYRA 4NBQA 5JEAF 2PNZA 2C38A 5K36B 2PO2B 1E3HA 2PNZB 2PO0A 1UDQA 2C37A 5JEAC 3HKMA 2WNRB 3U1KA 2C39B 1OYSA 5JEAE 2WNRA 2BA1D 1UDSA 1UDNA 2NN6B 5K36C 4IFDD 4IFDC 5K36D 2C37B 5C0XA 5K36E 2JEAB 2C39A 4IFDF 2C38B 2NN6E 2JEBB 2JEAA 2BA1G 2NN6D 5JEAB 4OO1D 1OYPA 3GCMA 1E3PA 4BA1B 4IFDB 4AIMA 2NN6A 4OO1C 1R6LA 3CDJA 3KRNA 2PO0B 5C0XE 2PO1A 2PO2A 2BA0G 4OO1B 4AM3A 3H1CA 4BA2B 3M7ND 5JEAA 3GMEA 1UDOA 5JEAD 4IFDE 2NN6F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR2 A;  4IFD A;  2WP8 A;  2PO1 B;  4OO1 F;  5K36 A;  5C0X B;  2BA0 D;  3GLL A;  3M85 G;  2NN6 C;  4OO1 A;  5C0X D;  3DD6 A;  3B4T A;  2WP8 B;  3L7Z B;  3L7Z A;  1R6M A;  2JEB A;  3CDI A;  3M7N G;  5C0X F;  4BA2 A;  5K36 F;  4BA1 A;  3M85 D;  4OO1 E;  2BR2 B;  4AID A;  5C0X C;  2JE6 B;  2JE6 A;  1OYR A;  4NBQ A;  5JEA F;  2PNZ A;  2C38 A;  5K36 B;  2PO2 B;  1E3H A;  2PNZ B;  2PO0 A;  1UDQ A;  2C37 A;  5JEA C;  3HKM A;  2WNR B;  3U1K A;  2C39 B;  1OYS A;  5JEA E;  2WNR A;  2BA1 D;  1UDS A;  1UDN A;  2NN6 B;  5K36 C;  4IFD D;  4IFD C;  5K36 D;  2C37 B;  5C0X A;  5K36 E;  2JEA B;  2C39 A;  4IFD F;  2C38 B;  2NN6 E;  2JEB B;  2JEA A;  2BA1 G;  2NN6 D;  5JEA B;  4OO1 D;  1OYP A;  3GCM A;  1E3P A;  4BA1 B;  4IFD B;  4AIM A;  2NN6 A;  4OO1 C;  1R6L A;  3CDJ A;  3KRN A;  2PO0 B;  5C0X E;  2PO1 A;  2PO2 A;  2BA0 G;  4OO1 B;  4AM3 A;  3H1C A;  4BA2 B;  3M7N D;  5JEA A;  3GME A;  1UDO A;  5JEA D;  4IFD E;  2NN6 F; 
#chains in the Genus database with same CATH topology
 4LF4 I;  1N33 E;  2BR2 A;  4DR7 E;  2PO1 B;  3LTO A;  1ZM9 A;  1J5E E;  4DPX A;  4U3D A;  2BA0 D;  3PS3 A;  3P06 A;  3B4T A;  4K0K E;  2NPF A;  1RHY A;  2JEB A;  4IZK B;  4PRV A;  5IWA I;  1NHI A;  1Z0E A;  4DV0 E;  5GMD A;  4DV1 E;  4OKG A;  5A2Q C;  5K36 F;  3OTO I;  2BR2 B;  2O1T A;  4DV7 E;  4AID A;  3F0N A;  4DR2 I;  2JE6 B;  1XMO E;  4NXM I;  2JE6 A;  2AE8 A;  2HFS A;  4YY3 I;  4DUY I;  1XNR E;  4DU8 A;  1HR0 I;  2PO2 B;  4OX9 I;  1FNM A;  2X36 A;  4IZK A;  5IT9 Q;  5FLX Q;  3PS1 A;  3Q6M A;  4DV5 I;  4MU1 A;  2UXC E;  2R42 A;  4JI0 I;  1OJ4 A;  1HNZ E;  2A2C A;  4LF6 E;  3J81 C;  1XXE A;  2WNR A;  4MYU A;  1Z5A A;  3M6A A;  3K1J A;  4DR2 E;  1EA6 A;  1N32 E;  2J65 A;  1HNW I;  1I94 I;  4IFD D;  4X62 E;  2Z5B B;  4DV3 I;  1P42 A;  5K36 E;  4DR6 E;  3QT7 A;  2UXB E;  4P52 A;  4JI8 E;  4B3T I;  3ZZU A;  2BM0 A;  2JEB B;  2UU9 I;  2NN6 D;  1Y4U A;  4MU3 A;  1OYP A;  2VQF E;  1E3P A;  5DRR A;  2V2Z A;  4MU0 A;  4IFD B;  1I94 E;  2F4V E;  3HUL A;  3K85 A;  1U2R A;  1HNX E;  3J7A M;  4B3R I;  1RRE A;  2HHH I;  2OI2 A;  1ZM2 A;  2ZM6 I;  2PO1 A;  5LMN E;  2PO2 A;  2BA0 G;  4IZJ B;  4FWG A;  4XTJ A;  3WU3 A;  4LPF A;  4GKK E;  1PIE A;  2O3Z A;  1BKN A;  4JV5 E;  3H1C A;  1IBL E;  4GKJ I;  1FKA E;  3CWV A;  1KTV A;  4ZVI A;  4OZE A;  1FWL A;  4NXN I;  1PVG A;  1UDO A;  4I3H A;  1Y6Z A;  4B3R E;  4YHH I;  5ELW A;  4IFD A;  4DR5 E;  2UXD E;  3B78 A;  5C0X B;  2O1V A;  3ZKD A;  4DUZ I;  3M85 G;  1ZM4 A;  3GON A;  1EI1 A;  2F1D A;  1XMO I;  2BV3 A;  4DR3 E;  1FJG E;  3L7Z B;  5L3J A;  1R6M A;  4DV0 I;  4GKJ E;  3V5R A;  3CDI A;  4JG4 A;  4USK A;  5BR8 I;  4LCG A;  4JI4 E;  2A2D A;  2HK2 A;  4OO1 E;  4JI1 E;  4LF9 E;  4YHH E;  1XHK A;  1HK7 A;  4NXM E;  3Q1Q A;  4FWD A;  5A2Q Q;  4LF8 I;  4MYT A;  4HAC B;  4JI7 I;  5JEA F;  2PNZ A;  1A6F A;  3PYE A;  2Z5B A;  4B3M E;  3B8H A;  1HNW E;  1N32 I;  2PO0 A;  2HKJ A;  2C37 A;  3HKM A;  5BR8 E;  2WNR B;  3U1K A;  4X66 I;  1Z0C A;  5FWK A;  4LF9 I;  1MX0 A;  1MU5 A;  2Z5C B;  2BA1 D;  1B63 A;  1KKH A;  1UDN A;  2NN6 B;  4WUB A;  5DRQ A;  1H7U A;  4JI7 E;  3P3G A;  4IS9 A;  3T1H E;  5DNX A;  1K47 A;  2Q2E B;  4LFA E;  2HKE A;  2JEA B;  2C38 B;  2UU9 E;  1KIJ A;  1NZ0 A;  2HHH E;  4JI6 E;  1J5E I;  3JAM Q;  4U3B A;  4LF7 I;  5DNL A;  3GCM A;  4AQY I;  5GME A;  4BA1 B;  3T1Y E;  1RR9 A;  4HXZ A;  1Z59 A;  2NN6 A;  4LCH A;  3T1H I;  1R6L A;  3CDJ A;  2JT2 A;  1FI4 A;  2J7K A;  1N0V C;  2VQE E;  4OO1 B;  2AJ4 A;  3PRY A;  3WU4 A;  4QNJ A;  3P76 A;  1USU A;  2O1W A;  4DV4 I;  2R3V A;  4LCF A;  4LF5 I;  2PNM A;  4NXN E;  4DR3 I;  4BA2 B;  1FJG I;  3T1Y I;  4J3D A;  4DV5 E;  1D6T A;  1B62 A;  4IFD E;  4X64 I;  1N36 E;  1H7S A;  1HNZ I;  4LF6 I;  4JI4 I;  3WU6 A;  5IT9 C;  4IZJ D;  2WP8 A;  2GO4 A;  4OO1 F;  1Z0B A;  1H72 C;  2NN6 C;  2GQ0 A;  3DD6 A;  1Z5C A;  2E1R A;  3PS2 A;  2HFU A;  1IBK I;  3LPS A;  4KHP E;  1KVK A;  4DV6 E;  1ZM3 A;  5C0X F;  4JI1 I;  4BA1 A;  3M85 D;  1UEK A;  4LOM A;  2CVE A;  2LJP A;  4X65 I;  1IBM E;  2IOQ A;  4WUD A;  1OYR A;  4B3M I;  2Z5E A;  5EKW A;  4HAC A;  2PNZ B;  5JEA C;  2ZM6 E;  1QZR A;  1Y4S A;  3K17 A;  1OYS A;  3P3C A;  4MU4 A;  4DR7 I;  3H4L A;  5JEA E;  3P3E A;  2X7I A;  1S4E A;  4JV5 I;  4FWH A;  1IBM I;  5K36 C;  3QT5 A;  4DPW A;  4LFA I;  4IFD C;  5C0X A;  3PYG A;  3ZZT A;  4USM A;  2WW4 A;  2CG9 A;  4LFB I;  4DV7 I;  2UXD I;  2JEA A;  2VES A;  4DR1 E;  4DPY A;  4DV2 I;  4OO1 D;  4DUY E;  1XNR I;  4JYA I;  1HR0 E;  5LMU E;  4OX9 E;  4FW7 A;  1XMQ I;  4OO1 C;  3J7A G;  1Z5B A;  2GO3 A;  3KRN A;  1ZXN A;  2EFG A;  3PYF A;  2UXC I;  2VQE I;  4JI2 I;  4LFC I;  3PYD A;  4WUC A;  1VIS A;  4Z7Y A;  4FW6 A;  2CZ9 A;  2DEI A;  4LF8 E;  4DR4 E;  4DV4 E;  1XNQ E;  1WUU A;  4LF5 E;  1Y5Y A;  1N34 E;  4FW3 A;  1PKP A;  1Z0V A;  2V2V A;  5LMU I;  2UUA I;  3M7N D;  4X64 E;  1N36 I;  3GME A;  4DV3 E;  3V2U C;  4JI5 E;  4RPF A;  1N0U A;  2UXB I;  4JI3 I;  4FW9 A;  4IZJ A;  4LF4 E;  1NHJ A;  2ZBK B;  5K36 A;  4PU9 A;  4KQV A;  3GLL A;  5DRO A;  4OO1 A;  2DEJ A;  5C0X D;  2WP8 B;  3L7Z A;  1IBK E;  4K0K I;  4N3O A;  2VF3 A;  4DV6 I;  3M7N G;  3Q6N A;  4DU7 A;  1N33 I;  2UUA E;  1HNX I;  1DAR A;  4BA2 A;  4HY1 A;  5EL9 A;  1NHH A;  4JI6 I;  2V34 A;  4JI3 E;  3UHM A;  4LF7 E;  5C0X C;  4URL A;  4AQY E;  4GKK I;  4MQY A;  2UUC I;  4NBQ A;  1H73 A;  2PNL A;  2C38 A;  5K36 B;  1E3H A;  4ISA A;  4FW4 A;  3J81 Q;  1FWK A;  3ZKB A;  2HK3 A;  4DPU A;  1UDQ A;  4ED4 A;  3QT6 A;  2IER A;  1YHC A;  3OTO E;  4DXL A;  3J80 Q;  1USV A;  2C39 B;  5LL6 R;  3LNU A;  3D4J A;  4YY3 E;  2E5L E;  2ZIT A;  2BM1 A;  4DR5 I;  4LFB E;  2GS8 A;  1UDS A;  4M1K A;  4DUZ E;  4FW5 A;  3HJC A;  2UUB I;  4DR1 I;  2UUC E;  5FLX C;  4DV2 E;  4B3S I;  2V8P A;  5K36 D;  2C37 B;  3ZM7 A;  1Z0G A;  4X62 I;  4JI0 E;  4P7A A;  2C39 A;  4MDT A;  4IFD F;  4EMD A;  4DR6 I;  2NN6 E;  4FN5 A;  4B3T E;  1Z0T A;  2BA1 G;  1VI7 A;  4UT4 A;  4LFC E;  5JEA B;  2E5L I;  4HYM A;  4JYA E;  2V2Q A;  2UUB E;  1ZXM A;  1Z0W A;  2O1U A;  3B82 A;  3QT8 A;  2VQF I;  1XMQ E;  4DR4 I;  4R1F A;  4AIM A;  1YH8 A;  4KHP I;  4Z7C A;  4B3S E;  4JI8 I;  2Z5C A;  4PRX A;  2F4V I;  1ELO A;  2XEX A;  4JI2 E;  2PO0 B;  2CGE A;  5C0X E;  4UTG A;  3ZZ0 A;  1H74 A;  4X66 E;  3NZK A;  4GQU A;  2IES A;  3WU5 A;  4QNK A;  4X65 E;  4JI5 I;  4AM3 A;  1XNQ I;  1N34 I;  5DRP A;  5IWA E;  3J80 C;  1S16 A;  1IBL I;  4DPT A;  4DV1 I;  3JAM C;  5JEA A;  3U1Y A;  5LMN I;  1Y60 A;  2IOP A;  5JEA D;  2NN6 F;  1MG7 A; 
#chains in the Genus database with same CATH homology
 2BR2 A;  4IFD A;  2WP8 A;  2PO1 B;  4OO1 F;  5K36 A;  5C0X B;  2BA0 D;  3GLL A;  3M85 G;  2NN6 C;  4OO1 A;  5C0X D;  3DD6 A;  3B4T A;  2WP8 B;  3L7Z B;  3L7Z A;  1R6M A;  2JEB A;  3CDI A;  3M7N G;  5C0X F;  4BA2 A;  5K36 F;  4BA1 A;  3M85 D;  4OO1 E;  2BR2 B;  4AID A;  5C0X C;  2JE6 B;  2JE6 A;  1OYR A;  4NBQ A;  5JEA F;  2PNZ A;  2C38 A;  5K36 B;  2PO2 B;  1E3H A;  2PNZ B;  2PO0 A;  1UDQ A;  2C37 A;  5JEA C;  3HKM A;  2WNR B;  3U1K A;  2C39 B;  1OYS A;  5JEA E;  2WNR A;  2BA1 D;  1UDS A;  1UDN A;  2NN6 B;  5K36 C;  4IFD D;  4IFD C;  5K36 D;  2C37 B;  5C0X A;  5K36 E;  2JEA B;  2C39 A;  4IFD F;  2C38 B;  2NN6 E;  2JEB B;  2JEA A;  2BA1 G;  2NN6 D;  5JEA B;  4OO1 D;  1OYP A;  3GCM A;  1E3P A;  4BA1 B;  4IFD B;  4AIM A;  2NN6 A;  4OO1 C;  1R6L A;  3CDJ A;  3KRN A;  2PO0 B;  5C0X E;  2PO1 A;  2PO2 A;  2BA0 G;  4OO1 B;  4AM3 A;  3H1C A;  4BA2 B;  3M7N D;  5JEA A;  3GME A;  1UDO A;  5JEA D;  4IFD E;  2NN6 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...