2BRUC

Complex of the domain i and domain iii of escherichia coli transhydrogenase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
AEETAELLKNSHSVIITPGYGMAVAQAQYPVAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQDDPKSPIAGMPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAILKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) TRANSHYDROGENASE SUBUNIT ALPHA
publication title Structure Determination of a Transient Complex by NMR Using Paramagnetic Distance Restraints - the Complex of the Soluble Domains of Escherichia Coli Transhydrogenase
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 55
structure length 167
sequence length 167
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2005-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2bruC00
4Q9DA 1U2DC 1V5GA 4UUBA 4GG1A 2Q28A 4JUFA 3F6EX 3IAEA 1HZZC 1ICIA 1OVMA 4L3OA 4FEGA 3U3DA 1MCZA 1DJLA 4C7BA 3EY9A 2A1TR 4V1CI 2FSVC 4MPJA 2Q5OA 1T9AA 4ZZIA 3EYAA 3JWPA 2FN3A 3OE1A 4JU8A 2UZ1A 1EFPA 5K6RA 4V1CB 3GLTA 4MPRA 1UPCA 1T9CA 1E3TA 2DJIA 3ZGOA 2IHTA 4BN5A 3FLMA 5BWOA 5EJ7A 1YHZA 3CLUD 3CLTD 1XLTC 5K3SA 2JI8A 2W93A 4KPUA 1M2GA 4D5EA 4K9QA 4X3PA 3HWX1 2WVAA 2VJYA 3FZNA 1YTLA 1Q1AA 2H59A 5MF6A 2H2HA 1YBHA 5DEIA 4UTZA 2WVHA 2BRUC 1UPBA 3FSJX 4JUBA 2JLCA 5EJ8A 1PYDA 4FVTA 4MQ5A 1T9BA 4BVEA 1V5EA 4K9LA 4UUAA 2A1UA 4R8MA 1BFDA 3EA4A 2JI7A 4Y6QA 5BWNA 5EJ6A 4UTVA 4GM4A 1PNOA 4L2IA 1Q6ZA 4RMGA 2H2IA 2OORC 4K9PA 2FR8C 4JU9A 5EJ4A 4RMIA 4GM1A 2JIBA 4BV2A 5DGDA 2JI9A 4Y6OA 2EZ8A 4BN4A 1PI3A 3E9YA 2NXWA 1QPBA 4JUCA 4TWIA 4I5IA 2Q29A 1OZHA 4J1TC 1PO7A 3RIYA 3PDHA 4GM0A 3K35A 1YI1A 2AG1A 5K6TA 1U28C 4Y6LA 2H4JA 4JUDX 3GLUA 5FEMA 2V3WA 2H2GA 3LQ1A 2VK1A 4KGDA 3CLSD 4COKA 2QQFA 3D81A 4RMHA 3CLRD 3D4BA 2H2FA 4G1CA 3JR3A 2AG0A 1U31A 5IMSA 1M2KA 1SZDA 1O97D 3HWWA 5MFZA 1ZPDA 2H4HA 4IF6A 1N0HA 4K9OA 1UPAA 1O96B 1MA3A 1U2GC 2PANA 4RJJA 3IAFA 1S5PA 2UZ1B 1YC2A 4UU7A 4QELA 2VK8A 4IG9A 1V5FA 4JT8A 4MZXA 2WVGA 3PKIA 3PKJA 2IHUA 3RIGA 2H2DA 4IAOA 1YHYA 2IHVA 4JSRA 4UTRA 4UTNA 2EZTA 4RJKA 1PVDA 1M2JA 4FEEA 2Q27A 4K9MA 4K9KA 4MPPA 3GLRA 2JI6A 2Q5LA 5MGNA 5AHKA 4J16C 5EJMA 2X7JA 5D7NA 4HD8A 1EFVA 4TWJA 1OZGA 4V1CA 2PGOA 2H4FA 4UTXA 4HDAA 2OO5C 4ZP1A 4GPEA 2VK4A 5K2OA 3CF4G 4KXQA 5EJ9A 2VBIA 2OD2A 1PTJC 1YNOA 4X3OA 2NYRA 4RJIA 3U31A 2QQGA 2HJHA 2FWNA 2Q5QA 4UU8A 1JSCA 2VBGA 1M2NA 3GLSA 4RMJA 5EJAA 2FRDC 3D7KA 1OZFA 2Q5JA 4GP9A 1M2HA 4QPZA 4BVGA 2C31A 2B4YA 3ZGVA 2VBFA 3F6BX 4F56A 4JUAA 4O8ZA 2EZUA 4JT9A 2OD9A 1NM5C 4C78A 4BVHA 5DGTA 4F4UA 4K9NA 4D5GA 4BVBA 5BWLA 1PNQA 1SZCA 4FZ3A 3ZG6A 5FYQA 1POWA 2OD7A 1Z8NA 2JLAA 5MFPA 1PT9A 4BV3A 4BUZA 1Q17A 1POXA 5EJ5A 1YC5A 4BVFA 1D4OA 2EZ9A 1S7GA 2PGNA 4JD5A 1T9DA 2EZ4A 1J8FA 1YI0A 4QQ8A 1Y9DA 1Q14A
chains in the Genus database with same CATH superfamily
3LTEA 5ELMA 1PKEA 2BISA 4JHLA 4Q9DA 1D07A 4XSHA 4PW0A 2H4WA 2JVKA 3E2MA 5EZSA 1MOQA 1NDUA 3F90A 3RFCA 5DIZA 1YBMA 3IQZA 3CJRA 4LIPD 4PQGA 1LZLA 2Q6LA 5FT9A 1JIKA 5A7FA 1YUMA 1Z68A 1K3TA 1ZD3A 5TY0A 3O8BA 5CPFA 3HJFA 4IO0A 3FHJA 4KLZA 2R8YA 1KERA 4HNTA 3R3HA 1TRHA 5EE1A 1Y1LA 4FS3A 4R1TA 4LE1A 4LV5B 1NN0A 2DSNA 4K40A 3RUCA 4ECAA 2J41A 2HSDA 1UR5A 3AR6A 1OVMA 1UMDA 3DG9A 3O8OA 4HH4A 4R68A 4CT4B 3SYRA 2AWNA 1Z33A 3GUHA 3QPVA 3NW9A 4V0MA 1KOGA 1NASA 1KMHA 1N2BA 2G72A 1XDDA 4Z4GA 5JAIA 2GD2A 4D4KA 4K6HA 1XNQB 3E5NA 3KSDO 3TW8B 1PDOA 3QPAA 4ND7A 3WB2A 3IA7A 3HBFA 3NTRA 1IJFA 4CDMA 2DPLA 4URVR 5JNTA 1Q0HA 3VGPA 1WDWB 4CCYB 2VYVD 1TU3A 2C9YA 4BRUA 1DXOA 1LH0A 1I10A 3EARA 3NHSA 1YMVA 4MPJA 1K1EA 3WICA 1CIJA 4O4IA 1U8AA 5IC4A 4NYJQ 1TM5E 1IYZA 2X5NA 1BX1A 5L3SB 4LYHA 3JWPA 4A6XA 1IOWA 1ID1A 4TTPA 4RAQA 4AG6A 1LLUA 1IN7A 1JV2B 1YVUA 2R68A 2VHJA 3R3UA 1TU0A 2PZMA 4G24A 4L07A 3BTOA 2NO6A 4TT3D 3SC3A 1EE1A 1XD9A 1YQWA 2H0QA 5DW0A 3ZWOA 4GE0A 2AN5A 3OJWA 2CC2A 3JQRA 4JEMA 2BFMA 1ADBA 4LWOA 4Q1VA 1PR3A 2CHEA 4KJXA 5CGQB 3RJTA 5B58C 1YH3A 1XB2A 4S1VA 3SXPA 1G64A 1IEQA 4HAZA 2RGDA 4PHGA 2ZYUX 3WBJA 1SC1A 3DOFA 2QLNA 4P34A 1DAHA 4WAUA 1EM6A 3E9RA 1CDEA 1VE1A 4HUQB 4WL0A 2WQ7A 5COBA 2NP6A 1P8JA 3I6ZA 2HL6A 2VJKA 3W0LB 4BKUA 4PS0A 4RKFA 4X63A 4F45A 2JZOA 5JZMA 2VRWA 3OTGA 4NE7A 3IUEA 1V0JA 4G1VA 2FZCA 2O48X 1WKCA 2CVQA 4LXUA 3GDWA 1TQDA 2GVNA 3SSNA 3OESA 3W5JA 4HT3B 4Z4CA 2XZPA 1T6BY 3PNSA 1ISIA 1JZSA 4QG7A 4XDZA 5EOVA 2BMAA 2VHQA 4LCEA 3ZHYA 1CR2A 1K0UA 3L1JA 2PQ2A 3ZW7A 1Z63A 2P9BA 1KO5A 2Z4RA 3PDJA 4R3WA 3SXUB 1CUDA 2YHUA 3R9WA 3JQBA 4EQ6B 1II9A 2JA1A 4PS1A 3OPNA 4DKJA 4HS9A 4DSZA 3NHUA 2QLLA 1IZ0A 3QOXA 4HTAA 1PYOA 1JYFA 1M2GA 2ZRGA 4CM6A 1KP3A 5K03A 1VSUA 2Q49A 2R8ZA 3CA8A 4QQKA 5KAMA 3UB4A 5HZKA 5KVVA 5IK2A 1ZISA 2XAAA 3ZHQA 3SQNA 4CQMD 221PA 1M8JA 4N8SA 1GNQA 4IHKA 2D00A 3K2QA 4ZT4A 5FOSA 5IEJA 4EVQA 3IIEA 2QX7A 3MJRA 1Z7BA 3HA5A 1KWGA 3IAHA 1GCOA 2X3UA 2CDRA 4R6XA 1IC6A 4UTZA 5AKJA 4XI9A 5JCJA 5LMZA 2OLJA 2P65A 1CFJA 1TM2A 2VJCA 4LYGA 4TMXA 4D0RA 1Z0JA 3BJEA 1ZUNB 1KSGA 1DXQA 2J0UA 3FPKA 2HTFA 2VAPA 5JNRA 1RCFA 3RC7A 3L4JA 4ERNA 5EJ8A 1I0LA 13PKA 3A4LA 1V26A 3D0RA 3LS2A 3M1LA 5KWEA 1N34B 2IUTA 2IYTA 2CBXA 2RGNC 1SM4A 2YRXA 1JBKA 2WMOB 3BB3A 4PPQA 5JSQA 4BNZA 3G1UA 3EGIA 4P1ZA 1J09A 1ACMA 1QU2A 4RA9A 4Q9AA 1B74A 3DAHA 3LP5A 3QE0A 2ZIWB 3O3CA 2JLSA 1UM8A 1IB6A 3FF4A 1Q84A 2R97A 1DU4A 4DV7B 2PPVA 2ZYAA 1ZH6A 3AFMA 3RI3A 1KAEA 3EHDA 3CLTC 4OHOA 1WTCA 2ENWA 3DMRA 3EA4A 4EB6B 2ZZNA 1UMCA 2HF9A 1E5QA 1N9KA 2P77A 3DMYA 4XARA 3S7ZA 5BSHA 1GM5A 4F5EA 1BVRA 4LXTA 2AUTA 2FK7A 3HFGA 1STOA 3GGCA 5B2ZA 3O8DA 2OY0A 2A59A 4O2AB 4U9HS 3EZ9A 2BZ1A 3V5NA 4Z4FA 2BONA 2IP4A 1HF3A 4Q4DA 3SU8A 2DHCA 2Y67A 3TJRA 3UMMA 2JLYA 1Y82A 4ARVA 4XTCS 1OFGA 3I42A 3WLOA 3UGKA 2FQYA 3U3JA 5GTDA 2FZEA 4RD3A 3B6ZA 2FR8C 4HRAA 1K7CA 3HJUA 4HDRB 2P3LA 2O9JA 3KFLA 4M37A 3TLGB 5JUWA 4BPBA 4V02A 4OO3A 3MN1A 4GM1A 1TAHA 2CLFB 2FX2A 1DPGA 3PGKA 3B3QA 4MDYA 4ZXPA 3VKGA 4GVPA 5DGDA 4TKMA 3ZKAA 1PF7E 4ZCRA 3GJSA 5G0TA 2XF2A 2C29D 2OSBA 5ERYA 3AUYA 1KS2A 4F8EA 1AF4A 4ZI7A 4CETA 5HQJA 1YL7A 3KPJA 4NYIQ 1EMDA 3WMGA 5ALIA 3D2BA 3EXIB 5KTPA 4WUTA 2E5LB 4Y3UA 1PGJA 4IIXA 2P5SA 1G41A 4RF5A 2B2CA 3TSCA 3ZLVA 4TSRA 3RUHA 5TMBA 5JRJA 3T9BA 4LZLA 3F7MA 4J4HA 2O1WA 3QUBA 2HSZA 3TSWA 1WXWA 1Z73A 2CYBA 2OA0A 3KJXA 1E9CA 5GONA 4JQCA 2QN8A 2J1LA 3A6ZA 4YJFB 3M3DA 5DGXA 3RAPR 6REQB 2PE5A 3VDRA 4L0MA 2YL2A 4IP0A 1QVRA 1YR2A 3ULKA 1ZZEA 4PTZA 1ZM2A 1VJGA 1RYMA 2DRIA 3DWFA 3U40A 1IVNA 4W8OA 2WHPB 3OLXA 2F43B 4IDOA 5K51A 3VTAA 3ML1A 4AN0A 4E5VA 1D2HA 1N2CE 1V6SA 2QI9C 2H4JA 4QU8A 5B1SA 2WWIA 3RVNA 3N07A 4AUEA 3MJDA 1QH9A 3L7BA 5NULA 1JKJB 1LC0A 4FYKA 4WCFA 2V7EA 1JAHA 3OOSA 3EQ8A 4FCCA 4TUYA 2K2WA 4P5PA 4YUYA 4ZN6A 4NE9A 2CLEB 1CJUC 2CFIA 1E2PA 2F3TA 2J5BA 5D87A 4BMOB 5EERA 4GICA 1J9GA 3D6AA 5DBFA 2I33A 2VEOA 2D1SA 2BTOA 1ONPA 4AICA 1G19A 1WDTA 3BJIC 4RZ3A 2CWDA 1NY6A 3NH6A 3JQAD 4G37A 3VPBA 2HMSA 3T3DA 4DBZA 2ZRDA 4M0MA 1JW9B 1U7DA 4EHLA 2OMKA 2H1WA 1E9RA 2GH1A 3DDWA 1RRKA 1TO2E 2MHCA 2ZUBA 3INNA 4W8GA 1W36C 1A8UA 4WZAB 3ETDA 3JAKA 1ZH4A 3RC3A 3N2YA 4B44A 5BURA 4JI8B 2V7VA 5C9ZA 3DOIA 1SCDA 2ZUFA 3A6GA 3FLAA 1T1JA 2LIPA 1SOUA 4IVRA 4M9UA 5G3ZA 3WGGA 4DS3A 4ENUA 5CCXA 3F97A 4ECEA 1HDXA 5TF0A 2IPMA 3TCXB 1QRAA 1BVHA 3PKZA 1FFGA 3L7AA 1H2RS 1G8FA 1UPAA 4RORA 2I99A 4RELA 1JHRA 3NGXA 1MDFA 2W2NA 3PGJA 3FPLA 3RYHB 3ZGNA 3HVRA 2P4UA 1QBGA 4O59O 4YRRA 3VXKA 1E5LA 3V1TC 2IOQA 3SZOA 1D0IA 2FZWA 1BE0A 3I2YX 3L1UA 3E7DA 3ELWA 2JLQA 3N86A 2VTBA 1BFKA 5DYIA 1M5RA 3G7UA 1VXRA 4PBRA 1RIIA 3N76A 4ESVA 2XGOA 3BCSA 2QXUA 1ZGBA 3WRXC 3L0PA 5EIOA 3WZ2A 4Q3OA 5JBNA 2UUAB 1WX1A 5DBGA 3AW9A 4BXOB 3LBFA 2X1VA 2FTKE 2ID9A 3O7MA 4HDCA 4MV9A 3HCNA 4YP9A 5DJ5A 2D6FA 1PJZA 3AT1A 2G25A 3ICOA 3CUTA 3NWJA 3ZN2A 1FL9A 3K53A 4PNPA 4P80A 2AKAB 5CIYA 1ZJ6A 2W0MA 3NGMA 4F1WA 1G8AA 2G0TA 1XV5A 1LTKA 2QTVA 4Z3DA 3NPAA 2FH5B 3PDCA 1BXKA 3TDKA 4CIXA 2EZTA 4MKHA 1XLWA 4RZHA 4I4NA 5BT9A 2RE8A 4PC7A 3AONB 2XUIA 1CRQA 1VE3A 1MW9X 4H1UA 5DTQA 4DBLE 1AF7A 4MWZA 3V6MA 2CWWA 2G9UA 4J7XA 5JC8A 1QO7A 2AMYA 2SCUB 3I6IA 3PWTA 1F5SA 5E38A 5EPEA 3STUA 4BQOA 4KPUB 5A9SA 4R2KA 1GKYA 4DLWA 2XXAB 3ISJA 1CRZA 3LFUA 1XDZA 1MN6A 1SVLA 1V16A 4JHXA 4KJZA 3WZMA 1H22A 2JH9A 3JWIA 3GUZA 1C80A 3LOUA 3OTOB 3Q0TA 3WFZA 4DJ5X 4BB9A 3CVXA 1K9VF 2BM9A 2X7XA 1MQAA 3PPXA 1PKXA 2GD0A 3RWMB 3BHJA 3B2QA 1QP0A 2AXPA 2NX2A 3BICA 3WGVA 2BTQB 4BQQA 1N5LA 1VCNA 4JNKA 4TZTA 2I7VA 3A9UA 2JJQA 3N2IA 4ZVQA 3COWA 3UPDA 4EO7A 4MV7A 2M32A 4C4ZA 4CF6A 3K15A 4Y6SA 3JALA 1V8ZA 2HPHA 3AX6A 3EXEB 1HV8A 3O8QA 3RASA 3S2SA 3TDNA 4AULA 2ATCA 3T7AA 4CW7A 5FUQA 3PQ4A 2EFCB 4HDAA 1PJTA 2Z30A 4EJFA 1GHTA 4PN3A 4NDAA 4QHSA 4TPKA 1QYCA 3PLRA 3PUHA 1N1EA 2GOYA 4NBTA 3AIOA 1HT1E 1NKSA 2I3ZA 4PV7A 4IBOA 1TU4A 2NZ2A 4MW5A 2K7ZA 3WQSB 3FSGA 4QGHA 1HH4A 2GX6A 1W7AA 4MMZB 4JJ4A 2JGDB 3Q7PA 5JNVA 4J0HA 1Y1TA 3CINA 1GN8A 1P72A 2QQGA 1ST2A 4D9HA 4AECA 1RI3A 3G9QA 3VTFA 5EIBC 4E2XA 4AJIA 3IB6A 4WBNF 4U7GA 3QZUA 3L0CA 1QO9A 2H1FA 4CKCA 1NU6A 4TL9A 3T1YB 1T8SA 1W5FA 3TX2A 1SXJB 3WWYA 1KEUA 2WKPA 1F60A 3HDHA 3LAWA 4UREA 5BORA 1O08A 1QTIA 3KZXA 3N75A 3MS2A 2OM6A 4P4NA 1O94A 2VDPB 4I5GA 4L15A 2G36A 2ZBUA 5BO5A 1BEEA 3KQYA 4DMHA 1T36A 3ELDA 1NC3A 1HL3A 1M75A 4R16A 3D7KA 4BO8A 3ILVA 1QGAA 4UTOA 5JQGA 1YIOA 4GEGA 3C7TA 3U80A 3AESA 3BIFA 3LM8A 2IU0A 4AROA 3ZXUB 4C4OA 2VPYA 4JOBA 1PVVA 3QRWA 4QRDA 1KVQA 4B8YA 3VH4A 5JAZA 1I7NA 4FHFA 2ZSHA 1F38A 1YZNA 2BSXA 5C0OE 2CMGA 1UEJA 3GR6A 2JFUA 2R6ZA 2VJDA 3CCCA 4V0ME 2PZEA 1X80A 3LY7A 3JQ9A 1EINA 3O3NB 1TOAA 1WXHA 1NG9A 4N47A 1H3EA 4MRVA 1QLHA 4M49A 2ZDHA 2B2XA 4TVSA 2BHRA 1IY8A 3WMEA 4ENQA 3L7DA 1W4ZA 2HEIA 5HBGA 5KVQA 1G8GA 4TWRA 2PKQP 3IPLA 1YGYA 1TJ4A 1LNQA 1FRZA 4G1BA 5CCBA 1RM3A 2Y0CA 3EIEA 4ZQEA 1S2OA 4ALLA 2Y0BA 1YRWA 1U2RA 2BJHA 2F67A 4L51A 3VNVA 2GPWA 3SE0A 2HA3A 3F96A 5C8YB 4R2XA 2ON6A 4EZEA 1EX9A 3REOA 1N75A 4KACA 5JSKA 1TTQB 3TS1A 4WK6A 5FV7A 1PZGA 3TZHA 1SZCA 3RS5A 2FP4B 3WAJA 2A5LA 4I6EA 2F1HA 3W5BA 2UZ3A 4MS3B 3W04A 5BVGA 3ZIAD 3RFFA 2H1SA 3WHKA 1X8JA 2HBQA 2C2OA 1N7GA 3LH5A 4FCWA 2WAOA 1FJXA 3DZGA 2PD4A 5ALDA 1HFEL 3RTDA 3P71T 2QLBA 4REOA 2Z2ZA 3NTUA 1SVMA 2D59A 4QXAA 2CB0A 2SKDA 4EI8A 1ZJZA 1F6WA 3ER6A 3P0RA 2P2DA 3CC8A 3PEFA 2KWIA 2Z1MA 4R1NA 3KEGA 1IQ0A 2BI7A 3B78A 4GOXA 4MV3A 1N1GA 1U9JA 4L4UA 1GDDA 1R6UA 1YB5A 3VDXA 1PFQA 1QH1A 3H3XA 4GLFA 5IKOA 5F2EA 3I9FA 2RHWA 4YI5A 4BCBA 4QJBA 3RJMA 3M7IA 3RK1A 4E5UA 4YAJA 4OMFG 3S81A 1DJQA 1QZ3A 4GX1A 2GBLA 2B92A 2P5UA 4QPDA 4RD6A 1T8RA 1RQGA 1VCHA 4FDUA 4RVNA 1IK6A 1PS9A 4YX9A 2RAVA 5KNLA 1SCNE 2QQEA 3C3MA 1PG2A 4D96A 4HQ0A 4HAVA 1RP7A 3ESAA 3LUFA 2V7UA 2I4OA 3O92A 5EWMB 4DYVA 3G89A 4JL6A 5TQ0B 4N9QA 1Y3DE 5HGXA 2OHIA 1ZIOA 2EERA 4B3GA 1JWBB 1C0EA 4WBSA 4KLRA 2HK6A 2V5AA 1R9GA 3HP7A 3KRTA 3WGZA 1KOJA 2YX1A 3OO0A 2EWMA 1G17A 2WC1A 1VL6A 1B73A 3JVUA 1SOAA 3HBMA 2VHXA 3F6EX 3V00A 3IAEA 1G8SA 1KK3A 2Z6QA 4O1MA 4Y7CA 4BB5A 1Z2NX 3F2IA 1A9XB 2WIKA 4FQ5A 4H4EA 4K6CA 5HIJA 4MVJA 4MJ7A 4DCPA 3WIUA 2AZMA 5JANA 2O3JA 1SMKA 2I1WA 1QFJA 4G5QA 1ZRHA 1GPH1 4ZEXA 4AMUA 2QL7A 2HWXA 3WIBA 1Q0TA 4K6MA 3V4SA 1GTL1 16PKA 2C4KA 2CZGA 1RKUA 2PXHA 2YS7A 3IMGA 3R7SA 3KXLA 2XYRA 4D1YA 2ANBA 4KFUA 4PIMA 2WAXA 3AR7A 4JKIA 3GEMA 4WVFA 2X77A 2OBBA 1NGSA 1RDFA 5ALMA 3TZBA 2EJVA 1W47A 4PBSA 3D0QA 5KQMA 2QMOA 3KZKA 1MQ8B 1ISGA 2G80A 3U0BA 3O4IA 3FCCA 3MVEA 4M21A 4Q1EA 3KPUA 3ASZA 5A7HA 3AHHA 1BKSB 1ECFA 4RE6A 1BGXT 5KZMB 2AH5A 3WLNA 4RY0A 1Z2OX 1II0A 1BOFA 1QUFA 2ZBVA 1FW8A 5G0VA 5FL3A 1ADFA 2C95A 2XA9A 2FCRA 3Q9NA 3C6YA 4FFSA 4IDPA 3C7DB 1BYIA 2FVXA 3TGWA 4BLSA 2HCFA 1WTAA 1FDWA 2DFKB 4PSVA 5FBZA 3VYUB 1ESZA 4E3WA 3IXLA 1DEXA 4KXFB 5BV8A 1CQJA 1FYFA 1R6DA 1XDBA 2HMVA 2WRZA 2EOAA 3DUWA 1Q2UA 2CDAA 1BD3A 2HF8A 2IPAB 2OV2A 3ESRA 3KB1A 4H3KB 1VPTA 4O08A 4Q34A 4EMBA 1WL8A 3T7IA 2KJQA 3H2HA 4KK3A 3PXDA 2NADA 2X4IA 4NSNA 2OCKA 3RNLA 2HJVA 1ZESA 1XLTA 3O8RA 2EJCA 3TLMA 4PCVA 5EJ7A 4MWSA 4HKTA 4NU8X 5JY1A 1Z37A 4ZVNA 2ZJ6A 3MWEB 1VIDA 1THTA 2A0KA 1J0BA 3UJDA 3PTLA 1Z4JA 5LYJA 4R69A 5K0TA 3H83A 1P18A 3F2VA 5EXXA 4A2WA 4I46A 4MCHA 2VJPA 3UPUA 2FDCA 1G21B 4HG2A 3INGA 4NTZA 4R8LA 2Q3HA 5FA8A 1KI1A 5FOUA 2PA3A 3IPCA 4Y2XA 3E5MA 3SQMA 3ZNQA 2AC7A 4K9QA 4TLBA 4GF5A 2JANA 5DVZA 2VNKA 1DQPA 1DKUA 1Q1BA 4CDRA 2DTEA 5ITVA 1E9FA 2LCFA 1DWUA 2RB5A 2CVFA 2ZSJA 3UVEA 3KTAB 5DT9A 5EQJB 1B2RA 3L4BA 4HVAA 3MTBA 3AM4A 2YY6A 2P2CA 2QD1A 4L4RA 1C1HA 3M70A 1KFKB 2XZDA 4JLDA 1IZ7A 4YMIA 1WY5A 3FDFA 1YT5A 4A36A 2BFBA 4WLVA 1W4CA 2FZKA 3NIWA 4B5KA 1QAQA 1VOTA 1IHYA 3LD9A 5F33A 5ALRA 3V32A 3MS4A 4R1MA 2G0NA 1VBNA 1YQQA 4X1KB 2XVZA 3N5CA 5G0WA 1QNLA 2BKXA 4OXIA 1WBBA 2VQDA 1FZTA 3O5AA 1HYGA 2BEUA 4WZ6A 2HK7A 1MEEA 1CJCA 1WQ3A 2X1MA 3KR9A 4Q9IA 2QBYB 4K9LA 1CUJA 1RMQA 1KJ9A 1ODLA 1JJ7A 1RADA 3EWIA 2BIFA 2ZBQA 3KG2A 3PNBA 1BFDA 4OATA 1SBIA 3FVTA 2JGLA 2Y92A 2QRPA 4F4FA 3H9GA 3WG9A 3TKYA 1YJCA 1YOBA 3DEJA 1UDCA 1AVTA 4ZVKA 1IQRA 2OAEA 5K3AA 2DEUA 3E7PA 4I1IA 1WVMA 1H1LA 3H2BA 1MTZA 3JVIA 4WK0B 4I50B 4N6OA 3BFJA 5REQB 4M1KA 4GUAA 1V7QA 1O87A 4EARA 3ONVA 2XGJA 3OHMA 1JR6A 1A5SB 3KT3A 1LB1B 1NJ5A 4ZQIA 1L1FA 3LYAA 3CPEA 1SC4A 1TX4B 3P9KA 2EXXA 3G5TA 4JU9A 4OA5A 3R7DA 3ZDCA 4W1RA 3KFXA 1H3FA 4ZK2A 1JLKA 7REQB 1OKKA 7YASA 2DAPA 1R9JA 2A88A 3ADKA 4G5HA 5F2KA 5JH7F 1EI9A 3K4QA 3TTXA 3TR0A 4R1OA 4ROSA 5HIAA 4XFKA 1KK2A 1YK0A 1YF3A 2BCEA 3A2LA 4REQB 421PA 2F4VB 4UQOA 1E6CA 1G7CA 2EZ8A 4DRZA 2WEKA 3GUUA 1EEHA 1T2EA 2H1RA 3KAJA 1G3RA 4RTMA 2HN9A 3OECA 3I8OA 3OZSA 4HAUA 4RLHA 3HA7A 4GT1A 5JWHA 1W59A 3U61B 2C54A 4X66B 2CT8A 2J6CA 4ALIA 2IH2A 1KGDA 1P1JA 4YP6A 2RHGB 4Y0NA 1Q7GA 4C03A 3V8MA 2VDWA 1PT5A 3HNOA 5DM60 2HGSA 1S01A 1QF9A 1X2EA 2G09A 1O9GA 4KSCA 1N1DA 1Q3KA 1S8NA 3KXKA 2NU8A 4CFYA 3PXEA 4CFSA 1AQJA 4C04A 4XWTA 4C3OB 4YAOA 4AWXA 4B31A 1G5IA 2IXBA 1JG7A 2BV3A 2XQIA 3G59A 3NBQA 4FIDA 4MUIA 1BDMA 3ON5A 4K6FA 3OAAA 5H16A 2B4QA 2VPWA 3KOZA 4XDGA 3GLFB 2AQIA 3BL8A 4QUHA 2FN9A 4IINA 5BYKA 2PDAA 3LSYA 4TWAA 2JDID 2VWHA 1ORWA 2QGZA 3Q85A 4COKA 4B2LA 2QQFA 2D7DA 4QXMA 3B9BA 2IDJA 2E5FA 3RRNA 1PFYA 3TZ6A 1X92A 4NESA 2FZVA 1E69A 1PJ4A 3V7FA 2Y9MB 4C22A 1SD2A 1D2MA 5AXDA 3VJMA 4B0PA 1SG6A 4FZ5A 3IEMA 1Q16A 2ZXEA 5CJ2A 3OG9A 4E14A 4ES6A 4YT4A 2XUQA 1NM5A 3RNOA 5DM2A 3T1TA 1T2VA 3DGFC 2HLPA 1NXVA 1P2SA 2P6NA 1A8SA 1SZDA 3ZKWA 2C5SA 2R8EA 1S2MA 3IEUA 1VHQA 4QJIA 2IEGA 2XCOA 4JELA 3S3TA 3EGXB 4AQDA 2J3HA 5BQ3A 3DYIA 5MFZA 3IHWA 3QKSB 1VKNA 1CB0A 4BKRA 2ZIVB 3M4YA 4WOBA 4BNIA 4XVCA 4ZPXA 5JMTA 2H4HA 1R00A 2VT6A 4RPHA 1CY2A 1G0OA 2FPGB 1JP7A 3H97A 4R51A 4U2EA 3T7JA 1HDIA 1YUNA 2AG5A 2BAGA 3GRYA 4JA2A 4MINA 3OJ0A 1ZGHA 3IBGA 1QG0A 1PL0A 1S9HA 1SEVA 2PX5A 3UKOA 2ZREA 4FWIB 2JGIA 3SSOA 2H65A 3EPKA 3ESXA 2RGCA 4JEIA 5LN1A 3T3IA 1KH3A 1TI7A 2Q1WA 2FQWA 5B58T 1QC5B 1II8B 4L0CA 3WGLA 3CX7A 4CTKA 5KTOA 1UOOA 3AC0A 4RGYA 4XGNA 2OV8A 3LL4A 2A9OA 3WX0A 5DHTA 1HWYA 1G6HA 3VVCA 2Y1FA 2EL7A 2YNMA 4L6AA 4BCDA 4HUTA 1IY0A 2FJ0A 2Q8NA 3B5JA 2RHOA 3PT5A 1KC1A 4Z0NA 3UOWA 2XCIA 1CKEA 2NO0A 1XMIA 4IAOA 1ORRA 3I76A 5HDBB 3URMA 1E4VA 3NRCA 3R3WA 4TVOA 2C20A 2HH9A 2REOA 2VXCA 3G9XA 4LNAA 3DZBA 1XQXA 4JSRA 1QAMA 3IOMA 3ICPA 2OHOA 1IHOA 1WSBA 1C8BA 3MTDA 3ACDA 3E2PA 3IBFA 5U4QA 4DRYA 3UJ6A 5LXTF 4J91A 4Q9JA 4QDUA 5G41A 4R6WA 5K4GA 3K0HA 3O1HB 2PNJA 4LDQA 4COOA 1MX9A 1HY3A 3GLRA 5CDUA 1FFXA 1HM5A 3VX3A 3ZBQA 2QXTA 4BWGA 1NI5A 4G0XA 4U00A 1CEXA 1VI6A 2GN8A 4X95A 2CNBA 3DV0A 2DKNA 1KKMA 5E6RA 2X13A 5AESA 3WFIA 4FX5A 3ZV6A 3DAGA 1N7JA 2Y1OA 4OGLA 4UMVA 3S4YA 2JL1A 3K0CC 4UBNA 2IZ1A 3SDSA 5C5CA 3VPCA 2VJMB 3AJDA 4L28A 3OIYA 1PR9A 2EW2A 1E63A 2QTFA 3WWDA 1K66A 1F2UB 5CGZA 1QKKA 2QV7A 8LDHA 1XAHA 2J30A 2XAUA 2B4RO 3KKNA 1B6GA 3O3MB 4FR0A 1TJPB 4Q12A 4UNIA 4DIFA 1DQNA 2UYHA 4H6XA 5ADVA 1OZGA 3TAHA 2I9PA 1G5FA 2H7YA 2PHZA 1E2EA 3JW8A 3MWLA 3NHMA 2CLSA 1N8TA 4DSTA 3KUXA 1L5MA 3C3AA 1OXXK 1UJBA 3KQWA 3QWAA 5B1IA 1IVYA 1PRYA 1BN6A 3AEQA 5TDHA 3ZIAA 3AEYA 3ABZA 3PTZA 4TTIA 4WH0A 4Y2RA 3RYFA 1N33B 1U9IC 1WEKA 1A9SA 4Y1RB 3PXBA 3JQCA 3V8BA 4GLBA 4B6FA 3CH4B 1T5LA 1BA3A 1HRKA 2HWYA 5EUQB 2NQ2C 3AI7A 4D4GA 4DEVA 2PX0A 5NLLA 3VI3B 2WPNA 5HVNA 5IUNC 1VLJA 1U1CA 3E8MA 2PZFA 1UANA 1HG1A 2F1RA 4WN9B 5IVPA 3G5LA 4QDTA 4ZMBA 1PGOA 2JAXA 2C4UA 1XI2A 5DNDA 2HX1A 3MYRA 4XWYA 4XZ3A 5F23A 2QI9F 3JPWA 4ISBA 1K75A 1IEXA 4MKXA 5AVTA 4C0KA 3GX1A 4I99A 4HQNA 3RTCA 5EJ4A 2EU8A 3ZVLA 2BCGY 2NU9A 1KYIA 4LZWA 5IKEA 4J9VA 1E1RD 1X7XA 4BKPA 4ZJUA 3SIWA 1X8LA 4GKBA 1AGPA 2XMSA 1Y8QA 4AN4A 1I1QB 3ZU6A 5F9FA 3R6DA 1Y5RA 4PZEA 3CEAA 3QX7A 4WXMA 3A4MA 1WUIS 4FDMA 4DLXA 1C4KA 3QVGB 5TPWA 2ACWA 2ONKA 5LUAA 3VPDA 3A9RA 4KODA 2Y3IA 3N70A 3L84A 2PUWA 3CX3A 4IHJA 4TRNA 2KBFA 3F6BX 1SCUA 5IAAA 2ZAIA 4M1OA 3P9YA 2ZUCA 2RG7A 1QIHA 1P5RA 4N5HX 1HR0B 4D99A 3MSXA 4UASA 4OKNA 1U6JA 3QPBA 3R0VA 4FOPA 4B6SA 1Q1EA 3PEEA 2Q5HA 5HFNA 1O5TA 3IPRA 4FN4A 4IOLA 5TT1A 1EVJA 2XIJA 3WYGA 1E0JA 4UU1A 4CGZA 1BH6A 4NICA 3BXGA 1SHUX 1EFDN 3W8FA 1DAPA 4DTCA 4MUNA 5FUXA 5JMOA 5HKBA 2X5XA 4I6JA 3BA1A 2IS2A 1M1YB 4FOLA 3USCS 1U1EA 1EVYA 1OV6A 1GGNA 2R00A 4RKQA 3H1PA 2QLTA 5CD1A 2P3SA 5IDXA 1JHUA 1DB3A 5TJ9A 4KYTA 1AB5A 1Z4IA 2AMJA 2JGRA 4DPMA 3MEQA 4C2TA 4BVBA 2XNJA 2GD6A 3H2ZA 2DU8A 4IX1A 1WP9A 4LC9A 3OTWA 3PUYA 5K0LA 1CUZA 3KXPA 4RDHA 3ZBUA 1MUUA 4JXXA 3UWMA 1N2SA 3OIDA 4NL4H 3HCWA 2NG1A 5EE0A 5EMKA 1IOZA 2J3LA 3C7CB 3V2HA 5K9ZA 5KYUB 3H4MA 1XCJA 5LD2B 2NPIA 2AA3A 5AUOB 4EJMA 4Z7OB 5EZYA 3FE2A 3WLAA 1TB4A 3FB4A 3M6FA 2C03A 4NS4A 2IV3A 1DJNA 3LBNA 3U4IA 1ZN7A 2PY6A 2D3TA 1I01A 1PUJA 2EIXA 2GKSA 4LKRA 4PYNA 1XYGA 1Y4AE 4FMDB 1KR5A 3T5GA 5CXQA 1ZR2A 1CT9A 1QRSA 3A3YA 5JMPA 3GJRA 4JBIA 2GGSA 4EO9A 4EUKA 3BD8A 1XKLA 3TKLA 2Z6VA 4Q05A 4W4TA 1MO6A 2G5PA 2CXRA 4TTQA 3HEAA 1PK9A 3ZJ4A 3EULA 2J33A 1P2TA 5IHXA 2QRZA 3L7OA 3P9RA 1Y9ZA 4AJOA 4II2A 4TYMA 1F8YA 1JZQA 4LZOA 3I5UA 3VU1A 3PI6A 2WPDA 3PIRA 1HA3A 5BN5B 1V9SA 3BC1A 3HA2A 1R0YA 4O2BA 3ANYB 1OFHA 1YRYE 2GEFA 1KJWA 2RC5A 4RENA 3IEPA 2P0YA 3W6PA 1WIWA 1Q0QA 2WFLA 4N76A 3EDCA 2V3VA 2WU4A 3R5FA 4X7BA 5AJUA 1EM8B 1VL1A 2G28A 2PKXA 3BWEA 3NB0A 4C4AA 1Y48E 1NE7A 5HS4A 2FUG1 4M54A 2FDRA 2GAOA 5ALLA 4DM7A 5JU6A 1E32A 1UP6A 2R1TB 4G23A 5TQ2B 1DRVA 4YALA 1MJGM 3NTXA 4ZYWA 3AR8A 3DLPX 4KLAA 3ZVNA 2XOEA 3DDUA 3OJLA 4PFQA 1R8SA 1V5GA 2W2VA 2ZYGA 4J03A 4G1UC 4OLJA 3FVWA 3UHAA 1R2QA 3C5CA 5H82A 1PD0A 1DIGA 2CDCA 4D43A 7MDHA 2NZJA 2ZJ0A 4OJQA 3GPDG 3K6KA 1O0CA 4ER0A 1O94D 3PFIA 1Z9BA 3RJ5A 3T34A 5L7TA 5HFAA 3GPLA 5GZ6A 3QVXA 2IELA 2QMYA 3P96A 3TIFA 1OH5A 4JMPA 1W1UA 4PLYA 1CB7A 4WLOA 2FWPA 3VMFA 2CLCX 3WLFA 1ULSA 5LQUA 5T8KC 3U3DA 2CJFA 1IRIA 2Q1XA 3QEMB 1XCGB 1AHPA 1N7HA 3W4JA 1Z08A 1M54A 4KYUA 3M4XA 2WHYA 3H2IA 3K32A 3KLNA 1P73A 2W8BA 3LFTA 3U4GA 4AY6A 4TWBA 1PFGA 2VVTA 4PZDA 1RRGA 3UJBA 5M29A 1YMQA 2BWJA 3DVQX 1GAXA 4EUEA 7AT1A 4QDJA 1SK9A 3RFUA 4Z8XA 4H0NA 5IJZA 4CKXA 3EIUA 4OXQA 1XTKA 4A5OA 2BT4A 4NPAA 1XRJA 5H81A 4GKVA 1L5YA 4LJ9A 3DJYA 3LA6A 3EYAA 2GSWA 4LBZA 4TV9B 1TA0A 1P91A 1Z06A 2HC9A 2FN3A 3OFND 2WT9A 1BJRE 3KZVA 4JYPA 4MTCA 4AIRA 3A9VA 1LBQA 3QMMA 1XMPA 2OCBA 3PJDA 4XJVA 5JNWA 4ON9A 2ZUWA 3FUVA 1X70A 4IIJA 4HDKB 4YCAA 4UC0A 2OFXA 1P4SA 2RB4A 3UMBA 1EFVB 5J4VA 1M5UA 3GA7A 2D1QA 4YDSA 2NT3A 4KVZA 1C9NA 5AI0A 2J0SA 2PGXA 3BH0A 2B1GA 1IOVA 2I5PO 2BHNA 3HG7A 1HFKA 3LBAA 3OI7A 4FT2A 4MQFA 3N53A 3A1SA 4TN1A 5TRTA 3SR0A 1PT7A 1P2VA 4MPRA 3UXEA 3E3MA 4A27A 4MDHA 1KHHA 1DQYA 4RIIA 4D4LA 1Y9AA 4EGAA 1AKEA 1GRNA 1MO4A 4F0JA 3NEJA 5B3KA 1DUVG 2ZE6A 2MINB 2E4XA 5T64A 4D44A 4D3SA 4US1R 4D0GA 3BS4A 3SBXA 3KL2A 1BOOA 2WJWA 2C92A 2P9CA 1C4OA 4K88A 2KS6A 2W9XA 1U7OA 3AM3A 5EHZA 4PZUA 4ND6A 2VKTA 1P0FA 5EYPA 5J4KA 3GY0A 2PS3A 1E99A 2WFZA 3N6VA 2D54A 1KJIA 1L7VC 3MM4A 4D8YA 5A6VA 3HDQA 5K0FA 1Y4DE 3EH1A 2IVFA 2QUAA 3A06A 3DL7A 4G5XA 4MK4A 2IYYA 5T67A 5EQDA 3QUAA 4LOHA 2XUFA 4EIWA 1YFJA 1ZIDA 4ZU3A 4Z99A 2PJUA 1JJAA 1VE7A 3D3WB 4HQRA 4P81A 3I4FA 3NOQA 4XXHA 4YRAA 5AJVB 2BJWA 2HXSA 1VKOA 2AEMA 3QX8A 3UJ3X 5KWJA 3CUSA 2J9RA 3H7IA 3QENA 1YTLA 4CMCA 2R3SA 1SG9A 2C0QA 3B6EA 3CE9A 4ZVRA 4CVNA 3ER8A 2A14A 3CZQA 1N32B 3NWBA 1JEYB 2H59A 4DCVA 1JDJA 1V3UA 1KYVA 2JGKA 3W79A 3TNYA 1DTEA 5DP2A 5A9RA 3ZK7A 3EEYA 1X9HA 5A5GA 3MQ4A 1NUTA 3C3CA 2J7KA 4RSGA 2I6GA 4YECA 3E3LA 3KJEA 4X84A 1RXIA 2FEXA 2YMQA 4OP2A 2A0YA 1Z4LA 1ZU5A 4D9CA 3SS7X 2HBZA 4JUBA 2H06A 2V6IA 5I6DA 2ANCA 3UHPA 2GJ9A 3MHTA 1P0QA 4BAUA 4MVJD 4G0ZA 2R2GA 1K06A 2F9FA 4HTFA 4XM1A 3NYIA 2CN1A 4KV7A 4S3MA 5JBQA 1VGQA 2BUAA 1UC9A 4FYMA 4TZKA 2PV7A 4K9DA 3UFXA 4K86A 1X15A 5B37A 2EIHA 1V5EA 5CVUA 3S2IA 3DV9A 3I01M 4BVEA 4J3FA 4KLCA 4M88A 1JQKA 2VNSA 3I0NA 2GNPA 3EODA 3O9VA 4E5MA 4XWWA 3B1VA 5JALA 1XZDA 3FRIA 4RPIA 3S29A 2PJDA 2ORVA 4Q00A 4UAUA 5BV1A 3O90A 3TVYA 2WYIA 3OOYA 2KBEA 1N2OA 4TS3A 3TK1A 3OPVA 2PUJA 4LCBA 4OH1A 4OLFA 2ZZKA 4FFVA 1XA3A 5CHEA 1ZNZA 1E2UA 3CLVA 1VRCA 2C5AA 1OU4A 1FX1A 1M8PA 1EUDA 4M76B 1COZA 1OYWA 1NDQA 3FTPA 3K09A 3LK7A 3M6WA 5FBHA 3DA8A 2H2IA 5D8DA 3BM5A 1MIOB 2RK6A 2AE2A 3GZNA 2ZRNA 1V9CA 4GOJA 4IJUA 2HNAA 2C96A 1WABA 4LTMA 4C07A 2OHGA 2P9JA 1TCVA 5JBIA 3TGLA 1GY8A 1CQZA 2NUPA 1YJQA 5DRYA 1RPTA 4RMIA 1ZHOA 2E4AA 3UMRA 1GXSA 1UQRA 5CFPA 2ZULA 2GCGA 1OV4A 3KLBA 1J90A 3VV2A 4Q3LA 4DF3A 4Q3DA 4P4SA 1FFCA 3IUBA 1JQJC 1YMUA 4JIMA 5J1TB 1NU8A 2V65A 4LJ4A 3VDNB 1RHUA 2ISCA 2QJOA 1YNSA 3PL5A 2JJMA 4P3PA 1V7CA 2DWQA 2OWDA 4UPEA 1DMRA 2PUGA 4G65A 3K9FC 3R20A 4NCIA 1CUCA 2X4LA 4UHKA 4WGGA 3B6JA 3KHUA 5THXA 4J1TC 2AS0A 3IE1A 3SEZA 3GOQA 5LKAA 5D3ZA 3LQYA 2WTAA 1Y3FE 4CQMB 1GU1A 1UIMA 2OHJA 4HWKA 4NENB 4BVJA 2QRQA 4BQFA 3K35A 1YB4A 4MR8B 3SF8A 4FR5A 3T6KA 3FLEA 2OCGA 3VHRA 1O6ZA 1ZG3A 1LDYA 4HP8A 3ZHBA 3OPYA 3T4UA 1YVEI 4GO1A 1EBUA 1E0AA 1WV0A 3DWIA 3SI7A 4KX5A 5IJ0A 4D8TA 4C7MA 4DNXA 5AIAA 4WTOA 3AF6A 2Q9CA 2V3WA 2H2GA 3LQ1A 4NAHA 3LWBA 2UVPB 4MMYB 4JLVA 4EX7A 3SVTA 2HA6A 3GZJA 3TINA 5JAPA 4KBFA 4NCNA 2R0QC 1TIPA 1A9RA 3D81A 1KPIA 2HDNB 3CISA 1TZBA 2PO7A 3DL0A 1Q3HA 3QKRA 3WGTA 3ZZTA 1FDTA 3UHFA 2B21A 2AYZA 5F3DA 1XF1A 2QJFA 5I9SA 1N77A 5FEUA 1RACA 2X9GA 4BN0A 3PEYA 1JHYA 4FFMA 1RPZA 1A8HA 1P6UA 4H08A 3ZC3A 2JIZA 3BWCA 3KXIA 4NNPA 4QO8A 4ZJZA 2YMLA 3JR3A 1EH5A 1HYEA 1P7CA 4UEWA 3GVPA 3D5TA 5IMSA 4AMYA 3KPWA 3IJRA 4UARA 1U02A 5LD2C 4FFRA 1M2KA 2WABA 1W2HA 3A28A 1NBIA 4MEBA 3SKXA 4DUGA 1WWKA 1WF6A 3AU9A 3EVDA 5DXFA 1H5NA 2PL9A 5AW8A 3BFPA 4I66A 2FYTA 1T8PA 4PHHA 4TXJA 1BU5A 5GQSA 5CFLA 1QVAA 3KQKA 2JNWA 3UY4A 1SUBA 1JH9A 1VFNA 1BMDA 2VZEA 2EDCA 3MAAC 1G42A 2QN9A 4BLPA 1IU9A 3C1TA 4EG4A 4NLLA 2CSXA 1U2GC 1XZCA 3LBHA 3KV3O 3G85A 3ROXA 1KSFX 1ISSA 1F9AA 4ARZB 3PQFA 5KYWB 2BDEA 1P0IA 2EBFX 3N0XA 1EEXB 1BWPA 4QDZA 2WJJA 2QAGB 5E3JA 1EAYA 3HDJA 1ZITA 3HDVA 3O1LA 1KY5A 4TL7A 4TS4A 5EE9A 4MGKR 2COEA 2QB5A 2CGEA 4Z86A 2CE2X 2VWGA 4AYXA 3U9TA 2BGTA 1Q1NA 3VYSB 3WNVA 1TZCA 1Y1RA 3EXFB 1TT5B 3RAGA 1TQ8A 1M34E 1RHQA 3L9WA 1A5TA 1ECGA 1ND5A 2IEAA 2EWWA 2HZ7A 3JD1A 4MYHA 4Y2VA 1RRPA 1OKKD 2WJIA 4YFYA 3AVTA 3EGOA 2BW0A 1UK9A 1CRLA 1M6YA 2PWBA 3LC0A 2PL3A 4GI7A 4KQ1A 4XA8A 3LGAA 1XD8A 2CK3A 4RW0A 4M0KA 4MUYA 1O57A 4Q7KA 3EJ6A 3WGKA 3GCXA 1X1DA 1QGED 1SULA 1TKBA 1AKTA 1FMCA 1N0IA 2QSZA 5LIPA 6ADHA 5A2GA 4JBLA 1R9NA 4DV1B 3EGVA 4ARIA 5DE3A 2Q5LA 3KHSA 1AG9A 1NC1A 2UUCB 4LZZA 4DJAA 4TZ6A 2O2SA 1M3SA 2FQXA 3OEYA 1KI7A 3WL7A 3M6VA 3E15A 3O0TA 4WNYA 2NTJA 1L6IA 3U62A 1R6VA 2H52A 3QMWA 3L4KA 1UEXC 4QU5A 4U02A 3LVFO 2WSSA 2EQBA 3R7LA 1XNJA 2HSEA 4BO5A 1KZ9A 1Q11A 5JOQA 4JI6B 1ADGA 1H8EA 2WP0A 4C0SA 3D6TB 3OLCX 4TRJA 1QTQA 4MCJA 3UK7A 3WISA 4ZCIA 1MG0A 3L1IA 3ME5A 4EA9A 1VE9A 2ZB3A 3OAAD 4JROA 3RIEA 3T3EA 3VJRA 4GH5A 2GKOA 4WDRA 1B76A 4YP5A 4MOWA 5AJZA 4JUIA 1UBSB 4HPWA 3ZW9A 4IW3B 2PSJA 2E1RA 5CBPA 3UMYA 1EE2A 1L4HA 4HGOA 5AHRA 4K1XA 2GPYA 2J59A 1ABBA 2P1RA 3TQCA 4FNOA 1IMOA 1MGOA 1LQTA 1L5SA 4H3HB 1FS4A 2IOFA 2XA2A 4MR9A 3SFVA 3B2NA 5KYNA 4FBGA 4PVCA 1S8AA 1EGQA 4WLNA 2PKQO 3ICQB 1B41A 4KR7A 1DJPA 2I7DA 2YWCA 3T3MB 1KMCA 1RLUA 1NXWA 2P5YA 3UB3A 5GINE 1E7SA 1FZQA 1P6QA 1W46A 4PZ0A 1NSFA 5FAXA 4BZZA 3H5OA 4OGKA 5GADl 1U5BA 1UBMS 4GX5A 2ZJ7A 5K3DA 1DRJA 2F1JA 1E9VA 4E5YA 4DJEC 3DYVA 5FBRB 1R6XA 1YFKA 4B1FA 4FZRA 1DAOA 1U0EA 2SNIE 4TM8A 3V4OA 2X15A 1N6HA 4O63O 2FRDC 1U8FO 3IVCA 3IOCA 4G1MB 2QHXA 4EJSB 3CVJA 1EBFA 4PFSA 2BR4A 1TF5A 4KP7A 4PLTA 1LPNA 3QVLA 1JHQA 4PO8A 5C8YF 4MCIA 1SJ9A 2XBLA 4G1FA 1A0OA 4QPZA 1YWGO 5IHPA 2IBSA 1E9DA 3ILXA 5F1PA 4DLBA 3CVOA 4UHHA 1P45A 1C3OB 1SB8A 3C6XA 3PRKE 5DHFA 5KSPA 3HXMA 3FDXA 5LQMA 3KUKA 2C7BA 5D2CA 1RHKA 1QQ7A 4YRKA 1PZXA 1H6CA 4JJ6A 2YNMD 4DY4A 3ZCQA 2PPLA 3FDIA 3HZHA 1T6NA 1HUQA 3BHIA 4XB2A 4UE2A 2Z5LA 1KIMA 4DQDA 2OPBA 4OMUA 4F7DA 4TXMA 2CXUA 3NJ8A 1OLOA 1U0HC 1NRWA 3FKJA 4MA5A 4MS4B 1CF9A 4Z4IA 4NVRA 4MHSA 4JT9A 4PZAA 4MRSA 5IFKA 2QNRA 2ZCUA 1C14A 4R2IA 2VOEA 3R9IA 3V4LA 5EINA 1Y8ZA 3GFSA 5JS1A 5CT6A 1P61B 2JKZA 2IH4A 1G9SA 1KQPA 1F2VA 4RY8A 1CR1A 3DBHB 3N2LA 5TGZA 1VL2A 4IL5A 1A71A 1O7JA 4BFWA 2VUTA 4F71A 4ZDJA 5K05A 3OFVA 3OCYA 4IUDS 4LS3A 1BE1A 2H5LA 4K2AA 4EZBA 3PHIA 2QEQA 1XZKA 4ZCPA 1JXAA 3VC7A 3WYEA 3L46A 3OBIA 3WI7A 4OHVA 4OLAA 5K6AA 4QUKA 3IIMA 1FVHA 1JYEA 2X0IA 2W70A 3WLIA 3CNOA 3R8FA 1NYTA 2ECQA 5G3YA 2HEGA 3WGHA 1A69A 4RZ2A 1R0RE 1Q1ZA 1OFUA 4BVFA 4F2DA 5K3FA 1CR6A 2JI4A 4MI6A 1KTIA 4R9UC 1JHXA 3JX9A 3SAJA 4RTLA 3R7WA 3PYXA 5KUTA 2BKVA 2BH2A 1Z8NA 3MB8A 3D1VA 4W5NA 1I4LD 1IFXA 1AGRA 1LPBB 2NSHA 2WW8A 3AIIA 3I9V1 1ZI6A 2HU7A 4U2BA 3BE4A 5F77A 3SHVA 3W05A 4RESA 1WCV1 3BZWA 1P33A 2O2CA 4PZCA 2VF8A 4DXAA 5KNDA 4WKGA 3MFYA 1B2LA 1T6ZA 3H5AA 1GZSA 1W30A 2REXB 2VP2A 1BQEA 1Z8HA 1E2LA 1ZOIA 1HG0A 1EJ6A 2PMWB 3CJTA 3G0DA 2Z8ZA 1CQIA 3OOHA 1D4OA 2QNBA 3HY6A 3O8LA 2BFOA 3K0FA 4FU0A 4OQDA 5BRJA 5CFMA 4FT4A 1JECA 3TSAA 1U2DA 1M6HA 5JXIA 2NZVG 1QYDA 4UNPA 1AV6A 2A5YB 1D2NA 1ZGAA 4QRHA 2Y2VA 5EHIA 3DULA 4XRGA 3ZEAA 5LQJA 1SXGA 1DC4A 1XCBA 2HOQA 4MQEA 2HYIC 3E9NA 3NOOA 3KEMA 4QTXA 4JI2B 1X1BA 5L40A 1TCAA 2CHQA 3KETA 2JFYA 4ER5A 2YUTA 1VB5A 4RQTA 4X6UA 3P9ZA 2V9PA 3NXKA 3L1KA 4OUDA 4ZTBA 2OXRA 3OZ7A 3TUIC 4DHWA 2JRCA 1BZYA 9ABPA 1DNPA 4B5LA 4LYJA 5KX5B 1PJ2A 3IBSA 4CR8A 1AUOA 1DO0A 3TLEA 3L0IB 1Y4ZA 2BCJQ 4EY7A 5LA6A 3SR4A 3WK6A 1QH0A 1FSGA 3WYNA 1DCFA 3E0XA 4HDOB 4FYXA 4ZOCA 3CO0S 3LLCA 4IGFA 1CUUA 4DABA 2OLKA 1NQWA 1SIUA 3AEKA 2XVXA 4NXMB 3HKCB 2PMCA 1ICIA 4HGNA 1PZHA 4CEHB 1T5DX 3TXYA 5T7BA 2VUUA 1FXWA 1I2AA 3KTDA 3K1JA 4E11A 1RAFA 1XALA 3MWDA 2PUDA 3PC8C 3TIXB 3ZJVA 3GNLA 2ZJ4A 2VG8A 2A30A 2ORWA 1FEZA 6PFKA 3ADCA 4AURA 1P2DA 3PX3A 3PWZA 5DGHA 5J2TA 1NVVQ 1RQNA 1RJGA 3ESZA 1KBQA 1AURA 3BXOA 2QTMA 2BGJA 3EAGA 3PSAA 2IHNA 5JVDA 1N2CB 1VP9A 5FQOA 4C3VA 3HLKA 4OM8A 4KRFA 2CJYA 4BECA 3WV5A 3LC7O 1ZIYA 4BZPA 2R11A 5JTUA 2F17A 5JTTA 3LWNA 3EF3A 3K5WA 3BKXA 1CUVA 1SKYE 4DV5B 4IFTA 1IUKA 3SIXA 1DI0A 1O96A 3FR7A 1YZHA 4OTZA 5CK4A 2AFIE 3RSSA 1FQWA 5C4GB 1EK6A 1J1IA 3Q3JB 2UZ1A 5FOXA 3VNBA 3A14A 3ELYA 5ALQA 2IEZA 2WDZA 3H3FA 3QI2A 4Q6WA 2J3JA 4YJ3A 3UAOA 3WLQA 1TLLA 4KGVA 4DRXA 1UPCA 1T13A 1C7QA 4Z4QA 2I3DA 3OZBA 1OX4A 5HX7A 2O0HA 3CWCA 4PG7A 1QS0B 4Z7QB 1E2FA 1U5CA 1M6WA 1MDBA 2BEWA 4UNNA 5AVQA 2FR1A 2Z2JA 3VBEA 5KDOA 4FB4A 2BKUA 3S8EA 1E1CB 2F8TA 3PJFA 4MQBA 5SYAA 1L5ZA 5PNTA 5A5DA 4WN3A 2FFBA 1LJ8A 3FJ1A 2WMYA 3NC1C 2Z57A 4KDEA 4EJ6A 4F97A 5BWOA 2FWRA 3CS3A 3BRCA 3KOWA 1AQUA 1TPYA 2QAGC 5M04A 4XDYA 1NV8A 1SK8A 3OU7A 3Q72A 8ATCA 1NTOA 4DR6B 4CT5A 2V45A 4NMXB 5F1OA 3Q7TA 4G97A 2EF0A 2XTNA 1KORA 1K7SN 1OI3A 4KWTA 2G4CA 4R8SA 3NNNA 4YRPA 3ZV7A 4UFPA 5CB4A 4BEBA 4QVIA 1KDRA 2PQ6A 3ZPXA 4ZHQB 4P5EA 2XRMA 5DASA 2CV0A 2IRWA 3WO0A 5IT4A 4MW0A 1AKWA 1ENYA 3MMSA 2JI8A 2HMAA 1MU0A 2DCMA 3PQ2A 1KZHA 1OVGA 1WMFA 4D9JA 5EIEA 1U0BB 1I2DA 4RHUA 4D5EA 5AVOA 4E88A 5JXGA 1NW9B 2O0LA 3CRVA 1A7JA 4ND8B 2P35A 4WERA 4ZAVA 2YOGA 4GZLA 4O4HA 1T4MA 1SFRA 3DW3X 2Z1DA 1Z6AA 3DVLA 4RC9A 4NZPA 4X44A 5AW3A 1CV2A 1ZJWA 5I7WA 5HJEA 1KDTA 1ZAYA 1ESCA 5JD3A 1WD7A 2FF5A 2GJ4A 2ODEA 2ZYRA 4P2GA 5E7IA 521PA 2GZ3A 5LZ7A 3ZDYB 4C0AC 4C4PA 1KWKA 1HT2E 2B1IA 5DK6A 1P31A 4YAEA 3VZQA 1UOPA 3N87A 2ZGVA 4EFKA 1SA0B 2WVHA 2FW8A 1X9GA 1Z0AA 3I3SR 2FUNB 4C14A 2IUUA 2A86A 4KTTE 1F7VA 1SZJG 3HCDA 1RFLA 2WTEA 4RTKA 2HQSA 1P0MA 2UKDA 2JLCA 2SECE 4FFNA 3ENNA 2GEDA 4FMPA 2O2GA 1GV0A 2OPHA 3V7WA 4DWJA 3KQNA 1R8QA 4M0PA 5ENDA 4ZDWA 2IL1A 1EIZA 3I28A 3C4JA 3F5FA 1G9TA 1JIIA 3HVHA 3L7LA 4E13A 1PBNA 1UXJA 2ZWMA 3K6JA 4CG1A 3WJ7A 1RYBA 4MV6A 5LC1A 1CZUA 2QGNA 3WQRA 2Q3BA 3D5QA 4E30A 5C5EA 3UT5B 3U3RA 2P2YA 1GNPA 2G40A 4RNCA 1Q74A 5G02A 3SHWA 2V7WA 3LY8A 5JDIA 1YS7A 3WKCA 4BNVA 4NNJA 4P36A 1ZXXA 2OORA 3TCKA 1XTSA 3NIDB 1V8BA 3J80A 3DCJA 1KQGA 3ANXA 1CDOA 1G18A 3S27A 1YASA 1Z2AA 2Z8XA 5AOVA 3TW8A 3W9YA 4MUFA 1IY9A 4C21A 3T3OA 1MRZA 2ZI3A 1GWNA 3SFTA 3EQ6A 4UTVA 2GBCA 2WIJA 1AGYA 1OI7A 3AL2A 4IWYA 4XWKA 3DEIA 3P32A 3KPYA 5F1YA 3JATB 3OCXA 3CX6A 3E5RA 4W63A 4GL2A 4OB6A 1P0CA 1SELA 1ZDMA 2M6KA 2DT8A 2R65A 3KZ1E 1I4OA 1KMQA 2GTPA 3OIVA 1CIPA 1NVKA 2HV8A 1XQ1A 4GWLA 3I09A 2DKOA 3HS3A 3WWZA 1SOWA 3LV8A 1ZK0A 1VTKA 3B53X 3T1OA 5AUNB 4YAGA 4A4DA 4AZ3B 3DYBA 3W2EA 1WD5A 1NIPA 3M6AA 4LISA 3DOOA 2ID4A 3HRIA 3QG5A 4EJSC 2VA8A 1I1OA 1A7UA 3L2OB 5B6PA 3NIFB 3FNRA 1VZ3A 3GQBA 4MPDA 1G8KA 3VU9A 1QANA 1QFYA 1X7YB 4MAMA 5B7GA 5BR1A 3PFHA 1H0SA 3EY4A 1KO1A 2VNIA 3NV9A 4LKOA 2SKCA 3IV7A 1XJ0A 2CEKA 1ND6A 2P2LA 4GM0A 3M4JA 3SQDA 1EDOA 1GG2A 2AG1A 2GAJA 4RIHA 1R50A 3V1LA 5A02A 4CR7A 1T5HX 1JA0A 3A9WA 3HDTA 5ER9A 1YBFA 2XCUA 3UICA 3WNDA 4DT1A 3KSUA 4H16A 3NDIA 4LY3A 4TLEA 4E4TA 8OHMA 1HDOA 3UBTA 3Q98A 2M9MA 3SXUA 1IH8A 2I8LA 4OXNA 3TIIA 2W42A 1XTTA 2MYPA 4EQ6A 1D2CA 1C0IA 1QIFA 2XRZA 3ZUGA 1FFYA 2A84A 2DPYA 4XB6B 3TLJA 4QYWA 1CNMA 4XCVA 3V3TA 4JLOA 5LCXA 3H9UA 3WLJA 2RC6A 4CQNA 4ZGWA 3T7CA 3O8OB 2TSYB 2QP4A 3W06A 5L3VA 2XUGA 3NMUF 4GBGA 3TLBA 3INYA 4MB6A 4YMWA 2PEZA 1D6MA 1XPJA 1CHNA 1FNCA 2POQX 3PVZA 1GZ6A 4WY5A 3UMVA 1KMHB 4PPGA 4S0XA 3QJGA 1TJNA 4X6YA 2H2FA 3BVPA 2Z8YM 1DRKA 3R3YA 4YB8A 4DGSA 1HLDA 1QOZA 4M9XA 1F0KA 1HSOA 2YHAA 3AHFA 4BEVA 4PRKA 5FF9A 5KOIA 3GW8A 5B12A 4PXSA 1YFZA 2PXAA 2QR2A 3JYLA 1SOMA 1J70A 3Q2OA 1A5AB 3SHFA 4P4UA 2J5QA 2XLCA 1PK7A 1KO7A 4ZT5A 2HQBA 3OCZA 4HRVA 4NYJR 4MGHA 5CLGA 4O4IB 1V96A 4RYDA 5K99A 5AO9A 4UBMA 1SUFA 1NLYA 4IH9A 5A71A 5JS8A 1TUBA 4YEDA 5HW0A 3TQSA 3GUCA 2F3SA 1QHXA 4NRDA 4EELA 3FBGA 1C50A 2OQVA 2O7SA 2I3AA 4RPLA 5KHLB 1I6LA 1Q0RA 1X7DA 3PC7A 4MQLA 4U5QA 1KNQA 2V1XA 1ISHA 2ZJ8A 3AM1A 3NZEA 2IXEA 3LLMA 3FTEA 3R5KA 2VK8A 4IG9A 2FPSA 2GO7A 3UENA 3ZLBA 2VTDA 1K7YA 5JI2E 3HRHA 4BO4A 1U3GA 4M87A 1J22A 4EB6A 4W5RA 2VAVA 4YUVA 5AKKA 1ISRA 2OQ2A 3G8CA 2C00A 5B53A 4QE3A 2BL4A 1VSVA 3AHGA 4O2AA 1WMSA 4E5PA 4PZLA 2X2PA 4GKKB 3AUUA 4YROA 3ZTYA 5BQXA 4YIHA 1TUIA 1C3XA 1ENPA 1V95A 3AU8A 4FKZA 4ZO4A 5C7YA 3KJIA 3I6BA 2DWUA 3O2QB 3MLBA 1GGMA 4UMEA 2H1OA 2A1IA 3LCVB 3TLGA 3UAXA 4RZXA 2ZAMA 1BMFD 1AKQA 1L3BA 2J9YB 2UZAA 3X1DA 4DWWA 1E64A 4F38A 2PMDA 3NFRA 1IBCA 3GCGA 1DDIA 1K6IA 1N0UA 2CCKA 2FMHA 2LCIA 1OAOC 4M9CA 4MPPA 2OZKA 2EBWA 4XVQA 5C81A 2R6CA 2ZRJA 3FG9A 4KGZA 5F4BA 1V8FA 1NMQA 4KVFA 2IPLA 5DO9A 3EXIA 2CLMB 4RSMA 4QREA 2FPLA 4KN8A 2DWPA 2VF4X 1IHDA 5EJMA 2FEPA 1FOEB 2CHVA 1J56A 2QN7A 3FB1A 5D7NA 1V5IA 3QLUC 1A4RA 3E8SA 1CJTC 5EQFA 2N3ZA 2OCLA 2RCNA 4YJFA 5KREA 3QU5A 1XBTA 5I7SA 2PRKA 1Q57A 3IRUA 2CXQA 4GLLA 4CKZA 2P11A 1OFVA 2QX9A 1UDAA 2J0UB 4YJ2A 1PTJA 2GYWA 3FKQA 2HMWA 5ESDA 5HF6A 2OECA 4KIFA 1UQTA 3TRIA 2W71A 5F52A 3WWOA 1TK9A 4XVUA 4DDVA 4M1WA 4Q82A 2H9IA 4GPEA 5AM1A 2AL7A 1S4QA 4RA9B 4ZODA 5EE3A 3W6OA 5DYNA 5I5GA 1NXPA 4N0QA 1OAAA 3CW9A 2YVAA 4ND3A 5AICA 4YV7A 3TL2A 2PK3A 4Y2TA 4BWFB 2JIZD 2WD8A 1JSRA 5D5HA 5AKIA 4BQNA 1USUA 3EH2A 3W2HA 1EWRA 5I4CA 4DIOA 4ILEA 4I4TA 4REMA 2AOVA 3VISA 1Y6FA 1U3VA 4YPVA 1MENA 2O7QA 4LXQA 1UMCB 5E1DA 4RJIA 1JPVA 5EP4A 3U31A 3KVVA 4DUGD 4LC1A 2WYOA 3NUZA 2FWNA 5HIKA 1EAMA 1DHRA 2J67A 2Q62A 2GM4A 2HWWA 3IPXA 1OYOA 3M81A 5DWVA 2O05A 4YRSA 4HBZA 4DLUA 3MAJA 3KLPX 3LOPA 3NORA 3WRVA 3LQFA 2VDMB 1CJKC 1Z6YA 4FFOA 5FPSA 1GFSA 2DR3A 4KN6A 3U7RA 3O9ZA 4W9RA 4KQFA 3GAAA 3G79A 4K9RA 4M9SA 5CIWA 5HDQA 2Q7OE 4BRWA 4CMKA 2RONA 3L82B 4GMGA 5JS6A 4UCXA 2BH9A 1CXZA 1MJHA 2P5TB 2MWMA 3EA0A 4GP9A 3VHQA 1EGAA 2WHQA 3RVRA 3BF7A 4HVTA 3ZNOA 5G2OA 1AH2A 3RYHA 1BXGA 4ND2A 3DKPA 4NYIR 5EZ5A 5FWAA 5I8WA 1UMBA 3NO4A 5FR2A 3ZGVA 1UJ4A 2FMIA 4BP1A 2P79A 1ZONA 1ZGCA 5HBRA 2F8MA 2GK7A 4TSKA 4PG4A 1Z5GA 4JUAA 3E70C 3GLGA 2I6SA 2MU1A 3G23A 3ED1A 4B46A 3FWKA 3I45A 5IULC 4AKIA 3JQ6A 4A15A 4BNUA 1U1IA 4II3A 2ZRHA 5GONB 1WZNA 4KUEA 4YO8A 3X1MA 3QKTA 2FVYA 4XYLA 4FMDF 4BJ3A 3IQDB 1RQ2A 3PVCA 2XV1A 3CU5A 3LPAA 3N59A 1ZVMA 4MRPA 3GLIA 5FUWA 1B15A 3LF2A 4CQLA 2PJZA 5K0NA 2ODBA 3NEPX 2F1KA 4PSCA 3TQFA 4X8LA 3G2IA 4TTRA 1JEJA 4EL5A 4DIMA 3QBTA 4BQPA 1WZUA 2YWEA 2II6A 1J97A 2BFEA 4NZYA 5C1BA 3LU1A 4WCFB 5DWDA 1J0CA 2Q1UA 2E2WA 4TUYB 2FHPA 3VNUA 3X43A 1T3HA 4GI3A 1V2HE 2C3UA 4RF3A 3KEOA 1AIPA 5CFOA 3U5TA 2W90A 2WSSD 3MZ0A 2AT1A 4BNMA 1D4FA 3LLUA 5KKAA 1H1DA 2NV2B 3GFOA 1Z2PX 1BH2A 2AOUA 4WFIA 5E1OA 2QN1A 5E3IA 2CYCA 5H70A 4HXEB 1F51E 1L4YA 4L5BA 4NMMA 3H8WA 4URUR 3DSRA 3G9ZA 3OF5A 3JAKB 4U9IS 4BUZA 4R2JA 1D0VA 1JXMA 2Z2IA 4CM4B 3OZEA 5LB4A 4E4YA 2FCAA 3K6SA 1JFSA 2E1PA 2PZBA 2L82A 4CBVA 2P7HA 3TTVA 3ECAA 2QUKA 5AK6A 2PGNA 3EUAA 1I2BA 3H16A 1EVKA 3O38A 1X8KA 2EGUA 2LE0A 1Y63A 2FX5A 1CHDA 1ZN2A 5FOTA 3K8QA 4X93A 5GGYA 4TVKA 3IT3A 2Q3EA 4O0LA 1QHNA 2FGJA 2JEZA 2ZRBA 3PNLA 1TYCA 2VTBB 3HHEA 4KOEC 3SP1A 3RRMA 3TD2A 1FMFA 3GLKA 5BVHA 3Q4GA 4EFMA 5GIOE 1ZD1A 2B36A 3WP0A 1RWBA 4UBOA 4ENSA 1XZJA 2H9YA 2Q3CA 5BQOA 5SZJA 2IEYA 3VOBA 3CWZA 3N28A 2XEDA 5CK5A 1O6BA 1WNTA 3GLHE 3FYCA 4EYEA 4ARCA 5I47A 3SC6A 2PZKA 5E7JA 1DIOB 4XM0A 2X0JA 4FQ8A 1G8MA 1VL0A 2JHAA 2VPZA 2XB9A 1NQ5A 3CLKA 1UK7A 1IQPA 2J0EA 2XDAA 4LC0A 1UP7A 1H5UA 1L6RA 4TV9F 4BJ6A 3ZDEA 1YA4A 3WJAA 2QTVB 2HPAA 3N3BC 1OSNA 1CUGA 1J33A 2X42A 4S35A 4UVDA 3VKVA 2OLEA 1XJCA 3NTVA 1Z6GA 1GO2A 1WCIB 1WOYA 2XTAA 3PA6A 2XMQA 1X19A 4LGMA 2WIBA 1A7AA 1XVIA 2W2OA 3EGDA 1F17A 4HZGA 3TQHA 2H4XA 1HE4A 1M76A 1Z5ZA 1NNSA 3HL0A 4PLWA 4B3XA 1TMKA 2IGBA 1ZHFA 1YQUA 2XTJA 1AQIA 1QYVA 3JYHA 2PCLA 3CUVA 3GYBA 4E07A 5A9SB 3C15C 3IE0A 3KKLA 3EIQA 1JAYA 1CX9B 4LJAA 3IP8A 5JHGB 1BG6A 3QELA 2NO7A 3AB3A 3AF1A 5A4JA 3BMQA 1HRDA 4MHOA 3EIHA 3SX0A 3VVLA 1VLLA 3AB8A 1DV1A 2C4WA 1V16B 3A10A 3D8TA 2PH3A 1XZBA 3G0OA 4OCZA 4PLCA 3UNXA 1PCXA 1LJLA 4W1SA 1IB0A 3G2KA 2FZ4A 5GOZA 3VR3A 3CY6A 1ZH2A 4C2UA 3WK9A 2DH6A 2IHBA 3KB2A 3W9SA 1CZLA 1M74A 1XDSA 2EVWX 4Q1CA 2B99A 3BKWA 4MWDA 5C5IA 5K4HA 5AJHA 2G6BA 4YMUA 4IMPA 6YASA 1YUBA 1O6FA 4X8MA 2ZDQA 5F4ZA 3JALB 3IESA 4P6VF 1LI7A 3NBMA 3O8QB 4KQHA 1QDLB 1YIDA 4OAOA 1QAOA 3CB2A 1LTHR 2YQ4A 4GLJA 4EG7A 5BWMA 4QM6A 1E3MA 3DE7X 4FD3A 1LDBA 4L5CA 5HK8A 2ZVDA 1M1NA 1RWXA 4MO9A 5I7UA 1OUMA 2JCBA 1FU4A 4AJLA 4G67A 2JRLA 4ZAZA 1F8UA 1UZUA 1QQBA 3MELA 2O23A 2VA9A 3GHHA 1JF8A 4D45A 1LEHA 1KSJA 4MI1A 1E3LA 4X62B 3RSFA 1S3IA 1J5EB 2XB8A 2QNIA 4LOLA 5AVWA 2P8SA 1RZRA 3F4BA 2FZ5A 5KNDD 5CURA 2FW0A 3SJ7A 2X9VA 3HBLA 5IVDA 4GQIA 5LFAA 2YMPA 3TUZC 3L8ZA 2NNLD 1KK1A 2BJVA 1CIVA 4CN9A 2LKDA 1GRRA 1Y3BE 2C5EA 1QJCA 1QK5A 3CLTD 3EUEA 5GJWC 4F5ZA 1RQPA 3YASA 3TGPA 3DE6X 4EG5A 1N6LA 4N3NA 2O2HA 5CDFA 3CRRA 1T36B 2EFJA 1J2RA 1ZM4A 2G1UA 4J94A 1CNEA 3C2QA 5K2MA 4NBKA 3V8RA 1ZUHA 3S2YA 1Z29A 3OEHA 1VA4A 1G8HA 2Q4EA 4IY1A 4GHWA 3WDSA 4F9EA 5JQGB 1DE0A 2VPIA 3FZNA 4RYLA 4EUSA 4EHDA 3OZGA 1JGTA 3WLPA 3Q0IA 2HHJA 3OQIA 4L6IA 2P4HX 3A7EA 2A6PA 4OOEA 4WINA 5KOYA 3X2SA 4B9EA 3GAZA 3NJ4A 2WD7A 2LUOA 3L6UA 3Q1LA 4QDKA 4RFVA 2XUAA 4RDCA 4V3CA 5TQ0A 3H75A 3UBMA 2RHCA 3UUGA 4YV1A 1X80B 2ID7A 4AX4A 2H0AA 4ENPA 2MYTA 2R8OA 4P5DA 4LQLA 3SZLA 2YJNA 3Q0EA 3AR3A 2GEBA 2VHZA 2GCIA 2XDYA 3G68A 4RPCA 3ICEA 2BGIA 3QOWA 1DCKA 3ED5A 5L3QA 1FBNA 5C3MA 4CM8A 2IBTA 5BNZA 3FOCA 5I9IA 2BGMA 1XO1A 3TQQA 1WEHA 3M9XA 3TBHA 1OGIA 3AF3A 4M0LA 4K03A 2IDMA 4KO2S 2Q7DA 4DUPA 4YUXA 2JW5A 5JR3A 5P21A 1R4MB 3ADBA 3H2KA 2IVZA 1HGXA 3OZAA 4ZQBA 5I7OA 2Y93A 4KXNA 4R8MA 4CKYA 4A10A 1NBMA 3FXAA 1MO5A 4G81A 1SOVA 4F46A 2I4TA 2R8BA 3A6KA 5BVGB 3F74A 4WE3A 4MLPA 4IKOA 4PSDA 1F7UA 1KAGA 1PNOA 3K0SA 3OSZA 3OHSX 4J8PA 3KZCA 3FTNA 1NRXA 3DO6A 4D9MA 2JFQA 2DECA 2PZJA 1ZP6A 4A2CA 2VAXA 3IAUA 3ZWMA 2LPMA 1HE3A 1UC5B 4NX2A 3ILHA 3HJRA 4W1QA 3SOPA 1Q91A 5EMNA 4N0EA 2CL5A 4LRXA 1N6PA 5DLYA 1QH1B 1NJ2A 1VGVA 2PLFA 1U80A 4MRNA 2EHJA 4TQ9A 2XNCA 3QV1A 2ASVA 2HUPA 4UCQA 4DPKA 4ZEOA 5FHQA 1PI3A 1U8ZA 2FU5C 4IMRA 4OA8A 4XASA 5PGMA 2VSFA 5ALSA 1PS8A 1CQXA 4BYMA 3EG5A 4OI2A 5F98A 4DM4A 4IILA 5L51A 3CUEF 4ZJYA 1YL5A 5F2NA 3P0HA 2FW7A 3LVRE 5D85A 2ZI9A 3WBFA 1SBQA 1M0TA 1LQ2A 2WWGA 5CVDA 5CX1A 1VKZA 2CL7X 1QX4A 4TLCA 3BJMA 3C3XA 3Q7QA 4PYRA 1DEHA 1XZEA 1CUFA 3O73A 4O0MA 4YT8A 5FWNA 2DPMA 2YWXA 3ET4A 4HEA6 4MIEA 4F4JA 5AKXA 5KNDH 2J5KA 1GLGA 3MGBA 4HX2A 3BDVA 4XH9B 4GS5A 1T8WA 1AS3A 4D4MA 1GRCA 1C3JA 2NYAA 3DLAA 5L4NA 3MPUA 1G21A 4F8YA 1GTG1 1LVGA 3MCUA 3S44A 2ZVPX 2HAEA 3CLSD 3TEFA 2JIDA 5K3OA 1JQLB 3RHSA 4AO7A 3VO9A 2H1VA 5EMHA 3Q12A 2CMHA 4IDAA 1C1DA 4LDAA 1DVRA 1D5CA 4YI3A 1C1YA 3IOYA 1T4BA 3GFGA 4HXFB 2JK0A 4MA0A 4P7KA 5H3HA 2OO3A 2OC9A 4Y2GA 3K8YA 4DIKA 1K4KA 4WCFC 5ERXA 1HMYA 1TAQA 2FKAA 3VBCA 1DT3A 2VPXA 1IWPB 3I37X 2AG0A 3KTAA 4GR5A 4RTNA 1BDBA 3IXMA 4YO7A 4NZZA 3ORSA 4EKNB 2V54A 5AD1A 5ED4A 3SLRA 1UKCA 1LFAA 4MGEA 2Y1DA 2C0PA 1CE8A 1K7FB 2X2OA 3R76A 5L95A 5BPFA 2DR2A 2GM9A 1U4OA 2KLHA 3JCZA 4MI9A 5TEVA 5TSDA 3U9SA 1FNSA 4DMUB 1ODTC 1T1EA 3F8WA 5AWFC 1HEIA 4MUGA 1SQGA 2Y77A 1JG1A 3ZXYA 2YHIB 1YKGA 3O2NA 2JA2A 3D31A 2QVLA 4L4XA 1C4XA 1RZUA 4RV9A 5K7SA 2AN3A 2V0CA 1T25A 2WG0A 3LQ2A 2GZMA 3N9IA 4KR3A 1ODSA 2PZ8A 3LQRA 2FEMA 2OE2A 5CHYA 1UJ2A 4L0QA 4B3TB 1UPXA 3CKYA 2I80A 1AY0A 1XMVA 1U0JA 3Q2IA 4IR7A 4ZQFA 2OZEA 4YRBA 3BL5A 1CQJB 3HABA 4BOYA 5C1DA 2WIFA 3PKIA 4CIAA 1EWVA 4UXIA 4AXXA 2QRJA 1Y80A 4AMGA 1NN5A 7ADHA 3TX6A 3T9CA 3FVVA 3G2NA 1UJCA 3ZD7A 1L9KA 5HE9A 3QX3A 4IKPA 4OH7A 2YZKA 4EI7A 4I50A 1JJBA 1YZUA 1ZVJA 3JARA 4IMJB 3TN7A 3D6UA 4BE9A 1LJUA 3O31A 4M8IA 5LZ5A 2UXCB 4KHPB 3CNHA 4BJ1A 3UCFA 5H4GA 4UTRA 3BBPA 3UFBA 4KW7A 4V39A 4ENRA 4LVUA 5LZ2A 2F8SA 1XK6A 2J3QA 3TOCA 5JEDA 3QVWA 5LYJB 1GCAA 1J42A 1FSZA 2GLTA 2VNAA 3DOCA 4KKXB 3UCEA 3PR3A 1NF8A 1O97C 3Q9LA 1OYVA 1PX0A 4FEEA 2O5CA 3BAFA 4RD0A 4HQLA 3I9MA 2Q27A 4MGZR 5DYTA 3SY8A 1SVKA 2VYNA 4OHXA 1NVBA 1Q44A 4N12A 3S40A 1P19A 2IE0A 2ZUTA 4C7KA 2XUDA 1LRKA 4XLZA 5EIBD 4KV9A 4YP7A 1JNXX 1XLUA 1FFBA 1RM5A 4P33A 4C29A 1I24A 2P68A 3LDFA 2WA2A 2YZ7A 3EGCA 1YR6A 1K88A 3M1YA 3MGGA 4X20B 3V55A 2QTBA 4UD2A 2ZBGA 5FA5A 4R2MA 4NARA 5CIQA 1FP2A 3EVNA 3T7RA 2PRIA 2CUTA 1AV7A 4EPWA 3VTZA 3HYNA 2X1LA 1RZ3A 1Y1KE 3ESCA 1QFSA 4ZKDA 3N0TA 4DG5A 4QBFA 1TTHA 3LZDA 1N7IA 5CDTA 2BFBB 5I9MA 1S0UA 2P90A 1JJIA 1RAAA 1G55A 3EMKA 4AKGA 1FTWA 2ZBPA 3FHOA 3JASA 3MCAA 4V1CA 1DEAA 4UTXA 5FNVA 4IOMA 3FBTA 4WSOA 2BE7A 3P8ZA 1EQAA 2JH3A 3U81A 3MMPA 4UNSA 5B3JA 1GKIA 3FNBA 2QVBA 3UGJA 5BPHA 1BEZA 2J87A 3WKEA 3G0HA 3ZNPA 3LW8A 1NLUA 1XMJA 1T0UA 3TSOA 3P20A 3WKAA 2ZT8A 3MFQA 1JHMA 3TWOA 3UG6A 4RH0A 1T43A 1GRVA 2V96A 4PQRA 3RU9A 1KP2A 1TM7E 1WVIA 2XX3A 4G9BA 1T3GA 5DTJA 2IU4A 5BSRA 4FHZA 4C0BA 4EBFA 5C18A 4QKQA 5A6SB 2Z9BA 3X1JA 4PAOA 4GOOD 5KC9A 5C7LO 4MZDA 3JQEA 1H4SA 2AN4A 2WNIA 1GAQA 3WQQA 2QTLA 2KMLA 1ZO8A 3UYLA 4NEHB 1SKUA 1AZSC 4J6FA 2X3FA 4W5WA 3O03A 1JR3A 1ZVVA 1GQFA 5K4AA 1KPHA 2PMKA 1TQHA 2MSCB 1SKQA 1SB9A 3EZYA 2IHZA 3MJCA 3OIUA 3QKSA 4KIJA 5H83A 4OSOA 4JCCA 2IZ0A 2VSXA 1RXSA 2GA8A 4HB2A 1DS6A 2XB4A 1A3CA 1TYBE 3NKFA 4DM3A 3AL0C 2XWBF 1AXGA 1U7PA 4OUKX 1O94C 4U6SA 1D1SA 1Z56C 2GAFA 4FN5A 2GCPA 1RTTA 2AXQA 3O4HA 4ML3A 2W2MA 5JY6A 2YN2A 3T4XA 3M5DA 3C8ZA 1II8A 2J9FB 4X7PA 1U2EA 1U6IA 3AGQA 4RZQA 4QEZA 4PCAA 3A27A 2XWSA 3R6TA 5FUVA 4LDJA 1P4RA 2C7RA 3VKHA 4FI3F 4NIMA 1FE8A 3KQUA 1F48A 2HGZA 3NAMA 1BWQA 2C59A 1IY1A 5HKAA 4JITA 3HXKA 5FJJA 2ONCA 3O2JA 1LD3A 5LWHA 1E3JA 1LSUA 2AWOA 2A3NA 2XWPA 1DKPA 1FVXA 2NU8B 5B64A 2GF0A 3ZJUA 2ABWA 4D5GA 5H9WA 4L95C 2EARA 4RA6A 3JQ9C 1MR3F 1PT8A 3V48A 5KNCA 2ATVA 3T1HB 3PHLA 4DEYA 3OCJA 4HNGA 5AK0A 4BTLA 4HLDA 3QEAZ 3MW8A 3E18A 2WZDA 2C99A 2E87A 1YRAA 2RGUA 2YZNA 3VAZA 4N3BA 4G86A 2W58A 3PPWA 4HRXA 2QRHA 2FPRA 4JZKA 5CUQA 5KWVA 1J25A 1EUCB 2PZGA 2OHXA 2W48A 4N7BA 1KI9A 2IP1A 5EZ6B 3TOVA 2ZJ5A 5CLFA 3HE3A 2IYVA 2MSDB 1XIVA 1U8UA 4CIWA 3V8PA 4HNUA 1O8BA 4Z9AA 3ZW8A 2Y66A 3FPBA 4OX9B 4LXHA 5KX5F 5EWJA 4BNHA 5EIWA 2F3UA 4H9GA 4YYZA 5AKLA 1T0JB 3A25A 2Q9AA 3FCYA 5EC8A 3PWSA 5IT5A 1KZGB 1XRRA 2E3JA 3EEIA 4Q3EA 3WGOA 5IPFA 3MUEA 3WLEA 3ES9A 4F93B 5EJ5A 1KHTA 5B6IA 2BEVA 2VH2A 1SZPA 2DUNA 2NVOA 3B82A 3KWFA 4IIBA 3IQHX 4RCZA 2YC2C 3BMNA 1K2VN 3MWKA 3QW4B 5ALGA 5FPYA 4Z49A 2AHRA 2EZ9A 1AD2A 3GBPA 1V3VA 1S1MA 1FJHA 1SKBA 4KAFA 4B2IA 4BNLA 3GH1A 3UZUA 4B3BA 1OXMA 2VXOA 1NL3A 1Q77A 4MJXA 1O54A 4I9HA 4N5IX 1S2DA 3PQCA 5CPBA 4E1BA 2IU6A 1KMNA 3LHIA 3VPXA 4EYKA 2Y9PB 3BHNA 1J8FA 1YI0A 4LHXA 5G4LA 5M5BA 2NXJA 4BRZA 1CU1A 5FTJA 1XN1A 4B3FX 1Q14A 3AVVA 3COSA 3JPYA 2ZR9A 5DTMA 3ZWVA 3GB9A 5JD4A 3EWSA 1PR4A 2I03A 1MC5A 1XKTA 3ONDA 1SHZA 4V0SA 3T7SA 3ZWWA 2L2QA 1SUPA 3DZCA 3M3HA 4I8DA 5DHQA 3D54D 3SJAA 3Q5DA 1AA6A 1PVOA 3D3KA 2H51A 3A4VA 3L1VA 1B3BA 2GBLC 5TX7A 1XQVA 1VPLA 4RXTA 4G0PA 3P2YA 3MRXA 3M5CA 3DUFA 1KJNA 5T41A 3K0KA 1M83A 3RU7A 4D3ZA 4IUYA 4FW8A 5IFLA 4ZO8A 1AT1A 4MQ4A 1N2ZA 3PYLA 1F6DA 5C1IA 2ZR0A 1Z3CA 3WL4A 3ZJTA