2BRUC

Complex of the domain i and domain iii of escherichia coli transhydrogenase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
AEETAELLKNSHSVIITPGYGMAVAQAQYPVAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQDDPKSPIAGMPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAILKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) TRANSHYDROGENASE SUBUNIT ALPHA
publication title Structure Determination of a Transient Complex by NMR Using Paramagnetic Distance Restraints - the Complex of the Soluble Domains of Escherichia Coli Transhydrogenase
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 55
structure length 167
sequence length 167
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2005-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2bruC00
2PGOA 4Y6OA 1NM5C 1U28C 2NYRA 4GP9A 1OZHA 2FWNA 2WVGA 1YHZA 2A1TR 5BWNA 1U31A 2OD9A 1YTLA 2IHUA 2C31A 5EJ9A 5K3SA 4K9PA 1PI3A 3CLSD 2H59A 2JI6A 1U2GC 4FZ3A 4JU8A 4K9OA 1Z8NA 4J16C 4JD5A 4RJJA 2OORC 1Q6ZA 4X3PA 1M2NA 3GLSA 2VBIA 4G1CA 1SZDA 1OZFA 2VK8A 4COKA 1J8FA 3D81A 3JR3A 1Q1AA 4ZZIA 3RIGA 3EY9A 4GG1A 3LQ1A 4JT9A 4JUCA 3FLMA 4BVHA 5K6TA 4JU9A 2WVAA 2JLAA 4UTRA 2AG1A 4QQ8A 4GM0A 4KXQA 3ZGVA 2EZUA 4UTNA 3JWPA 4D5EA 3PDHA 2Q5QA 4HD8A 2OO5C 2EZ4A 4GM4A 5EJ6A 4QELA 2PANA 1UPCA 4RJIA 4Q9DA 2H2HA 2EZ9A 5BWLA 1YHYA 1S7GA 2EZ8A 2EZTA 4JUDX 4TWIA 5EJMA 1YNOA 2HJHA 2Q5LA 1MCZA 2DJIA 2WVHA 1T9BA 3U31A 1Q17A 2QQFA 1ZPDA 4MPJA 2VBGA 5EJAA 1PNOA 1M2JA 3EA4A 3FSJX 2FRDC 4JSRA 3GLRA 4L3OA 5D7NA 3ZGOA 4V1CI 2FR8C 1YC5A 2V3WA 3ZG6A 2OD2A 4FEGA 3F6BX 5MFPA 2IHTA 5EJ7A 1T9AA 5EJ8A 4UUAA 4X3OA 5K2OA 2H2DA 2UZ1B 3GLUA 4K9MA 4UU8A 4BV3A 1POWA 3CLUD 5MF6A 4O8ZA 3CLRD 1OZGA 4ZP1A 3HWWA 1YC2A 2JLCA 1PNQA 4JT8A 2A1UA 2JIBA 2VBFA 4RMHA 1XLTC 4TWJA 1YBHA 4RMJA 1DJLA 2Q5OA 3F6EX 2VK1A 1Y9DA 4K9LA 3CF4G 4UTZA 4F56A 2FSVC 4V1CB 3E9YA 4GPEA 2FN3A 3PKIA 2X7JA 1Q14A 5DGTA 4RMGA 3K35A 3CLTD 5FYQA 4MPPA 1PTJC 4BN4A 4K9NA 4QPZA 4I5IA 4BVFA 5MFZA 5DGDA 4D5GA 2VJYA 4K9QA 4RJKA 3OE1A 4K9KA 2H4FA 2NXWA 1T9CA 3IAFA 1MA3A 4Y6LA 5FEMA 2IHVA 1EFVA 2PGNA 4UTXA 4JUBA 1ICIA 2BRUC 2JI8A 4UUBA 1S5PA 1SZCA 1U2DC 1YI0A 4RMIA 2OD7A 4MZXA 4UTVA 1M2HA 4C78A 1V5GA 3EYAA 2UZ1A 2W93A 1QPBA 2B4YA 2H2GA 4BVBA 4L2IA 4BUZA 2H2IA 4IAOA 1V5EA 3GLTA 5EJ4A 2Q29A 1O97D 5AHKA 1HZZC 3IAEA 5K6RA 5BWOA 1N0HA 4BVGA 1E3TA 1UPAA 2Q5JA 4J1TC 2VK4A 2JI9A 4GM1A 1PYDA 1V5FA 5EJ5A 1D4OA 1OVMA 3FZNA 4KPUA 1O96B 4IG9A 4UU7A 2Q27A 1JSCA 4V1CA 1EFPA 1UPBA 4R8MA 1PVDA 4BVEA 3U3DA 2Q28A 4C7BA 4FEEA 3D7KA 1M2KA 3D4BA 5IMSA 4IF6A 1PT9A 4MPRA 3HWX1 4BN5A 5DEIA 4HDAA 5MGNA 1POXA 4KGDA 2AG0A 4MQ5A 4F4UA 1T9DA 1BFDA 2H4HA 1M2GA 1YI1A 2QQGA 3RIYA 4JUAA 4BV2A 2H4JA 3PKJA 4JUFA 4FVTA 4Y6QA 2H2FA 1PO7A 2JI7A
chains in the Genus database with same CATH superfamily
1EP3B 3PVSA 4EA9A 4U2GA 4RUKA 1V8BA 3UH1A 4Y2SA 1D1QA 1L4UA 2H2AA 1XD8A 3L6RA 2AQIA 4TKVA 3WX0A 3ZXSA 2HPAA 5KNCH 4URXR 1YOVA 3KB8A 4R0NA 1K9SA 3FDZB 4D8TA 1IQ0A 1TJPB 2O0HA 5HIMA 5LB4A 1SUEA 5E6RA 4X7PA 1WXQA 1KYIA 3R41A 2W42A 1I94B 2X2EA 1GZVA 3EASA 3IKLA 4K28A 1NLMA 3BEDA 3PI6A 2HXSA 1DC8A 4MB2A 1W2WB 1R0XA 2XIJA 5G0SA 4G4SP 3DH0A 2GCOA 2QL5A 4CCAA 1MJ5A 3PUYA 2CL7X 4WK6A 3H3FA 4NH0A 4W63A 3U7QA 5KPDA 5EGNA 1Z36A 4QLBA 1EFKA 1XGKA 4K8RB 5AK4A 4A36A 1Z5WA 2IEZA 1IZYA 3A26A 1NGSA 2BBSA 1XFDA 2HJRA 5D85A 2LRHA 4GRIA 1MEJA 4P36A 1EVIA 2JLQA 2QR2A 4DDMA 5AOCA 4A5OA 2JI6A 5LMNB 1LCIA 3X1JA 2NSDA 2IWRA 1BC5A 1A4UA 1FTNA 2ZPTX 1LDEA 1OBVA 2VF5X 1R0YA 2SKCA 2ZVJA 3GGOA 4KYVA 4R1MA 4WECA 1KMNA 1NVBA 1DELA 2GRAA 4R7ZA 3SYLA 4F1JA 1WBDA 4H6XA 4WN3A 4KRFA 1PQYA 2I6QA 3HV2A 2WIDA 4GWKA 4DV4B 4YMHA 4F9FA 4X3PA 1LEHA 2IDKA 2E2WA 3V55A 1T1JA 3ENZA 1QV6A 2ZWIA 1W87A 3DHEA 3CNEA 5AKJA 4W8HA 4ZANA 2GTPA 5J2UB 1BWRA 1FUIA 2CL5A 3DZJA 3I1JA 4E12A 4NAVA 5AJUA 5FLYA 3FNIA 3T9AA 5JHHB 3FMVA 3KAPA 2POCA 2HJWA 1CUFA 1EEXB 3RSGA 1J8FA 4IQ8A 1T1IA 2FEAA 3EG5A 4JQZA 3RIGA 4NE9A 2WWVD 4PX5A 1SULA 5T64A 2QJRA 3BWDD 1F1JA 1YCHA 1U0SY 3VOAA 1M8GA 4QBFA 4FKBA 2WYIA 5FPPA 2IV7A 5JS7A 4A8HA 2A5FA 1W2GA 5LUBA 1USWA 3OOEA 5ESDA 3AERB 4B40A 2EZUA 3EVBA 4C4YA 4EIWA 5FPSA 4UTNA 1Y7PA 3WLKX 3I42A 3D5TA 1JTEA 1G291 1E9BA 5EHXA 1E94E 3FF4A 1KBZA 3T9FA 4BFVA 1VJGA 4AP5A 1VI6A 1Y4DE 3T7KA 3TAHA 2OO5C 1GSHA 1APBA 1NVFA 1SG0A 4N7MA 5KTOA 5IJ9A 1TMGE 2V59A 3A36A 2ZIXA 1T5LA 2GNPA 3O2QB 5B1SA 4ZOLF 4CODB 3DEYX 2A9FA 4RJIA 3DBLA 4RVGA 2G0AA 3SR3A 1CIJA 2CVPA 1D1SA 3NB0A 1OYVA 2VQDA 3TI9A 1NW3A 3MBIA 3PHLA 2WUEA 3TW0A 3U40A 1Z4QA 2BEUB 4B45A 1NASA 2GLUA 3FMIA 4OQZA 1IFXA 2CD7A 4LZWA 3UMCA 3ICEA 4GWLA 3RS3A 4FT2A 4ESEA 4IIJB 2AXPA 2I2CA 1O77A 4P4SB 4NCAA 1HFJA 1CG6A 1UMCA 1UP4A 3AUAA 4QUHA 1YA4A 1JPJA 4MTCA 1MCZA 3LTEA 4RX1A 3TPCA 4G56A 3SC2A 3PRKE 1SKQA 5C8VA 5DBIA 4RD6A 2X1HA 2JBAA 5IVDA 4ETIA 2ZRPA 2H1RA 2WG2A 2BFOA 5FUXA 1E9FA 2PZFA 4V24A 3WYDA 5ALVA 4LY6A 4B8ZA 3BX1A 3JD1A 5A62A 2YZMA 3ZCTA 2CEKA 1Z82A 3EBOA 4M37A 3I64A 4K9RA 5IKMA 5LWQA 4ZT2A 3UXEA 4CL8A 2GJ4A 1TK3A 1MJNA 3LM8A 2IU0A 3BGDA 1I6WA 2CLEB 2KLBA 4TYNA 1YR3A 4N0EA 3FYDA 1YJ8A 2I6UA 1CJCA 1CSEE 3E3AA 4N12A 2Q99A 1PD1A 4LYFA 4RY0A 1KTIA 4AIIA 3DUFB 1M2JA 2JCSA 1C8VB 4G8JA 2AB0A 1Z4PX 1EX6A 3SEQA 5BT8A 4URWR 3AFNA 1XZCA 3U4GA 2A57A 1UBMS 3GCZA 3PWKA 3TZHA 2Q6TA 1P7WA 5TIIA 3EXHB 1FUUA 4DYHA 2BGUA 4P5EA 4YRDA 5FADA 1DXYA 4MHSA 4G85A 5G0TA 3ZXUB 3OE7D 4XAQA 2VQEB 2QUIA 4JEHA 3V1MA 2YXLA 4ENUA 1CZHA 2Z4RA 4YY3B 2CKMA 4QBGB 2GESA 1SXJE 3IBFA 5FUMA 1S2MA 1SUAA 5TPWB 2G08A 3E8XA 3WHKA 4HRYA 3ZQJA 5MN4A 2W2OA 3PX7A 2ZSBA 4HVAA 5CJ2A 4NZYA 2OYRA 1Z75A 3C39A 3C7TA 3NTXA 3RKUA 5MFPA 3WK8A 4GLBA 4U7TB 1G7CA 4X3OA 3VVCA 1KH3A 4RBNA 5DVZA 3JZAA 4TLCA 2ECQA 2W5UA 3I01M 4MUYA 1HL3A 2E3JA 4IS2A 2JAWA 4TMZA 4UKDA 4NXNB 3VDQA 2EOAA 2WP0A 4B9AA 5A6SB 4RTRA 1ZIPA 2PNFA 5GOTA 3HUDA 2C2HA 3OQBA 3F4LA 1CHNA 1H22A 2KB0A 4Z7OB 1W1WA 5LXTA 1VG8A 3WLAA 2IUTA 1JLSA 1L7BA 2WU0A 3UT5A 3OSZA 2QIOA 3F3MA 4YMWA 1J1UA 3LYLA 2DKFA 1BHSA 4TOIA 5JLAA 3ML1A 1NNI1 3CTMA 2ZYVX 3QFRA 4ZO9A 2PCJA 2PWBA 3ZQ6A 4AX4A 2DP4E 2QW8A 1C50A 4CTMA 5JD5A 4CTKA 1F4LA 5CU7A 1DAMA 5EYPB 3LBYA 4GX2A 3HKDB 4KSCA 3MJFA 1PWZA 2HEGA 3F5MA 2IUEA 5C7LO 4L8VA 4UVGA 2ZIAA 3AQIA 3M5DA 1VE1A 3O4VA 2EEZA 1Q12A 3V6LA 3HJBA 3HWWA 1TLFA 1E8NA 5KYYA 4D25A 2GT1A 3LYHA 4ZYVA 1T3HA 1E0DA 1YASA 4U7HA 2WZBA 1HEUA 4WACA 3DLIA 3H0EA 4E07A 2FFRA 1P29A 3QU4A 1JG2A 5KOIA 4GI5A 1NV9A 3CRZA 1WTAA 1GT91 5AYVA 1DKNA 3GGJA 4RIHA 5NULA 4CVNA 1SCAA 1Q7BA 2MYNA 4JLUA 3KUKA 4LYAA 1AM4D 1XLTC 3RVBA 4W1RA 4NYMR 2IVZA 3ZR4B 4DGSA 1TPZA 4O0MA 4ZOCA 1ZWKA 1LPNA 3CISA 3MJCA 5JTTA 4ZK2A 3VI4B 5E9JA 4DIDA 1P31A 3X1MA 2HA2A 4GKKB 4QUGA 4BVAA 4YYEA 1JQBA 1YS9A 2I4TA 3A2LA 4CKXA 2IPNA 5DMHA 1GTSA 5CFRA 1L7DA 2P4UA 4DXDA 3E61A 2ORVA 4LGMA 2N1MA 2CNKA 2X0EA 3V2UA 1P6XA 4L5AA 1ZSVA 2C7VA 3ESAA 1A96A 4YT4A 2YXDA 3ZH9B 1KJWA 3E27A 3GPDG 5CYFA 5E7QA 4H27A 2AFHB 1ZJZA 5IAKA 5LC1A 3E7WA 3GVCA 3ST7A 4C2UA 4E46A 3T94A 1LDYA 1R10A 1VLVA 5AW1A 5F3WB 1RI2A 1SH7A 4O02B 4CG3A 5IUJC 1NUTA 5IXYA 5EWMB 1XQWA 3HM2A 3ETCA 1NDHA 1UMKA 2VZ0A 4FNOA 2DBQA 3TE6A 5M2QA 2N46A 2JGLA 3OA2A 4N40A 4AX8A 4Q02A 4DR3B 2W6OA 4AIRA 4ENQA 2P35A 3Q2KA 3RODA 5FNVB 1O6CA 2NT4A 4GOLD 2ID8A 3OPXA 3P9NA 2JLRA 1WOYA 2EKBA 4YCBA 2ZW9A 5I9BA 1AQNA 5CVDA 1PEAA 2JKZA 4YP7A 3JQDA 3ZIUA 1CUYA 4PSAA 1D09A 1EP2B 3LCMA 2BD0A 5G41A 1CD5A 4BP1A 4BVFA 5KYWB 2VTKA 2DWOA 5DGDA 4LMBA 4GPD1 1L1RA 3ZDXB 2VJYA 2DFTA 2VJNA 2M1XA 3FM9A 4D4IA 3KAQA 3U16A 1L5NA 3FG9A 1K5HA 3HDVA 3OY2A 3SZRA 3AP2A 3IVMA 2D7JA 2DSTA 4KRGA 4CZ2A 4CKCB 1HR0B 1LBSA 2GEDA 3A1EA 3PUVA 2ZDQA 4K9KA 4DMHA 2CLLB 9ABPA 3AF1A 4RF3A 3ZJTA 4M0CA 3TLXA 5ECDA 5AVOA 3UH0A 2GTIA 3QI7A 4OXQA 2VDPB 3D2BA 3QVJA 2PMKA 4O2BA 3DHVA 2FE1A 3TLYA 1CXZA 1YCFA 2W4IA 3N7UA 4M89A 2CMFA 2ZPUA 3QBEA 1RKXA 3PQDA 3FHCB 4QIHA 1XRLA 5LU8A 3MJHA 1OIWA 4R1PA 4ARVA 4QG7A 3TB6A 5AW7A 4H0NA 1I3MA 2JI8A 4JIGA 3SEFA 1QIMA 2RHGB 2W6CX 4HUQB 5L7TA 3O6VA 1E8MA 2H7XA 3VSBA 2Z2XA 3RYFB 2Q49A 3USCS 2YASA 4Z3DA 1GIAA 1LLDA 4NFHA 5H59A 2O50A 4N4AA 1C4XA 5LA6B 3TGPA 5GV7A 3PUIA 4V0NA 2IRWA 5HUQA 3L1IA 4I8IA 1C0PA 4TS1A 5G3ZA 2DBYA 1GG8A 4RABA 1PR5A 4MYUA 4B83A 3OA0A 1WLSA 2ZU0C 3GZTB 1TVKA 1OH7A 2HMTA 2JGKA 3ZJ4A 2QTHA 3I6BA 2VPYA 4KV7A 2CSXA 3VR4A 5JARA 3GFGA 3NWOA 4D8VA 2JG3A 2BAGA 3LOQA 3DDCA 3SYKA 1ZNXA 3NRBA 1JP7A 4Q7JB 4BVBA 1Z28A 1IHDA 3S2IA 1BE0A 3EXAA 4H4CA 3T7IA 4CR6A 3SQOA 2GTHA 1DDGA 3KZMA 4QU9A 2CNNA 2F4NA 4YDRA 4BUZA 3KWJA 3HM9A 3QJ5A 4P6VF 4YV2A 4DPLA 4ZJPA 4I50F 2ZJ4A 5B6PA 5LZ4A 1IWBB 4WLFA 2ZKIA 4XD7D 4DIUA 3RKRA 4XYMA 3C41J 1N0UA 5EIBD 3F6SA 4IVQA 4US0R 3AF2A 2CJWA 2H17A 5ALNA 3W9BA 1E2IA 2QD2A 2E5LB 3H9EO 4HNUA 2GHIA 4HTFB 2J1LA 2WHPA 1M1YB 2BGMA 3STHA 4DLXA 1C8LA 4OX9B 1XD2B 3ITEA 2J6CA 3OEHA 3ZY3A 1WQ4A 1RHJA 5I47A 4B44A 4JC8A 2XXJA 3LMKA 4RYLA 1UDCA 3IA7A 4FDTA 1WZIA 3ZW7A 3F4KA 5K05A 2O8EB 1E89A 2VK4A 3B20A 4KL8S 1I80A 4YCJA 2GO7A 4KO8A 4PZZA 1HUQA 1KORA 1L5FA 1N9KA 4D4LA 1X0XA 1ZGGA 1NC1A 4BX8A 3NKVA 1HYHA 2B4RO 3H2HA 3GN2A 3EXFB 3NYQA 4AY4A 5LP6B 5SZKB 1GHTA 3PXXA 1V16A 2YWBA 4EDFA 5JS1A 2W70A 3C70A 1GNRA 4TS3A 1J2TA 2NU7A 1Y7IA 4N5MA 2DQKA 1ZD4A 4UTVA 1A5ZA 3GJTA 3O4RA 4C9BA 1OVMA 2PNJA 4PO8A 1WSDA 1OR8A 4KQ1A 2HNBA 2C07A 5JSYA 5LBUA 3RU2A 4C3VA 2AK3A 4DCJA 4EJMA 3O7MA 1OPXA 4ND8B 5I51A 2Y1GA 2QAIA 3GJRA 1E9CA 4UXHA 4ZYZA 3GHHA 4KUEA 3GJ4A 1DC6A 3GVHA 4L16A 2PMWB 4H1HA 2ZWMA 3D3WA 4ZAWA 3CUYA 4XE5A 4Y0AA 3ZDDA 1C0LA 3G79A 2X23A 2ZQZA 3HL0A 4R8MA 1SD1A 1YSCA 2JF0A 2VTVA 3BXHA 4OH7A 1THZA 1IUKA 2NGRA 4XYEA 1PVDA 2IPLA 4IJ5A 5EQTA 1NF3A 4J1SA 3Q87B 5KI6A 2DYKA 4H7HA 4TRRA 1G8PA 4POOA 4B3MB 3N6VA 1FMCA 4JHLA 1QYCA 1V7PC 3O90A 4KJZA 2OA0A 1REQB 1FY2A 1U7WA 2HLHA 3N1UA 5KYXA 2ZSEA 2DXIA 3PWZA 4ANFA 2GEKA 3DZIA 1VDMA 4PAGA 7YASA 1IUNA 3WLRA 1FUEA 3KETA 1I2DA 1SXIA 1FP2A 1YQUA 1JIIA 2JFUA 3A32A 4TTPA 4WUVA 5DBEX 3AFMA 2RHRA 4EYKA 2PGJA 4ZQIA 3S5UA 3O1IC 2G17A 3GGPA 4MPRA 2G80A 2ZQ5A 1CS4C 3DYVA 1PNVA 4KH0A 3VZCA 1ZBQA 5HHTA 3AJAA 4Q9HA 5F7ZA 3PC8C 1DKPA 3OOJA 1G2OA 2VEDA 5FWAA 8OHMA 5LD2B 3F3YA 1EHCA 3F9RA 4V0KA 4CMGA 4CM4A 3CUVA 4UDNA 2ZJAA 4RSMA 5IYZF 4B2IA 2R79A 4JWKA 1QM5A 3CN9A 2JGNA 4Y6PA 3MMZA 2WD8A 5J58A 2J9XB 4PZLA 1D2EA 1VRVA 2VZ8A 5CW2A 1B7GO 2YNMD 4U0JA 2DPYA 1QORA 5FBRB 4JJ6A 3BG5A 3K0EA 4UPEA 5IBRA 5HJ5A 2XD4A 3FNBA 4R1TA 5LCXA 2Q1XA 2Y67A 4BIMA 1TM3E 1EHYA 1MXHA 3H2KA 4O4HA 3UKJA 1S1MA 3VKUA 1T0IA 3HVIA 2GM3A 1QCDA 2PKWA 1AMUA 3PLRA 2XE6A 4FYIA 6GPBA 4N39A 5LZ8A 3W5DA 2J0QA 1E79D 2H2FA 1HK7A 2VPZA 3HR4A 5EUMA 2PX6A 1WHSB 3DE2X 4RQUA 3IHWA 4IFIA 1U8CB 1ZJYA 4TRMA 5H81A 4A8JB 5HF9A 2XWBF 3A9VA 4GW3A 4YA6A 4XWGA 4WZBB 1UXIA 4A73A 3NNDA 2YKGA 4EHAA 4EY4A 4U7PB 4NEHB 2A67A 2RGUA 2VJMB 4W7HA 3T15A 1J33A 1N2JA 1WUKS 1PT6A 3LD9A 4FR5A 4BMYA 3FMGA 5LM3A 3VU3A 1GQYA 3HN2A 1DQSA 3HV0A 1JBEA 4CUZA 4MQFB 2YC4C 1H2YA 1OX4A 4DYVA 4BBJA 1P5RA 2CLCX 3T7RA 2Q8QA 3M1AA 5JCPA 2FUKA 2DG2A 5KCZA 3VDNB 1TT5A 2CDCA 3PR2B 1RI3A 4L6CA 2IYRA 2WYUA 2IJGX 4YACA 1NY6A 5GJBA 4IRMA 2NU9A 4D9FA 1DAEA 2IBTA 3W4IA 1IBRA 3G1UA 1DC5A 1N2CE 1UXJA 2DFLA 3HR8A 2CK3A 2YHIB 3ADOA 3JQPA 3HU1A 5CLQA 4UVHA 1N5LA 2R60A 2P8SA 4FDAA 3HBAA 2PRKA 4IIEA 4R2WA 5KVAA 4FZ3A 2NP7A 1RJ9B 4H60A 1XTBA 3X44A 4Q3NA 4G5OA 4JQCA 4DA7A 4PC1A 3WK6A 2HA5A 3AOGA 1YJCA 3E22A 4H18A 4U1RA 1F17A 3WGKA 4CFSA 5IABA 1ZY2A 1Q1EA 1VLHA 3OCYA 4LEIA 1YT5A 1UDXA 3OM9A 3ZEIA 2O1XA 5K9ZA 1T29A 3BD8A 5MDHA 1Z34A 1XZEA 4QUJA 4AI6A 3W2GA 4DTIA 4X24A 3ZE6A 4GUDA 2IXFA 3MGBA 2H5EA 4WW0A 2IIQA 1O5OA 1S4QA 3SJ7A 4B6RA 4HNQA 3JR3A 4R1OA 1ZS9A 4CI9A 2VTBA 4EG8A 3K2IA 1Q16A 5CTAA 3TDNA 2BKAA 4BRZA 4CMAA 4OGKA 2VDWB 3LNCA 1Y5IA 4JT9A 3NVKI 4YC7A 2IU6A 2ZPAA 1M2WA 3ILVA 3LT1A 1JXAA 3WKEA 3EUEA 3GI1A 3DHWC 3TOCA 4B32A 1R5NA 2BE7A 5DZSA 2IDZA 1JT2A 1QTRA 2G7MC 2JARA 1Y1TA 3C97A 3W5AA 1OI3A 2VJBA 4F4DA 2PLRA 2Q5QA 2W6MA 1FCJA 4WCFA 5ARDA 4AJPA 3I3SR 3AMVA 4HDOB 5EWJA 5T8KC 1RNLA 2EARA 4GR9A 1ZR4A 3JQGA 1TF7A 4RVCA 5JC8A 4EUSA 2BTOA 1I4LD 2V7PA 1NLZA 3SYMA 1E3SA 1JIJA 1JAHA 3A10A 1NQWA 3BH6A 4HDKB 2H4YA 2DBVO 3DDSA 1WEKA 3H9JA 5EN4A 1SQGA 2HRCA 1KGSA 1N0WA 3SVTA 5BQ3A 1H0RA 3IEVA 4XD2A 3UB3A 3UJBA 1H4SA 2J41A 2P79A 3KT3A 2NX2A 1YNOA 4QXOA 4IRXA 4RTMA 2BBOA 3PGLA 1G1AA 3VVLA 4PXSA 1YZFA 5BR7A 1TKRA 3MTQA 4TXLA 3GIWA 1MAVA 1GFSA 1TQ6A 2GRJA 1NDQA 2W71A 4I2VA 4XFJA 2YCLA 4DM3A 5I7HA 3IDQA 5DX1A 3KCNA 4L51A 4FFRA 4KI0A 3NHZA 3AXTA 3M9WA 4HNRA 4LXYA 3STYA 4AQDA 4WLEA 5DDIP 5DK6A 3AUXA 4MA0A 721PA 2AYZA 2ICAA 3PHCA 4Q4JB 2AFIA 5KQSA 1US8A 2GPSA 1IOZA 1E6EA 1X80B 2BGIA 2DPXA 2YQ5A 3ZNOA 4BMPB 3FTNA 5KX5A 3OU2A 1MO5A 2Z2KA 4HFJA 3C6XA 2QXTA 4TTVA 5LLTA 5IDQA 4WSOA 2IW3A 1VHQA 4MVJE 4V02A 3OLWA 4ZMBA 4X60A 4YUYA 3ILHA 4O1IA 4UEOA 4QRHA 5AM2A 2WWFA 3L6UA 3N0XA 2YN4A 3LUGA 2WA2A 1NQOA 1EUCA 2B2NA 2KI5A 3AJRA 3M81A 3BK1A 5FV4A 3A4YA 2W6ZA 4MWTA 4M0FA 5FPKA 5K5EA 4DLRA 3U17A 1CE8A 4LBZA 2A0FA 1CW2B 2YN2A 3PFWO 1JEQB 5C52B 1OZAA 3BCUA 3KSDO 5FUBA 3N70A 1PFKA 1JAXA 1LF5A 4D4MA 4QSHA 1ZGAA 1E32A 2G3YA 2QV0A 4GSYA 4A2PA 1P2VA 3TIXB 3C6ZA 4FEGA 3OFJA 2VJLA 1KMIY 4H15A 3E0QA 5HK8A 1NOJA 3BILA 2B35A 3SR4A 4GE3A 1QZ3A 3NH6A 4UUAA 4MB6A 5BRNA 4NQRA 1KK2A 3VPFA 4DQVA 1XMOB 1WU8A 4LXXA 4RORA 2UZ1B 1GGMA 4KXMA 1FYDA 1DQNA 3IDZA 3VR6D 3ZE1B 4BVJA 1JNYA 3PB3A 4EX6A 4YMSA 1IRXA 1TF2A 1AHIA 2C88A 4AB1A 1X15A 4N7RA 1V9CA 3IUSA 3JVVA 1JHZA 1G41A 4MR8B 4XOIA 4XWTA 4QQRA 1FXWA 1Q1QA 1DXOA 3PP8A 3P5BA 3VR3D 1W59A 4KEAA 3PFNA 4KLCA 1R6AA 2AHRA 4LCBA 4C0SA 2CHVA 1RBZA 2I22A 2C3UA 2P2DA 1XTTA 2V7WA 1P91A 2Z2JA 3LZCA 4M1KA 1QYIA 3IMFA 3LPAA 4NPHA 4KQEA 4Q1BA 3RANA 3GZ4A 1MABB 4EQ6B 3CEAA 1Z29A 4DR2B 1HDXA 3KOUA 4JS0A 3CH4B 4ZEMA 3SX0A 1AG9A 3CJQA 5KKCA 3QKTA 2OBFA 2IU4A 2XV1A 4R40A 3KSMA 1Z22A 4E6PA 1YC2A 3ICCA 2J5XA 3HY3A 4PNZA 4LF4B 1TCBA 3UJAA 1Q7TA 4DBLE 1NI5A 1BE8A 1I1NA 1XZGA 6REQA 2JIBA 3PT9A 3LU1A 2DZDA 4U7WA 2I6FA 3DWGA 3IMCA 3BFPA 1RHMA 1YZYA 2ATIA 1LJ8A 2O1SA 4OAOA 3VJMA 2YBDA 1D4ZA 1CZKA 1NHGA 2REQB 3R0JA 3S1AA 1OILA 2GRUA 4ER6A 2BEVB 4ZHQB 4KFUA 5HDQA 4X95A 3O8NA 2J08A 3KYCB 1E3QA 4JLOA 3GRYA 4WLOA 1DHRA 1LLFA 1U3DA 2ZRLA 3K4HA 3LF1A 3ZE2B 1I2AA 1JZQA 1TYDE 2B5VA 4R5MA 1CDDA 3LVQE 4DL9A 2ZCJA 3O2SB 1VGVA 2HA4A 4HZUA 2WWRA 3W2HA 5CLIA 3OPVA 3DKPA 4LTMA 3EIXA 1Z2CA 3K9BA 3I1YA 1C8KA 3FPHA 4RGBA 5J2UF 1K08A 2D5LA 3BYZA 4G4GA 5ALLA 4WWHA 3ZTTA 1E6UA 2AVNA 4TLEA 4BASA 1U7HA 2ROQA 2B7LA 1JI0A 2XRYA 1RWOA 2IQ5A 2X22A 2ZVDA 3C7CB 3HA2A 4KQIA 4N6OA 3V7YA 2XCTB 5ALSA 4E94A 1HX7A 3OCWA 1EAMA 2XY4A 2PBLA 4UHFA 5AK6A 5MGBA 1D4AA 2HHLA 5AHOA 2J32A 1Q14A 5IFLA 3MOSA 3B1YA 1GL3A 4RFLA 1ST2A 3WIUA 4DV2B 1INLA 4J76A 1LFDB 3SMVA 3J7TA 3GNQA 4OVKA 3VVBA 2VNAA 3I76A 4BFLA 4NBKA 1P8AA 1UKEA 2V0NA 3FCCA 3GFSA 1XVAA 4K9NA 1RRFA 1QP8A 2YXBA 4AP9A 1BDHA 1AS3A 3MUOA 1QK4A 5CBPB 3LLSA 4J0EA 2D1YA 4PRZA 3GLGB 4WIAA 1DJNA 4WUTA 4U00A 5AO9A 5TPZA 3STTA 1RRMA 1GN9A 1RP1A 2L17A 4DR6B 3WGJA 3K9FC 1P33A 5DOVA 1LPBB 4G09A 4RL6A 2C03A 5EVCA 5HS4A 4B0OA 4UZEA 3NIBA 2FTKE 3FTDA 3JARB 4UZSA 1AKQA 2X13A 4MB0A 5ESRA 2O06A 3ER8A 3AUYA 1WW8A 2DMRA 2H4FA 2ZIFA 1HBJA 2FZ4A 3G8BA 3OSUA 3PDWA 4ZVTA 4GEGA 1YQDA 1UJBA 3LQ4A 1ULUA 3MTBA 4RHTA 4KVGA 2B1IA 3QZUA 5HCNA 4P5DA 4A8TA 4EPWA 3ABZA 1EU1A 1JXOA 3HY6A 4D8XA 5ERGB 1C3VA 4IVPA 3VX3A 2FQXA 1KA9H 5HP4A 1EFVA 3KEMA 5CA0F 3IJEB 2OO5A 2A7QA 3TUJC 4MUNA 2EHJA 4HQRA 4JI7B 3DBOB 3B3GA 2Z3ZA 4CCYB 4E5MA 2GXSA 2VRNA 2M6KA 2ERXA 2XOKA 1U2RA 1FSGA 1QYDA 4IVRA 4GI1A 4NCJA 1H2WA 4Q3OA 1HDYA 4GAEA 4UHHA 1GG2A 4K88A 2NW6A 4K9SA 1EDEA 3WP1B 5TVGA 3D7MA 4QOHA 3VU9B 4CQMD 3P26A 3WS7A 1ZONA 1G6OA 3B6MA 5ALEA 3BK2A 4EBFA 1ODTC 4IV0A 5FUVA 4BLUA 4B3GA 1NVXQ 4ZQBA 4C5CA 5H68A 1CERA 4XWKA 3Q7RA 1FYXA 1KBOA 3C48A 3WI7A 3H6KA 3QUSA 1JFTA 2ONKA 3AHCA 5BNFA 4A27A 2DLDA 1UM8A 2P27A 2PBFA 4ZCRA 3RC2A 4KQ2A 2QLBA 4GT1A 4BFZA 2G67A 3OMWA 5ELXA 4JN6B 1WMFA 2D54A 1JSZA 3MZ0A 3KVRA 3VHLB 1RE0A 1QGAA 3DLHA 4LOLA 3K71B 2VSYA 2AJDA 3WDSA 1WZNA 1SC6A 1QV7A 3K1AB 4RTSA 5AK5A 5JFTA 2HBQA 4XOUA 3VYWA 3PUKA 1P7CA 4MWZA 4ND6A 3WC4A 3FDXA 4ACBA 2DLCX 1FRQA 2QTVA 3KQVA 4M99A 5GGYA 3NGLA 4MQMA 3JTEA 4NFYA 2LKDA 1ONSA 4AWXA 1N1DA 1XKLA 4WFIA 4F38A 4QG3A 4FUTA 1E0SA 5AVUA 2I80A 1A9YA 1FQOA 1TVCA 2CY0A 1YRLA 4MI6A 2VAVA 2G71A 4FK8A 2NTEA 2PU5A 4L4YA 5A5GA 1Z6PA 3C45A 1XU4A 3HCFA 1CR4A 2AR0A 1TGYA 3BFJA 1QG4A 4NZ9A 3Q9NA 1LPMA 1IBCA 5CFLA 2Q7XA 5JCZA 5IHPA 4ID3A 4OJTA 3UYKA 3Q8LA 2OZLB 5BV1A 2OG2A 3NJRA 2XCQA 4P93A 3VYUB 3OQMA 3KXIA 3PEYA 1Z13A 3R0VA 3UTCA 3DBVO 1NKTA 4EENA 1JTVA 3INTA 3UGJA 2XMBA 2G9ZA 2CBGA 3C1OA 3I6IA 4K1XA 4NBTA 3TEJA 3D7SA 2V9CA 3VHXA 3FZNA 3GUYA 1NLYA 3C74A 1A8PA 3LT4A 3OPYB 1OAOA 2R87A 1WCWA 5KAMA 2WFMA 4HNTA 1SOUA 2WAXA 2OMKA 4PF1A 2AWNA 3GP3A 4B6FA 4ZOQI 1B8OA 2FQQA 2Q0QA 2QF7A 3IE1A 3AHIA 3AI7A 2ZRAA 3U7FB 1HF3A 1XQ9A 1WQ3A 2JA2A 3BREA 3DL0A 2WI8A 3GEGA 1ZCFA 3BSFA 4K6KA 1EG7A 4PLCA 3IIJA 4QM7A 5CFPA 1KAGA 3ZJVA 3BRWA 5I48A 2G9NA 3RVQA 4K6GA 1G5IA 1PYOA 3EQZA 2C2YA 4FMDF 5T6MA 3M89A 3IP9A 2XECA 4FGSA 4CFZA 4ZWNA 2GAAA 1N0VC 4PSUA 2II6A 3IBCA 4RWEA 1G6KA 1X38A 1FB5A 3IA2A 3NHRA 1WF3A 4PZAA 2ZR0A 2XA1A 3IAM6 4HO1X 1PG5A 2X8JA 4H1UA 1EUQA 1WPXA 3SIWA 1UZNA 3EC7A 1Y8RA 3ETNA 1R4ZA 2NTJA 2O2SA 5CYPA 3M2TA 4NV1A 4R8RA 4AMVA 4CLOB 3SZ3A 3ZJUA 4ZU6X 3HK2A 1DQRA 2GN2A 4N41A 1QF6A 3GT4A 3U56A 3DXYA 1UXKA 2AL7A 3SF8B 1P0FA 1XLTA 4Y1EA 3RBXA 1GM5A 1RP7A 1SUPA 1RLIA 5TMBA 3RSOA 3GDOA 4G1FA 3PFIA 2IS1A 3L9XA 2PX8A 3SQMA 3ZKWA 1YZVA 3ASVA 2XSZD 4RGYA 4NJMA 4WLVA 1J42A 5FNVF 1OGIA 1LTKA 2I3DA 5LB2A 1C30A 1EBBA 3LRPA 4BBPA 3F3KA 5E7MA 4HV4A 1KHHA 1M7GA 5JNLA 1W4CA 4AZVA 1J8DA 1ZIYA 3L07A 3GAAA 3VYRB 1NVWQ 3SXUA 4L02A 4QTXA 2JCVA 5K0ZA 4BMVA 1T24A 5KSWB 3RIYA 4UU0A 3MSCA 1KJ9A 1YVRA 2FN8A 3VYSB 4M0KA 4FYHA 3C3PA 3FAKA 1QLJA 4CHTA 2O20A 4BX0A 4JUFA 4LECA 2OXFA 4Y8VA 4BFYA 1IOWA 1CVRA 4NU0A 4Q4AB 4EWLA 4BKOA 4F8JA 4EL5A 3Q7QA 1IK6A 1MGOA 4MKFA 4I8DA 1EJBA 2Q3JA 3H2BA 4WGFA 5JISA 1FFXB 4KPFC 3VNRA 1ODJA 4AQ7A 2FUNB 2Q1SA 2O0LA 4FHCA 1CPYA 4KN8A 3NIFB 4AM8A 3FYUB 1S0UA 1NQVA 3PHIA 5FF9A 1O57A 2ZM5A 1SB8A 4OM8A 4IXDA 1E58A 1P1CA 2AUMA 2CF5A 3QU7A 2NAPA 1FDVA 1KVRA 1VSTA 3KZKA 4OGWA 5CXXA 4BQIA 5KUTA 4M3NA 5BR4A 3CU5A 4MRPA 4G5SA 1XVLA 2FF5A 2FG6C 2IEGA 2SNIE 3KBBA 3UJHA 5FOQA 1BQEA 1NNSA 2UVPB 2WQ6A 1NKVA 3STXA 4XRRA 5HUHA 2ZYWX 4Z0NA 4YJ2A 3G0OA 2PRSA 2QUKA 5GM2A 5FI3A 2X3FA 1ZH4A 4XWOA 4EUHA 3O92A 5KPJA 1CUXA 2WKRA 1TECE 2XF8A 3ND7A 4L4XA 4OXRA 4OM7A 5LA6F 5J4VA 2R4TA 3WO1A 5GIOE 3D43A 4BFXA 3OCVA 2IKSA 3CLSD 1WMEA 3C2QA 5A6VA 2J7KA 3NIDB 4BNIA 1PSWA 2IYNA 1KKMA 1N57A 1XF9A 1GTJ1 3C5CA 5DFAA 4ABYA 1MEOA 3MVEA 1LSUA 3DV2A 4A82A 1E2BA 3AETB 4TXMA 3I4FA 1LKZA 4M60A 4OYHA 1R74A 4Q66C 4BB6A 4TRNA 2GDZA 3OQVA 1E4EB 2GA8A 2H8KA 2HYDA 2OP0A 521PA 4C4XA 2WRZA 3INGA 5I8PA 3OQIA 3WZ2A 3NC4A 4XIFA 1Q0HA 1VKNA 3AONB 3G82C 4X1KB 2QZ4A 3BRCA 4Y1GA 5DI3A 4E21A 1RD4A 1ARZA 3MGGA 2G6BA 3QYAA 1IN4A 3GJ8A 4DSZA 1NP7A 4D81A 4B8YA 1PW7A 2GLXA 3MWJA 1MQ9A 1OXVA 4ZODA 1SZDA 1E7WA 3N8GA 5AW8A 5C32A 1XD9A 3SBDA 2JJ1A 3TB4A 3QYJA 2IHKA 3PFGA 2VK8A 5FBHA 2TMDA 5EXTA 5JSFA 3IRUA 4BEJA 2CDBA 1Y3IA 4BNJA 4ENTA 5HX7A 1QBGA 5DHAA 5GJVC 1JE0A 3T95A 1K3TA 5J1SB 2BBTA 4AK9A 2HQOA 3MD0A 3TSYA 5F7XA 3VJLA 3LQ1A 4EKYA 1Z3CA 3G7UA 1N2GA 4QGGA 2R5FA 3OQHA 2YS7A 1WXEA 4N8EA 4PR0A 3UAXA 3ZU4A 4FGLA 4A5SA 5LP6F 3GDHA 4OQQA 2DY1A 1OBOA 1TADA 1XJ5A 2J0UA 3I0NA 3HXKA 5HRCA 3GLIB 1DKLA 3QSYA 1FP6A 3HEAA 1JWBB 4K5QA 2D59A 1A2KC 1JALA 2DBZA 3DP7A 2QAJA 3TL6A 4DIFA 3RYCB 2ODPA 2IYQA 1FNCA 1PWEA 2QLFA 4HDQB 2X77A 1RW4A 2CNLA 5EJ6A 5LN1A 3AL3A 1UKYA 3C6BA 4UEWA 5J59A 1UUFA 2JLSA 2QTCA 3C98A 1RHQA 4DJJA 1T2EA 3R74A 4JGIA 2Z2IA 3BIWA 1VBFA 2JHAA 3PQEA 1GPWB 1ZOIA 3EVCA 2DUWA 3BD7A 3IOCA 3NT5A 3QK7A 5TR9A 4C4AA 4DMLA 2QM0A 1XKQA 4FLFA 3RU9A 3RABA 1N3LA 2BJVA 4TWIA 1N7HA 3TJMA 4F5WA 3HLTA 1KETA 1OASA 5H3CA 4UNNA 1QB7A 1JMYA 5LBTA 2FR1A 3ZBQA 4KDCA 2ODWA 2AOWA 2ZSIA 1W4AA 1IULA 4C6HA 4F4HA 2PL9A 4H6WA 1KI8A 2J9RA 1W581 3U9SA 3LZ6A 4I4TB 1SAYA 1ODCA 2QROA 1T9BA 3U09A 3EOAI 1G20B 4RLHA 2ZSUA 1XCMA 2GZDA 1JJVA 1ZPDA 1UBUS 5IH7A 4I14A 3B12A 5AVRA 1JDSA 1N34B 2BEWB 1ULSA 1JPUA 3LJKA 1WEHA 4GBED 2FZEA 3NHKA 3DM9B 4C89A 4I5FA 2Q1TA 1KEWA 2QXUA 3FBWA 5L7YA 1AUOA 5CGQB 4L5YA 3GNSA 3KX2A 4NQZA 4PTLA 4O59O 1FQKA 3BHIA 2V9ZA 4WDRA 2NO5A 3AESB 4PTZA 5DTEA 3RASA 4YRCA 4FCWA 1Q7GA 3KKKA 2XPCA 1XKTA 2OHHA 5IX8A 3FPGA 2RGWA 1EGHA 1QG2A 5E8RA 621PA 3P9PA 1DJMA 3WAKA 4L3OA 5D00A 2Z83A 3WL8A 1KMCA 1U6JA 2X9VA 1RIFA 4MV5A 2BR3A 4DJAA 3F6YA 4V1CI 1KZ9A 3OPNA 1ND6A 1QIGA 2O54A 4EG4A 3I1IA 4YRFA 1WB5A 2FZKA 2XUIA 1K89A 3JRWA 1M67A 3BXEA 2ZJ2A 1XELA 3F7OA 4IIGA 1Z4NA 2W43A 4KXXA 3A2NA 1TJ4A 3PQCA 5TQ2A 4ARZA 4MKRA 3EMDA 3R0IA 2BCEA 2JIRA 4RVSA 3PC8A 2G72A 1A8QA 5F21A 3RJMA 1QO0D 2G5CA 2YY5A 3UY4A 3IFSA 2WT4A 4A2CA 2BYTA 3T8YA 4M83A 1T9KA 4PYOA 4YRKA 1IBMB 3HJUA 5E6RB 3GLFA 4I9HA 3KSZO 1XPUA 5FTMA 4X41A 4IDNA 4MQEA 5CIQA 2A9QA 3GEMA 1KEEB 1C7EA 1OA0A 2QRJA 3EHDA 3NYIA 4ZU1X 3W3ZB 4TWAA 1U94A 2XQJA 3IAS6 1M1XB 3G8DA 1Z2NX 2YZNA 1Y4UA 4PIPA 2BMEA 1GDHA 4QYXA 4TTIA 1QLHA 2DUNA 1W5FA 4LBYA 3T3MB 3U7QB 1KAHA 1OWNA 3MYYA 3QITA 1QO9A 2XCIA 2C00A 2X2FA 3GJXC 2P6OA 1N25A 3H2IA 4K26A 1XDUA 4LXUA 5F5NA 3NR2A 3T1NA 4BC1A 4EW6A 1GQSA 1W0JD 3CLRD 2W2MA 4I5GA 5ICGA 3OH8A 4U2EA 1LA2A 2PL3A 4EA8A 2M9MA 1LSSA 2C04A 4ND4A 5F35A 1WY7A 2PUHA 5JATA 4MGKR 3FIUA 4OLAA 2VDJA 5FI5A 4I55F 3SBXA 2TYSB 3JWEA 1PJ2A 4BO9A 3R75A 3QKUA 1WW3A 1XDBA 1D0SA 2J3DA 3HNOA 5K0GA 2AIRA 2VSQA 2AXEA 2O14A 4ZAVA 5J4LA 2OILA 3CLUC 3JAWB 3UV3A 5C7YA 4QUKA 1X7ZA 4YDSA 4A23A 2I6XA 2VYCA 4HEA6 3NXSA 1ADBA 5DW0A 3GEEA 1CJVC 1U8EA 4PAMA 5JS8A 1JLMA 3V4FA 2EJTA 3E7XA 2IYFA 4K9LA 2CFTA 5AKKA 1E1CA 3I8SA 5CR9A 5D2CA 4QBKA 5I7OA 2OAGA 2P4HX 3NHSA 1PGQA 2V8BA 1WMSA 3OE7A 4KBGA 4NH4A 5DIZA 4GI2A 5DT9A 1SQFA 2C29D 1C1HA 5CDYA 2AE2A 1COWD 2JH3A 4Y7CA 5EVJA 5PNTA 2XYQA 5BN3A 3CN7A 2DCMA 2FN3A 2C9DA 2GZMA 1BVYF 2VHXA 5H4GA 4AMBA 4JROA 5E2IA 3COVA 2ZI9A 5CCEA 5I9NA 3AF4A 3OX3A 2CBXA 3A06A 1PK7A 3LFTA 2UXCB 2YJ3A 4NNJA 1THGA 2GKGA 3M3HA 1PTJC 1YNSA 4JV5B 1BKSB 5FBWB 3BA6A 1T3SA 2WB2A 3E2PA 1QFJA 3SHQA 2R1VA 3DW3X 3MYRA 3HYCA 4JODA 3BWVA 5IJ9B 4QVKA 3R77A 1NXOA 2ZDGA 3G68A 2ZIXB 4O25A 1RZRD 3OZ7A 5L40A 4P53A 4RJLA 1TZ2A 2CE7A 3DBLB 4YLGA 1EIZA 1STOA 1ACLA 1SHKA 3HYSA 4RIEA 7AT1A 3JZMA 3ONDA 3QOYA 1WZCA 2MIIA 3RFXA 3AR7A 3K1TA 4I5EA 1P3Y1 3VNBA 1JN0A 2ETXA 2GI4A 2MR6A 2OOKA 1F5NA 3G0GA 3QHPA 4RZ2A 2HQBA 1NP6A 3MIZA 4KFTA 4OJYA 3RUIA 1YUNA 2G36A 2Z2YA 4D8YA 5IUKC 1EK5A 4PLTA 2EBHX 1F38A 1KKLA 2J5RA 2QD5A 3CZCA 1UMCB 4IDOA 1MVOA 1PKXA 1T9CA 3MPUA 1Z0KA 1ZBDA 5ALPA 2AGVA 4IDBA 3TD2A 1K97A 1DRJA 3KPUA 3PS9A 3BH0A 5AKIA 2NUTA 1MA3A 1ZGHA 5CX4A 1XQ1A 3QHAA 3GBPA 5FHQA 2FMFA 5BMVF 3U0VA 1U2TA 2WJIA 4R1UA 3RT7A 1UIRA 3V1UA 3A4VA 4C05A 1MJHA 4OI2A 5EL0A 1BH6A 5T8KA 3I53A 3ZCUA 2WNSA 4V0MA 4G26A 1CY1A 2NWQA 3OM0A 3W1WA 2H08A 3H42B 2YOFA 3TLBA 3MRXA 4UAJA 1TKBA 4L6AA 4UVIA 4IJVA 1YU6A 1SD2A 1PSZA 1NQTA 2EYQA 3L7YA 3K0HA 5DRYA 1GL7A 1YMUA 1KMHA 4O4IA 1K8ZB 4M8KA 1XZHA 2Q4BA 1EFDN 1TD1A 3D7NA 4OAQA 3AHDA 4MARA 1F0YA 1IY2A 1UBOS 1GZHB 1C3OA 4FFDA 4PG8A 1S8OA 5HCUA 3IPXA 4RKQA 1O03A 4E5KA 3NBZC 4GUAA 3MBKA 4B47A 1S1CA 1JBKA 2RG1A 1FTWA 5EEGA 1QPBA 3TJZA 2PUJA 4X71A 5AW2A 4EW1A 5BSTA 1TC2A 2DWQA 5DHRA 3TN7A 4POAA 1KQOA 3ESZA 3E9DA 3W2FA 3VKWA 1F9AA 1WKCA 1TYCA 2HXGA 2J59A 2A35A 2ZAYA 1M6WA 3LP8A 2DTXA 5SICE 4EARA 3FOEC 4HJXA 3FOBA 2P2GA 1M2VB 1XZBA 4RPGA 3IKVA 4AROA 4LJ4A 3RC7A 4HGOA 4PPYA 5AVQA 4NMLA 5TVKA 2ZWOA 3H9GA 3ND8A 3GQVA 1K4YA 4J0CA 5AI6A 3W6PA 1KE1A 3GFBA 3DLPX 2P2ZA 3FBGA 4QOFA 1VTKA 4NZPA 4CGZA 2NZJA 4NOLA 5B1EA 4Z86A 3ZVNA 5BSEA 1SMKA 1SZJG 4LG1A 2PCLA 3BE5A 1A69A 2IZ7A 5I8ZA 1K5DA 3D4IA 1GNQA 1ZMXA 2ZR8A 1QC5A 4N6NA 5IKXA 4JYPA 5KYVA 1TFUA 4CMEC 1N3BA 1BCSA 2BZSA 3DBIA 1E3TA 4FW8A 5EPEA 5L4NA 1RRPA 3OD5A 4J1TC 4R31A 3R3VA 2P1DA 1HORA 2FMHA 4X5OA 5I4BA 3C7DB 1ORTA 1X7YB 4MYDA 4IDAA 4LQLA 4TTQA 3JYQA 1VC2A 1PYDA 4XH9B 4HLQB 1V5FA 1CY2A 2PXCA 3WBFA 2OO3A 5EJ5A 4CM7A 3QWHA 3CLSC 1WS6A 2BUCA 1NUSA 5F5LA 4JLDA 1VIDA 1T2UA 2SICE 1O9BA 1NDUA 2NSJA 4OK3A 3G3EA 4F3TA 1EDDA 1ZRHA 1V35A 1W4LA 1GFIA 1NC3A 4IYJA 4YCDA 1A7UA 1PIWA 1P4HA 3RSFA 5DGXA 5LWHA 4IFTA 4XVRA 1QU2A 1QGUB 3EGEA 1P77A 1WWKA 4UBIA 1JHQA 4A8PA 1PG2A 3HDGA 4NI5A 2N9UA 4OAPA 1TUGA 3TD9A 5B30A 1I4WA 4UE2A 3ZYZA 4CQJA 4OQPA 2Z43A 3N7AA 4OHBA 3LS2A 1NFRA 1XI2A 4EFNA 3O73A 4LOAA 2A4MA 1N5MA 4ZHQF 4PHFA 4WY8A 3PD7A 1Z38A 1WCXA 4FCTA 4AJIA 4E3WA 2FN4A 3KOXA 4BHTA 1BG6A 1EDOA 5JBQA 2Z58A 5DX8A 1L5HB 4PONA 1Z2DA 4MKGA 1GRCA 4ZN6A 1ZQ1A 3L41A 3QNMA 4ALMA 5IZCA 1DWOA 3UQYS 5L4SA 2MSDB 4MCJA 5C7OO 1OAKA 2B0CA 1DZIA 3QJYA 2V97A 3FOCA 1AGYA 3KZNA 5A0FA 1XTIA 4AUEA 1SQ0A 2Z4SA 1OU4A 2CLFB 5BN5B 4QYIA 2PL5A 2CLMB 2I4RA 4P33A 1SA0B 3DB2A 2PSFA 3TRIA 1PT9A 3IPLA 4OGLA 1LK5A 2O4UX 5BSMA 4I46A 3FHTA 1L8QA 2Y92A 4XD7A 2PBRA 4MR7A 2VPWA 2R8XA 3W5VA 4LFCB 2O2JA 3BERA 3IQZA 1FJHA 2Q4DA 4BGEA 1SXQA 5D87A 2I3ZA 1T9DA 4TSKA 5DMXA 3HGTA 5IEJA 1MOQA 2D6FA 5JSQA 4I19A 3JQ8A 1LPAB 3ZHOA 3JQAB 1M2GA 2XR1A 3O4IA 3Q2OA 2Q0XA 1F0NA 3INYA 1AV7A 2CCGA 2XGOA 3C24A 1FFWA 3D8HA 4MRRA 1DS6A 4EO9A 1V3UA 5B3LA 5IMBA 3VNVA 3NRJA 5IJ0B 2LE0A 5D7BA 4N3GA 3VO9A 2BGRA 3WOVA 1Y42X 4EA6A 4KQJA 1XZKA 3MWDA 4MV7A 3S7TA 1E5VA 4Y30A 2ZBFA 4XGNA 4Z9YA 5BW8A 1XZJA 2G8LA 3JAKA 5CXUA 2V7XA 3A7EA 4OYRA 2P3SA 4U2DA 5FPQA 4S24A 4FD2A 4XLLA 3RSQA 1PR0A 1G98A 4DT1A 1TUBA 4ND7A 3A1TA 4YALA 1GP2A 5ELMA 4HNSA 4YAOA 1NM5C 5ALMA 5EE3A 5DXJA 2C3PA 1RWBA 3QLTA 4RHXA 5JH7F 5DSTA 3C3KA 2ISQA 2VC2B 5DM70 1DPGA 5TDHA 3WKBA 4B7CA 1E62A 4Q47A 1ZOLA 3W9SA 3ZHCA 4G0QA 4JXZA 1FUYB 4M0MA 1GZDA 1YFZA 1ZNYA 4H3VA 1GQFA 4NCNA 1IY1A 1QYRA 4RHFA 1KJJA 3H6HA 1U31A 1XCLA 4XASA 2KW5A 2OD9A 4UE6A 4EYGA 2X5KO 2FOLA 2UUOA 1NZJA 3QY0A 5DCWA 5FP0A 2ZBQA 2X4GA 4EO4A 4J0GA 2BM0A 3BN3A 3U49A 3RC8A 1BHJA 1IM8A 4ZEVA 1ZRMA 3HVRA 1BS9A 1SKYB 1SHZA 3IAHA 3ZZNA 3KU4A 3VNUA 4S3MA 1ORRA 1SBHA 2XVZA 4FHZA 4NV0A 4QJ5A 5GM1A 2QLLA 4V03A 3TFOA 1U0HC 3OOSA 1BTOA 3EDRA 1E4OA 2R00C 2WOOA 2J4DA 2ZGVA 3N8HA 1FP4A 1TAGA 4QAQA 1UQTA 3AZQA 5THXA 3G0IA 3P71T 3QJGA 3IHKA 1GAQA 1Z7WA 3D1JA 2RH5A 3ZDCA 1FZTA 7REQB 3JWHA 1Q19A 1Z8NA 1V1RB 2P4QA 4X84A 1CFZA 3HBJA 1PJLA 4Z99A 4UCXA 4HGPA 1UJNA 1M2NA 1MO3A 3HKBA 1ZITA 1XHFA 3ZV7A 2DH6A 3GJ6A 1AXRA 1MIOA 4JJGA 3TOXA 2QP4A 3CX8A 1SHLA 2O07A 3L7MA 3B2NA 1TO6A 4GKJB 1QG6A 3QIAA 1H66A 4PLHA 3VZPA 2PVSA 1YULA 3F71A 3MINB 1DPFA 1ZLXA 2YNMA 3T3DA 3HUUA 5JY6A 1GPNA 1G4HA 2O2ZA 5D5HA 5C8YF 3B1XA 1G7SA 2RI6A 5JZBA 2F9LA 1YDHA 4ZOLA 3P4YA 4JZKA 1MC5A 421PA 2IYXA 1ELOA 2NU7B 1SG9A 4IG4A 4QDKA 4AJ4A 3P9RA 1GZ4A 2ADOA 1P4AA 1G63A 1E7YA 4IS3A 1JH8A 4NP6A 5FL7D 4FNGA 3G5UA 4JP5A 5K6TA 2PFSA 4XSVA 1GKIA 1E79A 1MHTA 3GGCA 3BGIA 1KFEB 1HLDA 3CLRC 4P38A 3DOJA 5M3BA 4AURA 2Q1WA 4B85A 5ELLA 3GDWA 4GHWA 1E2FA 3CM0A 4HWPA 1AGNA 2ZIVB 3U19A 4MGEA 4LQ4A 4R51A 4ZPXA 5E9WA 3VHRA 3QVGA 1W88B 3P2YA 3HJRA 1C9KA 3GFVA 3EZ9A 2CGEA 2IZ5A 3WJ1A 3LK7A 4D1YA 3EXHC 1QPZA 2VWHA 4XM1A 2CCJA 4PS0A 1RKQA 2AUNA 3DVAA 2VP6A 4QFDA 3IPCA 3AB8A 5FWNA 1E7SA 5JU6A 1MOSA 1UOPA 2QPOA 4IWXA 5HG0A 1D7OA 4UHKA 1QUEA 3E9EA 3HB5X 2MR5A 2RK6A 1RXYA 3O3NB 4L7VA 1C7FA 4UNIA 4D9GA 4J9UE 2Z8ZA 2AR7A 4G89A 4P3YA 4CM8A 4KQHA 2YYYA 4AJOA 3ESRA 1WDMA 2ZAIA 1YACA 3LUJA 1E0KA 5KZMB 1Z2AA 4OKNA 1G5RA 4DZZA 1CWUA 5LZ9A 1Q3HA 2BH2A 5CCBA 1R0LA 1WX1A 2Q5LA 1XRPA 2QMZA 2WKQA 2V5VA 3DEIA 3IULA 3Q2IA 4IH4A 4YJ3B 3EX7C 2R6JA 3E3NA 1EQ2A 3MQFA 2IXTA 1U5BA 5JSHA 5IRCD 4H0FA 3GRFA 4KJXA 4QPPA 1BDMA 1K86A 5I7RA 3MTGA 4AQYB 1RJWA 3DJYA 1W1UA 1GGEA 1NF9A 4FWIB 4XCXA 5JNRA 4R1SA 3L8EA 4KFRA 5JRZA 1EUZA 4PAWA 4YV7A 2OQIA 1QOPB 1JDZA 2IY8A 4JOSA 3QBDA 4CM4B 4LRWA 1J39A 3E05A 4G0YA 3RJ5A 3SVLA 3AEZA 4Z4QA 4KACA 2HGZA 3D2AA 2EATA 5K6AC 5FOWA 3EA4A 3RUEA 1Y3DE 2R6DA 3ET4A 1KOGA 1T25A 2QX7A 4L50A 2R84A 3ACCA 3F8WA 5HUJA 3OICA 4HDMB 1GRNA 2JS7A 3C5EA 3SS9X 1JWAB 3T35A 3C6MA 4FYMA 2GUGA 2WU3A 2VH2A 3QFCA 4IIHA 4TT8A 3WHLA 5AW0A 2EWWA 2MU1A 2EFEB 3PC4A 4HFRA 3OLCX 4O4HB 5EA2A 5G2OA 1EK2A 1KS2A 3G6WA 1JHOA 1FVFA 1JR3A 3DF7A 4FQ8A 4H16A 4WHMA 2O8FA 4WNIA 3HVKA 3VA7A 3EPJA 1XRNA 4UJ5A 4UD6A 3IYLW 2SKEA 1ZEMA 3BSYA 1IXKA 1D8AA 3VU1A 5E9AA 3KTDA 3CJTA 4QGSA 2GK6A 1U8TA 5G1PA 1U02A 3HFJA 3ETLA 4R1LA 4ZT4A 2QLJA 2W2LD 3KQOA 1ODLA 3KR0A 1ZO8A 1Z68A 5LQMA 3K1JA 3TZBA 1H6DA 3QX8A 4LWOA 3FR7A 3GT0A 1ZR2A 1W85B 2HHJA 4PHHA 4UOEA 4D79A 2PUBA 1I51A 2FXVA 4XXHA 4OI0A 3GK3A 3IE0A 1Z63A 1Y1RA 2BDTA 3CCCA 3KCQA 4LZNA 4AF8A 4KO3S 5JROA 3QELB 1BROA 3EAFA 4NEGA 5HS6A 4QYMA 1WHTA 2ZUSA 4EHIA 1Q0TA 1MO4A 3F90A 3VR4H 2PGDA 1H2ZA 4GNKA 3OT5A 5GONB 2H18A 3H0CA 4H7PA 5KDOA 3SYTA 1UWCA 1TT5B 5FIUA 4O33A 1SVIA 1BS1A 1KVUA 3DVSX 3HSYA 3N2ZB 1XVTA 3VTFA 3LPNA 4HR7A 2Q1YA 2ID7A 4M0DA 4YCAA 3HMKA 2AEEA 1KRXA 2NU9B 4A0RA 4KR9A 1Z0DA 2GF2A 3EEOA 3FFBA 4XQGA 3PGA1 2FFQA 3R3WA 2B4QA 1RQ2A 4FXOA 4CLRA 2EP7A 2FWMX 3LPCA 1P5FA 1XN1A 3AUKA 5A4MS 2WWIA 5IXJA 1YZUA 4J75A 4MW2A 2XTZA 2Q41A 1AK1A 3NO4A 5ALGA 1K7EB 2HDOA 1O96A 4WBNB 5JV5A 3CCFA 1XWFA 3E22B 3FCOA 4CR8A 2XF2A 3KQNA 1JGTA 1SUIA 3BWXA 3V7WA 2AFRA 1Y89A 2R4QA 3PQ4A 2X5JO 1TM1E 3PEFA 4PCAA 4RCYA 5B37A 4C0WA 4NRDA 3REGA 4KAJA 1N2OA 2OBMA 2Q5OA 3PX3A 1T4CA 4YFYA 3I83A 4BBAA 5E0OA 3RUCA 2VNSA 1B1CA 5ITZA 5JQWA 4EQZA 1RYDA 1F8GA 1VHLA 2WTEA 2MHCA 4YIKA 2CXSA 4KOAA 5BNTA 4K81B 5AKLA 1GPAA 3F1LA 1ORHA 1XXLA 2C84A 1I10A 3ZWOA 3E9YA 1GRVA 4MW7A 1SIOA 1JLKA 2ZI6A 2FPOA 4K86A 3FNHA 2VPIA 3JYPA 4IJUA 1J0BA 4RXUA 1MG0A 4Z54A 4WOKA 2EGHA 1PUXA 2XGMA 1IHXA 2BC9A 3DDOA 4LGYA 3OZVA 3R3HA 4UQPA 4LOIA 4K6FA 4PYJA 5HXAA 1U1IA 1TEXA 2RGCA 1HQDA 5DM60 1HMYA 1Z6YA 1QHFA 2BCJQ 2PAFA 3K35A 4L4ZA 4DS3A 4WCFB 3BMCA 3OZWA 5EWJB 4Z7JA 5BVHA 3B7GA 5IVKA 1LWNA 2IHZA 3SBOA 3F67A 1NN5A 4Z4FA 3HHPA 4UJ3A 1OXXK 3LP6A 2HTEA 4MVJG 1MOPA 1Q0QA 1FNDA 3TEMA 2BFBA 5ER6A 3NYRA 1ZD8A 5ABPA 5AKXA 4M98A 4RE6A 4ZTZB 2R6AA 5JSKA 3TRFA 5ALTA 4BLRA 2WJZB 4PGGA 3O93A 1WO8A 2W22A 3LKVA 1W93A 1VIMA 1JA0A 4MMZB 3WO0A 3LDHA 2P9HA 4W5NA 3CLTC 4YRGA 1HV8A 1RRCA 3CE9A 3K6SA 1GYRA 3R5JA 5EMNA 3D64A 2BFWA 5A4FS 2NU6A 1XXHA 3GXOA 4JBLA 5DLDA 4TL8A 1AN0A 1B15A 2Q9BA 2YHBA 3DOFA 5CG2A 3UJ7A 5FEMA 3KEOA 3IVCA 4F06A 4DWWA 2HCTA 3MWLA 1YU9A 3K8ZA 4UTXA 4ENVA 1GUBA 4TYQA 1US8B 3RYIA 5LQAA 2OSVA 2XE8A 4Y2GA 4ZEOA 1ICIA 2AOXA 5JBNA 4CM5A 4KVAA 1TL7C 4UM8B 5JRJA 2DPHA 4BTEA 4EO7A 1XZMA 4J90A 4OBXA 3FNFA 3BB4A 4G6ZA 2UVDA 3P4XA 2YV4A 3L6BA 1JMKC 3NX4A 4UQOA 4ICIA 3R5XA 2YOGA 1COZA 1GUAA 3IUNA 1FFYA 1KJIA 1RM3A 2QT0A 2RIRA 4I50A 4ZK6A 3MT8A 3U3MA 1Q0UA 2DHDA 3ENQA 2HT1A 2FWIA 1RI1A 3G7SA 3CJRA 4BVKA 1IY9A 2LWIA 3L1KA 1LH0A 1CEQA 2QTMA 1CUGA 1ZUNB 2B92A 2YUTA 1Q7EA 2ZYIA 3JQ9C 4OHPA 3M70A 3QWBA 1I7DA 3INRA 3V4RA 4GZMA 1YJ5A 3K53A 1NRWA 2VLIA 2K87A 3C5VA 5KJ6A 5ADUS 1S3GA 4YJKA 2YWGA 4LOKA 2DX7A 2I7DA 4PG4A 3RTCA 1IUOA 1ECFA 5JAPA 1ZWLA 1LPPA 4L2IA 1X1SA 1WVMA 2FX3A 4F9TA 1D6NA 2FK8A 5JE8A 3GUZA 1MT0A 4RK0A 4AF6A 1NBMD 1DT5A 1VOTA 2BZ1A 4D2IA 3N5CA 1OFGA 3CZ5A 2BMFA 2FW0A 2B69A 2FE4A 4QC2A 1B6TA 3L6EA 3I52A 5LQDA 2QL6A 3ROKA 5IBCA 4WK4B 2V1UA 2Q29A 3IEKA 2AMYA 3CX6A 4WXYB 5CFOA 1FNSA 2G5PA 1Q0ZA 1G5TA 3L18A 4GZ3A 1XX6A 4LDAA 4FQ7A 3TIFA 4QTYA 3Q11A 3HR7A 1FDUA 1FVHA 3W1EA 2RGYA 4RA9A 4EUKA 1IXRC 5I7FA 1NW4A 1T6NA 3E35A 4M1ZA 5B58T 5J5CA 5AMXA 2QD1A 3WLLA 3BT7A 3NANA 4XA8A 4I9UA 3M4NA 4DM7A 2WEKA 1KEUA 1NT2A 2FLWA 2FYTA 4H1WA 5AUQA 4KMMA 1QJ4A 5ALRA 1QZTA 4CLHA 3S1SA 1D4OA 4UQLA 3B8HA 3A3PA 5BNWA 1L4MA 1XA0A 3EDMA 3PUZA 4LK2A 4TMTA 4KO2S 1UJCA 2I4IA 1ESZA 3L8GA 1KJYA 6REQB 1O87A 1SCUA 2ZTVA 3OTWA 4UATA 4W8OA 4AJ9A 4EDHA 1D6JA 4QXMA 5I7WA 5KS2A 4ZVNA 3S1AB 3ZX4A 4C0JA 2OZEA 3CONA 5JT1A 2PGAA 2W83A 3GLVA 4Z0TA 1CUIA 4FJ1A 3LT5A 3WQQA 3OTGA 3OX2A 2WSYB 4BFTA 1DUSA 1PE0A 1WQ1R 4KXWA 4OY3A 1BJRE 3LC2O 4OQ4A 2EL9A 3HGMA 5KYKA 3GT3A 2B4AA 4H59A 4H1VA 1ZRNA 1JBQA 4YPVA 2Q28A 2PRIA 5J40A 1OFUX 1RIIA 2A33A 4JA2A 2QRQA 3C1TA 1Q44A 2BE9A 4MKZA 1MB0A 4KNVA 4IV8A 4B2LA 5B7PA 3A04A 1N6LA 1V7ZA 1UBTS 4ZAGA 5HZGA 1Q0RA 1FLAA 5TJ9A 2C5BA 5E0KB 4A8JC 1A5TA 4YMGA 1DKMA 5IYZA 4MYTA 4LDNA 3QEMB 5D3KA 1XPJA 2AEMA 5T67A 1BWPA 5F2OA 2I6TA 3FUXA 4IOKA 4S0ZA 2QN6A 4FI3F 1DBWA 1UJ5A 4OYLA 3V97A 1P0MA 4HPJB 3WJ7A 3COWA 4IF6A 3SICE 4Y2XA 2HA6A 3SNHA 2FJ0A 2O7VA 4M1MA 2JJ8A 4KN6A 1XLUA 1L1QA 2B7BA 3RGGA 4DNXA 3B1ZA 2BLLA 4PPGA 4ZO4A 2WF7A 3P1JA 1CZUA 1Y1SA 4DBLC 1OWLA 1RCUA 3C6KA 2PXAA 4IXTA 4Q6WA 4EFMA 1M8KA 2W6NA 4ZPJA 1QS0A 1B2RA 2AK2A 2E4ZA 3BSSA 1QANA 1OT3A 1T36A 1E2UA 2B9VA 3KVYA 4BWFB 1GQQA 1BFDA 1PX2A 2VNKA 2YV3A 4JLVA 1X7XA 3SI7A 1WU7A 1WB6A 4ZYYA 5I9IA 5KO2A 2EFGA 2ZYGA 4NYJR 5B3AA 4X1YA 4YN3A 4HH3C 1X7WA 4IOLA 5AXDA 2WLSA 3R7WB 1AHPA 4DR1B 3TI7A 1UKZA 1J2EA 5HJEA 4I7EA 2WF8A 4JWTA 4JLNA 4KXNA 3KQHA 1F9EA 4KLRA 4GXNA 5D3ZA 5F77A 3A3YA 2H4ZA 1Q20A 2Y27A 4EG1A 3DOIA 4Y6QA 4KSBA 2WE8A 2WIFA 4BLVA 3H8VA 3BRQA 2DKNA 2HH9A 5E1BA 2VP0A 1EFVB 4O6VA 2C57A 1PTJA 4WMLA 2JW5A 4CEJA 1AQUA 1IVYA 1VCHA 4JJ8A 1V71A 4UHEA 2G76A 5FJJA 1R50A 1MT3A 2QIPA 3LRTA 1KZ4A 1X1AA 2XZTA 3D8BA 3X1DA 1ANKA 1E2GA 1G16A 4XI9A 4XUGB 3ZGYA 3EF3A 1Y6FA 1LNQA 2R65A 2ZWAA 5EFZA 3TXXA 3ZU6A 2F8SA 5K0LA 2QJWA 3AILA 3RTAA 1GCAA 1WXWA 4Z8YA 2PXXA 3BAZA 5L6MB 3CVUA 3H2ZA 2AN4A 4KU4A 3OT4A 1KDVA 2V6FA 1UEXC 2ZP1A 2IHUA 2C31A 3RFFA 2WTMA 3O47A 3X3HA 1AIPA 1GLGA 3FGOA 2H92A 2JGMA 4E6EA 2A78A 4GMDA 4YV1A 4TLLB 3SM3A 2C82A 2H0RA 5HGXA 2NZ2A 5JS2A 4J0IA 5K4AA 3K20A 1NKSA 3K70D 1VPEA 4F2PA 4DR4B 1QKIA 5KAPA 3LDGA 4EABA 5JAIA 3ZDFA 1MDBA 2VDMB 3UAGA 1G4AE 5D51S 4MUBA 1BX3A 2P75A 1Q1BA 4XWAA 3RAFC 1KI9A 2QG9A 3RF6A 3VPXA 3KQKA 4O3MA 3CH7A 3GLQA 2Q5HA 2ERCA 3IX7A 5K3BA 1GQ2A 1M34E 5CEFA 4F4CA 5AVSA 5E38A 1YTUA 3AFHA 2IH4A 1VPLA 4JUIA 4YYZA 3U4MA 5U9CA 4W5HA 4W5JA 1UK8A 2FFAA 2W9XA 4R3UC 1G59A 4CLEA 3MJTA 1P2UA 3JZIA 2EVWX 3EHEA 2A0WA 4JXJA 4PHTA 4C04A 2VOEA 2W8BB 3I92A 3RVSA 5JNTA 2QMYA 4Q0MA 3W5BA 2NVBA 3FUUA 2XSZA 4U2FA 2NSHA 2ACKA 1H8HD 2C9BA 1XZQA 1XAJA 3OF3A 3TQCA 2W2NA 1IAQA 2A7XA 1SCJA 4ZGWA 4P54A 1UDRA 3HFRA 2I9PA 2CWDA 2H4WA 2H3EA 4IGFA 3DOUA 1ML3A 3KQSA 3MS2A 1UFKA 1W44A 4RVFA 1B93A 3FWPA 5BORA 2C2MA 1KWKA 1T3LA 1DAFA 2ZWVA 2VXOA 3P94A 4PZYA 4M86A 1B6GA 3T3GA 2XIQA 3PGVA 1W48A 3SDZA 2I4NA 4URFA 3IB3A 1E2QA 5I4KA 1CUUA 2O57A 3F7MA 3VTKA 4P7BA 4C0BA 3C8MA 5LQCA 4QFCA 4Y6GB 1YIOA 4KWCA 3GBVA 1OWPA 2CMHA 2JLAA 2J45A 5J63A 4MWDA 1FYWA 3KB6A 3C3WA 2YYSA 1BMFD 4E2YA 1AN9A 2JVJA 4E15A 2P5TB 3E3OA 3FPBA 2VXCA 2ZJBA 5FPTA 3RB8A 1OFIA 3WVNA 2EW2A 4D6PA 1P4JA 1NYTA 3QEAZ 2I3GA 1EH5A 2QUJA 1QIFA 3M49A 2HXYA 3L2OB 4O3FA 2H1LA 5F2KA 3V42A 2JGDA 3KNZA 1M5TA 4RTOA 2QRZA 4KMOA 4CMEA 5J23A 1P3JA 3ZCSA 4X62B 2X8AA 3EWIA 4C0AC 4C14A 2NZWA 3HE3A 4LI3X 4J1TA 4JL5A 4WI1A 5FTKA 1ISSA 3VO2A 2RK3A 4E33A 4PX9A 1SKBA 1YHYA 4HG2A 3RM3A 3ZLVA 1U0RA 3EZFA 4B0PA 3KEFA 5KWIA 2QA5A 3UHOA 5JCXA 4GH5A 1GADO 1Y8QA 3JALB 4F9GA 1TU0A 1P1HA 2HJHA 3PJFA 2X8JB 5IDVA 4O08A 2YMPA 4ZTUB 1ZLYA 3H5IA 1IBLB 1IEWA 2JFBA 3LQKA 3OI7A 4B6SA 2Z8XA 3I9V1 1QIHA 1PJZA 3C3JA 2HF7A 1IJBA 2VAXA 1ID1A 1XNHA 2WVHA 4HGRA 4RNDB 4BMSA 5DLYA 3BL6A 3IIKA 3PNOA 1R6UA 1ZC3A 3L1JA 1AUPA 5T4EA 3EGXA 4F0JA 1YB5A 2X3UA 3GJZA 1BH2A 3ZDEA 1DUIA 2IYAA 4LAFA 4CEIA 4QEKA 3MWGA 5TMDA 3NBAA 3A6PC 3ABQB 1JFRA 4HWGA 2Z5VA 3SJZA 3ZKWB 2P68A 3Q12A 3TSOA 3ZX5A 1ECPA 1JXQA 4LUCA 4MI1A 2P91A 5HTKA 1C30B 2QVZX 4MGZR 2DFNA 1ABFA 3U13A 5EKDA 2VNIA 4NSNA 4NJEB 1OBHA 2DY0A 4L8WB 2WSLA 3U5TA 1WW2A 3I5AA 4JH0A 2OGZA 4NOJA 3SXUB 4EHBA 1G21A 3CCBA 4IDPA 1G5FA 2X76A 1E2PA 4FS3A 2XA2A 2C5SA 3VR0A 4E2FA 2ADFA 1J8YF 2QN9A 4HMQA 1ZA2A 1K6XA 2Y0EA 4JOBA 1NNUA 5AVWA 1G42A 2XXAA 1YC5A 3OZDA 3FDZA 5SY6A 4DCSA 4BQFA 4PFQA 5DP2A 3SSAA 1VPWA 2O8CB 3N2LA 2VCEA 5KTKA 2BFMA 4GOND 3C8UA 4RLQA 2ZETA 2IHTA 1QTIA 3I5MA 4PYKA 4FFMA 4QOIA 3SPXA 5EJ8A 5JOQA 2ZJFA 2UKDA 2Q9UA 3OZTA 2E18A 2L42A 1RAHA 3WSWA 2H2DA 1I24A 3L8YA 3Q3JB 3D4PA 3NWJA 3SKXA 3U4QB 3DEHA 3NM6B 2FPLA 4G67A 3HDYA 1WVGA 5ALZA 1C1XA 3GLUA 2EW1A 2G6TA 5A4KA 3TSZA 1QRSA 4UUMA 4DA4A 4U7JA 4I81A 3N2GA 3R6LA 3Q72A 3UCEA 3TSCA 4YJ2B 1TRKA 4UFOA 2I1QA 1T2FA 1ZCZA 1BYIA 3NT4A 3NCTA 3QPDA 4HAZA 1U1CA 3C8HA 3NAMA 4MVJI 4DQKA 2EKQA 5FAKA 4P3KA 4EVSA 2ZRMA 3BXFA 4KQCA 2DERA 2VAMA 2XW6A 5FWXA 3L4JA 4LVOA 3WR5A 2ZSDA 4ZREA 2O5RA 1XDGA 4G1MB 3BA1A 3UWDA 3URMA 3SSMA 1BD4A 3FZGA 4XFKA 3T1QA 3U4HA 5EIXA 4MICA 3EIFA 5BRAA 1NXXA 2OENG 1SKUA 2V7UA 2VNHA 1YL7A 2AG8A 3IO3A 1L5VA 2CLIB 4YR7A 4B6QA 2ZJ6A 1ZX1A 4RTLA 2JIOA 3NMUF 1V1MA 2PJZA 2FUG6 3F97A 1NM5A 2OP1A 4DHWA 2X1MA 5ALDA 4RQTA 5J2UA 4LDPA 2MJLA 4J7AA 4RADA 3CH5A 3DFUA 3OQIB 4KXVA 1E2HA 2A92A 3PD1A 4CIBA 1EFUA 3FYCA 4FGJA 4O2AF 2ERYA 2QPTA 5JCJD 1UM9B 2PWAA 4KYIB 5H70A 4DQLA 2P9FA 1I5OA 2IT1A 4HXGA 3QH4A 4EVQA 3RRMA 2V4MA 1H3FA 2C2ZA 2GN6A 4EA7A 1DJLA 1VHJA 2PGIA 4ITRC 1TM7E 1CFJA 1XMSA 3S27A 2B5OA 2IF0A 3TK1A 3A1WA 4XJSA 1VSUA 1Z7YA 1OBCA 2F3QA 3CUSA 5AVKA 4DA8A 4ZIRB 1PRYA 4GMKA 1KYWA 3AERA 1WSBA 3REQB 4PGFA 4XM0A 3RBAA 4HMOA 4XDYA 1EFLA 2G70A 4N3CA 4BX9A 1G19A 3C14C 3HRHA 4JC0A 4CW7A 2QYSA 2ZRGA 3W6UA 3IEIA 3L7AA 1T4DA 3VSAA 1B41A 3IAXA 4ZMRA 2B98A 2Y1CA 3UGKA 1L3BA 3PKIA 4LJ9A 3U7RA 3D6MA 5JG7A 3GFRA 3SFVA 5CIYA 3DC2A 1YK0A 3BFKA 3GUUA 3AY7A 5DGTA 1SIWA 3IP6A 3HBMA 3TKLA 3DOEA 1MJGM 2QS9A 4G07A 4KRYA 1ESMA 3K0BA 3PITA 1X8LA 4UBMA 3WV5A 4M1WA 4BX3A 3IQHX 1PS9A 1SY7A 4K9DA 3LC0A 2VDVE 3IAUA 4WE3A 5SYMA 1HOXA 3USZA 1HSOA 2BBWA 3O3CA 1QDLB 2AG5A 4PY2A 4XPIA 1RWPA 2P6NA 1PCXA 3D3JA 5CA0A 3PA6A 1DX6A 4ZAXA 4CHGA 3S81A 2ZTLA 2W4QA 4UMDA 3R9IA 3RREA 2XTNA 1PJ4A 4KIWA 3B9BA 4KR0A 4MR9A 4RH3A 5JAZA 1O6ZA 1PL8A 3DFFA 2ABWA 4QQFA 3RS7A 1OH8A 4PTYA 2PS9A 5IHXA 1P9WA 4KK4A 3LXXA 3WL5A 1FTYA 2VHUA 3BXOA 4MMYB 4LFBB 1W4RA 1J5EB 2E5WA 3CNQS 5BNIA 1A9SA 1WD7A 3UHAA 3DS8A 3VHQA 1Y3FE 5BSFA 2CB0A 4U6QA 1TCUA 1JR2A 2C9MA 4HYYA 5IBPA 3UUEA 4EGFA 3R8FA 1HTWA 3TLCA 4DOMA 3NWPA 2GBPA 2PGNA 3P0JA 2D1QA 2JIZD 4YJ3F 2JFGA 1TQDA 2OXEA 1WMAA 4ZCSA 4E03A 5KDDA 4B7XA 3AKZA 1OREA 1R6DA 5U4XA 3EXHA 3N76A 2IUUA 2BRUC 4HRXA 3VPSA 1WUTA 4HJRA 4DHEA 4EKDA 3W8RA 4GXRA 4L95C 5C0OE 1FU7A 2HPZA 1CP3A 3ABRB 3LGXA 3ECSA 3ADKA 1PR1A 3PF9A 1XL0A 4BO2A 4HGNA 3M1YA 2X0FA 4MVCA 4MUXA 2C0PA 2QPAA 2QTNA 2ZUBA 5BR8B 1H4TA 1W5BA 2AD5A 5IKOA 3ICOA 5ALWA 1UC5B 3SHVA 4JOQA 3FBTA 1WE2A 5I7EA 2UDPA 1W29A 3AJ9A 3KR2A 4CKEB 2P65A 3S8EA 4L5CA 1ZUHA 4B81A 4M22A 4AG3A 3KZCA 4BIIA 4ESOA 1DBVO 4C20A 4H08A 4WXPA 3AEXA 2ZRHA 3NHFA 4U2KA 3VDMA 1LRJA 4GX0A 2FFJA 2BF4A 3JRXA 1COWA 3KSBC 3A1NA 3IR7A 3WK7A 2ZJ7A 2H1WA 2PKQO 2QORA 5DYIA 1NI3A 2Y6VA 3BVPA 3FUCA 5BWBA 5C1PA 3CNNA 3T9CA 1WSAA 3OCCA 4AECA 4W9MC 3NG1A 2Z6VA 3ESCA 4X92A 4LCJA 2RGXA 2I2XB 1U65A 3PR1A 2ZRIA 3V7UA 1KYVA 2FPSA 4I8XA 3U61B 1ID8A 1V3TA 1XQYA 3EUWA 3RRFA 3F0TA 4AJ2A 4U7DA 3GLFB 1KQPA 4U6NA 3ISJA 4OHXA 1Y8AA 4PR3A 3QOXA 2ILVA 2J3IA 2GN9A 4JA0A 1KC1A 2C9YA 3H8SA 5AESA 5JYDA 5KDLA 1ZD3A 2BZ0A 3NUQA 1Y80A 1IQUA 3I09A 4N3AA 4YP1A 2IS2A 1SK9A 4K6OA 5HYVA 4YMTA 4UAGA 1F3LA 3OQJA 1GT6A 2JI9A 1UMDA 1BX1A 2AI2A 4EHNA 2LVBA 2VKTA 3UYLA 1BRTA 1EZ4A 4F46A 1KU6A 5IN5A 2GZ1A 5GONF 2QAGC 3PR3A 3R0ZA 5A06A 4RTJA 1Z3IX 5B3JC 3DO8A 3TJRA 1A7AA 1HOTA 1UJ4A 1EGAA 2XB8A 4QEDA 1NBWB 1O54A 1SWVA 4KGXA 3L0PA 1SBTA 4GZLA 3JQ7A 3F9CA 1T9GS 3H5OA 5CAEB 3K70C 1CUAA 3WG9A 4QREA 2EG9A 3KELA 2I67A 3QOWA 4UASA 1P9RA 4BNHA 4IG9A 4KW7A 4FSXA 3V3KA 4MIKA 3PCTA 4R9NA 3BMNA 4JR2A 4X9XA 1E2LA 3TZEA 2WSMA 4TX1A 4Y67A 4Z3KA 1AOXA 2RHJA 4JLKA 2XA9A 1T8UA 2HO4A 2O7SA 3DKIA 1DV1A 3CW2A 5AQEA 4WBNF 5B7NA 2Q6IA 5AJTA 1GPH1 3OZEA 4RTKA 2NADA 4EPYA 1RMQA 2EG5A 2OCBA 4EW2A 3AKYA 1IJFA 4PO1A 1I7NA 1MH1A 3H97A 4G1EB 3E15A 5EWMA 5AVYA 3KT0A 1E1CB 4TMXA 2JEYA 2VH1A 4ARCA 2OCYC 4L72A 1EFCA 2K7ZA 2JIQA 4YTEA 3MWKA 3LXMA 3L0ZA 4BB5A 4C01A 1G5PA 2WF5A 4L0QA 1L0BA 3KT6A 4JAVC 2YFHA 4KKVA 4DNFA 4FZRA 5FNVA 4A10A 4IKOA 4EW3A 5BN3B 1KYQA 2WAMA 3RBZA 2VH5R 3IEUA 1VSBA 1A9OA 1M2KA 2C61A 4JVMA 4NYIQ 4P7JA 4JL6A 5KNBH 3QWFA 4J0KA 3BB1A 3PRYA 2BN4A 2HF8A 2QMHA 3K8YA 1CR1A 1KDPA 2HNAA 1MOZA 2CCKA 2P11A 3C4JA 3VH4A 3EQ9A 3LX5A 3GEDA 1ISMA 5DTQA 4F1KA 3U7GA 2GJSA 2R44A 4YLYA 5KNDD 2CXXA 2FN7A 1T26A 4E5PA 4JITA 2VDOB 4KQFA 4N0DA 3OAAD 2YWEA 1L8LA 3VC1A 5L6LB 2EJWA 2ZJ8A 2R1VB 4HDAA 3RRXA 3NFYA 2COKA 3EFEA 5K0TA 5MGNA 1OI4A 5TRTA 3SC6A 1KOFA 1SCKA 5J4YA 3KAKA 4MV0A 1QCCA 4JQYA 3BQMB 4RKWA 4DTCA 1KAOA 2F6RA 1SK8A 1OHHA 4D4JA 1NOKA 1XROA 1ZH8A 2X5OA 3LF2A 3OZIA 3QVWA 4M2LA 5FLKA 3RK4A 4CM6A 4OHFA 4R05A 3F9IA 1AKYA 1Z62A 2XVXA 1FTQA 4AJ1A 3E5HA 5I3ZA 5L3QA 4NDNE 5LKAA 1IZ0A 4U2CA 4GL2A 3LE8A 3P45A 5K3AA 3WYCA 4D74A 4FUQA 1U04A 3HPRA 5FR2A 3HCAA 2GFHA 4H77A 2DHRA 2QLMA 2YV1A 2Q2QA 1Q3KA 2EL7A 2ZBPA 2A8YA 3I9NA 2OHVA 1NJ1A 2NUTB 1QMPA 1R8YA 2H4JA 2YL2A 1Q84A 4MP8A 1DAIA 4N7JA 5IKPA 4AJEA 5AW6A 4LF5B 2J6IA 1LV8A 1YIDA 3URKA 4GVLA 4ZKDA 1OYOA 5LA6A 4D43A 3Q7PA 2QMUA 4G0MA 2DBRA 1FMFA 4X63A 5M34A 3RH0A 5B1HA 1NXVA 1VSQA 2A9RA 3UFXB 3KS9A 2W2QA 1JG6A 2YIMA 3O83A 2VHVA 3NJ4A 5C1IA 3KZOA 4HLCA 3OT1B 3KPWA 5SZJA 1OZHA 2CXNA 1NJFA 4BMNA 4BQOA 4OHCA 1W7AA 1BN6A 2X5NA 3EGWA 1HTTA 5K09A 1X1RA 4HDNA 4ZQGA 5ALIA 4O4IB 1KMHB 3IVGA 3LUFA 3TPZA 4EPXA 3JPWA 3VSCA 1YZHA 3QV1A 5CX1A 4MDYA 2ANCA 3HCWA 4R2KA 1NYLA 5T4FA 3H8JA 1BO6A 4WXRA 5IP5A 3U26A 3WDMA 5BUSA 2HREA