2BR2A

Rnase ph core of the archaeal exosome
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
260
Chain Sequence
b'MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
molecule tags Hydrolase
source organism Sulfolobus solfataricus
publication title The Archaeal Exosome Core is a Hexameric Ring Structure with Three Catalytic Subunits.
pubmed doi rcsb
total genus 79
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2br2A01
2PNZB 1OYRA 2C37A 2C38A 5K36A 3CDJA 3CDIA 4AM3A 2C37B 5C0XC 3DD6A 3H1CA 1UDOA 4OO1F 1R6MA 4BA1B 2PO1B 2JEAB 3L7ZB 4IFDD 4OO1C 5C0XE 1E3PA 3B4TA 3U1KA 4AIDA 1UDNA 2NN6B 4OO1E 4AIMA 2BR2B 5K36F 2NN6A 2JE6B 2PO0A 3L7ZA 4IFDA 2BA1G 5JEAF 1UDQA 2JEBA 3M7NG 2PO2A 3KRNA 2JEAA 4BA2B 3M85D 5JEAC 4NBQA 5JEAD 5JEAB 2PNZA 5JEAE 2BA1D 2WNRA 3GLLA 3M7ND 2PO2B 5K36B 2NN6F 5K36D 2WNRB 4BA2A 2C39A 5K36C 4IFDE 5C0XD 5C0XF 4IFDB 5C0XB 4IFDF 2PO0B 1OYPA 3GMEA 5JEAA 3HKMA 2NN6C 2WP8A 1UDSA 2C38B 1E3HA 4OO1B 2JE6A 2BA0D 2JEBB 4IFDC 3GCMA 3M85G 4BA1A 2WP8B 2PO1A 2BR2A 2NN6E 2NN6D 4OO1A 1OYSA 2BA0G 5C0XA 4OO1D 2C39B 1R6LA 5K36E
chains in the Genus database with same CATH superfamily
4GKKI 2V34A 2V2QA 1IBKE 1H7SA 1EI1A 4JG4A 1PKPA 3V5RA 3WU6A 5K36A 5DNXA 2CG9A 3UHMA 2LJPA 1IBLE 1RHYA 1H73A 3Q1QA 1XMOE 3DD6A 1Z5CA 3P06A 1IBME 4JYAE 3H1CA 2BM0A 4LF7I 2Z5CA 1KKHA 1R6MA 4WUDA 5GMDA 4JI1E 4URLA 1XNRE 4DUZE 5FWKA 1Z0BA 4PU9A 4DR3E 4IFDD 4FW3A 4DV6I 1WUUA 4AIDA 4QNJA 2V2ZA 4DR7I 1DARA 2ZM6E 1NHHA 3PYDA 4KHPE 4DV6E 2Z5EA 4IFDA 3U1YA 2A2DA 1UEKA 3QT8A 2JEBA 1MU5A 3KRNA 4P7AA 2UU9I 4USMA 3PS3A 3PRYA 5LL6R 4FW6A 1OJ4A 5JEAD 5FLXQ 4DR1I 2IOQA 4YY3I 2AE8A 2IOPA 3B8HA 3ZKDA 2UXDI 2Z5BA 5K36B 4DR1E 2Z5BB 5K36D 2XEXA 3J80C 4X65E 2E1RA 1K47A 4OZEA 1USUA 4DR5E 1OYPA 3GMEA 4DV0E 2C38B 4DV3E 2JT2A 4JI8E 4WUBA 1KVKA 1HR0E 1IBLI 2JEBB 3T1YI 3P3CA 4HACA 1HNXI 4JYAI 1USVA 3OTOI 4DUYE 4DV4E 4BA1A 2CZ9A 5DRPA 4MYTA 4UTGA 4JI6E 4JI1I 1XXEA 2GQ0A 4DV4I 4DUZI 1OYSA 5C0XA 4IZKA 1N34I 4JV5E 1RREA 1S16A 1FJGI 5A2QC 3J80Q 4FWDA 2PNZB 3LPSA 4MQYA 4IZJA 4FW4A 1OYRA 2A2CA 2C37A 3D4JA 4FWHA 5DNLA 1XMQE 2UUCE 4JI4I 4GKJI 1N32I 5EKWA 4MU0A 1ZM9A 2GO3A 1XNRI 3CDIA 4JI7E 5FLXC 4USKA 4LOMA 1HNWI 2UUCI 2UXCI 2HKEA 3QT6A 1ZXMA 5LMUI 4LFCI 4JI5I 4B3ME 2BM1A 4GQUA 1UDOA 2ZM6I 4M1KA 4ISAA 2UXCE 2VF3A 1ZM2A 4HXZA 3T1HE 4DV1E 4DR6E 4LF4E 5BR8I 4BA1B 3P3GA 2JEAB 4OO1C 5A2QQ 2UU9E 3T1HI 3U1KA 2UUBI 4AIMA 3ZKBA 2NN6A 1Z5BA 1Y4UA 3P76A 4JI0I 4PRXA 2R42A 3L7ZA 2HK2A 2UUBE 1MX0A 5JEAF 3HULA 1HK7A 4JI3E 4JI2E 1I94E 2F1DA 3WU4A 2PO2A 4MU1A 3QT7A 4Z7YA 4MDTA 4BA2B 1FWKA 5DRQA 3M85D 5JEAC 2HK3A 4P52A 4JI3I 4NBQA 1H7UA 2PNZA 5JEAB 2V8PA 4X64E 2BA1D 2X7IA 4DV3I 4JI6I 2PO2B 2X36A 4DU8A 4N3OA 4UT4A 3H4LA 4BA2A 4B3TI 1YHCA 4IFDE 3Q6MA 4EMDA 4DV5E 2GS8A 1HNXE 4LF5E 2PO0B 1N36E 5IT9C 4JI4E 1Z0WA 3V2UC 4B3TE 1ELOA 3NZKA 4LFBI 4NXNI 1IBMI 4LCGA 4DV7E 4NXME 4AQYI 1N34E 2O1TA 1NHJA 4JV5I 1HNWE 1B62A 2CGEA 3ZZTA 3J81Q 4IFDC 4NXNE 5LMUE 2O1UA 3K1JA 3PS1A 4NXMI 3ZZUA 1N32E 1J5EE 3M6AA 2WP8B 2BR2A 4YHHE 2J65A 2NN6D 2OI2A 2HKJA 4LF6I 5BR8E 3F0NA 4DPWA 4OO1D 2R3VA 4JI5E 4LFCE 5K36E 4B3MI 1Z0TA 4LF6E 4DR2E 3ZM7A 1Y5YA 5L3JA 2C38A 4LFAI 1H74A 4DV1I 4DR6I 4LF4I 3CDJA 4JI2I 4FW9A 4AM3A 3JAMQ 2C37B 5C0XC 1RR9A 1XNQE 2UXDE 4U3DA 1VI7A 1VISA 4HACB 2HFSA 1XNQI 2VQFI 5ELWA 1YH8A 1I94I 1Z0CA 3L7ZB 1D6TA 5C0XE 2O1WA 3JAMC 1ZM4A 3B4TA 1MG7A 5K36F 3Q6NA 4ED4A 1N33I 4B3SE 1H72C 2JE6B 4X64I 2PO0A 2Q2EB 2BA1G 2HHHE 4GKKE 4DPYA 2EFGA 1UDQA 3PYFA 2VQEI 3M7NG 1BKNA 4B3RI 4XTJA 3QT5A 1FI4A 4LCFA 4DU7A 2JEAA 2IERA 4LF5I 1PVGA 2BV3A 1U2RA 4B3RE 5LMNI 4LFBE 5IWAE 1XMOI 4DV7I 5GMEA 2WNRA 4AQYE 2PNMA 3GLLA 4DV2I 2O3ZA 2WNRB 1HNZI 2C39A 4IS9A 5EL9A 4LF8I 5C0XF 4IFDF 1B63A 3P3EA 4IZJB 4JI7I 4DR2I 1J5EI 4OKGA 1N0VC 3HKMA 1HNZE 4X66I 4DR4I 2NN6C 4LF8E 2UXBI 1E3HA 4I3HA 4ZVIA 4DR7E 3LNUA 4KHPI 2J7KA 1P42A 2UXBE 4LCHA 4OX9E 3PYEA 3GCMA 4HY1A 3M85G 2DEJA 4LFAE 3J81C 3LTOA 1EA6A 2NN6E 1NHIA 1ZM3A 2V2VA 2Z5CB 2BA0G 2AJ4A 1N0UA 3B82A 2C39B 2ZBKB 4YY3E 4X62E 2E5LE 1N33E 4Z7CA 4FWGA 4IZJD 2VQFE 4X65I 2DEIA 2CVEA 4X62I 4LF9I 3J7AG 1Y4SA 3K85A 4FW5A 1FWLA 5DRRA 4MYUA 4KQVA 4OO1F 4DPXA 4RPFA 4B3SI 1Y6ZA 3T1YE 4QNKA 2O1VA 4DV5I 1N36I 2VQEE 3OTOE 4DUYI 2PO1B 1Z0VA 4DV2E 1E3PA 1ZXNA 1XHKA 3HJCA 1UDNA 2NN6B 4DPTA 2F4VI 4OO1E 2BR2B 1IBKI 5LMNE 4LF7E 4FN5A 4HYMA 1FJGE 1PIEA 5IWAI 2ZITA 4DR4E 2F4VE 1Y60A 3PS2A 4R1FA 3WU3A 2WW4A 4YHHI 4MU4A 4LPFA 1XMQI 4GKJE 4OX9I 4PRVA 1NZ0A 1QZRA 5JEAE 1Z59A 4X66E 2VESA 1Z0EA 4U3BA 3M7ND 1Z5AA 4DR3I 2NN6F 5K36C 3PYGA 1KIJA 2NPFA 1FKAE 2UUAI 4K0KE 5C0XD 4DPUA 4IFDB 5C0XB 1A6FA 3GONA 3B78A 5JEAA 4WUCA 4MU3A 2HFUA 2UUAE 1UDSA 2WP8A 4IZKB 4K0KI 4OO1B 4DXLA 5IT9Q 2JE6A 2BA0D 4LF9E 4JI0E 2GO4A 3K17A 3J7AM 4DR5I 1KTVA 1FNMA 2E5LI 3ZZ0A 4DV0I 5DROA 2PO1A 2IESA 2PNLA 1S4EA 3CWVA 4OO1A 3WU5A 4J3DA 4FW7A 4JI8I 1HR0I 1Z0GA 1R6LA 2HHHI
chains in the Genus database with same CATH topology
2PNZB 1OYRA 2C37A 2C38A 5K36A 3CDJA 3CDIA 4AM3A 2C37B 5C0XC 3DD6A 3H1CA 1UDOA 4OO1F 1R6MA 4BA1B 2PO1B 2JEAB 3L7ZB 4IFDD 4OO1C 5C0XE 1E3PA 3B4TA 3U1KA 4AIDA 1UDNA 2NN6B 4OO1E 4AIMA 2BR2B 5K36F 2NN6A 2JE6B 2PO0A 3L7ZA 4IFDA 2BA1G 5JEAF 1UDQA 2JEBA 3M7NG 2PO2A 3KRNA 2JEAA 4BA2B 3M85D 5JEAC 4NBQA 5JEAD 5JEAB 2PNZA 5JEAE 2BA1D 2WNRA 3GLLA 3M7ND 2PO2B 5K36B 2NN6F 5K36D 2WNRB 4BA2A 2C39A 5K36C 4IFDE 5C0XD 5C0XF 4IFDB 5C0XB 4IFDF 2PO0B 1OYPA 3GMEA 5JEAA 3HKMA 2NN6C 2WP8A 1UDSA 2C38B 1E3HA 4OO1B 2JE6A 2BA0D 2JEBB 4IFDC 3GCMA 3M85G 4BA1A 2WP8B 2PO1A 2BR2A 2NN6E 2NN6D 4OO1A 1OYSA 2BA0G 5C0XA 4OO1D 2C39B 1R6LA 5K36E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNZ B;  1OYR A;  2C37 A;  2C38 A;  5K36 A;  3CDJ A;  3CDI A;  4AM3 A;  2C37 B;  5C0X C;  3DD6 A;  3H1C A;  1UDO A;  4OO1 F;  1R6M A;  4BA1 B;  2PO1 B;  2JEA B;  3L7Z B;  4IFD D;  4OO1 C;  5C0X E;  1E3P A;  3B4T A;  3U1K A;  4AID A;  1UDN A;  2NN6 B;  4OO1 E;  4AIM A;  2BR2 B;  5K36 F;  2NN6 A;  2JE6 B;  2PO0 A;  3L7Z A;  4IFD A;  2BA1 G;  5JEA F;  1UDQ A;  2JEB A;  3M7N G;  2PO2 A;  3KRN A;  2JEA A;  4BA2 B;  3M85 D;  5JEA C;  4NBQ A;  5JEA D;  5JEA B;  2PNZ A;  5JEA E;  2BA1 D;  2WNR A;  3GLL A;  3M7N D;  2PO2 B;  5K36 B;  2NN6 F;  5K36 D;  2WNR B;  4BA2 A;  2C39 A;  5K36 C;  4IFD E;  5C0X D;  5C0X F;  4IFD B;  5C0X B;  4IFD F;  2PO0 B;  1OYP A;  3GME A;  5JEA A;  3HKM A;  2NN6 C;  2WP8 A;  1UDS A;  2C38 B;  1E3H A;  4OO1 B;  2JE6 A;  2BA0 D;  2JEB B;  4IFD C;  3GCM A;  3M85 G;  4BA1 A;  2WP8 B;  2PO1 A;  2BR2 A;  2NN6 E;  2NN6 D;  4OO1 A;  1OYS A;  2BA0 G;  5C0X A;  4OO1 D;  2C39 B;  1R6L A;  5K36 E; 
#chains in the Genus database with same CATH topology
 4GKK I;  2V34 A;  2V2Q A;  1IBK E;  1H7S A;  1EI1 A;  4JG4 A;  1PKP A;  3V5R A;  3WU6 A;  5K36 A;  5DNX A;  2CG9 A;  3UHM A;  2LJP A;  1IBL E;  1RHY A;  1H73 A;  3Q1Q A;  1XMO E;  3DD6 A;  1Z5C A;  3P06 A;  1IBM E;  4JYA E;  3H1C A;  2BM0 A;  4LF7 I;  2Z5C A;  1KKH A;  1R6M A;  4WUD A;  5GMD A;  4JI1 E;  4URL A;  1XNR E;  4DUZ E;  5FWK A;  1Z0B A;  4PU9 A;  4DR3 E;  4IFD D;  4FW3 A;  4DV6 I;  1WUU A;  4AID A;  4QNJ A;  2V2Z A;  4DR7 I;  1DAR A;  2ZM6 E;  1NHH A;  3PYD A;  4KHP E;  4DV6 E;  2Z5E A;  4IFD A;  3U1Y A;  2A2D A;  1UEK A;  3QT8 A;  2JEB A;  1MU5 A;  3KRN A;  4P7A A;  2UU9 I;  4USM A;  3PS3 A;  3PRY A;  5LL6 R;  4FW6 A;  1OJ4 A;  5JEA D;  5FLX Q;  4DR1 I;  2IOQ A;  4YY3 I;  2AE8 A;  2IOP A;  3B8H A;  3ZKD A;  2UXD I;  2Z5B A;  5K36 B;  4DR1 E;  2Z5B B;  5K36 D;  2XEX A;  3J80 C;  4X65 E;  2E1R A;  1K47 A;  4OZE A;  1USU A;  4DR5 E;  1OYP A;  3GME A;  4DV0 E;  2C38 B;  4DV3 E;  2JT2 A;  4JI8 E;  4WUB A;  1KVK A;  1HR0 E;  1IBL I;  2JEB B;  3T1Y I;  3P3C A;  4HAC A;  1HNX I;  4JYA I;  1USV A;  3OTO I;  4DUY E;  4DV4 E;  4BA1 A;  2CZ9 A;  5DRP A;  4MYT A;  4UTG A;  4JI6 E;  4JI1 I;  1XXE A;  2GQ0 A;  4DV4 I;  4DUZ I;  1OYS A;  5C0X A;  4IZK A;  1N34 I;  4JV5 E;  1RRE A;  1S16 A;  1FJG I;  5A2Q C;  3J80 Q;  4FWD A;  2PNZ B;  3LPS A;  4MQY A;  4IZJ A;  4FW4 A;  1OYR A;  2A2C A;  2C37 A;  3D4J A;  4FWH A;  5DNL A;  1XMQ E;  2UUC E;  4JI4 I;  4GKJ I;  1N32 I;  5EKW A;  4MU0 A;  1ZM9 A;  2GO3 A;  1XNR I;  3CDI A;  4JI7 E;  5FLX C;  4USK A;  4LOM A;  1HNW I;  2UUC I;  2UXC I;  2HKE A;  3QT6 A;  1ZXM A;  5LMU I;  4LFC I;  4JI5 I;  4B3M E;  2BM1 A;  4GQU A;  1UDO A;  2ZM6 I;  4M1K A;  4ISA A;  2UXC E;  2VF3 A;  1ZM2 A;  4HXZ A;  3T1H E;  4DV1 E;  4DR6 E;  4LF4 E;  5BR8 I;  4BA1 B;  3P3G A;  2JEA B;  4OO1 C;  5A2Q Q;  2UU9 E;  3T1H I;  3U1K A;  2UUB I;  4AIM A;  3ZKB A;  2NN6 A;  1Z5B A;  1Y4U A;  3P76 A;  4JI0 I;  4PRX A;  2R42 A;  3L7Z A;  2HK2 A;  2UUB E;  1MX0 A;  5JEA F;  3HUL A;  1HK7 A;  4JI3 E;  4JI2 E;  1I94 E;  2F1D A;  3WU4 A;  2PO2 A;  4MU1 A;  3QT7 A;  4Z7Y A;  4MDT A;  4BA2 B;  1FWK A;  5DRQ A;  3M85 D;  5JEA C;  2HK3 A;  4P52 A;  4JI3 I;  4NBQ A;  1H7U A;  2PNZ A;  5JEA B;  2V8P A;  4X64 E;  2BA1 D;  2X7I A;  4DV3 I;  4JI6 I;  2PO2 B;  2X36 A;  4DU8 A;  4N3O A;  4UT4 A;  3H4L A;  4BA2 A;  4B3T I;  1YHC A;  4IFD E;  3Q6M A;  4EMD A;  4DV5 E;  2GS8 A;  1HNX E;  4LF5 E;  2PO0 B;  1N36 E;  5IT9 C;  4JI4 E;  1Z0W A;  3V2U C;  4B3T E;  1ELO A;  3NZK A;  4LFB I;  4NXN I;  1IBM I;  4LCG A;  4DV7 E;  4NXM E;  4AQY I;  1N34 E;  2O1T A;  1NHJ A;  4JV5 I;  1HNW E;  1B62 A;  2CGE A;  3ZZT A;  3J81 Q;  4IFD C;  4NXN E;  5LMU E;  2O1U A;  3K1J A;  3PS1 A;  4NXM I;  3ZZU A;  1N32 E;  1J5E E;  3M6A A;  2WP8 B;  2BR2 A;  4YHH E;  2J65 A;  2NN6 D;  2OI2 A;  2HKJ A;  4LF6 I;  5BR8 E;  3F0N A;  4DPW A;  4OO1 D;  2R3V A;  4JI5 E;  4LFC E;  5K36 E;  4B3M I;  1Z0T A;  4LF6 E;  4DR2 E;  3ZM7 A;  1Y5Y A;  5L3J A;  2C38 A;  4LFA I;  1H74 A;  4DV1 I;  4DR6 I;  4LF4 I;  3CDJ A;  4JI2 I;  4FW9 A;  4AM3 A;  3JAM Q;  2C37 B;  5C0X C;  1RR9 A;  1XNQ E;  2UXD E;  4U3D A;  1VI7 A;  1VIS A;  4HAC B;  2HFS A;  1XNQ I;  2VQF I;  5ELW A;  1YH8 A;  1I94 I;  1Z0C A;  3L7Z B;  1D6T A;  5C0X E;  2O1W A;  3JAM C;  1ZM4 A;  3B4T A;  1MG7 A;  5K36 F;  3Q6N A;  4ED4 A;  1N33 I;  4B3S E;  1H72 C;  2JE6 B;  4X64 I;  2PO0 A;  2Q2E B;  2BA1 G;  2HHH E;  4GKK E;  4DPY A;  2EFG A;  1UDQ A;  3PYF A;  2VQE I;  3M7N G;  1BKN A;  4B3R I;  4XTJ A;  3QT5 A;  1FI4 A;  4LCF A;  4DU7 A;  2JEA A;  2IER A;  4LF5 I;  1PVG A;  2BV3 A;  1U2R A;  4B3R E;  5LMN I;  4LFB E;  5IWA E;  1XMO I;  4DV7 I;  5GME A;  2WNR A;  4AQY E;  2PNM A;  3GLL A;  4DV2 I;  2O3Z A;  2WNR B;  1HNZ I;  2C39 A;  4IS9 A;  5EL9 A;  4LF8 I;  5C0X F;  4IFD F;  1B63 A;  3P3E A;  4IZJ B;  4JI7 I;  4DR2 I;  1J5E I;  4OKG A;  1N0V C;  3HKM A;  1HNZ E;  4X66 I;  4DR4 I;  2NN6 C;  4LF8 E;  2UXB I;  1E3H A;  4I3H A;  4ZVI A;  4DR7 E;  3LNU A;  4KHP I;  2J7K A;  1P42 A;  2UXB E;  4LCH A;  4OX9 E;  3PYE A;  3GCM A;  4HY1 A;  3M85 G;  2DEJ A;  4LFA E;  3J81 C;  3LTO A;  1EA6 A;  2NN6 E;  1NHI A;  1ZM3 A;  2V2V A;  2Z5C B;  2BA0 G;  2AJ4 A;  1N0U A;  3B82 A;  2C39 B;  2ZBK B;  4YY3 E;  4X62 E;  2E5L E;  1N33 E;  4Z7C A;  4FWG A;  4IZJ D;  2VQF E;  4X65 I;  2DEI A;  2CVE A;  4X62 I;  4LF9 I;  3J7A G;  1Y4S A;  3K85 A;  4FW5 A;  1FWL A;  5DRR A;  4MYU A;  4KQV A;  4OO1 F;  4DPX A;  4RPF A;  4B3S I;  1Y6Z A;  3T1Y E;  4QNK A;  2O1V A;  4DV5 I;  1N36 I;  2VQE E;  3OTO E;  4DUY I;  2PO1 B;  1Z0V A;  4DV2 E;  1E3P A;  1ZXN A;  1XHK A;  3HJC A;  1UDN A;  2NN6 B;  4DPT A;  2F4V I;  4OO1 E;  2BR2 B;  1IBK I;  5LMN E;  4LF7 E;  4FN5 A;  4HYM A;  1FJG E;  1PIE A;  5IWA I;  2ZIT A;  4DR4 E;  2F4V E;  1Y60 A;  3PS2 A;  4R1F A;  3WU3 A;  2WW4 A;  4YHH I;  4MU4 A;  4LPF A;  1XMQ I;  4GKJ E;  4OX9 I;  4PRV A;  1NZ0 A;  1QZR A;  5JEA E;  1Z59 A;  4X66 E;  2VES A;  1Z0E A;  4U3B A;  3M7N D;  1Z5A A;  4DR3 I;  2NN6 F;  5K36 C;  3PYG A;  1KIJ A;  2NPF A;  1FKA E;  2UUA I;  4K0K E;  5C0X D;  4DPU A;  4IFD B;  5C0X B;  1A6F A;  3GON A;  3B78 A;  5JEA A;  4WUC A;  4MU3 A;  2HFU A;  2UUA E;  1UDS A;  2WP8 A;  4IZK B;  4K0K I;  4OO1 B;  4DXL A;  5IT9 Q;  2JE6 A;  2BA0 D;  4LF9 E;  4JI0 E;  2GO4 A;  3K17 A;  3J7A M;  4DR5 I;  1KTV A;  1FNM A;  2E5L I;  3ZZ0 A;  4DV0 I;  5DRO A;  2PO1 A;  2IES A;  2PNL A;  1S4E A;  3CWV A;  4OO1 A;  3WU5 A;  4J3D A;  4FW7 A;  4JI8 I;  1HR0 I;  1Z0G A;  1R6L A;  2HHH I; 
#chains in the Genus database with same CATH homology
 2PNZ B;  1OYR A;  2C37 A;  2C38 A;  5K36 A;  3CDJ A;  3CDI A;  4AM3 A;  2C37 B;  5C0X C;  3DD6 A;  3H1C A;  1UDO A;  4OO1 F;  1R6M A;  4BA1 B;  2PO1 B;  2JEA B;  3L7Z B;  4IFD D;  4OO1 C;  5C0X E;  1E3P A;  3B4T A;  3U1K A;  4AID A;  1UDN A;  2NN6 B;  4OO1 E;  4AIM A;  2BR2 B;  5K36 F;  2NN6 A;  2JE6 B;  2PO0 A;  3L7Z A;  4IFD A;  2BA1 G;  5JEA F;  1UDQ A;  2JEB A;  3M7N G;  2PO2 A;  3KRN A;  2JEA A;  4BA2 B;  3M85 D;  5JEA C;  4NBQ A;  5JEA D;  5JEA B;  2PNZ A;  5JEA E;  2BA1 D;  2WNR A;  3GLL A;  3M7N D;  2PO2 B;  5K36 B;  2NN6 F;  5K36 D;  2WNR B;  4BA2 A;  2C39 A;  5K36 C;  4IFD E;  5C0X D;  5C0X F;  4IFD B;  5C0X B;  4IFD F;  2PO0 B;  1OYP A;  3GME A;  5JEA A;  3HKM A;  2NN6 C;  2WP8 A;  1UDS A;  2C38 B;  1E3H A;  4OO1 B;  2JE6 A;  2BA0 D;  2JEB B;  4IFD C;  3GCM A;  3M85 G;  4BA1 A;  2WP8 B;  2PO1 A;  2BR2 A;  2NN6 E;  2NN6 D;  4OO1 A;  1OYS A;  2BA0 G;  5C0X A;  4OO1 D;  2C39 B;  1R6L A;  5K36 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...