2BRUC

Complex of the domain i and domain iii of escherichia coli transhydrogenase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
AEETAELLKNSHSVIITPGYGMAVAQAQYPVAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQDDPKSPIAGMPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAILKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination of a Transient Complex by NMR Using Paramagnetic Distance Restraints - the Complex of the Soluble Domains of Escherichia Coli Transhydrogenase
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords NAD(P) TRANSHYDROGENASE SUBUNIT ALPHA
total genus 55
structure length 167
sequence length 167
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2005-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2bruC00
2IHUA 5MFPA 1PT9A 4C78A 2BRUC 1U31A 5FEMA 4V1CI 2IHVA 4Y6QA 1OZHA 5EJ7A 1M2NA 4GM0A 4JUBA 2QQGA 1S5PA 1S7GA 4JT8A 4K9MA 4K9OA 5EJAA 3JWPA 5MF6A 1T9DA 4C7BA 1PNQA 5EJ5A 1O96B 2OD9A 4JSRA 1ZPDA 4RJJA 4BVBA 4RJIA 1Q1AA 4KGDA 2PGNA 4FEGA 1M2KA 2PGOA 1M2JA 1YI0A 1ICIA 4IG9A 2H2HA 4MPJA 5EJ6A 3EY9A 4F56A 3E9YA 1Q6ZA 1YHZA 4IAOA 4RMHA 3LQ1A 1UPCA 4JU8A 4Y6OA 4X3OA 1YI1A 5MFZA 1T9AA 2HJHA 1POWA 2H4HA 4RMIA 2UZ1B 4FVTA 1PYDA 2H2FA 2EZUA 3JR3A 2JI6A 1SZDA 4UTVA 5BWNA 2C31A 1YNOA 3ZGVA 4ZZIA 1Y9DA 1PNOA 4BV2A 1E3TA 2JIBA 1EFVA 2Q27A 2UZ1A 2WVAA 4BV3A 3IAFA 1YBHA 4Y6LA 1HZZC 2VK8A 1UPAA 2VK1A 3CLUD 2JI7A 2H4FA 2WVGA 1PTJC 4D5EA 4FEEA 5FYQA 3HWWA 2NXWA 2H2GA 4RMJA 4KPUA 1OVMA 1M2GA 4L3OA 4HDAA 2FN3A 2FSVC 4JD5A 4RJKA 4BUZA 2OO5C 3D7KA 3GLRA 5IMSA 2PANA 4MPRA 1SZCA 2H2DA 3FLMA 2WVHA 3D81A 2QQFA 2VBFA 1YTLA 4I5IA 2VJYA 1NM5C 4UU8A 1UPBA 3GLUA 4K9NA 5K6TA 5K6RA 2IHTA 2Q29A 4UTXA 1XLTC 3GLTA 2VBGA 4L2IA 1MCZA 1Q14A 1U2GC 1POXA 1U28C 3K35A 4K9QA 4QQ8A 3U3DA 4KXQA 3ZG6A 3CF4G 4BVHA 5EJ4A 1EFPA 1V5EA 1JSCA 5MGNA 1OZFA 1T9CA 5BWLA 3F6EX 2VBIA 4ZP1A 4UTRA 4BVEA 4V1CA 2EZ9A 2FWNA 1M2HA 4JUCA 4GG1A 4K9LA 5EJMA 2H59A 1PVDA 2AG0A 4V1CB 2JLAA 5D7NA 3RIYA 5AHKA 4COKA 4RMGA 3FSJX 4TWJA 3D4BA 4K9KA 4F4UA 3CLTD 4BVGA 4UTZA 1PI3A 1PO7A 4MZXA 1YHYA 3CLSD 3ZGOA 2JI9A 2Q5JA 2H4JA 4JT9A 4Q9DA 1D4OA 1V5FA 3FZNA 1V5GA 2A1UA 4K9PA 4UUAA 4BN5A 5K2OA 4X3PA 3PKJA 1MA3A 4JUFA 2NYRA 4G1CA 4D5GA 2Q5QA 4MPPA 4GM4A 3HWX1 1BFDA 3U31A 2AG1A 1DJLA 3IAEA 2JLCA 4GP9A 4JUDX 5K3SA 5DEIA 5BWOA 3EYAA 1OZGA 4UUBA 4R8MA 2EZ8A 2Q5LA 2OORC 4FZ3A 2FR8C 2OD7A 2X7JA 3GLSA 4GPEA 2B4YA 4QPZA 4TWIA 5EJ9A 1J8FA 1O97D 1T9BA 2V3WA 1YC5A 2EZTA 1Q17A 2W93A 2H2IA 4GM1A 1YC2A 4O8ZA 2VK4A 2FRDC 4BN4A 3PDHA 3PKIA 4J16C 4IF6A 4UTNA 2A1TR 4MQ5A 2DJIA 5DGTA 2Q5OA 3EA4A 3F6BX 4JU9A 4UU7A 1Z8NA 2JI8A 1QPBA 3OE1A 2Q28A 3CLRD 1N0HA 4HD8A 1U2DC 4J1TC 4JUAA 2EZ4A 4QELA 4BVFA 5EJ8A 2OD2A 3RIGA 5DGDA
chains in the Genus database with same CATH superfamily
4RU1A 5HMLA 4KFSA 4HB2A 2O5RA 2PEZA 4I6JA 5KVCA 1AOXA 5JVDA 3ZHUA 2PSJA 1E0SA 3R5TA 5F3WB 2WJ3A 4FB5A 1JIQA 2NPOA 5AVWA 1Z8HA 1UKAA 2CWDA 3V33A 4CMBA 3PTAA 3I04A 3IV7A 3VR3D 1FYEA 3P71T 1X8KA 1E3EA 3U40A 5J63A 1CZUA 2X7HA 4D4HA 4DUYB 4HDOB 4GBJA 2WD7B 2R5FA 4ZEMA 3WP0A 5DN6D 5MFZA 1HMPA 5KINB 5TC4A 3ETJA 5I9NA 4XGRA 1E1NA 1FS5A 4R6XA 5I8PA 2ONZA 1PJCA 3M5DA 3PJDA 1XEXB 4WNYA 5GIPE 4CEJA 4X1YB 1KOGA 1ZD8A 1Z6QA 4UHJA 3FDZA 3GO4A 1SY7A 1XMJA 2HPVA 2PEYA 3QY9A 4G5HA 4RTOA 4JJ8A 4BNYA 4P53A 3H7IA 5B1SA 1A7UA 3HWSA 1TA4A 4Q03A 1SK9A 2AFHE 2WJYA 5ECYA 3CRNA 1G17A 3UOGA 4M54A 2Y1KA 3GJ3A 3GROA 2C97A 1F38A 4FFMA 5LA6B 3UCFA 2NWQA 2IZ1A 3T5DA 5IAAA 5L9AA 4D7AA 1SN7A 2ZUEA 1PLLA 3HWWA 1FB5A 1NW8A 4C3VA 3VZBA 3GCGA 4RZUA 4Z9AA 1E3WA 4NU5A 4L51A 3UVEA 3E7FA 1GXSA 1EBBA 1L4GA 2FEMA 2JZOA 3HU2A 2XWSA 4QEDA 5JNWA 1NVUQ 3VOSA 2AMLA 4EPVA 2VCEA 4JLBA 2GZDA 1PEDA 1KAOA 2GASA 2CLSA 3ND6A 3NTXA 2VDJA 2ZI7A 4M0MA 4ZTUB 1BXZA 4TSFA 5L3SB 1A2QA 3E9EA 4X1KA 3RKSA 2C3MA 3S6JA 2GBGA 1J21A 3HCDA 1LKZA 2J1LA 4KAAA 5DYTA 3NBMA 3OLWA 5JJBA 3K5IA 3LFHA 1U0OC 4RK7A 4G5XA 3WGVA 4TYWA 2YQ5A 4R1MA 2Q3HA 2BFMA 2BIFA 2FPGA 3GT4A 3NHMA 1U9JA 3Q5DA 2YV5A 4FYHA 1B93A 1RXYA 1VMIA 3AVOA 4QUJA 2SICE 4EDFA 1TIKA 4BP3A 4U9HS 4OF4A 4DADA 1PZNA 2E4AA 2QRVB 3QUSA 2HSZA 3AY7A 4F8EA 1U0LA 1EJ6A 1LDBA 2OXCA 3L5OA 3D6TB 1E9FA 4Q4JB 2PRSA 4GECA 2EL9A 3DD1A 1WCWA 1UJCA 1JZSA 4U1RA 2I22A 5EWLA 3V8NA 2Z9BA 4DQLA 2R7KA 5M7EA 2WA2A 2Q8NA 2HXSA 4OJNA 3WADA 2K6GA 1AQNA 4I1YA 3CEJA 2FR8C 2QAIA 3V5NA 1ORDA 1Q7EA 4QLBA 2R00C 3F3SA 1J8FA 1JQAA 4LDJA 5CYOA 5EA2A 5HUJA 3EF1A 3WNVA 1PCXA 4JI3B 8ADHA 2XUFA 3HYNA 2C7OA 4GICA 5CVEA 3V1UA 3OX4A 4BOYA 2GXQA 2VPIA 3NRCA 3G2HA 3KZMA 4L5AA 4RH1A 4Y9SA 3VHXA 4L16A 1D0IA 4IEFB 1A5TA 4AS3A 5CPBA 4Y1FA 1LBQA 1SCUA 1KOJA 3QLUC 4TV8F 2HWUA 5KVVA 2A94A 3I05A 3H5NA 3FFXA 3WGOA 4YUVA 3GQVA 2VSYA 2WPDD 3C14C 1W25A 1A5AB 2P40A 3K8ZA 4YMGA 3ZIAD 2QRLA 3PHJA 3ELWA 3RS9A 2H3HA 1LPBB 5DCUA 2SKCA 5I51A 1NN5A 1WUKS 2OEPA 3B9BA 3X3HA 1SA0A 3ZI0A 2CJXA 2IIVA 1UPTA 2Z98A 3LYHA 4K87A 3P0JA 1TW2A 4PAOA 1ZGHA 1ETHA 5ETJA 5FEUA 3ZGZA 1TE2A 1RFGE 2C59A 2COUA 3KYBA 3GP8A 1YBVA 3IB6A 4CIYA 1FTGA 2HXGA 1KZ6A 3AINA 3IA7A 3SC3A 4PX2A 4BJ5A 1RDFA 1ORHA 3MUEA 2PLWA 3E7DA 1CLUA 3PHHA 5AVJA 4CDMA 5C0OE 1PFWA 4YAUA 4DHEA 2ZANA 4OGKA 4U6SA 1F2UB 3K3PA 4JZYA 5BW6B 2Q0HA 3VPXA 1Q21A 1M2EA 1GZDA 4R0NA 1QONA 3AUYA 4X45A 2I7DA 2P27A 2X7XA 1MA0A 3C87A 1EA7A 1HT3A 3L8DA 3LYUA 1FDUA 4U7TB 4M89A 2HDOA 4BKPA 4XCXA 4EUEA 1EUYA 1Z4QA 4BKQA 3AKEA 4JA0A 3I52A 2OORA 3T9CA 5FV4A 4M86A 2BGLA 3HGQA 1H69A 1MFZA 2QSZA 1QIJA 3NBKA 4RCVA 4UFNA 4BYGA 2X77A 3QFSA 3VU9B 3ST7A 3ZEAA 3SR4A 3KZVA 1F4VA 2XUOA 4MWCA 1NKSA 1E2PA 3ORYA 4Z9YA 1NNUA 4PQEA 2KWIA 1JALA 1OTYA 1Z7GA 2JJ8A 3I58A 4J76A 1QVAA 3U4MA 3VI4B 2GZ1A 1VG9B 2ODTX 3D8RA 5F9FA 2ATIA 4I99A 3U1TA 3O2NA 2RD2A 3VR6D 4NCKA 1VLQA 2ECFA 4RPJA 5JRDS 4XOIA 5BNFA 3SYNA 3M6IA 4PAMA 1EM8B 5G0SA 2CZGA 2P30A 1X1RA 2VL7A 2MMGA 4LRQA 3SPXA 2YYYA 3FVWA 3WFZA 2G9ZA 1ZZEA 5TGZA 4V2IA 3IBCA 3D7SA 3O3CA 1S2LA 4KQJA 3LBHA 4Z7OB 1PO7A 1YB6A 4HDRB 1MEJA 4ALJA 2GWRA 1NHGA 1E9CA 2FW7A 2AOUA 3K92A 4P84A 2GILA 2GPJA 4Q9HA 3WMFA 2VQFB 1PV1A 2R1VA 3DOUA 4ONEA 1T3TA 1FMTA 4Y2HA 4ENVA 1RC8A 3CX7A 3AJRA 5BWMA 2WOJA 2DUWA 1LFAA 3A3YA 4HNVA 3LCMA 4AKEA 1KPIA 2FZ4A 1G20B 1WMDA 5K20A 4MOWA 5EHQA 1ML4A 3PP8A 4IIBA 4DSUA 5C5EA 1X7DA 4MJ3A 1UBKS 2NU7A 4FDAA 2ZAIA 3BA6A 1B43A 3BD6A 4O5AA 5FWXB 1B0ZA 1I51A 3TLJA 1MC8A 2P91A 1V35A 4HYTA 3PQ7A 4IRUB 4CI9A 2NP6A 4C06A 2C2WA 3U44A 1QHHA 1PR6A 1TJ3A 3U4IA 3PJEA 4DC1A 2CXQA 1EB8A 2EARA 2JIZA 4GYJA 1JX6A 3I6YA 1D1TA 4QPDA 5FBQB 2NO7A 2RKBA 3SJBA 3K0AA 2WDZA 1DWQA 4J16C 3CVYA 2IKQA 2OCKA 3PNOA 1K97A 1T9KA 4J1TA 1KTVA 4ICIA 4B75A 4YRZA 3V2GA 5B1YA 5KPDA 3DZ8A 3DBHB 3B6EA 2NIPA 1VHJA 1SFRA 5HKAA 5KX5B 1X7YB 2OMKA 2ZSEA 1PW7A 4B2LA 3KJEA 4RD0A 1ECFA 2DHDA 1ARZA 3RK1A 1N75A 4LV6A 3T5BA 1O8CA 3I4CA 5C9ZA 5BR8B 2JH8A 2CFSA 4DRYA 1F7VA 4ZGBA 1XP5A 2E6KA 4IJQA 1SVNA 4P81A 5JZMA 2Z4RA 3LNCA 2D74A 2DQYA 2GAJA 3KWMA 3IMCA 4FGSA 2OHFA 3JQ8B 4HB4A 4NYIQ 5FA5A 3WS7A 1AKNA 1YBMA 4KZKA 4PG5A 3ER6A 3O8NA 2QGFA 4FGUA 1C9DB 4DBVO 2I1WA 2C8LA 1EHCA 1G64A 2P9FA 4FD2A 1D1PA 5BOVA 3QA9A 5HM6A 3SI7A 4FB4A 4XJSA 3UXYA 2H2FA 1E3IA 1NVWQ 2CEKA 1HTTA 4URZR 2ILTA 1YNOA 1HZZA 5DB4A 2OECA 5AW1A 3EQ2A 5CLLA 2NUAB 1VCOA 3L84A 1ZD2P 4GP7A 4H3HB 3NTVA 4FR5A 4KAFA 4EY7A 1L7MA 2X6QA 2ZUCA 4N9QA 1U0EA 1AQUA 3ZDAA 3ZE0B 3AOGA 5JZBA 5I5EA 2LGJA 4DG9A 1NM5A 1SRQA 1R5NA 4PLVA 4LYEA 1EWRA 4WBNF 2I03A 1JFFB 2XRFA 3H1EA 1GDTA 4CFSA 3JQFC 3B1YA 4KACA 1C30A 1CJUC 3BXPA 3ZE6A 2FCAA 2WIKA 5CB4B 4PY2A 1HXHA 3A9RA 2ZBFA 5ENDA 3RRNA 2JJ2A 4Z4HA 2RE8A 2GRAA 2XA2A 2NVOA 2UYGA 2YV2A 4I9GA 5AHXA 5D1HA 3FMFA 4UXJA 2BE7A 1M6YA 1T9CA 3A04A 3HFRA 3P45A 2FWBA 4ZVKA 2LTAA 4M9QA 4DV1B 3VPFA 2OBYA 4EA6A 4X71A 5KKCA 1PBNA 3TOSA 2GPWA 4I8DA 5KAMA 4N8EA 2DPHA 2OB2A 1EU1A 2OENG 3DD5A 4DJTA 3ZCQA 1OOEA 5C2JB 5LXTA 1PI3A 1Z6TA 3CXUA 1WW3A 3U4QB 4HYEA 4B0OA 2VCYA 5DP2A 4W5RA 2EU8A 5BQXA 4OYYA 3C15C 1D4OA 2YBDA 4OHVA 2H07A 4OH1A 3SR3A 3V1MA 2WF9A 1JEOA 1KKMA 3L0SA 4IH4A 1J70A 2NZ2A 2G1JA 3BGIA 1B1AA 4QXAA 4X1YA 1XVUA 2Q5CA 2OLJA 3H97A 4ZKDA 4KRXA 4OUDB 2VNJA 1GEGA 2DFTA 5ALUA 5BP7A 4BXOA 1BZYA 4RK4A 4TTIA 3WNZA 3B38A 2QWXA 2QXTA 4DCJA 2FSIA 4UUBA 1LCIA 1U1FA 3DW1X 1JDPA 3TUIC 4B5LA 2CNLA 1FEZA 2XLBA 3FW1A 2AG5A 2YQZA 3GJSA 3HJCA 3TW0A 2FN9A 3ORHA 3R8FA 5T8KA 1U0TA 1N2HA 3C6YA 1JQLB 1NOIA 1Z62A 3P2IA 4B3RB 2AWOA 2FOIA 1QYXA 3S44A 1W29A 1Q7BA 5A3RA 2FZKA 5C5IA 2X0KA 3ICOA 1Q7RA 3ORQA 5BOSA 1HDRA 1IMOA 3IELA 3UXHA 4XB2A 1U5AA 3CPSA 2FZEA 2PX0A 1VBMA 5JCJD 2LD4A 2OD2A 1ODLA 1N6OA 2WV7A 4HAWA 1NW6A 3UEOA 5LP6F 1BGWA 1FW6A 5JJLA 1TMYA 1ZL0A 3U7IA 3CLUC 4TWZA 1G18A 3P1JA 3PWSA 2QG9A 3OQMA 2RJNA 3WMXA 2IXGA 5DISB 3OE7D 2MU1A 4NZMA 5HGXA 4BDTA 2A14A 4UPVA 1ULAA 1IQPA 4OFXA 3UWPA 2KX7A 4BAGA 1E4YA 4EZIA 1E1CB 4LN1A 4YJGB 1DNPA 3TJZA 5TMBA 3PUZA 1R2QA 5BMOA 2VHEA 1W47A 3OKFA 2I55A 1VMAA 4FJ0A 3M9WA 1TYZA 3LK6A 4X7BA 4D99A 1DEAA 4ZZ3A 3MZ0A 4DB4A 1N6LA 2HD4A 3CB2A 4Q3KA 4YI3A 2X5KO 3Q7EA 1Y3AA 3SDSA 1Z47A 1IXKA 1R8SA 3DZHA 4IH1A 4MWTA 2D5IA 3NNNA 1XQ9A 4NBNA 4O4JA 3OZEA 5CJPA 1V5IA 4CMEA 4C5CA 3HU3A 2Q1YA 1AM4D 1GU7A 3IC5A 3MWKA 1ZOLA 1ZD4A 5DT9A 2R9VA 1CNMA 1Q1BA 3CW8X 1QPGA 3KUDA 3OZXA 3OEHD 4IOKA 5C51B 2H92A 3CWZA 5DK4A 2VPTA 3BMQB 3CPEA 2ZIZA 1R0XA 1OA1A 1R4AA 1TZKA 4G0XA 3V97A 2ZW9A 4YUZA 5B6JA 1EX6A 3ADPA 1CVRA 1M72A 3EFHA 3WP1B 2QVXX 1ZGCA 4D8WA 4CV3A 4YRGA 1YFLA 1SCUB 2P9TA 4RK5A 3B1VA 2C9ZA 3QEBZ 4DBZA 2JLQA 3G5AA 3R77A 5DGXA 1C8BA 1K75A 3ZD9A 1AB5A 1QJ4A 5BSUA 3OEED 3VKFA 5K6TA 1QLWA 4AUNA 2E5LB 1Q0TA 1RWXA 1CWUA 2AG8A 3IPLA 2GF9A 4OH7A 3D54D 1GYPA 2IEBA 4F1KA 1MXFA 2G7ZA 5IT4A 5BWLA 1UM9A 2XEXA 4PGGA 3CMMA 4RAQA 4YJ3B 2PJZA 2MIIA 2BGKA 2P6NA 5HKKD 1OB5A 4H1TA 5IC5A 3WLRA 3EMDA 3E23A 4JUCA 4ZQEA 3K8YA 1LW7A 1NF2A 1WZEA 4O0LA 2OHVA 2AN4A 4P7GA 2MSDB 1EZ1A 3U5TA 1E79D 3P9QA 4M9XA 1X2BA 2WM2A 3F7TA 4LW8A 1NW3A 1E60A 1N2OA 2X2PA 1HH4A 3D2BA 3QKWA 4K05A 3BHNA 2QVBA 1QHXA 1SHZA 2DYKA 2P41A 5LBTA 1CF2O 1U4NA 5KCMA 3P2EA 1UMBA 5LJLA 3NCTA 1USKA 4Q7LA 2IZ5A 2FTKE 3ECCA 4QRHA 3K9LA 3K30A 5B3JA 4DNQA 1J24A 4ZPJA 3WLEA 4X8OA 3DCNA 4O02B 1N9GB 1WPGA 5MN5A 3NHZA 4JELA 1O95D 2KMLA 1PQPA 3FWKA 2Y6UA 5TJ9A 3HXMA 4F56A 1UMDA 4ODIA 3VNBA 4PYMA 1G4UR 4LMRA 4WINA 3RYTC 3LUPA 1Y1KE 2XVXA 3BXHA 4GGOA 4U2KA 4WFJA 4Y2PA 5SZKB 4C7VA 1ZHHA 3G2NA 4KV9A 4FDMA 4PPQA 1FCJA 3EXG2 3LA6A 4NECA 1GPWB 3L3BA 2P2NA 4IF6A 1TLLA 1J0BA 5AK3A 2HK7A 5F35A 1KH1A 2ODWA 2WWRA 4I46A 4WCFA 2JIDA 3ZHCA 2GN2A 2IF2A 5E6UB 3EPJA 2PGXA 2Q6IA 2TRSB 1KMHA 4HZGA 4U5QA 4QODA 2W37A 2J45A 2I4IA 4INOA 5KYGA 3ZWYA 3R7BA 2WSYB 4O2BA 2XKJE 5FEMA 3FPJA 2OAEA 1JP7A 3G2JA 4P3YA 3QJGA 4JLMA 4BO9A 2X4LA 3COSA 1VPDA 1S5PA 2I3GA 3PQDA 3HHPA 3F4LA 1GCOA 1MVOA 3EVEA 4IDAA 4IM7A 3ROEA 1A9ZA 1QC5B 1QK4A 4DGQA 3GGSA 1M8PA 4KXUA 3GJ7A 4YO8A 2BFAA 2WSIA 5IKOA 1PP4A 1X8LA 3IDFA 4URWR 2AOUB 1NQWA 3C85A 2K5UA 1JF8A 3JYPA 4RF4A 2Q41A 3M49A 3E9YA 1T4CB 3R5KA 2NX2A 2YL2A 4G4IA 5DM1A 3I83A 2GCNA 3KPWA 5B57C 4JBXA 3LQ4A 3BD7A 5TVGA 4P0QB 3MAJA 1P81A 3UW3A 1D0SA 2PX6A 4X8MA 5IJXA 4ENWA 1SKYB 2BGNA 1AKRA 2PM8A 4BGEA 3U7HB 1I32A 2F2TA 1E0JA 1Q95A 2ZKIA 3KBOA 5JCZA 3DQZA 2AOWA 1J42A 4B9EA 5JEDA 4OK5A 4D9HA 3DE2X 3VPBA 3MQ4A 5CFOA 3S2GA 4GVLA 3N5CA 5ED0A 4DDHA 3ENZA 2WWHA 1M1YB 1PS9A 2ZS8A 3OTOB 4FNAA 3ZWXA 2Q4OA 3STXA 2PFSA 1MC1A 1DLJA 1UBCA 2GFIA 4OCZA 3GDWA 3QUAA 1V48A 3VR4H 3HC7A 1E5XA 1MJNA 1P74A 5J4HA 3AOEA 2JFUA 4W5WA 1RKUA 1UP4A 1PL0A 2BISA 2QG4A 2VJAA 3KWLA 3L0DA 2FUNB 3MXOA 3SBEA 5I7HA 4BWGA 1JEEA 5CD1A 1SO8A 2AE1A 5ICGA 4ZYYA 1ABFA 2DR0A 3L7AA 2OVBA 3PQFA 4G1EB 3VTKA 5BR1A 3TMKA 1CK4A 3VU8A 3R44A 2P4EA 4O33A 3SF0A 2BFOA 5JT1A 1HQYE 3INGA 5TQ0B 1M34E 1AA6A 3E9ZA 3STYA 1GCAA 3F1LA 2NO1A 4XUGB 4EX6A 1I3NA 4LISA 4XVQA 4HLNA 3BK1A 1JXAA 3PUHA 1TC2A 3R6TA 4WZZA 4NV1A 5CJJA 1VFNA 3OIDA 4ARIA 1LLUA 3L4BA 4EABA 3CF0A 5TV2A 1N6NA 4ER0A 4FFBB 1B3RA 2EDCA 1ZHOA 4IZ6A 2B1QA 4LE2A 1G2QA 2PD4A 4R3WA 3RBVA 1A9XA 2O54A 5A9RA 4OHRA 2AZMA 3ANXA 4ZI2A 3LOPA 5C32A 2BFDB 2JHGA 3ESXA 3M0EA 4A9AA 4GOLD 3UF0A 2C9BA 1MC4A 2O07A 1R6VA 3PDIA 1SHJA 2OORC 5KTMA 1RXWA 4IMRA 3QOXA 4O6VA 4D4GA 1P6QA 3K6JA 3OY2A 2ZTVA 2IYQA 4RD4A 3T9AA 1VJCA 2I4OA 4HJRA 3ABQB 3CLHA 4UFOA 4E4YA 2AB0A 1IHPA 3PRYA 4DCNA 3IAM6 4ZOBA 1KBOA 4BTEA 4DUPA 5I45A 5IASA 3M6LA 1P6XA 4XW2A 4CR6A 4P33A 2C78A 2PG3A 4R1TA 3DPSA 3TKYA 4O5OA 1VDZA 5LB4A 4EHJA 3VPDA 2VXOA 1OBHA 2D8AA 2OM2A 1CX9B 2AX3A 5DLEA 2H48A 3H2YA 2FN8A 3OF3A 3FY4A 4WD3A 1MNAA 2BP7A 3NJ8A 2R7NA 3AJDA 1C9YA 1MF7A 4OAQA 3VV2A 4OLBA 5EJ7A 3N8GA 1IM5A 1SVLA 2WTNA 1WXDA 2BKAA 1CCWA 2QHXA 2XDAA 3HVHA 3Q12A 2W2OA 1B6RA 3A6ZA 3URMA 2DFKB 1ZVVA 3M6XA 1PNQA 5HEKA 1WMFA 3A7EA 4FYJA 1ADJA 3HG7A 3D5EA 2PVPA 2B94A 4R41A 4IL5A 4E1BA 2XD4A 2P9JA 1K5HA 3FMOB 3W8NA 2H1CA 3GEEA 4LNUA 2WUGA 3JD1A 3VX4A 5CEJA 4YQFA 3DV9A 1TXGA 3DE3X 2OQ2A 1T2UA 5L3ZA 3UAZA 4MKFA 2EF1A 1JPUA 1XKQA 3I2HA 4FLMA 4D4LA 4PPGA 1E1YA 3BTVA 4KXMA 1D04A 2A4KA 3WGQA 4D9JA 2HY7A 2X0NA 3D3KA 1DBSA 4PRLA 5G2OA 4EECA 4G67A 1HWYA 2HT1A 3VZRA 1E1CA 2AOXA 4QA9A 2FA9A 4Q66C 1GA1A 1S8OA 1E2BA 3RVLA 4LEIA 5BY2A 3NXKA 3ZKAA 5HM8A 3GOQA 3GXOA 3L8HA 4HWOA 4HMOA 3UTCA 3S81A 4PO8A 2RH8A 1NN0A 1Z5OA 3DV0B 4ZHQF 1DT3A 1AKUA 1DJPA 5K0GA 4HMQA 4KWTA 1DKRA 5KQPA 4H15A 5LQNA 1QVVA 2Z8XA 2IXFA 3LYLA 2FY8A 1N2SA 4FFOA 3SHWA 4YASA 4WECA 4PLTA 3BT7A 5JH7B 2O8DA 4NONA 3O1JC 3DMRA 4H35A 3DO5A 5FUMA 4ZK2A 3T35A 4EG1A 4N7JA 4ZVVA 4GE0A 1O97C 3PFBA 1CUCA 3ZW7A 4LOLA 1ANKA 1DC7A 4PZEA 5E6SA 2B92A 4F91B 5A1JA 2N1MA 2W2MA 2P2LA 4RFVA 5BN4A 5IUJC 3GLGA 2JJ1D 5CX1A 2GO7A 3QTTA 2Y93A 3JYHA 5FOUA 1GSIA 4KIUA 1NFQA 3INRA 1N3BA 3IPYA 1KKUA 1U8UA 4GQBA 4KX5A 1P62B 5CNMA 4B73A 1KARA 2ZSHA 4E2YA 1BRTA 3QUTA 5A0TA 1KEZA 3UFXA 4RE5A 3I9MA 2X23A 1ZKDA 2BW0A 5AP9A 4K0RA 4W8GA 4DMRA 1K6JA 1L4NA 1YZVA 3IUPA 1ECJA 2ORED 3K0FA 4DV3B 1QFJA 2YVAA 4G97A 1YJBA 1CE8B 3EMBA 1PJ2A 1V1MA 1K6IA 1HL3A 2IW3A 3M70A 5U1PA 4B9AA 2O50A 1EVIA 1M6WA 5L3RA 5A2GA 4LSMA 1XCGB 2A9RA 1BWPA 2IEYA 4WXMA 3AHDA 2GM5A 3JQQA 2C5FA 2G76A 3QVJA 4Q9LA 3GJQA 3HR8A 4PU0A 3RIXA 1NUSA 4H7KA 1OV6A 3OQOA 1NRIA 1VQ1A 4AJJA 5DBFA 1P77A 3VR2A 1UZAA 2Q5OA 3CUVA 1IHUA 1IIRA 2XV1A 3ISJA 3CUYA 1UP6A 3IMKA 4NFLA 1W35A 2LIPA 1M2VA 2PSEA 1JRLA 2XZDA 3K9CA 3PFHA 4C7OB 1XRSB 2ZJZA 5HIMA 5KTOA 4UXIA 3S1AB 1GPDG 3NATA 2OBXA 3KVNA 1P4AA 2QTCA 4YJ3A 2P5SA 4G36A 4Q01A 1ELOA 1DZIA 5AIBA 2I4MA 3KZKA 4I3FA 1I1QB 3PR1A 4QECA 5A7HA 1OXMA 3H2ZA 2VDRB 3L4BC 1W0JA 3HKEA 4B7ZA 1FTWA 3FCEA 1U0GA 2EIXA 3TXXA 4MV7A 1Q1AA 3EEOA 1E8NA 5A4AA 1GZ4A 4Z3KA 1WCXA 2O2SA 1L5KA 1R4NB 3AGPA 4ZPXA 4E5YA 1CETA 5JBNA 3U19A 2PQMA 4IYRA 2E4UA 2GQ0A 3FBGA 1Y33E 3C3EA 5EINA 2NZXA 4U2CA 2ZSBA 2VJDA 4ZI3A 2B1JA 1V1RB 5IHXA 2CFOA 4RKQA 4ZA2A 5FF9A 4KH0A 3I9JA 3ZDEA 3BGVA 1OC2A 2V4ZA 1ORRA 4IPTA 1XVLA 1IIBA 3FTNA 2PX5A 2RGWA 3AIKA 2V7QA 3WQBA 2QRNA 4EVQA 5D6NA 3RYFB 3UQZA 4FCWA 2H8KA 3CLTC 5A9SA 2X2FA 3A6DA 1NN3A 1R6DA 1NUUA 5EP2A 3ZXSA 3L8GA 1FX0A 1DX6A 4DCTA 5FWYA 1PJ3A 3A4NA 3UK0A 2BFCB 4WCFB 4YJHA 4IILA 2YJGA 4Q1AA 2I65A 3FOEC 4ANFA 4XLLA 1JJIA 2IT1A 2Q29A 3DEZA 4J4HA 4I1PA 1TAHA 2JRCA 5LQMA 5ICCA 3ANTA 2BUCA 4KQFA 2ZVPX 3P8ZA 1WJGA 3BBPA 4U63A 4YACA 3MMSA 3VV3A 5J3JA 2WILA 3R75A 1BQ3A 2F3PA 2FQYA 2YNMC 3W6ZA 3CCFA 1JTVA 2EBHX 5FNVB 4IJKA 5CDFE 1XRRA 3UT0A 1X1CA 5DBHX 1EWTA 1T4CA 4GL2A 3HWRA 3B85A 4W7SA 4Y1GA 5THKA 1LBSA 2I29A 4KEAA 2LNDA 2WWIA 4KXYA 3ZVRA 3ITEA 1A9RA 3LP8A 4KE9A 1YR8A 1KVSA 2M98A 2ZU6A 5C8YA 4HUTA 2WOOA 3ZGOA 3KJHA 4AAYA 5I3CA 3GUYA 3MTJA 2RJOA 1EX7A 4FOOA 3O73A 4FHZA 5AVQA 3HI4A 1GO2A 4RACA 3WMEA 3P27A 1Q7CA 1R3UA 4QU5A 4RSHA 3ZI7A 1QORA 2QF7A 3ABOB 4F9FA 5LOVB 2WVJA 4QG3A 3DFIA 1XDWA 1JVSA 3HJTA 3IIJA 2ET6A 4ZAYA 3RC1A 5EIHA 1PW5A 5AXDA 2PGIA 4BVAA 1SQGA 3PD0A 4K5QA 4CIWA 4R7TA 1EP9A 4Q37A 4K2HA 5HF8A 1EGVB 1VHTA 1CZLA 1CUVA 1DWPA 3NHAA 1GPAA 3DP9A 1IOLA 4NF2A 4FBGA 2B8TA 2QA5A 1B6GA 1H0HA 3Q4GA 5E9WA 1IAQA 1EUDB 1W9HA 4WUTA 5JS7A 3AO0B 3IEIA 4CKBB 1JMYA 3FF1A 4IO1A 3O1IC 1P61B 1Q77A 1WRBA 4QXMA 2Y1XA 3TEMA 5K8UA 2F9MA 4C5BA 4F3YA 4KPYA 2H4ZA 2DPXA 4TS1A 2OG1A 4XM0A 2NYVA 1EIZA 1IK4A 2GA9A 3AOEC 4JP8A 4TRJA 4B2IA 1ZMBA 4X65B 2XCRB 5AXCA 1MW9X 4C4ZA 2ZIVB 1E2DA 1OXKB 2BVNA 3N39C 4TYMA 3SICE 4CDGA 2L18A 4QDKA 4CCWA 4NZNA 5IUKC 3VH1A 3FVRA 1X7ZA 2ARKA 2G4VA 2LCIA 2QY6A 3KAPA 3ZPXA 4C3UA 1SIOA 2XMSA 3MYYA 4EI9A 1PDWA 3JCZA 4GI1A 4IZOA 1XRMA 3E81A 4KAJA 3V4RA 4B3JA 4N76A 2MSNA 2OFWA 4YI5A 3PNQA 3ZHBA 1NY6A 3GLVA 2WU8A 5KEIA 3FPHA 2ZZKA 2PMWB 3SKXA 4ZU1X 4RTJA 3THXB 1DDGA 1FMFA 3W4JA 3EQ6A 1MAHA 3FNIA 1W93A 3HSYA 4JYZA 1YHZA 2VUUA 3WDLA 2GD1O 3AFOA 4HCJA 1VGQA 4GXNA 2FK8A 3CNBA 5FBLB 3O8CA 1X1AA 5B3JC 3ZE8A 1AKMA 3RTEA 4GKKB 1TJYA 3WGZA 5BYKA 1OGJA 2A0WA 1PR5A 2OAQ1 4QZVA 3QBDA 2JGIA 1OWMA 4N47A 1XT6A 1NRJB 1FFWA 1ADBA 1PFYA 3H9BA 3U4DA 4BKOA 4U7DA 4W9MC 3WSWA 3E53A 3IBYA 1GPMA 1UC4B 4GW3A 2I34A 1PJ4A 2DU8A 4PXAA 1YBHA 3DM9B 3R7WA 3H18A 4EG5A 4ZMSA 5IAGA 5FNVF 4D0NA 4B45A 4FE4A 3C97A 2WQ6A 5KTSA 3ITKA 5D2CA 1YRYE 4RMJA 3LOUA 5JHHB 3EGWA 4OJMX 1U1IA 4JSTA 1SXGA 3VO9A 4XAQA 1QF6A 3GIDA 5KJEA 2XMRA 3AQ4A 2ZUTA 1IVYA 4FKBA 3I23A 3GGGA 3NB0A 3QMMA 3UJ6A 4A0SA 1TCCA 3VNQA 3RFCA 2VJPA 3LHKA 1PFGA 1Q14A 4MA5A 1VYVA 4X41A 2Z2XA 3D3EA 5SY4A 3D7MA 1C4WA 1X14A 1T5IA 1V5EA 3NOXA 2C3YA 4OOEA 1H1TA 1H6DA 4QOJA 2DWUA 4KOEC 1GXSB 1C2TA 2H06A 3QTLA 4QXPA 5F12A 5HG0A 3V2UA 2AJBA 4MYCA 5I7WA 3RK0A 3OTQA 4QAQA 4KQ1A 4RMGA 4M8LA 4PZYA 2AJTA 3QNUA 3IQGX 2G5CA 4FXPA 1O58A 4AZVA 5KOIA 1Z0ZA 4URXR 1RQLA 3COVA 4J0JA 4ZTBA 5JS2A 2P6OA 4HLUA 2WAXA 3EWSA 4G9BA 5NLLA 4EF5A 3ZLJA 1IUKA 3CLSC 4RUKA 1SVSA 3GEBA 1A72A 4XH9B 2Q6VA 3G17A 3NGMA 1YKSA 4GRAA 1XU4A 3Q87B 4GM4A 2P4SA 2G8LA 3PZRA 3EZ9A 3AWDA 3MGAA 1W36C 1D4ZA 3U62A 2PS9A 1OUMA 3F9CA 3G1UA 5BV7A 1BEUB 2NTNA 1UFOA 2AEJA 4Y3UA 3THWA 4R8RA 1KPHA 4OP1A 1XJ0A 1JMVA 1NUQA 1XCMA 3IB3A 4NL4H 1HORA 4B32A 1BXGA 3E9CA 1Z7BA 1ZJ4A 3R20A 3B51X 3T7JA 2R96A 2Y1EA 4AKSA 3RASA 3IXLA 1JLSA 2P5YA 3CV3A 3LBFA 3OCXA 4WOKA 1CZKA 2FUEA 1IZ7A 1G6HA 2FNAA 3ODGA 4BFLA 5KYWB 4XEUA 2B0CA 3EE6A 3HUEA 1NX6A 4NLLA 5AOVA 4IIJA 3MN1A 1BIFA 1FFEA 2C7BA 2O4CA 3LUBA 2HC9A 1W0KA 1KNQA 4WRRA 5BN4B 1IQ0A 3A8TA 3OCCA 4JC0A 4JKIA 3UQYS 2A3NA 3QKSB 4RZ2A 3WE7A 3FCCA 5G4KB 2Q4EA 1ZVJA 4A82A 1G8SA 3PUKA 4YFYA 4B6FA 1F9EA 5E9QA 5K0JA 1IPFA 3I61A 1QQ6A 2GPYA 1ULBA 1U2SA 3KQSA 2ZJ4A 3USCS 3W2GA 4WSOA 1TYDE 4OMCA 5BVGA 5C4IA 1EJ0A 2GZ2A 4U9IS 4FWTA 2DBQA 3EXHB 2XYGA 4W99A 4KLAA 4Z4CA 3AF4A 3KOUA 4HSEA 1KFCB 3PT9A 1IN7A 4N54A 5IXSA 3QPBA 3V1LA 2EAUA 4NCNA 4WLFA 3D8HA 1TQDA 5CR9A 2BMEA 5CCEA 1I7NA 1UQTA 4M1MA 5FI3A 5ILQA 2D6FA 4NE2A 4EKIA 1I1NA 2O7QA 4XCVA 2GDJA 1SUIA 3STHA 2FH5B 1GFWA 3PC7A 3VJRA 2JI6A 5C81A 2EQBA 2NPFA 2SKEA 3Q7SA 3WBFA 4B6SA 3W04A 2JCVA 4DAOA 1N5OX 4FFSA 4CKWB 2YH2A 3NEYA 4NJMA 3UXMA 3VHXB 2QAGA 5HPYB 2IDJA 5AHOA 1AMOA 4I6GA 2A0FA 3UV6A 3GWGA 5CFPA 1KKLA 4OQYA 2CK3D 3P96A 3ROGA 3BUSA 4OHXA 3ONVA 4D5EA 1HT2E 13PKA 4INAA 1DJOA 1IBCA 4E51A 1YZNA 3IURA 3MCAA 3R4VA 4LY6A 1EWKA 3MM4A 4QFDA 1GQ2A 2O2ZA 3GZ4A 4U0KA 4DKXA 3HQ4O 2KM1A 1CULC 1FLDA 4FU0A 4AURA 2FW9A 1DWUA 2ABWA 2ID8A 2RHGB 5EIFA 4EJ6A 4C7OA 4LHEA 2I2XB 1MG0A 1K8QA 3QFCA 4AY4A 1NJ2A 2O1EA 4UW9A 4JLSA 4F4CA 4C4OA 4D97A 1LLFA 2VDWB 4C04A 1KAQA 3IDZA 4UAUA 4N39A 1KDVA 1L7XA 1ZU5A 2FMTA 2I6XA 2CK3A 2P0YA 3P5SA 1Z6GA 3LP5A 5C53B 2XKKA 1KEEA 3A9SA 1O94C 2NZUG 4I5GA 4ZAFA 1E89A 5KVQA 3WL3A 5KZMB 3QEKA 1TTTA 4NXNB 3SQDA 1J8MF 4I4TA 1P0MA 1EM8A 2PLAA 3IT2A 3R0ZA 4QLOA 5FIUA 1EFRD 3C5VA 3ZY4A 4CEIA 2B78A 4YT2A 3WLPA 1W8DA 3MIIA 1Y48E 1J7KA 2JH9A 3DQPA 2QDXA 2QZSA 4J4TA 4X54A 1YVDA 5AW8A 1XWFA 2H2WA 2WMNB 5IH7A 1YR3A 2DHEA 3OQ6A 5T4HA 1TGVA 2E4ZA 1TEZA 5B4TA 1PN3A 3TLGB 2O19A 2C9OA 1XYVA 2IELA 4OLFA 1J00A 1Q0ZA 3WLHA 2DWPA 2QAJA 3B6IA 2G36A 3PU6A 4R1PA 1O9GA 3SEAA 4C22A 3TG8A 3MJRA 2QJFA 2ZUDA 2QD2A 1AUPA 3GJZA 4UNRA 4D9EA 1UR5A 1LLDA 4MB6A 1N6KA 3T1OA 2I1VB 2YVKA 2P3SA 3LUCA 3V2IA 4LA4A 4Q48A 3CIFA 4Q82A 1XRJA 3ESYA 1UMCA 4RXTA 3PE6A 4BNHA 3Q7IA 2KBEA 2P78A 3SU8A 3SZ3A 4IIHA 1JEJA 4MWBA 3DKPA 5IBQA 4MKRA 1QHHB 1CDDA 1LJUA 1RADA 4TXLA 4Z6KA 1HYEA 5CBKA 1PUJA 5GV7A 5DYYA 2ZREA 2P69A 1RWMA 1DXOA 5C8DA 3U9LA 1LY1A 1L8XA 3K0AB 1HZJA 3B7PA 1QYCA 2A9QA 2ZFUA 1BQEA 1XF9A 2EHDA 1KDPA 4F6RB 1FTNA 4KYVA 4N5HX 3OUUA 2G1AA 2AH5A 3IPAA 2BUBA 4ZOLB 2OSVA 4MV1A 2BD0A 4X8LA 2R1VB 2RIRA 2ZZMA 2WYVA 4LE0A 3D0KA 4IIVA 5EPUA 2AFHA 3W5AA 2RGEA 5JAUA 4CL8A 4KGDA 4B33A 3FX2A 2W98A 1J1IA 3QKRB 4KI7A 1UPCA 2PWZA 4RNDB 1DKLA 4EUFA 3GJXC 3OLQA 1T8RA 3IAAA 2EX4A 1OC4A 1WW8A 2UV8A 1CJMA 3IOEA 3JQ8A 2C2MA 4NG5A 4UCQA 3VHLB 5J1SB 2V0GA 4M0UA 5KDDA 3WYFA 3OPYB 1Y9DA 1G2IA 3PNMA 2ZRQA 3UJPA 1DX9A 3DWGA 3MILA 3CUTA 2E85A 4S0XA 2FLWA 1MO3A 3DUFA 4YEDA 1IWPB 4LXXA 4B3TB 1TECE 1UJ2A 1YZQA 1IEQA 1Z5GA 3R2JA 3KX2A 1ZQ9A 4RIHA 1J5PA 5G4LA 3EEQA 3OOWA 3Q6NA 3R5FA 2DGDA 4IUCS 3TSZA 2XMBA 1X2EA 5FAKA 4NMWA 2MYNA 1ENYA 1RM3A 1QHFA 4L5YA 4ZO6A 4DLYA 1RWQA 2VHYA 3F96A 2JGRA 1OT3A 2ATCA 2JD0A 3T8YA 3R0VA 3VR5D 2L2QA 4D1YA 3E0QA 3HP7A 2PYIA 2PCJA 1KO8A 1U8TA 1Y89A 5GVSA 2Q1SA 3NYWA 4ZOEA 2GXUA 4NAHA 2DXIA 4WKGA 2WB4A 4FW9A 1GUBA 2O05A 3VR4A 1R6XA 1NRWA 3DHWC 4BVEA 4CLOB 2QSYA 4V1CA 5JXWA 1AMNA 3BFXA 5DM70 1XCOA 1SVUA 1SXJD 4HZIA 1PHRA 1MJFA 5J1TB 1ZSNA 2IKSA 4Q7JB 3D6FA 4DTCA 3NTRA 2Q5IA 2ZWMA 5GONB 2QD4A 2QY9A 3KYDA 3LO5A 4L4UA 2WG1A 2XYPA 3O74A 4RLSA 4AQDA 3IYLW 3WL5A 1FFSA 1SC3A 3VGPA 1YL7A 4YMLA 5DHPA 4ZYLA 4CBVA 4WDRA 3UHPA 1J97A 5JXJA 1WM1A 3B13B 4XVCA 1I2AA 3AUAA 3HGTA 1E6EA 2D62A 1LNQA 1P9WA 5H68A 3WLNA 1AGYA 3H11B 2H1SA 4K46A 3K4QA 1ZIYA 4LOAA 4BZQA 1ZEMA 1SHTX 3S2YA 1Y37A 2PX4A 2VAMA 4AYWA 3H84A 3W9SA 4FZVA 4KE6A 3FWHA 1IWOA 1WXHA 1TD1A 2AEMA 1O77A 4Q4HA 1X7HA 2NUTB 3M4XA 1ZESA 1C80A 1STOA 1W4LA 5E4TA 4MROA 4ZRNA 1SUAA 2QTLA 3WGHA 3BTOA 2ATVA 3RJMA 1NJGA 1NN1A 5FLKA 4FBLA 4XQGA 2NNLD 3KOZA 5GZ6A 5IZCA 4BZWA 2A2ZA 1KFKB 1WOMA 3DLTA 1II0A 4JUAA 3NP7A 4RD2A 1GGFA 3MJ4A 3D8BA 1G7TA 4M46A 4U6NA 2VSXA 5TQ2A 4WX2B 4A8PA 5CVUA 4ZGGA 5LZ9A 1P1FA 2YNMA 1OX5A 1Y1LA 1QZ3A 1DE0A 4MI1A 1B4DA 4OXKA 1V8ZA 5DM0A 3WYNA 4B6RA 5TR9A 1UDXA 3O8DA 2NSHA 3JAWB 3ONEA 4R3UC 2EXXA 4S1VA 2BM9A 1NLYA 3DE6X 1C29B 3DZCA 3P19A 5DM4A 4ZD6A 3BXXA 5DDIP 5FLEX 4RJIA 3W0LB 1OYVA 2F00A 3EGCA 5G3YA 5KHOC 4DRZA 1ZFNA 4QXRA 4E15A 4RFLA 2A35A 3AVXA 2IZOA 5EE1A 1O9HA 5AUNB 3H05A 2WWWA 1EDEA 2PPVA 3RLFA 1QTNA 3A1EA 1RI1A 2V7VA 3T99A 3E58A 1MABA 7AT1A 3O8OA 2GDZA 1A27A 4BO7A 1SVMA 4HDSB 2PZFA 4NBKA 5ESXA 4LOJA 1PNOA 2G5TA 3A3OA 5JS8A 1WQ1R 3H4MA 1M5TA 4QJ5A 1VJ1A 3UB4A 3GPLA 1X9GA 2UZ1A 4BFSA 1IPEA 1H2YA 1OWNA 3HVJA 4HEJA 5DK6A 2BLNA 2HNBA 3TGPA 3FWYA 4RSMA 2C98A 1KETA 4JWTA 2PL3A 3BXFA 4MR9B 1T3SA 4ATNA 3C8DA 1HE8B 2A0KA 4NATA 4EKGA 3HA3A 2OCLA 5LLSA 2ZK7A 2NVWA 4IIJB 4DMGA 4A2WA 3QSGA 1U1DA 2CHUA 4MPRA 3RC2A 4AICA 3GT3A 4CM5A 5B5SA 1N8KA 4BTVA 1B16A 2BMFA 4AJEA 3Q85A 1UPBA 1BWQA 3MGKA 4DE5A 3C24A 3HDQA 3A0RB 2IHTA 4IW3B 2IZ6A 3EW9A 4WZBB 3SX0A 4C6SA 3RABA 1YL6A 2QL5A 4JLPA 4OYHA 5AVOA 4CT4B 3PI7A 4DSOA 4KL8S 4PLFA 2VA8A 2AEFA 4AP9A 4EPTA 1E7WA 3OZTA 3MJCA 5AKLA 3SXPA 3TFQA 3C6XA 3KKQA 4KO4S 4K6MA 3OOYA 1P60A 4G2TA 2I7XA 4DA6A 1OE0A 2OC9A 4HBZA 3FB4A 5JCOC 1SXQA 1L3IA 4WZAB 4NE7A 4O4IB 1FFAA 1UWCA 1Y34E 2C7QA 4MW5A 2O57A 3L0CA 3GGJA 1DBQA 2VNIA 3CLSD 1BDBA 3VU1A 4EFKA 4P5EA 1MN6A 5HIKA 2NV6A 2C5BA 2QW0X 1KY3A 3U7FB 4QQRA 3DE5X 1DTWB 4G85A 1E5LA 3BJEA 1GPUA 5H02A 1OAOA 3GRPA 5DN6A 3U81A 4XARA 1AURA 2GSDA 1QZTA 1IHXA 4GZ6A 2K7ZA 1KFBB 2X8BA 3AI2A 1Q1EA 1BJRE 1ODKA 2IOHA 4RK1A 3H5IA 1T9BA 4IJWA 3CR8A 1GQYA 1BHQ1 3RC3A 1R37A 3SQLA 5A0VA 3IJPA 2R3SA 1RPTA 1S8FA 1Z2PX 2VSOA 4N3NA 5CLFA 3H2JA 3R23A 3E35A 4R31A 2EOAA 3OJCA 5BO5A 2XITA 4DV4B 1RYHA 3NVMB 3DBLA 4XA8A 3U4GA 4EFNA 2F55A 2G72A 2MSWA 4X9XA 3CT4A 4OBBA 3V8PA 3VVLA 1UOQA 2NW6A 2KBFA 1QFZA 1YS4A 4XUDA 4P80A 3U56A 2RSLA 5JSZB 5FQOA 2JATA 5TMDA 1QHYA 1S2OA 4BJ6A 4CUJA 1T9GS 1IFXA 3A1FA 2XE8A 2VDWA 1NYTA 2IDZA 2RBEA 3BMOA 3O90A 2COKA 4YAJA 3UMJA 3ZNPA 4F3KA 1JUDA 2O5CA 1CR6A 1EK2A 5L95A 1XZQA 2H7YA 3JWPA 2LUOA 1LSSA 1EZ4A 3NKLA 3QKIA 4M0PA 2O2XA 1XCPA 2AZDA 3BL8A 2SECE 1O94A 2IU4A 2PGNA 2O2DA 1PLJA 3KE9A 1JG4A 3OA0A 4K28A 3CINA 5JC8A 1QIEA 4DPKA 1BMQA 1JU3A 2NXJA 4F5WA 2R25B 1CIVA 1UZNA 1ORVA 2XCUA 2HHLA 3QEOA 1J5EB 3MS7A 1JG2A 4PZAA 4GZ3A 4EYGA 4C07A 1D2HA 1MB0A 3BFKA 1Y4AE 3K0HA 4TLBA 3T4UA 1DC3A 1ESCA 1JKJB 1N1EA 3JRWA 4MI6A 4OJYA 4S0ZA 4WY5A 1SB8A 3DOHA 3WYAA 3B5EA 3DP7A 3O75A 2WTEA 4ZYXA 1G5QA 3LX4A 2BFPA 2VHZA 4UM9D 2YYZA 5CFRA 2UVPB 4OLHA 3LUKA 4MS4B 3MCWA 2LCQA 4DLVA 4MVJH 4N82A 3KD2A 3GAZA 1PQ4A 1GZHB 1RXCA 2TS1A 1IUNA 1XRQA 3FAKA 3I9V1 4KQEA 4XJVA 4AF8A 2P8JA 4QTUB 3QI2A 1QHEA 3IP9A 3MW8A 4O4LA 1RE1A 1XK7A 3MWYW 3ROPA 3ZWMA 3PX7A 2OGWA 4UBOA 5IVHA 1RMQA 3RRBA 4PNHA 2BCEA 4LWQA 4UDXX 3UC9A 3WO0A 2IH5A 1Y8RA 1FDWA 2V97A 3A6PC 3G8AA 3RUDA 4KQ2A 5JQGB 1N5LA 4PC1A 4DR5B 5LB2A 4AJ9A 1HE5A 1SJ9A 1S7CA 4UMFA 4J7AA 5EJMA 1TNDA 4HDNA 4B8WA 5FOTA 3ELDA 4K86A 2EW8A 2WU1A 4KDCA 3G2KA 1L4EA 1XGKA 3OX2A 4CKYA 3PEWA 3PVCA 1KYTA 4ZU6X 4FOPA 1IHOA 2GI4A 1Q3KA 1UXGA 4JQCA 4ZEWA 2Q3BA 5K0FA 1MRSA 2LKCA 5KWJA 2JAUA 4ND6A 1H3EA 2RGUA 4OMFG 2Z3WA 1DBWA 2F1OA 1ML3A 3CUWA 4LE1A 2QV0A 4DC0A 4K9DA 1HDYA 2W6JD 1NQ5A 1WU8A 5IK2A 1A71A 3ZLTA 2YRFA 4DMMA 3IH5A 1NNSA 4LRUA 5BW5A 3KKLA 1CUHA 3E9QA 3H0CA 4PICA 5H4HA 2FPWA 2YHSA 1RS0A 4RJTA 3SVTA 3U3MA 3HDVA 1XEWY 3NBQA 1QU2A 3TJRA 1A9XB 3HK2A 2DBVO 1P80A 1E58A 1IHDA 2PRYA 2W6MA 3B7WA 4G86A 1G8GA 3NM6B 3Q3JB 3I5AA 2K4MA 4OXXA 4PV7A 1QOPB 4GM1A 3LVRE 1R0YA 3MTGA 1T43A 1VFPA 2HMUA 5KOJA 4G3XA 4NP6A 2FVXA 4CM9D 3WJ7A 5DGTA 1IRIA 4ZVSA 4PZCA 4B3GA 3AEQB 3MWJA 1G6Q1 3RJ5A 2JVJA 4II7A 1JW9B 3N6RA 4MSUA 4LMBA 1R5OA 5AVXA 3KLNA 2O8FA 3OPXA 221PA 1VBFA 2ZVJA 3L49A 3HR4A 4NJEA 5F77A 4F2GA 1KQFA 1E3MA 3ZE9A 1ACLA 2AQKA 4J0HA 4GC5A 4B44A 2VPPA 4M1KA 2WFMA 3ZJYA 2LRHA 1S2IA 1OPXA 4IXMA 4YV7A 1NYRA 1CDOA 1LZLA 4XQ9A 2C2XA 3QELA 5EE3A 5JATA 4U4AA 1N2IA 4TQGA 1YOBA 3HO8A 3DZIA 3MUNA 3RS0A 1J23A 1BEEA 1C9MA 1ZK3A 2ZJ3A 1AN9A 3O95A 4ND3A 2HSJA 3GUZA 5D5QA 5IABA 4BY9E 1A97A 4H3VA 1AZLA 4MARA 1T2EA 2TMYA 4UVHA 3VKUA 2G9UA 3OP4A 1OLUA 1K7XB 3CRVA 4WLUA 1ULHA 3B2QA 2W2NA 2G0AA 5KI6A 4CM8A 4U0JA 1THZA 1EQAA 4ZHQA 1RXUA 2XDQA 1UL1X 4BLQA 1U7TA 1XLWA 2JB9A 1SU6A 3H87A 4H31A 3ZGVA 4X97A 4B3CA 1DUSA 1WNFA 3CEMA 4LRXA 3THOA 4DMLA 4QU8A 3GYBA 4A6XA 1HPLA 4IHJB 4DNFA 1PDOA 3Q15C 5AESA 1SUWA 1KH3A 2OC4A 3GLHB 3MJDA 4ARVA 3FJOA 3HVKA 5KWVA 5EUCA 3ZWVA 2MR5A 4C4SA 2ZAMA 5KDOA 3C6BA 1VI6A 1WCIB 5ARBA 5AUPB 3EUEA 4L2IB 2B5VA 4QYIA 4DCCA 1PR3A 2IS4A 4MQBA 5KQSA 4Q4AB 1MG5A 2NYUA 3BFJA 1NHWA 1NM5C 4PHHA 4YB8A 1CRZA 1V11A 2OSBA 2PH3A 1L7VC 2HIAA 1R0CA 1AK1A 1SVOA 2C4VA 3DVQX 3GLIB 5DM60 3ZG6A 1Z0AA 1U5CA 4KVZA 3HKDB 3GPDG 1PWHA 1XDUA 4XFDA 2VF7A 3JQFA 4HQ0A 1EX1A 3UMGA 5K3BA 1SNYA 2DCMA 1MFPA 3L92A 7MDHA 1PGPA 3I2IA 4Y2RA 1ZK2A 2UAGA 1F51E 2ZYSA 3PKZA 1QRSA 1UT6A 2GKOA 4HWPA 5T4FA 4BP8A 1KWKA 1GKYA 4LC0A 1EFPB 1UC8A 4GWKA 4L0CA 3W5VA 5BSFA 3V3TA 1SOAA 3ACDA 2WHXA 3E5RA 5AO9A 5EEHA 1SUBA 1H6AA 5LUBA 3DKRA 4J03A 5FJJA 3RODA 1I30A 3L4KA 2XQVA 1FSSA 1T2DA 1UM8A 4MQ4A 1BE0A 1T9GR 2J0UB 4MX8A 1XQVA 3DJFA 5D85A 3F7MA 2HHCA 3N05A 3OJEA 4Q5IA 1KY2A 2OZLA 4B6EA 2QMZA 1AB6A 1HM5A 3ZUPA 1AQ6A 2IC5A 4H59A 3HKCA 3IUQA 2OWDA 3R0IA 1UDBA 4GQAA 5AM5A 4NIMA 1J25A 4ZQBA 3ZD6A 4A10A 1EQ2A 1KMCA 2EBFX 3BIJA 3K1JA 3ZJVA 2VEOA 1KVRA 4KR7A 1C3JA 3Q88A 3M33A 5JPDA 3SZUA 2HFKA 4EHBA 3BQ9A 1Z4IA 2W93A 1K68A 1DJQA 4RTMA 1ID1A 2POQX 1HDCA 2FWMX 2Z4SA 3I04M 3QF4A 5ENZA 5F78A 121PA 3MJSA 5IWCA 2IH4A 2JI4A 3KTDA 4BLSA 2FPGB 3FTEA 1CUEA 4D25A 2Y2VA 3T3OA 3AF1A 3L4EA 2M6RA 3T1YB 5EKSA 5LD2C 2GEVA 2VNSA 3ZTTA 4EIWA 3HBNA 2EFCB 3L7BA 4HDKA 1TT7A 3CZAA 3MJFA 2Q2WA 3HCAA 1CF9A 5C5CA 2H29A 1P1RA 1E7QA 1U31A 2OHGA 2ZQYA 1DCTA 3EGDB 3Q3CA 4GYWA 1GN9A 3EJWA 1I0ZA 1UDRA 3UV7A 4YUAA 4CLXA 1P0IA 4EA9A 3CZ9A 4OREX 4YRJA 4XWYA 1N8NA 4O4LF 4EUNA 4YP9A 3DDHA 1E2MA 3JD2A 3SFVA 4PSDA 2XIJA 3FRHA 5B3AA 3HCRA 5J2TF 3EIOA 3ZVKA 1R16A 3OSUA 1UBNA 2GFHA 4YBZA 2AF3C 1MPXA 1XXHE 4CN8A 4UTPA 1HMYA 3P2JA 5DCLA 5B6PA 4CR8A 2FW0A 4BJHB 4BX8A 2IBMA 3VDRA 3C5HA 3MB5A 4XD7D 3C74A 2NO6A 4QX6A 1SKUA 1Q12A 1KSHA 2AFIB 4GX2A 2AZTA 1M2OB 3EQ9A 3DBLB 4NHOA 3W05A 2VK8A 5F21A 1UBGA 3LDHA 4EJSA 2V59A 4LTMA 2XMGA 2LW7A 2RGGA 4G5YA 4G9GA 1RCFA 3OKCA 3B9QA 4HNAB 3A1VA 3AP2A 3Q3GE 3QNWA 4I9HA 4AY3A 2FN3A 1NQUA 1OBCA 4YMIA 4WKPA 1JEYB 1CG6A 4LXTA 4MVXA 1XTIA 5E4FA 4IMIB 2XTMA 2OYCA 1JFTA 2BKUA 4JX8A 3K70C 2LPMA 1E59A 2HJ9A 2WFZA 2HCTA 4EJFA 4XPIB 1YGYA 2A7XA 4Z8XA 5DJ5A 1XPOA 3ABZA 4LWZA 3DCJA 4RPHA 3FNEA 1F2UA 3L79A 5LIPA 1VLHA 2AJCA 4YRNA 1JBEA 4L1KA 1HTWA 4HQOA 1GPH1 4COOA 3BZUA 1CJKC 4F45A 5H16A 3CVWA 4JLJA 4K0KB 3PC4A 5CDUA 1E2NA 2OP0A 3CC8A 1RRFA 1GADO 2QTFA 4RHUA 3MCVA 1IWBB 4FE7A 4YQYA 5TX7A 3ZXYA 1UKZA 3FH0A 5ANRB 1J0AA 5K3AA 3NBFA 3C8MA 4OMDA 2OQVA 3ZKWB 2OVFA 4CL3A 3FNHA 2RB5A 2ZPUA 4WH0A 3GF4A 3PQEA 1F4PA 2H2AA 1JXQA 3QLVC 4CYMA 4A2PA 1OBFO 1S0UA 2WWYA 3K4PA 1UMKA 2Q3JA 3OT5A 5KHLB 3JAKA 2G7MC 2YFQA 2C84A 4P3KA 2H5LA 4CG2A 1KAGA 4MW1A 4IUBS 1GFZA 2DWQA 4PIPA 5EMHA 1O57A 2BDTA 2GLUA 2O7VA 3DPIA 1P8AA 1GL6A 2Q4RA 3FMPB 3GCZA 2FUG6 3JTEA 4JUDX 3VC1A 5K0NA 5DVZA 4AJ4A 2IEAA 4RVNA 4BV8A 4PONA 3RVSA 1YCFA 1JA1A 4WXPA 4X61A 2NV0A 1QYDA 2WP8J 2PSSA 3LCJA 3FROA 1DWOA 1ENPA 3ZS9A 1YJXA 1U80A 3D8NA 4MP3A 3JQ7A 3FGPA 3VMMA 3WC4A 4CQMD 4ZN6A 4BE9A 2O59A 3HY6A 3CX3A 4DY4A 2AUNA 3A6LA 3EDQA 4LK3A 3TSCA 3GBVA 2INGX 1I3CA 3KKPA 1U99A 2O2EA 3DMFA 5KC9A 3HXOA 1KEPA 2HLDA 4BE4A 1U3UA 1P2FA 4QARA 5BSKA 4HDNB 4AJ1A 1V8FA 3H1AA 1E96A 3CCBA 3ILHA 3EVTA 1NBWB 1NWHA 3L1KA 5T6BA 4P86A 1HY3A 1ZGZA 4XPZA 2HREA 2YW9A 3RKUA 2FSHA 5FYDA 3D4OA 4J0KA 3WIOA 2AQIA 4LCBA 2WT9A 1SG6A 1R6AA 2DOKA 3DTVA 2F8TA 4Q3EA 3ROQA 4WT7A 1FU7A 2XWBF 2XKAA 2OXEA 3HBLA 3L5KA 5SY6A 5KNDA 2YMLA 1B6SA 5ICMA 5L4NA 4PGMA 4ZIRA 2GBLA 5DF1A 2ZAYA 1AN0A 2O8FB 1Q0RA 2NNWB 1I2BA 1PYOA 2HJHA 5G02A 1D2AA 1JKMA 1ZNQO 2FPPB 4CKZA 3UH0A 2HK9A 1A5ZA 1SBQA 2WG2A 3LGAA 5BT9A 1L0BA 4CCAA 4PBSA 3OQIA 1W4AA 1EUDA 4X6YA 2NPIA 4KIJA 1X7WB 1C3EA 1E3TA 4MVYA 1N2CB 3LL7A 3H2IA 2XUGA 1KR2A 3JQ9C 5COAA 4BWFB 5ABPA 3MJHA 2EG9A 4LIPD 4OGLA 1TO2E 2GJAA 3S5JA 1W4CA 5I8ZA 1G2OA 2ZJ8A 4YYZA 1OLUB 2Y4NA 1E7RA 4YVFA 1JFSA 1BJTA 2IITA 4IIYA 3OT1A 3QHQA 4RTKA 5A3VA 2FYTA 3FUXA 4MRRA 2G67A 2CBZA 4FX5A 1M33A 1P5FA 2GCGA 4LJLA 4JCCA 4I5FA 3S5UA 1WDTA 5BV2P 5L3QB 1IN1A 1WTAA 3KJNA 4YAKA 1O0SA 1ZINA 2QLMA 3EPRA 4C89A 2WYOA 1OI3A 2AQHA 4JJFA 4F93B 2O3JA 1XXLA 1A9QA 3HFGA 3OZVA 4YCDA 3TRFA 3E8MA 1QS0B 2OCPA 4S1PA 4UNQA 3VGJA 1ZL2A 3ZCTA 2Q0SA 5D1NA 1O95C 3H17A 2E82A 1M1NA 4N65A 1VC2A 2JEYA 2HDWA 2XX3A 2QUIA 4BEVA 4H7IA 4RFSA 1BXKA 1UT5A 1L7QA 1BVYF 4P58A 5EOVA 1RZ3A 4DCOA 4DCPA 3TGLA 3LKDA 2PKQO 4KRYA 1H2ZA 3EWNA 3LECA 3V80A 3H8JA 2CDCA 4TTTS 3R0JA 1WZCA 1XE3A 4LKOA 2A3RA 1LK7A 3DOCA 4PAWA 1FRVA 1OI4A 4B3FX 5BV1A 1J2EA 4MCJA 2HF7A 2EGUA 1TA9A 5SV2A 1FK8A 2E3JA 4YAWA 3D5TA 1BDMA 1R1DA 4RXUA 1C30B 3NH6A 5KTTA 2JLCA 3ZW8A 2HTFA 1XA4A 5F64A 2KLBA 2CMDA 5ALNA 1WCIA 3OF2A 4R2HA 3TBFA 4W7IA 3TLKA 3KSZO 2P9GA 4MPDA 1Y0BA 3RIEA 4FKMA 4K6FA 4BLWA 1NP6A 3GLHA 4DR3B 4Y9DA 1PG0A 4XGQA 1TVKA 1US8B 1U8XX 1IUPA 2DPMA 2RHTA 3LUAA 2FU5C 2ZRCA 4UE6A 4KDEA 5JR3A 1T3ZA 1IBMB 1IY2A 1Z0FA 2VNAA 4UVIA 1B0AA 1Z08A 4GLBA 2HA4A 1DG3A 4Q4AA 2J31A 4Z51A 1LBTA 2PGAA 2L69A 2ZE8A 4HVCA 3ZDFA 1LDMA 1N0HA 1FNBA 1GU0A 4IEIA 3HCOA 1RYBA 5B53A 1RC1A 2Q5HA 2YHUA 4MWOA 3ZBTA 3GFPA 1PGOA 4IQGA 2P7HA 1L7RA 4JOCA 1QANA 2V7TA 4MUNA 2VRCD 2QLFA 4DIEA 5CX4A 3BA1A 2I2AA 3JQEA 3SJZA 2HJSA 3V7YA 4NBTA 2RGNC 5ALEA 3BYZA 1FQKA 2AYXA 1R50A 2E49A 2MSKA 2PIAA 2O9JA 3L93A 3LRPA 1T6YA 4YIKA 5EPOA 3S2EA 2OZLB 1NNI1 1CRLA 1UINA 2REOA 2UZIR 1NYQA 2VF2A 2X8JA 4UDNA 1NVFA 3T41A 3T7CA 3ZHVA 3DFFA 1T9AA 2CUNA 4HDKB 4OMUA 2EKDA 1LLQA 2D5AA 4OQDA 5ALYA 4E08A 1VLLA 4AJKA 2XCQA 3K2IA 3KPJA 4X62B 3C8HA 4ZT6A 2JS7A 1KE2A 1Z06A 4DMUB 2FW8A 4UOEA 4ES6A 1QE5A 5JWHA 1OH6A 1EE1A 2Y9MB 1T4DA 3KJIA 4CFYA 2Q2NA 1UBJS 4OQLA 5EQTA 1IBSA 5MN4A 3I2FA 3K0EA 1H6BA 3LS2A 3O21A 4QTXA 1UC5B 1ZJ5A 2B21A 4UOZA 1NVDA 3ABIA 3OTGA 3EQ7A 2Z2ZA 3R40A 1QTQA 1S89A 3OQVA 2DWCA 2ZUSA 3AHIA 1I3OA 2H51A 2Q5FA 3V8QA 1G9SA 3NYQA 1OXVA 3DMNA 1BMFD 1Q15A 1YUMA 3D1VA 4XM2A 3EVFA 3JVUA 2QYSA 1H8ED 2BEWB 2FV8A 3DAYA 4G5RA 2R79A 4LAFA 3EW7A 3DWIA 5JSQA 4EHFA 1BHJA 3O1HB 4O63O 2RCYA 2W2XA 1SBCA 1E5DA 5J2TB 2J33A 3N2YA 2HI0A 2X4IA 3PWTA 2QNIA 4LC1A 1X1QA 1Y3BE 5FOWA 5AW9A 1Q91A 2ZIWB 4YRBA 4K6CA 4TMVA 1KSJA 3OPYI 4IH9A 4WBXC 5B2FA 9LDTA 4M0LA 4QNRA 1BN6A 3JVIA 1RVV1 3GLFE 3OCZA 4F4UA 2ZP1A 2CXUA 3Q9UA 1LJLA 1RWOA 3PG5A 3UHFA 1NJSA 3GLFA 4GSLA 3FZYA 2HMVA 2QR2A 3HXTA 3K09A 4G0QA 3HFJA 1ICEA 2RI0A 2JAWA 4LDRA 3E1KA 5DZSA 3WJ1A 1TRKA 2FPMA 1LU9A 1WP9A 4EDHA 1IJFA 3TKAA 3KKZA 2HGSA 3ILYA 3PD7A 3P5BA 1TPYA 1YZ3A 1P18A 2Q9CA 4QBIA 1COWA 3JS5A 4QHTA 1XD8A 4YJKA 5DXJA 3SBDA 5JMWA 1F8UA 4BBAA 4DZTA 2YYSA 4LDPA 1QAQA 2ADOA 2QN2A 1YRAA 4KXXA 4HY3A 1Q16A 2Q6KA 3SD7A 1M2OA 4J9VA 3RBXA 1BDHA 2ZYGA 3UNXA 4TRMA 2WU4A 2PH1A 4ZVMA 1AQYA 1Z33A 4HGYA 1B42A 2CNWA 4JS0A 3WY9A 4BO5A 1YR2A 1T2FA 2KLHA 1K7FB 4Q7MB 3QWIA 5T4EA 1RKBA 2C4NA 1DAPA 1Q11A 2V7WA 1QKJA 3TCKA 2OV6A 3JALA 2O14A 1Q57A 2R97A 4X7RA 4DQKA 1XZKA 4L6CA 2WW8A 3BRWA 3D0QA 5HQ3B 1VLMA 1Y6GA 4HD8A 4DLAA 4UMDA 1K3FA 2GEBA 2I4TA 1CDEA 5IJ9A 1E2KA 1R0WA 5AKHA 4BUJA 2JHAA 1QDUA 3QEMB 3M1AA 4O4IF 2FHSA 5FI0B 1ATIA 1ZAYA 2DB3A 5HJ2A 5A6SB 1N6HA 4CW7A 1XMSA 2HCBA 4BAUA 2UVDA 1KI9A 4PX9A 1N36B 1OWOA 1KK2A 5EZYA 3EIEA 4KIGA 1ODFA 4AKIA 1JEAA 2Q2OA 4Q1EA 3GA5A 2KB0A 3Q2KA 3K05A 3GNQA 3K6KA 3M1IA 3QUQA 4OIMA 2GK7A 3FSGD 3KXDA 1DT5A 5F2KA 1YRHA 3TG2A 1SA0B 2FUG1 1J2TA 2R6CA 3PK0A 4QPNA 1YZKA 3AERB 1HQDA 1VBNA 2X0EA 3JZFA 5I7SA 3ML1A 1CNFA 3A3PA 3RVBA 2W8BB 4EI7A 1E8DA 1K8ZB 4DSZA 1QCDA 2QN9A 2WLTA 2B0JA 1PBTA 2YOGA 2HIMA 1RYFA 5PGMA 4UDYX 3T38A 2JIBA 1UXIA 4FCVA 4J07A 5AUOB 2KJQA 1A8QA 3H0KA 3FLBA 1NGSA 2YZMA 1P2SA 2V03A 2YINC 2YHIA 4RTNA 3NIBA 3WWPA 3DB2A 3EJ6A 4RV4A 1TF5A 1GRNA 5LBIA 2CB0A 3B8EA 1DS6A 2VLIA 4YWHA 2D1YA 1QUFA 3LBYA 4A15A 2HF8A 5DBIA 1DKQA 2ZSFA 3QIVA 4PWZA 5K3CA 3DHNA 4PYNA 3N2LA 4CM7A 1QAMA 1RXSA 3AUXA 1CFJA 2R8EA 4B3HA 1WY7A 3JWGA 4EFDA 4JNKA 3FLAA 1OREA 2BRUA 4I1RA 4KITB 1RRPA 3RI3A 3W5IA 1DO8A 1H0SA 4XOUA 4V0MA 2PSHA 4XIIA 3VPCA 5IF9A 1QFSA 3FUCA 1GR0A 4AVYA 4YCCA 1H4SA 1LQ2A 3UAWA 3VNRA 1H1LA 2ID9A 3S8EA 2Q6TA 3MS2A 4CM4A 2IFTA 4YNBA 4ON9A 1LX7A 2VLBA 3R5JA 2G1UA 2FGJA 3G0CA 5CW1A 4H60A 5FDFA 1KK3A 2VSQA 2H4JA 2WSLA 1X9HA 3CUUA 2J07A 5HJ5A 4DNXA 3PNPA 4Q3DA 5F2EA 1KK0A 1R10A 1NW4A 1N2CA 4D5GA 4Y0VA 2Q21A 2V6IA 3BFVA 1PG2A 2DT5A 4GIBA 4KCGA 5GPBA 3HUUA 1W2WB 5FLXA 2FR8A 4EVRA 4OJQA 3DKKA 2EJUA 2ZIXB 5HCUA 4HVTA 5H5JA 2CHQA 5IJ0B 3USZA 4BNIA 4ENSA 1I24A 1BHO1 1M7HA 2FRXA 1HFKA 1T0PA 4EI8A 1DG9A 1PLKA 4GOOD 3Q72A 5LUAA 2J7PD 2CLEB 1G20A 1IN4A 1SEVA 5KQRA 1QH1B 1XO1A 1U0NA 2WHPA 3H9EO 4OA8A 5DNVA 4KQKA 5F7JA 4IKPA 5IVDA 1JDNA 5BQOA 3WWCA 3ZU6A 1M8GA 1KI7A 2XSZD 4RX1A 2C0CA 3ZWOA 4A5OA 4F11A 2GLXA 4D0SA 3ERCA 4M1OA 3DXYA 4LJ4A 4D26A 1VRWA 2VIIA 3BWMA 4L74A 1MVLA 2G28A 3ADKA 4ML3A 2M6SA 1EWYA 3U61B 5K4AA 1XMQB 2C5LA 2W8ZA 3R4CA 4L9AA 1WHSA 1E99A 2A9PA 4B7XA 4H6XA 5LNK1 3W8RA 4CXMA 1F5NA 3G9TA 1KO4A 2IUEA 1Z8DA 3KZXA 4Q4DA 4DLZA 4RCYA 2Z9CA 2FFBA 4US1R 1F0KA 1QS0A 2YFKA 1OGIA 3N70A 5FUVA 2H5JA 5KNCH 1DEOA 1ZYUA 2BFFB 3EIQA 1A4IA 3ZQKA 3D6VA 2QL7A 2W71A 1YAHA 4TT8A 1MO5A 4J3JA 5A62A 1ODCA 1VIVA 1G6OA 4YYEA 2PO7A 4D56A 2C96A 5A03A 4Q00A 3GEHA 3RADC 2ZM5A 2PFKA 5CA0B 4YP7A 3PF8A 3BSSA 1WXGA 2CLOB 2OZEA 3GMTA 1PK7A 4WW0A 1SBTA 4EW6A 3HSKA 2EW1A 1L6IA 3EPPA 3JQCA 3U0BA 1UFVA 2A9OA 1YR6A 2C1EA 3HJUA 3NEAA 3TTYA 3T9DA 2IZ7A 4HAYA 3L1HA 2YY6A 4FI3C 1SUEA 2EKPA 4J3FA 1H22A 2GUWA 2I62A 3R9KA 4B48A 5C7YA 1OY1A 2JD2A 1GT91 5ITZB 2CCGA 3BHIA 1YQDA 1YQTA 4PO9A 3RRJA 4BO1A 1GYQA 1X74A 4MUIA 5I9BA 1ZNZA 3WB1A 3DZGA 4YBRA 4OA5A 2DEUA 2P9ZA 4Q9NA 4I1IA 4LHZA 1ONNA 5IDYA 4DR6B 3ZBQA 4C76A 4HGQA 3W1VA 4DCUA 4KLCA 4PSKA 1EGQA 3RIHA 3STTA 3W5CA 1I5EA 4YRPA 4KBFA 2PL9A 2ZB8A 2R6HA 2VHJA 5BRAA 2B5WA 3DCYA 4UKDA 3B8HA 1ZICA 4GS5A 1HQCA 5GONF 1WD5A 2JJ2D 4REMA 3PQCA 1I2MA 1RHUA 3HYCA 3ZE7A 3QP9A 2I8CA 3GFTA 4YQEA 3DOEA 1LPNA 3T1QA 4LDQA 3U6BA 4I50F 1EEXB 1RE0A 1Z29A 2ZT5A 3BXZA 5H83A 5H80A 3RYIA 2C0PA 3F3YA 2B69A 4RGVA 2Z3VA 4V38A 1F1BA 1YH3A 4G2NA 4HPXB 1ZY2A 4K81B 4NENB 2IYFA 2R5NA 1JLMA 3VO2A 4WN3A 3VSDA 5C4GB 5JMPA 3LWBA 1NUHA 3A27A 1WB5A 2FR1A 4LS3A 4O59O 2F8MA 5KNLA 4ND8A 2WWVD 4DUGD 3ZQ4A 2FDCA 3ID6C 2FI1A 4UNIA 2B34A 5GGYA 1T8UA 1JAZA 1FZTA 3TF5A 4O4IA 5C1DA 4NRDA 4LHSA 2O2HA 1AG9A 1JPJA 3LDGA 4R9SA 2FPLA 3H3XA 4JJ7A 1XSEA 4G0WA 1QPZA 1ZOSA 3LPNA 1THGA 4AZ0B 3BH7A 2TMKA 6ADHA 1D5WA 3ZOZA 3S2UA 1CS0B 3N59A 2LBPA 1JJAA 2BKLA 4JH0A 4XQEA 1Y7HA 4G01B 2HCFA 1YUNA 1A7KA 1FP7A 2H3EA 3PPXA 3AFIA 4UXHA 4N7RA 2GVDC 2GF0A 1HC7A 1KO5A 2ILVA 3E1GA 3Q6MA 9LDBA 3H65A 2VT3A 4C2TA 3ZH9B 2CNNA 1RPAA 2VPQA 3SVLA 2BEWA 1WB9A 1C3OA 3CW9A 3MPOA 3OQHA 1RRCA 2QE7A 2LXNA 2Z2YA 1V4NA 2H1WA 2VQDA 1O6GA 1SXPA 4IIXA 4H16A 5A5FA 1V6AA 3CSDA 3PA6A 1KYVA 1JEDA 1WE2A 1XDBA 1YDWA 2Q3EA 4JMLA 5ECGC 5BUZA 1DC6A 2PUFA 2WZDA 4DLWA 2AOVA 4F06A 1II9A 1QHNA 2B4TO 4XD2A 5FUWA 3BB3A 5IXYA 4EMTA 4L4SA 2TMGA 1OZHA 2DLNA 3Q7RA 3CHYA 5I8WA 5AFSA 1JDBC 4C3ZA 3OVMA 2HU7A 4UUQA 4ZOLF 3BD8A 1QH8A 2JGKA 4M1ZA 4M9CA 4C3OB 4OGGA 2ORYA 3FWNA 5G1PA 4A8JC 5I6DA 1FPQA 1H2HA 4FEGA 1GUDA 1HX7A 2FFAA 1VG8A 3EIUA 1QKIA 3PXBA 3CQ9A 4G8BA 3NM4A 3TEFA 3ZWDA 2ZGVA 1C0LA 1GPKA 3O3OB 4X3OA 5B1DA 2HZBA 2DHCA 2H4HA 1VPVA 1QIIA 3ILSA 2VHUA 1WBJB 2NO0A 3GOHA 4G1VA 4NYMQ 4NNJA 4H17A 4YJGA 3EBOA 5ENVA 2JHFA 2FQ1A 4DR7B 1AS0A 1L5WA 1YMUA 3IULA 3VO1A 1JIXA 2IXTA 2YIMA 2GHRA 5A2QA 2Q1TA 3OEWA 4OM7A 3AFHA 1EFVA 1V1RA 3FCXA 3PS9A 2QVLA 4H18A 4WESB 3ZY3A 2GCIA 3BGWA 4BVLA 5AVVA 3RYHB 1OILA 3V8EA 5TPZD 5HR5A 4F60A 5DEOA 1TFUA 2HO4A 2VWGA 1KFEB 4G8JA 3TW4A 1G59A 3T1VA 2F3RA 3DDSA 4JBNA 4KAXA 3HEAA 5HUHA 1LPOA 4C2BA 2GS9A 2HU2A 2AF4C 3UK6A 4LKRA 1RQGA 4CGYA 1W76A 3BMQA 1M0SA 4M0DA 4UEQA 3AJ9A 3JY6A 3ZU5A 1JE1A 3NONA 4I5IA 4CPDA 3SP1A 3LQYA 3WL8A 2IEIA 4BZZA 3JQAB 4KI0A 4ZHSA 5JSFA 5F4BA 3UBTA 1ZN9A 2W83A 3BFPA 2PGDA 1TF2A 5EJ5A 5MGNA 1OKKD 4W1PA 1E98A 1IQRA 2CHGA 3QU7A 4FYXA 5DULA 5JI2E 1AUOA 1TPZA 2OT3B 3ZK8A 4PVDA 5JXHA 1KP2A 1XRLA 2O6LA 2HUPA 1JQDA 2QRMA 1QUEA 1ECBA 1BC5A 1CY0A 2ZDHA 3DLAA 1T1SA 3DC2A 3HVIA 2ZUVA 4FP9A 4HRXA 1KZYC 3TB4A 4PHTA 1QIMA 4JL6A 4YCMA 1VSVA 4YMUA 5ARCA 2BDUA 1H3NA 1SBIA 4ND1A 4ACAA 3WL6A 3K20A 4JFRA 2MHCA 5HYVA 2BE9A 2VYVA 4P3PA 4R2KA 5F52A 5FA8A 4MDHA 3PSAA 1RXEA 4R69A 3TNJA 2IBSA 4RWEA 1HEIA 3VYUB 3IUEA 4FYVA 4A6PA 1DO0A 1ZK1A 4H2DA 3VR3A 1YJCA 1YCGA 1Z2OX 3F2IA 4MRAA 1FX0B 3OMWA 3VO8A 2QJRA 1OT5A 2RB4A 1EI9A 1RBMA 2BCJQ 3DE7X 2CXPA 4B35A 1JPVA 3U09A 3U44B 3FF4A 3BRQA 5E6RB 1E1RD 2R6FA 2G9NA 4HX9A 3W2TA 4PN7A 3PUWA 1H1LB 1U3DA 3UAXA 1XZDA 4YROA 3PDWA 2FGKA 3HN7A 2FMXA 1XJ5A 5SZHB 4F2PA 2IE0A 2EF0A 1GTMA 3V4LA 4AXBA 3FOWA 4KSBA 4YRLA 3QVGA 3H75A 3N3AC 1GL3A 3LT1A 3UK2A 3EDRA 3MMPA 1ZZGA 2PT5A 2YDXA 4RK6A 3RR2A 5BQ3A 1U3GA 4B85A 4TYNA 5J2UF 2A1TR 2AKAB 3O4VA 2NO9A 3NBXX 4G56A 3T52A 4KNYA 1H9AA 2QUAA 3HLTA 5DO9A 1FP1D 3BZBA 1EXVA 1ZOIA 3ZIDA 3LT0A 4GWLA 3JQPA 2EZ4A 4RCZA 2QX6A 3IHKA 4NOJA 4TMYA 2AR9A 3UJBA 1G4AE 1L4LA 2XQGA 3A3NA 1VKZA 3W5DA 4HZUB 5HGJA 3P2OA 4IDPA 4EOGA 1CD5A 1U1GA 2F1RA 3L8CA 5ITWA 4GLOA 3ZXIA 1XVTA 3ECAA 4K9OA 2C5EA 1A2KC 3JRNA 4A6EA 3MD0A 4YRKA 5KYVA 3GPIA 2UYHA 3I9V6 4AJ2A 3FLEA 3LD9A 3UJ9A 1N5JA 2I6QA 1DOAA 4GUDA 1D09A 4QKQA 3QE9Y 2CDBA 1ZM7A 2YV3A 2I6FA 5AMXA 1P2GA 1EFDN 1W8IA 1VL0A 4RYLA 2ZEJA 1QO0D 2Q9AA 3EARA 3PHIA 4R01A 4HDQB 1XQ6A 4ZT3A 4PHFA 1Z73A 1Z74A 2F59A 1IEVA 4XUCA 3N58A 5CLGA 4JA2A 4WNAA 2VT6A 3FDXA 1UEXC 3MINA 1LRLA 4ZI7F 3OBIA 2Y71A 3AUJB 4UNPA 2VOJA 1QH1A 3UAGA 3CNQS 4DANA 3RB8A 3WAGA 4TZ6A 1DQYA 4LWPA 3ZTYA 4AF6A 3BJRA 3NHPA 2HT6A 3RUIA 4W1QA 1NNEA 4NMMA 1WHTA 1ZITA 1XZJA 5ALXA 3TW6A 2GYYA 2C88A 3GPBA 3LYAA 3COZA 1LRJA 4EKEA 1BDIA 1WETA 4UCXA 4NAUA 1A96A 1O6ZA 2YFYA 4AUMA 4HG2A 2D0DA 1K8RA 2CCJA 3KJZA 3PLNA 3ICQB 1AQLA 5BUSA 4EK9A 4JHLA 4UD2A 4ZREA 1JDSA 2XNHA 1I01A 4BX0A 5K8LA 1TRHA 3BQNB 2ZJYA 3ROKA 2DERA 3QELB 2XT0A 1Z4MA 4TKMA 1EM6A 1NURA 2AVDA 4U39A 4CM9A 3NTQA 5CVDA 1Y6QA 3H3FA 5JROA 1X77A 4UZSA 4N7MA 3W7AA 2X1HA 2F17A 4HSGA 4Z49A 4D0LB 3SSAA 3U4QA 4GG1A 1WSWA 5DYGA 5I4KA 3KYCA 3UJ3X 1I4DD 2BR4A 5AHWA 3ICCA 5HP4A 2JGEA 5B37A 2QV7A 3UKDA 2C4KA 1KC1A 5F23A 3B6ZA 2YRWA 3PCRB 1NASA 3TPZA 4AMVA 4N3AA 3GCDA 1P1BA 3O8QA 4TWAA 4KSCA 2HSDA 1Z0JA 3DHYA 4DZRA 3CH6A 3GLKA 4PQGA 2Q99A 2EW2A 3T1HB 4ZALA 1TKCA 3LIIA 4X20B 1AKQA 3RK4A 4UBMA 4DMHA 2X4GA 1E63A 3HCPA 4PSCA 2J0SA 4KYIB 4QOHA 4J0CA 4DA9A 4HGZA 1QF9A 3MQ2A 5K3SA 1VE9A 3VDQA 1M34A 1K8YB 2EV9A 5JNSA 3DE0X 4R8MA 3UB2A 4GC9A 3WDMA 1PNTA 1KBZA 2IYNA 1N5IA 1RI3A 2WUWE 3OOEA 3M6WA 1ZVQA 1KTIA 2FW6A 3LQKA 5BOSB 3KU1A 1C14A 3ZHSA 4I50B 1WDLA 3HP1A 3ZXXA 2HGZA 5T8KC 2B4KA 4RADA 1PR4A 1M6VA 3E3NA 3RSSA 2Q2VA 2JCBA 1ULSA 1D3AA 1X1EA 3HY4A 4GUAA 1M5RA 2JI8A 1RT9A 5KWIA 1RNLA 2F3UA 4LI3X 4XWAA 1JQEA 3FHJA 3WL7A 3INYA 1MX3A 1GNVA 2G77B 4JJ4A 4MINA 4BQQA 1RPNA 1J2RA 5IFLA 2EQAA 1C2YA 2C58A 2DQ4A 2Z5LA 2PJUA