2BRUC

Complex of the domain i and domain iii of escherichia coli transhydrogenase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
AEETAELLKNSHSVIITPGYGMAVAQAQYPVAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQDDPKSPIAGMPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAILKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination of a Transient Complex by NMR Using Paramagnetic Distance Restraints - the Complex of the Soluble Domains of Escherichia Coli Transhydrogenase
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords NAD(P) TRANSHYDROGENASE SUBUNIT ALPHA
total genus 55
structure length 167
sequence length 167
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2005-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2bruC00
1OVMA 4K9NA 3JR3A 4RJIA 3RIGA 4RMHA 4F56A 1HZZC 2B4YA 2UZ1B 4JUDX 5BWLA 2PGNA 1DJLA 4MPJA 2EZ4A 4JUBA 2W93A 3F6EX 4FVTA 4BVFA 4D5EA 4RJKA 2FR8C 4RMJA 4BVBA 2FSVC 4K9KA 2Q28A 5K6RA 3EA4A 3CLRD 2WVHA 3IAFA 2EZTA 5MF6A 4D5GA 3K35A 4UUAA 4KGDA 4TWJA 2VBGA 4JT8A 3D81A 4O8ZA 1Q14A 2OD9A 3ZG6A 1Z8NA 1PVDA 4MPPA 2OD2A 4GM0A 4MPRA 4MZXA 3D7KA 4QPZA 4IG9A 2Q5OA 5DEIA 4ZZIA 2FWNA 1MA3A 4V1CA 3CF4G 4L2IA 3F6BX 4JT9A 4UTZA 3U31A 5EJ7A 3FSJX 1OZFA 2JIBA 1YI0A 3E9YA 4V1CI 5EJMA 4TWIA 3OE1A 4JD5A 2JI6A 4KPUA 2AG0A 4BN5A 4QELA 1OZGA 3EYAA 4R8MA 4Y6LA 4KXQA 4X3OA 4F4UA 2EZ8A 2H2IA 4JU9A 1Y9DA 5DGTA 4FEGA 4K9OA 3FLMA 4JU8A 4K9QA 2UZ1A 2H4HA 2VJYA 4GPEA 4JUFA 4HD8A 1YHZA 4BV2A 1EFVA 1T9CA 1PT9A 1O96B 3PKIA 2FRDC 3HWWA 4GP9A 4HDAA 1Q17A 1M2KA 1POXA 2JLCA 3EY9A 4FEEA 4IAOA 4GG1A 2OORC 4Y6OA 3RIYA 3U3DA 1V5EA 4MQ5A 1O97D 2BRUC 2QQGA 3CLTD 2VBIA 3GLUA 4J16C 5K2OA 3GLSA 1MCZA 1UPCA 2V3WA 2HJHA 2X7JA 2DJIA 1YC2A 1M2HA 4K9MA 1ZPDA 2VK4A 4IF6A 3ZGVA 4COKA 2H4JA 3GLRA 1PNQA 3IAEA 2JI9A 1ICIA 2H2FA 1S5PA 1SZDA 1T9DA 2QQFA 2EZUA 4GM1A 4V1CB 2H59A 5D7NA 1POWA 5FYQA 3PDHA 5K6TA 1PTJC 4RJJA 4BVHA 5MFZA 1XLTC 1T9BA 1SZCA 2NXWA 4UTVA 1V5GA 1YI1A 2Q27A 1U2DC 2JI7A 4QQ8A 2NYRA 1S7GA 1Q1AA 2Q5QA 1UPAA 4GM4A 4BN4A 1BFDA 2H2DA 2Q29A 2Q5LA 1Q6ZA 2IHTA 2IHUA 3LQ1A 1YBHA 4BVEA 4X3PA 1D4OA 3FZNA 1PNOA 2C31A 2FN3A 2H4FA 3CLSD 1YC5A 1YHYA 2H2HA 5EJ6A 2OO5C 1N0HA 1UPBA 5DGDA 3JWPA 2PANA 4BUZA 5MGNA 1EFPA 4C78A 4BV3A 5EJ9A 5EJ8A 1PYDA 2IHVA 1PO7A 1QPBA 4UUBA 2JLAA 4JUAA 4RMGA 2VBFA 4UTXA 4BVGA 4I5IA 4Q9DA 5IMSA 1M2JA 1U28C 3ZGOA 4ZP1A 1U31A 4JSRA 3PKJA 2Q5JA 2H2GA 5MFPA 1PI3A 2AG1A 1YTLA 5BWOA 4FZ3A 5EJ5A 1YNOA 1V5FA 2A1UA 4JUCA 3D4BA 4Y6QA 4L3OA 5BWNA 2OD7A 4UU8A 1J8FA 2A1TR 2VK8A 2WVGA 5FEMA 4C7BA 1M2NA 5EJAA 5K3SA 4UTRA 4J1TC 4K9LA 4UTNA 1T9AA 4G1CA 3CLUD 3GLTA 4RMIA 2WVAA 2EZ9A 1M2GA 5AHKA 5EJ4A 4UU7A 1JSCA 3HWX1 4K9PA 2JI8A 1NM5C 1E3TA 1U2GC 2VK1A 2PGOA 1OZHA
chains in the Genus database with same CATH superfamily
2WSLA 1VGVA 5K8UA 4B3JA 4IV0A 5IKEA 1O94A 3RSZA 1FNMA 3EG5A 5ALTA 4RJKA 4EDHA 3GJZA 1OAKA 3A25A 2KPOA 3Q0TA 1TMGE 4ITRC 3CLVA 5KOJA 4BX8A 2H5IA 3VC7A 2A84A 2CVZA 2D0PB 4KR0A 3E27A 5MF6A 2DQZA 3CNNA 3KOMA 4D5GA 1OYVA 4TMTA 3ZJYA 1JIKA 2AZTA 5B4TA 1DDGA 4Z5XA 4IKEA 5AWFC 2AWNA 1FFXB 1P5ZB 1C3XA 3KR2A 1XU4A 2BHNA 3D6FA 2HIGA 1QTNA 1V4NA 3M5CA 5FHRA 4MVJF 1H42A 1U9IC 3G8YA 3VPGA 1RBYA 2VO1A 2OESA 4JT9A 1I1HA 4Q0MA 2J3HA 4YJ2F 1EE9A 1II8B 3ET4A 5HA5A 3L0YA 1C4WA 5B3JC 2QTVB 5KSOA 1IJKA 1EFHA 2VPIA 3EGOA 3R23A 3BPSA 3WQSB 1A0OA 3N53A 5JARA 4R9RA 1RNLA 1QGOA 4YAJA 3FFAA 1ZC3A 1JEAA 1NPYA 3CX3A 4DDHA 3EZNA 3H4MA 5H59A 1B0AA 2IS4A 3QZUA 3Q41A 4CLHA 3PT9A 4J4BA 2IZZA 4HRVA 4RM3A 2GHIA 3DV9A 4P9NA 4TMFA 5KQGA 4DBZA 4D0LB 1ZJZA 1T6NA 2X8JB 4QICA 4RVUA 1EX6A 5HTKA 1B41A 3MJDA 1X8XA 3MWJA 5JD3A 3ICWA 4ZT3A 1ZOOA 4W8HA 3T7KA 5JAHA 1IY0A 1DIGA 5AW7A 4KPYA 4IJ5A 4XM0A 2ANBA 1WMFA 2BPOA 1A9SA 1HL7A 3L8ZA 2G07A 2WG0A 5KWIA 3TN7A 1NUAA 3L4KA 2GF0A 5AI5A 2BGTA 1ZNWA 3AI1A 3M9XA 4E11A 1FQOA 3JZDA 2GTHA 4RQBA 4ND3A 4DSOA 3ESAA 1DEHA 1LA2A 2G72A 4FNOA 3VR4H 1GFWA 2H2FA 4B6JA 5JFTA 1XFDA 3DVRX 2QG4A 3W3AH 4XDYA 5LLDA 2R1UA 4FDUA 4L4XA 3AG5A 2WM9B 4IWNA 1CLEA 1EDOA 3UAXA 4F8EA 5K01A 1SC9A 3WBBA 4OQXA 1GTL1 2R65A 2NW6A 5B30A 3WAKA 1ZOLA 2OXTA 3MWYW 4CTNA 1ULSA 4ZPJA 1OBFO 3SHTA 4OHUA 1FDSA 2FMIA 1KJQA 3EWNA 3I2HA 1SRQA 3OWOA 4R3NA 3C5VA 1JVBA 1KF0A 3B3FA 3ABRB 3QPCA 3VKUA 3GIWA 3GLHB 4DLNA 1RPTA 3T15A 3M9LA 1SCJA 3EUFA 3SSMA 1BD4A 1C8BA 1MNAA 1CJMA 4BP3A 1EB9A 1JLLA 4IQ8A 1UM9A 4ZOLA 3T7DA 1ISGA 3WNQA 3DNPA 4HPWA 3UUGA 1FRZA 5CDSA 4IIFA 4J2TA 5IT0A 2ZYUX 4FYHA 2VF8A 1P4HA 1G4HA 1X9IA 3C3BA 3C7KA 4AM8A 3LBHA 3K0FA 2XE6A 4BUJA 4PCUA 1LS1A 3JZIA 2PMEA 2NT4A 1X2EA 2OD7A 4BGVA 4EABA 5D00A 2YXBA 4L22A 4HFMA 2GPYA 4M9QA 2X6RA 5E6UA 2QPTA 4II7A 1G3IA 2P0EA 1JDNA 3C5HA 4K6OA 4DC9A 1EIWA 3KAKA 5FPTA 1DBPA 2P9TA 3VR5D 3OP1A 3ZUGA 4HKTA 3WHIA 3LRPA 4B6QA 3HFGA 1GPDG 4KYVA 1M76A 4IQ0A 2E3JA 4W9RA 2YJ5A 4QUGA 3DTYA 5KQRA 3FUWA 3EOBI 1OWLA 3T5DA 1H2AS 2YY6A 4M6WB 1MQSA 4GX2A 4RVFA 4XYLA 3MD0A 4PNEA 5B3LA 3ZQ6A 4B3GA 4RY9A 1Z4NA 2FG6C 3K6JA 2EIHA 4DZRA 1FA9A 5EJGA 3VJRA 3OECA 3UT0A 1QGAA 2MYPA 4PLVA 1RQLA 3B13B 3Q7EA 4DMMA 1DBRA 1XD8A 3H99A 3OT5A 4P7JA 2FPOA 3AT1A 3HUTA 1FVFA 3H87A 3K1JA 3JD2A 4KXMA 4NG5A 4XRRA 4E88A 5KZMB 4N0DA 1S2GA 1O5TA 3D3WB 4BN5A 4R01A 4LHVA 1N3BA 3NBFA 2AZXA 1XRSB 2BFNA 1I3KA 3PGXA 1JS1X 3PL1A 4Y30A 2HHHB 1SA0B 2ZUVA 1H0HA 5HIMA 1JHMA 3E81A 2QDKA 2W90A 2APJA 3AVOA 1K68A 3G2KA 4Q6BA 5D3MB 3RS5A 2I4TA 4RVNA 4EZIA 1LLCA 4KG7A 1GZ7A 2C2YA 1GUBA 4C07A 1KL7A 4N48A 5BY2A 2CVPA 4U2KA 2D3WA 4GP9A 4M55A 4OA8A 1GZ3A 4FUTA 1W4ZA 1NN1A 5JSKA 3ESZA 4NBRA 4WOPA 1DAPA 3CZ9A 3QSGA 1SUEA 3RG8A 4ZHSA 4XDGA 4EDFA 2R7AA 3UJPA 1CR6A 5C1BA 3OJLA 4QUIA 5E1DA 3P0RA 4N0PA 3RU3A 1ZGCA 1W4CA 4FSXA 1H6BA 2A1UB 3UMCA 3DKPA 3I37X 3ZV7A 5BNIA 3AEXA 4QXQA 2F48A 2RSLA 1EVYA 1QHXA 2WAXA 2OBXA 4UPDA 1ODLA 8ATCA 2BR3A 3GEMA 3OJCA 4JQCA 2QX4A 1KOFA 3IVXA 4G36A 4AZ0B 1ODSA 3JATA 3EGVA 3MWFA 2B4TO 4MRMA 5D8DA 4LFAB 1WDTA 3HCFA 1JQ3A 4DR7B 4QT4A 3GCXA 2WSIA 2XB2A 2ZLBA 1PKEA 1UMBB 1JVSA 2Z4SA 4X44A 3CLHA 3P94A 4QULA 4BQNA 1OH7A 3TZHA 3EEBA 4CTMA 5J2UF 5IDVA 4H3HB 5JJBA 2X19A 4EA6A 4PGFA 3TCNA 3TZKA 3OM0A 3T95A 3G2HA 2AXQA 2DBZA 1TQDA 3FMPB 4A8JA 3DLIA 5AM5A 4NOKA 1SXJE 2F6RA 2CFOA 2P9HA 3O4VA 1ACJA 3P9IA 4F9TA 3JQCA 4LZNA 2YFHA 3WLJA 3BSYA 3FSEA 3PIIA 4XGNA 1C30A 3RFVA 1H23A 2F7SA 1QRSA 4CEIB 3JS5A 4RY2A 1SKUA 4C0SA 3KKNA 1SCAA 4KSYA 2E2WA 3C39A 1MIHA 1QHEA 4X41A 4MGIR 1LNQA 4NONA 2FZLA 3D5EA 3OQIA 4UVEA 4Y6RA 3SQOA 1E1DA 2VLIA 5E3JA 4KI7A 4RMHA 3T9CA 5LA6B 2GF9A 2GHQA 2VWQA 1Z37A 2VF5X 1UT5A 2HU2A 3AK4A 4RHCA 4RZSA 1NVKA 3ANMA 3LSTA 2RBKA 1KRHA 4ZAYA 2ZR9A 3WDLA 5L3QB 5B55A 4RTKA 3Q8WA 5JYCA 4RY0A 3SGLA 1DWUA 1GADO 1OYWA 2HL6A 2XKAA 2A14A 2YR0A 4Z7QB 5C7OO 1OROA 4TX1A 3TRFA 5DLEA 4XQ0A 2HU7A 2VS1A 1KH3A 2AD5A 2ZWVA 5TGTA 4BB6A 4BQRA 3ZVKA 2IHBA 4EVSA 5ALYA 1J1UA 1P18A 2ZQYA 1LJ8A 3SG0A 3A2KA 3KPYA 5DU2A 3OQIB 1JMYA 2AMLA 2ZS9A 4WT7A 1HF3A 3GZNB 3T52A 1E1LA 1K9VF 1XP5A 2WIGA 3Q10A 5AXDA 3T7SA 3DMTC 1BVYF 2YCBA 2AG0A 1NQVA 2PPLA 3LT4A 3TQRA 4QM6A 1RAFA 3AETB 3WDMA 4D3ZA 2ZBUA 3PUJA 4PLCA 1ZU5A 4K3VA 1DINA 2BFWA 2OAQ1 3FUVA 3JQ6A 4IYRA 4OA5A 5DE3A 2F8LA 3KIPA 1QYXA 5EYPB 3FUXA 3G9XA 3SLKA 3ZDQA 3DUFA 2WYIA 1SKQA 4W9MC 2YC4C 2IV2X 4N76A 2UXDB 4IDNA 2P91A 2PGDA 1WXXA 3UJCA 1IWOA 1QH8B 2WC1A 2P9ZA 2DG2A 2O0JA 4RGQA 5LCXA 4QE3A 3THWB 2GPTA 3GP3A 1RYNA 2Q3EA 4ZU3A 1OT5A 3VNBA 2ECPA 1Y8AA 3EZFA 1BEEA 2J1LA 4OYRA 3ZD8A 2VJDA 4BTVA 2Z5VA 2ATVA 4WASA 1ZK4A 5DO9A 1KK3A 1ZMTA 3TZBA 3HXLA 3SIPA 2JCVA 3UUWA 2ZK7A 4B4UA 5G0VA 2VRBA 2PV0A 3H2SA 1XLTC 4KKXB 1FSGA 2Y8EA 2YIDA 4R5HA 5ED0A 4IZOA 1Q2UA 3PFWO 5DX8A 4EX7A 1I10A 3OICA 5BRAA 2C2KA 5LQCA 4TL7A 3J7TA 2L82A 2WJWA 3Q8KA 3OCVA 3W4IA 1WUJS 2XQVA 2BM9A 1JIXA 2BFPA 2WNSA 3SYRA 2BKEA 1UBOS 4V0SA 2WB2A 3U4CA 1PCXA 4G0OA 1SULA 2ZYVX 1Q6YA 4IO0A 5EXSA 4JI5B 1U0FA 5JZOA 1J99A 1DTSA 2FW0A 4U9IS 3IUNA 4OEHA 3RSFA 3SZ3A 5K03A 1PJ3A 4FILA 2BMEA 1A3CA 1NW8A 1P5RA 1BA2A 2ZUTA 5F1PA 1YZTA 3FTCA 3EJ6A 3PCTA 4WK4B 4JDUA 1QTRA 4E5PA 4J76A 5EAIA 1VJTA 4MAAA 1JG1A 3MRTA 4IP0A 7MDHA 1KDVA 4A2PA 1HDCA 1JKMA 1TO2E 1GAWA 2YUIA 4X7MA 4EHJA 4ZFNA 2HHAA 2QMUA 4F0JA 5SY6A 1TZ2A 2IUTA 3BWCA 3K5IA 4RD2A 4EJ2A 3SWWA 2AS0A 4QUKA 1RE0A 3M6AA 2GBLA 3BCUA 4NE2A 1Z4PX 3EPHA 4ZOQI 2E6KA 3MJRA 1HPLA 2UYGA 5E3HA 3MTQA 4GW3A 1NNLA 1SPBS 2FKNA 2I1QA 1EAMA 3AF6A 1UEXC 4HNAA 1JDBC 4IIJF 2I66A 3V8NA 4B3CA 2PL5A 3ANSA 4DHWA 3U1BA 4PRKA 3L05A 1GCOA 2GS9A 2I67A 3H9UA 3S2EA 2YXDA 3OPNA 4EUEA 2R60A 3VKVA 3UWSA 5JWHA 2J45A 2JJ2A 5AKXA 1YA6A 2PBFA 2VJQA 4YMSA 2TECE 5G0SA 1AKWA 2ENWA 3BMOB 2GPSA 1N2CA 4P4LA 3AHGA 4KXUA 1CXZA 4KH0A 1VCMA 3RRFA 4AI6A 3JZFA 3U5TA 1CD5A 4WNIA 5LIRA 4QQRA 2G04A 3VI3B 1G1AA 4FHZA 4Y2GA 1RR6A 3OLXA 4CLRB 2AHRA 3E9YA 1FJGB 3P26A 5C8XA 3VR2A 1ENZA 2H6EA 3E8MA 5EPEA 2G1PA 5T6BA 5CHYA 1Z8DA 1NC1A 4BUCA 1F4PA 2PS9A 1HRDA 4MGZR 2AC7A 3MJEA 1YA8A 1EM8A 4IDDA 1CUGA 2EZ8A 3KUKA 1TO6A 5EJFA 3WRVA 4FEGA 3L8YA 3FUTA 4I4IA 5AICA 3IBYA 2A5DA 3G89A 4FDAA 1HEUA 1N5LA 1TI7A 3DYIA 1G20A 2NU9A 4TZKA 3R7BA 4LGCA 5IX8A 2Q1UA 1T9CA 1JZSA 4CIWA 1WKVA 3GVHA 5H9WA 2H7XA 2CEKA 3A4YA 3A70A 5IBPA 3NP9A 3K3PA 5IYZF 3R5KA 6ADHA 4AG6A 4HQFA 5AVQA 2QMZA 2QN9A 1AGRA 3PJFA 4U1RA 1L5RA 2DPYA 3OFSA 4FNMA 5AT1A 1B8PA 2CDNA 2Q2QA 1NI3A 2ODNA 3TCKA 2ZW9A 1Q0ZA 3GCDA 4MIYA 1JFLA 1ZHOA 3K0KA 3L8EA 1WW3A 5CITA 3IOCA 1IJBA 1NOIA 2QD4A 3OQNA 1G64A 1K5PA 2ZJ7A 4TMKA 5G0WA 5KYXB 2Q6IA 4NZPA 2R97A 1RRPA 3TRJA 3B3GA 5J4HA 2I91A 3I9OA 2Q4BA 5J4YA 3VU3A 1G7TA 1N3YA 1QGED 1BFDA 1XXHE 4X97A 1JYSA 1NL3A 1W2GA 2H4FA 2D3TA 2BHSA 4HDRB 3U0BA 5C46F 4LNHA 3BTOA 4ML3A 4WGFA 2B82A 4RTMA 1C0KA 2Q6OA 1E1YA 2NVOA 3M6XA 1XBTA 2J9ZB 1E8DA 2H48A 3U3OA 3ZNQA 1VLVA 3GPLA 2A7QA 3EFHA 4ZYTA 4E2WA 4OAQA 5CR9A 5TQVA 1OI4A 5TIIA 3DWFA 4M1KA 1U2ZA 4RC9A 3PGVA 1WCYA 4AJOA 4GGMX 2JS7A 2COKA 3NDRA 4GKKB 3VHXB 1B8VA 2OAGA 2QX7A 3KS9A 1W47A 3GFOA 1X87A 1GZSA 3LK7A 3N3BC 1B3BA 4UNSA 1K6EA 1DUSA 4OHCA 4UU8A 3ZVNA 7REQB 2RHWA 4OJTA 1CYEA 3HR4A 4RY8A 1SAYA 1RKXA 3KBBA 4CV3A 2VWHA 4IQ4A 1WD5A 1YQGA 2IUSA 4WH0A 3RSQA 1XTSA 1N4AA 1LX6A 3CZRA 2JI8A 2PDAA 3FW1A 3IV6A 3F5QA 5ALUA 3T41A 2XADA 1NVGA 2EXXA 3AEUB 1YS6A 2WD8A 2XWSA 3KQKA 1DC8A 1HOTA 2F55A 3FOAA 1HTBA 1PFKA 1VSQA 3RFTA 1U8CB 5G3YA 4Y0NA 2Q28A 5H7XA 2IYOA 1VOTA 1KJNA 1DKOA 3S29A 4ARIA 4DT1B 3IDAA 1V3QE 3EDCA 1G6Q1 3TFQA 1U7OA 3ZXSA 1W0JA 4FSDA 4MUEA 3KQUA 3HGTA 4MPPA 4TVSA 4CCWA 4O2LA 5FAXA 1OX4B 3EVFA 1JAIA 4QEDA 4ZHQF 5CDFE 2Z4TA 1DFIA 2J9GA 1AQNA 1NJ2A 1W1WA 1L4BA 2FPKA 1AKNA 3Q7PA 1U8TA 4IKPA 2BWJA 5GWXA 4ZYYA 1NT4A 3C45A 1I2BA 5EXDA 3K70B 2O0HA 1T8PA 4RA6A 2XWBF 4REQB 2HMAA 2HHLA 4LJRA 3DBIA 4XWAA 3UH1A 1RYYA 3A1EA 3DAHA 1P2TA 3GVXA 4BYGA 4JOBA 1AS0A 3VZBA 3WOVA 4DYDA 5KC9A 4RS4A 2NV2B 2WZDA 4OLBA 1W96A 2OL4A 1DJOA 2EAUA 4HI0E 4K9OA 1BE1A 3KQLA 2GNPA 5KHAA 2JGIA 1W49A 2XCLA 1F8GA 2J3IA 5FPPA 2OFPA 4DDWA 2L69A 1SIWA 2V4UA 2XWJI 1L1QA 1OWOA 3CSDA 4PG6A 5DF1A 5CG1A 4PSVA 3GFTA 3M1LA 3R3XA 1FNDA 4WN9A 3A1UA 2DSNA 3THYB 4D9JA 2QRUA 3VNUA 4ZVVA 3LC0A 4U6NA 3QMMA 1AN0A 2EG5A 3E18A 2BFEA 3IP5A 3PUHA 3RFXA 1NLYA 5TGDA 2WP0A 2XGMA 2ZYIA 4HBGA 1NBMD 3LZDA 3IUJA 1V7CA 5DRTA 4EKGA 4KQHA 1G55A 2R8ZA 4TV9A 5GP1A 2P2GA 4PYQA 1FC0A 4D74A 4X84A 1Q0HA 2CW5A 2TS1A 3ANYB 2I7XA 4PCLA 3U9TA 2CHVA 1XRMA 3T9EA 4YP0A 4F71A 4CNBA 6NULA 2CNDA 3BB4A 3WL5A 4AG3A 4YDQA 3I2JA 1E20A 4GQBA 4Y6PA 1V9CA 4ZRDA 2Q2NA 3IIIA 4IRUB 3GRKA 5F5NA 4ZVKA 1KVUA 1XKQA 1RZVA 5C5IA 5JBIA 5CBPB 3K73O 2PGJA 2JNWA 3DGFC 5IH7A 2DWQA 1G3QA 3DWIA 4KGXA 3MS2A 4LMBA 4LSWA 1O58A 1K8RA 4AJ4A 3OX3A 1W6RA 1PZEA 3L6OO 4BLSA 2IXFA 1N2EA 2HCJB 3B6ZA 4B44A 1OYOA 4LECA 4MCHA 5ADWA 1HLPA 2PMFA 1Z56C 3LDFA 1X2BA 1NRWA 3K6RA 5IZCC 1G5IA 2XUZA 3N07A 3O8OA 4TMYA 4UDOA 3URKA 4HB4A 2I76A 2VRCA 3FYCA 4WUTA 4Y2XA 5KVCA 1GYPA 1P2BA 1ZJYA 3M33A 1N0IA 3DULA 3S8YA 1ZW6A 4RVGA 5I4CA 1EGMB 3DFFA 2Y9MB 3MIIA 1T9AA 2UXCB 1FRQA 4MV9A 3LLMA 2XH8A 3ZGXA 5EIBD 1P1CA 2I8CA 1M75A 4RHUA 2GUGA 2HWUA 5TDHA 1FDVA 1LJLA 4NNPA 3K9GA 2EKQA 4C1NA 2QL5A 2FF5A 3HO8A 3SJBA 5HM8A 2B1RA 3AONB 2R85A 1XJ5A 2ID8A 4I1VA 1M1UA 1U3VA 2YYZA 4ZAGA 1Z5OA 3TWOA 3BZBA 3SC4A 4PN7A 1KNQA 3SJUA 4FZ5A 4KAXA 4PXYA 1O97C 1PHPA 3N8DA 3VHXA 2CV1A 2XXBA 5AXCA 3NNDA 4ZAXA 1VYUA 2FRXA 3PITA 1E2MA 1JIJA 4N0EA 2O2HA 3KKZA 2W0MA 3FBGA 4ND2A 4EYGA 2AG6A 3I61A 1SHUX 2AT1A 4EG7A 3NWOA 2PRJA 5T7BA 1EK2A 2HADA 4MRAA 4MR8B 1L5ZA 4PZYA 4CEHA 3E3MA 1KQPA 2QTFA 4TZ0A 1I30A 1WMEA 3PC2A 3S4YA 1G8KA 3ZYZA 1NHWA 2QOEA 4JR1A 3EPJA 3MS7A 1PFYA 1BS1A 2GQ0A 2J5RA 4JZKA 5DHSA 4OXQA 3HZHA 4C05A 3O3OB 3ZCPA 3O21A 3C8HA 1GCGA 2IYLD 1E0DA 4RCYA 5J40A 4GFDA 4BB5A 1ZK0A 3BK2A 3Q9NA 2JCSA 4AP5A 5KQSA 3HA3A 4GLBA 1JJIA 1VPTA 4I55F 4NZMA 1YRQA 4YRMA 3U3MA 4ENUA 1BRMA 4DCCA 4LBYA 1AO0A 3S40A 2Q0HA 3S7TA 2QLMA 3IEUA 4V1CA 2G40A 2VZEA 4P36A 2ORED 2ZBGA 5JYEA 2ZTMA 4L85A 4IDHA 4MR8A 4Y2QA 1WDMA 1FFBA 3W8RA 4MNTA 2P9QA 3ZH2A 1PEAA 1KMHA 3ZWWA 4K9MA 2JFXA 5KOHA 6PFKA 1W88A 4OXNA 4M87A 1CE8A 1KK2A 2FY8A 2VA8A 4KRXA 3Q5GA 3P1JA 5K05A 2OGSA 3V4ZA 2H59A 4R1UA 1HFJA 2HRRA 3VO8A 3BX1A 2REOA 3H2JA 4HFNA 4JT4A 1J8VA 2JGJA 4RABA 3QEJA 3CSUA 2X1HA 1FK8A 1KIMA 2DWCA 2QG6A 3G8DA 3LOUA 1SBCA 3U4AA 3RV3A 2JLZA 3HEBA 5I8WA 1CRQA 1UKCA 3P9PA 4OI1A 1G6HA 4RKEA 4TV8A 3OCXA 5FRDA 2AF3C 4R7ZA 2B3DA 3DS8A 1Z34A 4PFSA 1YE3A 1XCPA 5HF8A 1Q1QA 3WIDA 1T8TA 1FLNA 3I2GA 5T5QA 3A0RB 1S1MA 3GRYA 3LXMA 4OQYA 3KT3A 4RMNA 2ZRQA 1G20B 3SDZA 4NDNE 2FPUA 3BDAA 4FSHA 1S2IA 2JGFA 2ZUWA 4YIKA 3MNFA 2CNWD 1D1PA 3LT0A 4NEHB 2XDYA 1MG5A 2Z98A 4FFVA 4M1QA 2ILTA 4KR3A 3LCUA 3I52A 2GPWA 3LFHA 4M88A 4HADA 2AG8A 2FW7A 2QVXX 1SEVA 3VBEA 5BQ5A 4UEWA 4DL9A 4EKNB 3HVRA 3ER9A 3E1KA 1E32A 3WSTA 4NDAA 4GS5A 2P7HA 3M70A 3F6CA 2WFMA 5CIQA 4G84A 1O77A 3N8NA 4QM7A 4H7JA 4GMHA 4LN1A 2HW8A 4MCAA 4YCBA 3FTPA 1I6LA 3IIKA 2XEXA 2WTXA 1NPDA 3EJWA 3RFFA 1GVHA 2OZKA 4RO0A 4RX1A 1WXHA 2VCEA 3K35A 1DAGA 4RQAA 1JQEA 4RXMA 3OSZA 4KI0A 3NHMA 1N92A 3OJOA 2YJZA 4YT4A 4AVYA 4HB0A 4YT8A 5KO2A 2IXTA 1IM5A 3WLRA 4UOEA 3SF8B 1G21E 2FN9A 2PJDA 3PI6A 4FCCA 2QUZA 5K8IA 2GEKA 3K15A 1M7HA 3L7LA 3LCCA 4X64B 2EW2A 4G09A 2E89A 3A0UA 4UE6A 3NTVA 2R8PA 1DDIA 2FG5A 4P83A 4JKOA 3I0NA 5DLPA 3HGMA 4FS8A 4DIKA 2V3CC 1C7IA 2DWOA 3ZU2A 3PHCA 1AMNA 1NW6A 2GFIA 1M2FA 4H17A 1LF0A 2YWXA 1YQQA 4UZFA 4C4TA 3TD9A 2GN8A 2C2XA 3UOWA 4EGAA 2P67A 5CT8A 1VJ1A 5KTOA 4RD4A 1I9CA 6LDHA 3ZJVA 5A3SA 3FNIA 2MWMA 3TLJA 4S1WA 2BYTA 1VPLA 2Q3BA 1RLJA 1X7WB 2HO4A 2BKXA 4LY0A 4Q15A 1NVTA 1SR8A 1MB3A 1Z06A 3CU5A 2PTHA 3DNMA 4LRQA 1G5PA 4PQYA 3BXZA 4C0JA 3CEPB 3F8TA 5FADA 5AXAA 5EFZA 3A1TA 3DD1A 3GFSA 4HAUA 1G98A 3S2GA 1HLDA 4Y7DA 1LGYA 1INLA 3WTBA 3CX7A 2P77A 1FYWA 3PXGA 3AESB 1UUFA 3W3AD 3ZZNA 1II8A 1FS6A 1ONNA 3R0IA 4AL4A 1CVIA 3ZW8A 5LP1A 1XA4A 4FOTA 3CF0A 3ZE9A 1F38A 4AZVA 2VPZA 2ZM6B 1EP2B 2ZTHA 5AVSA 3SHQA 1A9OA 3L84A 1J39A 3KCQA 4HLUC 5AVOA 1IOWA 4E4TA 2AOWA 3WGUA 1TC1A 1L5VA 3ZY4A 1X7DA 4I9NA 2GCNA 1LBSA 2O2ZA 3ZDCA 1YOVA 3HCNA 4C0WA 3EZ6A 5IASA 4B2IA 2B7BA 1OKKD 2FX5A 2ZIAA 4RXTA 3C0KA 3OQ1A 1JXAA 1K92A 4EY5A 3M82A 3Q9UA 1Z5NA 4Q34A 2OYRA 2GEFA 3HCOA 1L4YA 5A04A 5J2UA 4UREA 3M1AA 3PNQA 4OGFA 2JC3A 4Y0AA 3ZNOA 5AOAA 3VJKA 1KH1A 1Z0UA 2XRZA 1RWBA 1U4OA 3FDJA 4BMCA 3QJYA 1WVMA 3BHMA 5CW2A 4AQDA 2AZMA 5IHPA 5BVGB 4UMEA 4MPTA 4Q3DA 1RMQA 3DZCA 1NVXQ 2H9AA 4E51A 3DLPX 5LFAA 4P22A 1KBQA 4OK6A 4XWGA 4TYYA 1S9DA 4UEKA 1EFTA 4NRDA 4XVRA 3VGPA 1T9HA 3N5KA 1YTUA 5JEDA 2P5SA 3BG5A 5AJXA 5GPBA 4WSOA 5KYYA 2HSDA 4RTJA 1OGIA 3KCNA 4V24A 1CK4A 1OFGA 1U4NA 2BSQA 3GEGA 4JLMA 1V45E 3NALA 2FJUA 4C14A 1S3IA 3KZOA 5IM4A 3ENKA 5KU7A 2OT3B 1IWPB 2FYTA 4NQRA 3V3KA 4PBSA 4W1SA 2ODPA 2ORVA 3LLCA 2QTBA 3E6AA 3NTOA 1FQWA 3IAHA 2ZFUA 3DFUA 1SOMA 4AT1A 2F62A 2GPJA 1KZ1A 1JTFA 4IG4A 2HUPA 3NETA 1CX9B 5IBCA 3EWAA 5FNVF 1BD3A 3SJCA 4UUOA 4J43A 3U60B 1GZUA 5JZ9A 2PWPA 1RM4A 2D1YA 3NEAA 2HIHA 3D0OA 5HS6A 1ORIA 1Z8NA 3LK6A 4CMAA 2XKKA 3COJA 4HAOA 1AURA 2HCRA 3H18A 3K4QA 1X92A 1HUQA 1DZ3A 1NKTA 1ULAA 1YJ5A 2LGJA 4PLZA 3JQQA 1MNQA 2NZXA 2Q41A 2Y0EA 1E4EA 4L7QA 3T3PB 2JAHA 1NSTA 2Z04A 2W0SA 2YQZA 1LNZA 1CIJA 2ZJFA 3F6SA 1WZNA 3LUCA 3QKSB 2KS6A 5KJCA 3KSDO 4BKQA 1TZKA 5EWJB 4WLEA 3COPA 4UBKA 4F4UA 1PW5A 4YRAA 4A0HA 4IKOA 3EXG1 3E15A 4DIOA 3EX7C 1BMFA 2VP9A 2P2LA 4YCNA 4TMVA 2V65A 2JIRA 2QTMA 1FLAA 4TTAA 5JVDF 2QK4A 4B74A 1G60A 3UMRA 4UMFA 4BXOA 4LJ9A 4X61A 5E9JA 3CN9A 3I5UA 2AB0A 2R8EA 3ZZTA 5LZ7A 2UYYA 4JYPA 3EIEA 1PS9A 1Y1LA 3CLSC 1X86B 2YVAA 4W1PA 4HWKA 1ML4A 1DBIA 1FXWA 3DEYX 4KBGA 5DTEA 3TNFA 4ARZA 1YC2A 3LXUX 1K5DA 5A71A 3WWZA 3D3WA 1KYVA 3DPIA 5D1HA 1M5RA 4M3NA 2ZYAA 1ZNYA 1F0NA 3IGFA 4KN9S 2J5XA 1R4NA 4F38A 1Y7LA 2FPSA 4PYIA 1PGPA 4KBFA 4DG9A 1WVIA 2HHJA 2JHAA 3W7VA 4CMBA 1YU9A 1N25A 5CG2A 4V0ME 5FO1A 1FP6A 3RSOA 3UMMA 2G0NA 1ZH0A 4LJSA 5JCOA 4AUKA 1XRJA 2CFRA 2QIPA 1QVAA 1UDAA 4H0FA 2YL2A 4HZUA 2C7GA 1BYIA 4KXYA 4M60A 3TUJC 4BVEA 1TMOA 2JK1A 4GECA 4EIWA 3LTNC 4QYTA 2YRWA 1BJKA 3UHJA 2QRHA 4N5HX 5KCMA 2PSHA 1NXTA 3LCMA 2WIKA 4G85A 1UFOA 3GLQA 4MRMB 3GMSA 5BNTA 2AFIA 5FAKA 1Z4LA 2D7CA 1DFHA 5ECWA 5DYNA 5A5GA 4DLRA 1D3AA 2QS9A 4JEMA 3ITEA 2HO5A 2WAYA 4IXWA 4YN3A 3D3EA 4Y1FA 1S8OA 2BKAA 2XWQA 2GJ9A 4P2BA 5CTJA 1H93A 1PWHA 3T7JA 1TC2A 3TAUA 4JWKA 3W5IA 4TV8F 2J09A 4XASA 4XFJA 3NOQA 4Y2RA 4YP6A 2HLDD 5LP6F 3F4BA 1V5IA 2ZCVA 3MWGA 3GU3A 1XZMA 2B20A 1Z33A 4AZ0A 4E13A 1U99A 5A9RA 5BWCA 4QECA 2GZHA 3ONFA 1GA6A 1ZS9A 2Y9PB 3INNA 3WWPA 4F12A 1GNLA 2P2YA 2OQVA 5HZHA 5L3VA 4XLZA 3K8QA 1UQTA 1KMCA 1VC2A 3KJNA 2E82A 4BP1A 1P0PA 3OQMA 2ACWA 4RF4A 1YKSA 3FOEC 1ADGA 1JR3E 2VIIA 4IXDA 4QOGA 1O3YA 4C6SA 4NBKA 1G3UA 4FQ8A 4Q9HA 2CBGA 2FPMA 1II0A 2RK4A 3K9QO 4Y8VA 5GONA 2HTFA 5U4QA 1DQPA 1SKYE 2O5RA 1IEXA 5ULLA 5KDOA 1XCMA 1XU7A 1F7VA 3JD0A 4O8ZA 4IUBS 1UMKA 2C4MA 4TSFD 3AHIA 5CA1B 5CFOA 1DV2A 1TTTA 2BFMA 1ZWLA 3CUUA 3QKIA 3FWNA 1T43A 3B20A 1GUYA 1RWWA 1XZKA 2OXEA 1JNXX 1W34A 2RGCA 3JY6A 3LUFA 4G89A 4DDVA 1EX7A 3TD6A 3L7KA 4C5CA 1IULA 3UEOA 5J4LA 4HLNA 4P3KA 4ZTBA 2FGJA 3AP1A 4B7CA 1WCXA 2WYWA 1GZVA 4CGYA 4DLPA 1ESNA 3GO4A 16PKA 1YJQA 2JKVA 2HEGA 2OK7A 2YJGA 2GEBA 4JJKA 3QEMB 1IUPA 4ND8B 3TQHA 3U6BA 1PNVA 3KM0A 3VVBA 2CNLA 3ZQJA 3CVJA 1V4BA 1KC1A 2AX3A 2P1ZA 3DOUA 3O95A 1C7EA 3ESCA 2FN7A 4HUQA 4OXYA 3SXUA 3U44B 4GO1A 4FHDA 1NF9A 4PPYA 1X7XA 4D45A 1ZICA 2X14A 3RUFA 3DE6X 3ACBA 1Z2PX 3IHTA 4ALJA 4F2HA 4YRCA 1GD1O 1ZISA 3ZI7A 2HJHA 1TECE 1SXPA 4TGLA 3K1AA 2G9QA 5F35A 3QVLA 4YB8A 2JFUA 1UWVA 3PQEA 4R2WA 2RHLA 2C3UA 2G6TA 2Y6VA 3ZHYA 4HMQA 5JQGF 4R5MA 4LF6B 2NZ2A 3R0VA 2YXPX 3Q40A 4FQ7A 5EYPA 3SQNA 1Z68A 1K7EB 5CCXA 2AL7A 4HQLA 3U6KA 1WU8A 2FPRA 1XPOA 1ZM9A 3VGJA 2H2DA 2ZJ6A 2ZRMA 3EIFA 3GNQA 3C3MA 2FB9A 4LVUA 1LSOA 1NI5A 2OP1A 1EK6A 4RD6A 2R86A 1P1BA 1H94A 1ORVA 3H6GA 1FZQA 1X14A 3H84A 3PQFA 1QFYA 4KLAA 3NJ8A 2ZAMA 4R1PA 3E7PA 2XKJE 5KYUA 2JLBA 1E6LA 3VO9A 3ZHRA 5CDYA 1R4NB 2QYHA 1U04A 3AHJA 4LF7B 1IVNA 3HU2A 4OKNA 4X92A 4M9XA 1CIVA 4HDCA 4AJJA 2GASA 1PSDA 3D7NA 4XQEA 2C95A 1C4OA 4M2LA 5G2OA 3VR5A 1D9ZA 3WNCA 3G8AA 4YRIA 3LDUA 1SWVA 3P2KA 4JVLA 1MGOA 4M37A 4TL8A 1OXBB 5BPFA 3VYWA 2AJDA 3U17A 4BKUA 1ECLA 2XGSA 4YDRA 1C50A 4E21A 3DL0A 4UHJA 1TF7A 3VO1A 1WB6A 2BLLA 4QDXA 5AW4A 3L4EA 4BVAA 4AQYB 4F4IA 1CTQA 3KJHA 1KHTA 2H3HA 2PLRA 4EFMA 1GU7A 1Z6GA 1OMOA 4NOMA 2HPHA 2FQWA 1RJ9A 2I1LA 2NO7A 2OO7A 3HSSA 2NOAA 2YS6A 4JJ7A 2GZ2A 3CVWA 5E8RA 4O1HA 2BUCA 5TEWA 1U8FO 2REXB 5I4KA 1DC4A 1VGQA 1LV7A 1W94A 3T1NA 3W5HA 5BO5A 5LZ9A 1TF2A 3EAGA 3UV3A 4JI2B 4AF7A 4AF8A 4ANFA 3KJFA 2H07A 2EFJA 1N6KA 1ZH2A 1LEHA 2QA5A 4ZMBA 4Z0HO 2YN0A 5IKMA 4M83A 1AKYA 4NC9A 3QV1A 2P6OA 2PXCA 3CLUC 5KNDH 4JVOA 3GLHE 3DR5A 4DLVA 3RNLA 4KLCA 4RADA 1M8KA 1UDBA 3RCBA 1CUZA 1ZP6A 3GUZA 4G86A 5CK4A 3W2IA 4LY3A 3ELWA 1GT91 2ADFA 1RAEA 1PV2A 1LS6A 3CINA 4P5DA 2BJVA 2CHGA 4QELA 4DT1A 4Y3UA 2UU9B 3HFRA 3W90A 3WWYA 2NYUA 3NNNA 1DKQA 3O31A 3DQPA 2H2IA 1QHIA 3G2LA 3I2YX 4PHGA 3G9UA 4TMZA 2AFHA 5HG0A 4NDZA 4WZBA 1P4RA 4M9CA 1BW9B 5CA1A 4L2IB 1XK7A 1LUAA 1BX0A 4UU1A 3RYCA 1J9ZA 4DUPA 2Q9CA 1RZ3A 2ZTSA 3O90A 1XDSA 4B81A 3BFPA 2HA2A 1SVWA 3ZHSA 2XNCA 4NS1A 3S3TA 3CUSA 3JALB 5ECYA 1P9WA 2X0RA 2IXAA 1USIA 2P3OA 2YWFA 3PWZA 3GLSA 4MDHA 1Y1SA 2HAEA 1DUIA 1W8DA 3OLVA 2HPVA 1MAUA 2KX7A 5F52A 3UFXB 2NUPB 1YZYA 4FP9A 2IDMA 5JNRA 5G4KB 1HDXA 1BHSA 3EVDA 1JAHA 5KYWB 1LPAB 2PZLA 3JVIA 3KDPA 4EL5A 3WGQA 2O8DB 4YMUA 5IT4A 1PZNA 2BC9A 3PT5A 3M1YA 4WOJA 2CHUA 4Z53A 4RJJA 4TXJA 2M6RA 2QUIA 3GLFE 2FN8A 4OQEA 1H2ZA 2GJSA 2C9CA 1BJTA 2WHPB 3R3YA 4GP6A 3EOAI 4RH0A 4IW3B 5BN1A 3RTEA 3A3KA 1FX0A 1RAGA 2ODBA 4DCGA 2Z5GA 2OFFA 1HYHA 3DT9A 5MN5A 3K6SB 2NZUG 3FBTA 5AJHA 3SZGA 1FIUA 2C3YA 3KTAB 4WWHA 2AFRA 1NN0A 4I3FA 4MUBA 1E7WA 4N7BA 1IMJA 3L79A 4GXTA 3ZNNA 1U7ZA 4GE3A 1DT3A 2HJSA 3WK6A 1ZCBA 2ZREA 4P86A 1SRRA 5DH9A 1F2UB 5K3OA 2OUKA 3CKYA 4IXNA 2VUHB 4HEJA 1NN3A 4NZ9A 1ZVMA 4TWRA 5CB0A 2R48A 2X0EA 3DDCA 2ZCUA 3KSZO 5E6SB 5SYNA 5DGHA 2DH5A 3EARA 4NECA 2VKQA 5K2MA 3SF0A 4Z1OA 2V7TA 1MRSA 3NOOA 1SBQA 4F2PA 1CFJA 2DTXA 4W5WA 2CJYA 1ZM4A 2BI4A 1TT5A 2AN1A 1RRFA 2OV4A 3E48A 2J7PD 1UFQA 3TW6A 5EZSA 2EFCB 3ZPXA 1WR8A 4PQGA 4QQNA 4G0MA 1YH3A 4Q21A 4F45A 3H9EO 4B3RB 3AF1A 4MS1B 3O3MB 4W7IA 1XJWA 2AR7A 2J7KA 4XPIB 4OV6B 1U28A 3F4LA 2HT6A 4H1VA 1BO6A 2QDXA 4XYEA 3UY4A 1WD7A 4KXNA 3VSAA 3PK0A 3ME5A 1I3LA 2PCLA 3T5BA 4D79A 5AW0A 1MW9X 1IN8A 1EA7A 3RS8A 10MHA 4B87A 4DQKA 2ZIXA 1U6JA 4R2MA 3TRKA 1CUCA 1NRXA 4XUCA 2ZGVA 3SLRA 1PVDA 3ZCSA 4EMSA 4OJMX 4YROA 1US8B 1BE6A 2FWNA 2CD9A 3EIUA 1FNSA 2IY9A 2B7CA 2SICE 3H5OA 4CLEA 3BIJA 4HRYA 4EQ6A 3ASUA 4QATA 3BD6A 4V0OA 4GX5A 7REQA 1DB3A 1KO1A 1A8IA 3ZX4A 3OE1A 3FNHA 4W4TA 1HSZA 3PC8C 1YRWA 3SI7A 3PV0A 4EHKA 1KDOA 2BHLA 2RGEA 2VUIB 2H8GA 1WPRA 2RGAA 1GIAA 1QMPA 3E9CA 1DZIA 1LDMA 4CNQA 4JU9A 3K5HA 3IQZA 5DNYB 2UYHA 2R7MA 2ISCA 3FWYA 2XR1A 3C1OA 4U7HA 1FXUA 3R6LA 3C3PA 3WP0A 3NPMA 1DIHA 4ZO7A 5GV8A 5H68A 3ROFA 5B7QA 1X70A 1KH2A 1YZKA 1ZSVA 4JBLA 2VC2B 4DLZA 1FFDA 4TM7A 5HBGA 1R1DA 5IWCA 4QFMA 4Q7LA 2F1KA 3IOMA 3ITDA 1U5CA 1XJCA 3GNLA 2TYSB 3WB9A 2Z0MA 1Z3IX 2BFBB 3C8UA 4P5PA 3S99A 3IHLA 1W5FA 5HUJA 4O3FA 3NHZA 4MVJA 4CQMA 5LXTB 4KUGA 2IITA 2BD0A 3EMVA 5IAJA 4RVSA 1M6YA 2Q2WA 1GRQA 1WY5A 2XB4A 2FP4A 2QKYA 4XZ3A 1L7BA 2Q29A 4LTMA 4NAUA 2WPNA 2FOLA 1FTQA 2CNKA 4DEVA 2O7VA 2OBNA 5JS8A 1KVRA 4RF2A 1W59A 1VE6A 3QYJA 4DJTA 1QP4A 3GH3A 1M5UA 4B4DA 5F7ZA 13PKA 2ZRDA 3CG0A 1PO7A 2JH9A 3SOZA 3FDIA 1Q7EA 3Q72A 4ZK2A 1ABBA 3FNQA 5DBEX 3MBOA 1U31A 4H7EA 4UNIA 2YBEA 2F8SA 5D5QA 1R6VA 4ZTUB 5IJZA 4WNCA 4Y6QA 2PXXA 1R6XA 3B9BA 3G1TA 3ZU5A 2AH5A 1DLIA 2G76A 2B78A 2FP4B 4UDNA 3K9NA 3U19A 5LMNB 2NU6A 4HPJB 2VYNA 5CLJA 1TAHA 4KNWA 1NNEA 2XODA 1CY8A 4MMXB 5A0VA 1CNEA 4MVJG 3SOPA 2O8BB 2JZCA 1HK7A 3HXKA 5JCJA 2DLCX 4NYMR 1NQTA 2GGSA 4U5XA 5FT9A 1M7GA 2C59A 3L41A 2M1XA 4QLAA 4S3MA 3DFIA 5ILOA 5JYBA 4FM9A 2DE0X 2FXIA 4EYSA 5I3ZA 1QRRA 1WW2A 1KORA 4JENA 4L4UA 4HYYA 4BEWA 3EAQA 5CEEA 2FSVC 5K6RA 4HAYA 2B2XA 1BQEA 1IN5A 2OUIA 2PBRA 5AKJA 2Q1YA 5LP6B 3KWLA 1QIGA 4QEKA 1QWOA 2RKWA 1UANA 3EXAA 4OMUA 1EFVB 3DBRB 1QF9A 3D2LA 2VPPA 1EYZA 2PA0A 4HNUA 1M7BA 9ABPA 4A5SA 2IQIA 3A9SA 4J0GA 4EUHA 5DI3B 2Q4TA 3JQGA 3K7EA 3Q11A 1QHYA 3H1PA 1GTRA 3KVNA 4A82A 2L18A 4BNWA 4YUAA 1XPUA 1OTXA 2GH1A 3FPEA 3PHHA 4JKIA 4WL0A 1Z88A 2G0AA 3DOFA 2DFTA 3G0BA 3CXUA 2MYNA 3F47A 3QUTA 4MKZA 4PCVA 2IE8A 3QX7A 3L6RA 3ZDZB 3TTVA 1IQPA 2XDAA 1RFLA 2X22A 4CIDA 4F4JA 3QU9A 4Q9JA 4LF9B 1VKNA 4KDRA 1YD7A 4MJLA 1WBDA 4BZZA 2QSYA 1KWGA 4KZKA 4HDSA 1CVRA 1DL5A 4H7PA 1W76A 2I03A 3DE0X 4JB8A 1IVYA 2Z2ZA 1C9EA 4EJSC 4RZIA 4GSLA 2UUAB 1ANKA 1BROA 4OHBA 4R83A 4UULA 3D0RA 1VLLA 2UZAA 5KCZA 4MHTA 2VBIA 2ATCA 5KTKA 1QQAA 1KY2A 3FNFA 2QRMA 4WLUA 1R6AA 4BE7B 4HFJA 3JPYA 2Q3CA 1Q2XA 1PJQA 3THXA 5AKZA 1ADYA 5CNMA 5KWVA 3K30A 3I32A 1H6CA 1UFRA 2GHRA 2QVLA 3EIWA 4PPFA 5CJJA 1NX6A 1HKHA 3E1GA 5T57A 4QQKA 5I4BA 3HSKA 4BFUA 3PF8A 3VM6A 2HTEA 3C3YA 2EGGA 3CT4A 3NANA 4MLDA 1VCNA 1W36B 4CL8A 3OCJA 2X1MA 3OU6A 5F4BA 3UIEA 2XA2A 1PJSA 1NQXA 1QLWA 1E1CB 1Q6ZA 1JXOA 2F2TA 3Q7IA 3V6LA 4C22A 1A2KC 1X7YB 2QY6A 4JQZA 5HDQA 4IS3A 2QAJA 4FYMA 3AJ9A 4QYMA 1U9ZA 2NGRA 3P71T 1FDUA 1PQPA 3TZEA 1K63A 3T34A 3QVOA 1MPTA 4JYAB 1LW6E 3HB7A 4CF6A 4D9EA 3HP1A 4W5NA 2VDOB 3RHSA 4O2BF 3BKWA 4NU0A 3WGLA 2VUUA 4OCZA 3SDBA 2WJHA 3GXBA 2GEDA 1M8GA 1A8SA 4JBNA 1SIBE 4NI5A 2NZJA 1GG9A 1JQBA 2DPXA 5AKYA 2VCYA 3LZ6A 1GNSA 4R51A 3PE6A 4CKWB 2J9YB 2M6LA 3A3PA 3NHSA 1PJ8A 2P9GA 2RHTA 1J0DA 2PZMA 1MW8X 3ZLBA 1WBJB 2V03A 2WT4A 1GJRA 5FYDA 2VWPA 3JAKA 4HDOB 1F8FA 5IAEA 1IUKA 1XTRA 3ZN2A 2W58A 4NG4A 3DHWC 4HY3A 1QFJA 4XQCA 4WKBA 4EGFA 4D98A 1M5TA 1UINA 1BXRB 4OLAA 2VPTA 4ZCTA 1NM5C 3NDPA 1TPYA 1JH8A 3UF0A 1CZRA 4CG3A 1Z12A 4Y2VA 3SAJA 1G63A 3F49S 3OOSA 3FKJA 2GXQA 1T9GR 4JEUA 1K4MA 5DTMA 2A58A 3SJZA 1GNRA 2FW6A 3GT0A 3HBNA 3NHUA 1E1KA 2J67A 1DKPA 1DQZA 1Q1GA 1SVLA 3I4LA 4PC1A 1Y81A 1UC5B 2CCKA 3KWJA 3V9AA 3ZJ5A 5LDGA 2P79A 4RTLA 3KOZA 1DAMA 4KN6A 3U62A 4AQ7A 1OAOC 5LQKA 3RYIB 4UTOA 3N0XA 1Z7GA 4YGXB 3U5ZB 3BGWA 4V39A 4MGKR 5DYWA 5SZIA 4OTZA 2I5PO 3QF7A 4A0QA 4Q4CA 2A57A 4NPAA 3TQIA 1KZ6A 5DDIP 1OR8A 1QAQA 3E22A 3TEFA 1FYFA 2WIAA 2B1QA 3RE1A 3EF1A 3I2KA 4DM4A 4Q93A 3KKEA 3QELB 1VJRA 1FB5A 1UAYA 1RWQA 4GBMA 4PLYA 4GR5A 3UG7A 1MMFB 3HDVA 3F3SA 1DBWA 4DG5A 3FHTA 4WLNA 3CZQA 1ZL0A 2QQEA 1CKEA 4FN4A 1QRTA 4EPVA 1Y3FE 2PZAA 3PUIA 2JLCA 4CCAA 4OM8A 3UENA 3QKSA 3QXHA 1JSXA 3DW3X 3CNLA 1SUWA 3OHSX 2IPOA 5EP2A 3PYXA 1GG2A 4B5KA 3WADA 2P2CA 5GQSA 1ACMA 2YVKA 5DTRA 4DYVA 5BYKA 5F98A 1R3DA 4UZSA 4RZ2A 5TJHA 3PJGA 1Q12A 3PXCX 1WZ2A 3UO8B 2XIJA 4YJHA 3O4JA 1Y1TA 1R9NA 4WFKA 4Z1MA 5NLLA 1Y80A 2VDWA 3BF7A 4B82A 1RRGA 3SM3A 3SS8A 1URPA 1RRCA 1T9BA 4TVKA 3BE6A 2OCPA 3M6IA 5DN6A 5B1IA 3M3PA 3WBKA 3UXEA 1I3CA 3OLCX 5ALMA 4FWTA 4DSUA 4CQNA 1Q95A 3TPCA 3DAOA 3OI7A 2J08A 4ZK6A 1S3GA 3LLUA 2CMFA 2JFZA 5H81A 4ZI7F 1TJ4A 5H3LA 2GZ3A 2P2NA 3ADPA 2BRUA 3GL9A 3OE7A 4F04A 4IRXA 1GEEA 4MVJM 4RA9A 2ZJYA 4RV4A 6ABPA 3A1WA 3OHPA 4CJXA 5JJIA 3CJTA 3GBVA 4AZSA 1UZUA 1QPBA 1J4AA 3DG9A 4ZICA 4O4HF 4P7BA 3O8QA 1OA1A 2NTYC 4BMVA 1XEAA 4PZEA 2IEZA 3ZCXA 1CF4A 3BICA 1D5CA 3DMDA 3WXBA 4UU0A 4FZJA 5EP1A 1U6KA 1TEXA 3IPAA 3M4JA 2NXNA 4LBZA 4M8LA 2PVSA 4Q3AA 1EFPB 5THQA 1R37A 4ARBA 4UOQA 3M6WA 4WHMA 2C94A 1ZCFA 3W6PA 5F7JA 2FWJA 2DUJA 3KLOA 3AUYA 5A02A 2X2OA 2WVAA 3BXXA 3HJCA 4BBJA 3HEAA 2BUAA 5G1PA 5DTQA 2F17A 3QI7A 1T5IA 2OQ2A 2AN5A 3F3MA 3PTLA 4NBVA 2I6XA 3R0ZA 1PJBA 5EGNA 1A4XA 2WWIA 5ER6A 3OO1A 1IMOA 3IT2A 3CF2A 4N4AA 4WADA 3NQ41 2XAAA 4MPJA 4HAWA 5GJVC 5IVHA 3T7RA 3BFXA 3QY0A 3O1HB 2PUTA 3I6ZA 4EVRA 2JJ2D 3EW9A 3EA4A 1JR6A 4TYQA 1ZEMA 4M1OA 2V59A 5HZGA 2R6DA 2ZJOA 3PUXA 1CR2A 3IERA 4C0AC 4OFBA 4UBOA 4DG8A 2WF6A 4OY3A 2GARA 3CZMA 4EVQA 3VSCA 2BMJA 2XNSA 1EFRD 3LKVA 4B6PA 2C97A 1NVWQ 3LCJA 1WXFA 2X23A 4HGRA 3RIEA 3FSJX 3KEGA 4DUGD 1CDEA 1NMXA 3AB8A 1SBIA 4I4TA 4FYYA 1K7SN 3IUQA 5EHIA 3GVIA 4E7PA 1NMQA 2HK6A 3G1WA 4RIIA 4DHEA 5AHWA 1VHDA 2ZRJA 3L1UA 5I9SA 3OQVA 3ZR4B 1XJQA 4MQMA 4PRYA 3U7HB 1BGVA 2FSHA 1WL8A 4IZHA 4FYJA 1K88A 2FZWA 1NJ6A 2Q0QA 4JEIA 4UEQA 4J0CA 2X77A 2XB9A 3L9WA 3CRNA 3IR6A 1C3OB 2JGAA 3MW8A 2DUUA 4DJ5X 5D51S 3KZMA 4A27A 1V9LA 3EHDA 1QSGA 3BD9A 3IKLA 2XF2A 5FBLB 4ZVTA 1QYIA 2AR9A 2P62A 2BF7A 3IRVA 1PJ2A 5TSDA 1X80A 3OKCA 2ISQA 4R8KA 3TH5A 3UT5A 3T94A 5KUTA 3RKRA 1CJVC 1ECJA 1MB9A 2ZSFA 4AP9A 2I4LA 4ERXA 2IGBA 1P6QA 4PU0A 3WJAA 2PL1A 4Q1EA 3ZGYA 4ZHQB 4RTOA 3MRXA 3ZLTA 1DRKA 1PTJC 3IYLW 1VMAA 1GNPA 7ADHA 1V37A 3G9QA 4X1OA 3L6CA 4QPDA 3OQHA 4PAQA 4R05A 3CGGA 3U1TA 2AE2A 3SEAA 3MT0A 2PWZA 2WM2A 1OSNA 3EGXA 2A0YA 4H6VA 4LYEA 3ZLVA 4TQGA 4J0KA 4QTXA 1N0HA 2V9CA 2VSFA 3UJ8A 3TUZC 1M9NA 4N03A 1BYUA 5JMOA 2VQEB 4MV6A 1AUQA 2YWHA 3ILVA 3X1KA 2PFGA 2R4QA 4CM6A 5D6NA 4HPXB 4TTVA 3VU8A 5JW6A 2FX3A 2JBAB 2JCGA 1ZUIA 3GJXC 3H3FA 2FKAA 3TLAA 4BNKA 1QQTA 4WKGA 1JEOA 4DJDC 4PEVA 1NFRA 5BV8A 3JQRA 4F92B 3UJDA 5JH7B 4XGRA 2V7BA 4NMXB 1NQOA 7AT1A 2QRKA 3CKKA 3WK9A 2A5YB 4GQIA 1PEKE 2NZ8A 1VHWA 4F2DA 3TBHA 2EFHB 4WBNB 4FT2A 3RQSA 1OPXA 1A50B 3K9CA 2OCKA 1WXGA 4FLEA 2Z9CA 1AKEA 4N8EA 2LCQA 3KXPA 3MAGA 2IOFK 1IBMB 3LUAA 1A71A 1QV7A 3W5DA 5DTIA 1C3LA 1PS0A 2QYTA 2X3UA 1Y3IA 3M4NA 2XMDA 4OK5A 1PZHA 2WWYA 3GP5A 1JFSA 1W75A 2OBMA 3IAXA 2IH5A 1MT3A 1RTKA 1U7HA 3R5FA 4PR0A 3RC2A 3JQ8B 3QU7A 3WWEA 1J23A 3UAGA 3WLPA 3SHOA 2OCGA 2FRVA 1K4YA 3N39C 3NT2A 5AKGA 4FKZA 3GUCA 4MQEB 4B73A 1X1DA 2QTHA 1U7DA 3AP3A 4WE3A 4WBXC 2HXGA 4QO8A 3GEDA 4R40A 2AKYA 3FCSB 5HOEA 5IDXA 5FLYA 2WWVD 3IE2A 1E6CA 2FSIA 3H4TA 1ZGGA 4MEJA 3PFHA 3U7QA 4NBLA 2X0IA 1MX1A 4AYXA 5KYYB 1E5VA 3T0FA 3QBEA 1PU2A 1FVXA 2XNJA 1MXHA 1D2GA 3ASYA 3HADA 4INZA 4JD5A 4S0XA 3RASA 4ER7A 4ZVQA 4DNPA 2WIBA 2GEJA 4RULA 1OHHA 3KDSE 4KN5A 2XSZA 4XWWA 1KYZA 3FVQA 1NYTA 4JB3A 2ZBRA 4OFZA 3RHFA 4TL9A 3TLYA 4BWGA 4KQJA 4CIVA 1GXSB 2JLQA 1A4RA 2QGZA 4QNNA 2ZRLA 5BVHB 1C8VB 1EDZA 4EHFA 5I7VA 1HYGA 2VAXA 4TLEA 2DETA 1CF2O 3B53X 3LBIA 5G3ZA 1UJ6A 4HVLA 2QP9X 1C9YA 1FS5A 3VR3A 1KA9H 1VHJA 2FDRA 3AI7A 3ZS9A 4ES6A 1SMKA 1XU9A 1UK9A 2QV0A 4LPKA 4PR3A 3QW2A 5L4LA 3B82A 1GAEO 2F1JA 2V0GA 1CB7A 2OO5A 2QM8A 3CR3C 5EI5A 1GDTA 3L8MA 4ZOAA 2RI1A 4XUDA 4XLLA 2ZIZA 1PN3A 3HV0A 2PKCA 4D92A 1R6TA 4BQFA 1NZDA 3LP5A 4WCFC 4LYFA 3CWQA 4JJ4A 4B35A 2P4UA 4ENRA 2A5FA 5ALFA 3WICA 4LWOA 2ZR8A 3GFBA 3CEMA 1R66A 4YAOA 1MOPA 5ENVA 4EB3A 5LQMA 1Z16A 4CHTA 1FTYA 1ELOA 2W7TA 4KJXA 1KI7A 2Q9UA 1WQ3A 3E53A 2NU9B 2QVGA 4I5FA 2Z8ZA 1M2WA 3IIMA 3LQFA 4LVNA 1CJTC 2QTRA 2HRQA 5BSWA 1DC5A 2NADA 4MAFA 4B4VA 3DBHA 2NO1A 3CLSD 4MGYR 2GLXA 1WCWA 3L7OA 3JQFA 5MGNA 3URMA 1FFHA 2HJVA 3EN0A 1Z15A 1Z36A 4Y18A 3RJTA 5AH0A 5JALA 5K3AA 1YS2X 3S70A 3EEOA 4C04A 2WJVA 3GAZA 2L17A 3ROKA 2DOKA 3O9VA 3EVCA 3N2LA 3FNBA 4UM9B 3K5PA 2QBYB 1W0KA 2VQDA 4JL6A 4X54A 4UVDA 4EJ6A 5IANA 4BTLA 2O1XA 2J4FA 4AURA 5A0TA 2QE7D 4GOLD 4HDRA 4P0QB 1UBJS 4JQSA 4D25A 2RKBA 4WVLA 1R0BA 4ZYLA 1YFZA 4AKHA 4CM8B 2CE2X 4FN5A 1T2UA 1PRYA 4JN6B 1H8HD 2VK1A 4DSNA 2JAUA 4EHDA 4OU5A 4DCOA 3BRCA 4K7JA 4IHKA 1UXJA 4Z3KA 5LD2B 1W52X 1QU3A 2JLYA 3HCPA 5EHZA 4R8VA 3AIMA 4BVFA 3GJ8A 4PGMA 4HRAA 1JQKA 1YK0A 3WYDA 3L82B 4LXYA 1L4KA 1SKBA 2CFCA 1C2YA 4OHKA 5EKDA 2QBYA 1LLFA 1XE3A 1NXWA 1RP1A 1OLSA 4KGDA 1WDWB 1JX6A 2C0CA 4NMHA 1FNNA 2C57A 1H05A 3S5UA 4ER6A 2RHJA 3D7KA 3NONA 3BQMB 4RHYA 2B9VA 2IBMA 1ZY2A 2TMKA 2QU8A 3TKYA 3U3KA 4D4JA 3WYAA 2OILA 2P6MA 3QFFA 4Q4JB 5A5VA 3QV2A 2V1UA 2EW8A 2A30A 3C6BA 3KQVA 2DKOA 1ZGBA 4G1FA 1CV2A 4JASB 4MVJH 1GV1A 2VPQA 1PT6A 1RADA 2IYRA 1EU1A 1RQPA 1QX3A 2VSYA 2X7XA 3FROA 3PR3A 4J03A 3RWMB 3VZDA 1YB7A 2BEWA 1FTSA 1M0WA 1P2SA 2VJKA 2YYYA 3B2EA 5EEGA 4Z7JA 4X66B 3T7TA 3PPYA 3D0KA 1HORA 4O6VA 2W6PA 4TQUS 2C78A 3C3XA 1Z0ZA 3DYBA 3TL3A 4EQ6B 3T35A 3PPXA 4AMGA 4HD8A 4OM7A 3GX1A 2GSDA 4HEA1 3N5CA 2E49A 4LJ4A 4CMKA 1NR5A 4UASA 3ODGA 3QU5A 4MWSA 2ZXUA 1O96B 3DT8A 4LXTA 1KFBB 1WDLA 1NFQA 4G8CA 4LZZA 2DULA 1IEQA 2CYBA 3QOXA 5D2CA 5AI8A 3TXAA 3RREA 2QQGA 3G88A 2FVYA 2O3UA 2YJ4A 1G7CA 1MCZA 1XMSA 3HYRA 2X1LA 4ZT7A 4MIOA 4Q4JA 3IHWA 4LVOA 5TV2A 1GZ6A 5FP0A 3EAFA 2JRCA 1YT5A 4IF6A 2F64A 4M76B 3MSXA 4WKNA 4DE5A 1XNQB 2CB0A 4BLPA 1MBZA 2PG3A 1EP3B 4REMA 3D6UA 3CVVA 2FSUA 1DC6A 4DRXB 3O1JC 1F48A 2W5UA 3P9YA 3OT1B 3R9IA 4EEXA 3FZQA 4MUGA 1QPZA 4AECA 1Z6ZA 5C53B 2Z9DA 3OF2A 2ENUA 2HJWA 2I9KA 2VYND 1XDUA 1EUQA 1TIBA 1I3MA 1KYWA 4TWAA 2IHUA 1GFIA 2AFHB 3FNRA 4UM8B 5FD8A 2I6GA 4DA8A 2C96A 1NNSA 3PWSA 5AFSA 1L8LA 3V8EA 3UVEA 2I1VB 3TLGA 4IVRA 4ZVOA 5G1OA 1FW6A 3OLZA 5CLFA 1GQFA 2C92A 2XNKA 2PKYX 1KP3A 2HY7A 3QKRA 5E2IA 1R0ZA 4CN8A 2O2CA 3E5NA 5JAMA 3PJDA 1APBA 4AC9A 1ZRNA 4DB2A 2OB2A 1EDBA 1S7CA 5H4GA 2MCFA 1VMKA 2IEDA 3W7BA 4ARZB 3PNOA 1U3TA 3IH5A 4DV4B 1AIPA 3U7EB 2CJFA 1PUIA 3ZHZA 3UJ6A 3T5GA 3BXEA 5BNZA 2IC5A 4LYDA 4QASA 5DGXA 5T8KC 2W83A 1F2UA 1ZH8A 4BAUA 1YF3A 5FR1A 1TM4E 2IGTA 2Q6VA 3HS3A 1O6GA 1TUGA 3FYUB 4M1ZA 3SDSA 4ZHQA 1TM5E 5IM4F 2A3RA 2D8AA 5DNCA 1B23P 5K2OA 2Y2VA 4LC9A 4HNSA 1OI7A 1T8YA 1BX3A 1GHTA 3H2ZA 2FG7C 1MIOA 3GJ3A 3O9ZA 4OOEA 3N2EA 4P2GA 2D62A 4ODIA 1BU8A 4QOEA 2FMTA 3S1LA 1O95A 4OMDA 4FCTA 2HA0A 3SICE 3ZZ0A 1H1LA 4W5JA 3O8OB 4CPDA 3HXTA 4JY7A 1ST3A 1GDDA 1Q91A 3C3CA 3HUFA 3N0WA 1EAYA 5CLHA 1N6NA 1MG0A 5A5DA 3B2NA 4M46A 5F21A 3KEFA 2R7KA 3BJRA 3ASZA 4BX3A 1U0BB 1RWPA 1TJ3A 3AR8A 3F9IA 1WIWA 2D0IA 2VAVA 4FE3A 1UKBA 3SR0A 2P3QA 5K0TA 1NDHA 1G5TA 1C3EA 1TT5B 4FGSA 3DM9B 5EXXA 3G5AA 3UUFA 5CW1A 2OVBA 3MTIA 1N6PA 4GI5A 2R9VA 1Z0DA 1YE5A 1ZBQA 4TWIA 1IAVA 3H42B 3CH5A 4WDQA 3IL2A 1O6BA 4GZ6A 4EKIA 1HNXB 1D2AA 2XMBA 4ZA2A 5A9SB 2H1VA 2CE7A 2HLNA 5HZMA 1OKKA 1M8PA 2ODEA 2V96A 4RW0A 1YZ3A 1VXRA 3QUSA 1ADBA 2G9RA 2E5WA 1SCBA 1E89A 1Y3DE 2LDXA 3AEUA 4NNJA 5DN9A 1Y5MA 5EVCA 5HK8A 3R76A 1C8KA 5CFQA 2ZB4A 1KYYA 1XCBA 4MB6A 5LIPA 4TTIA 3LF1A 1E2NA 3MT8A 3DMGA 3GLKA 4Y6OA 1U5AA 3MUOA 2V9PA 3I64A 4LYYA 3RRZA 1AMUA 1CZHA 3ZDYB 1EVKA 4D82A 1Y5LA 1UWKA 2FQQA 3BMQB 4KJZA 4M9UA 4URZR 2WILA 4BAGA 5IABA 3SKXA 5LOVF 1W30A 1WB9A 1CULC 4DY4A 1QG6A 5KYKA 4RGVA 1TT7A 5A3JA 5C8ZA 1EWYA 2WEKA 4Y1EA 3ZE6A 4BZPA 2X8LA 1CETA 2ZE5A 3QLEA 4C9BA 4KDEA 1IXKA 1N5MA 2WHEA 1EVEA 1I2MA 1V1JA 2D2FA 2HWXA 1GUDA 3B6EA 3QLVC 4FD3A 5ICSA 5LN1A 4HDSB 5A3QA 2VNHA 3CNOA 4FFBA 4V1CB 1GL3A 3JASA 3MS4A 2OC9A 4AKTA 1KHHA 4RD1A 4V0NA 4BVHA 4LXUA 2HLPA 3HNOA 1DBVO 2C58A 4J9UE 3QH4A 3ZHVA 1YR8A 1MJNA 1KY5A 4A8PA 2Q5QA 2VNIA 1SXJA 2N0SA 3A1NA 4CMEC 1M2OB 1ZD8A 1NGSA 3EGIA 3AC0A 3M83A 4HTAA 4X95A 5EUMA 1AMOA 1HMYA 4MQFB 2VYVD 2DPHA 2B83A 2W2KB 1IHYA 3UICA 3D4PA 5LOVA 1TLTA 2NQTA 4UARA 2XYHA 3A6LA 4D4HA 1E6MA 2XECA 4TYNA 1L7NA 4G1MB 4KREA 1XCJA 1SOAA 4FTWA 4BLTA 1J0XO 2C0PA 3W5CA 1YBMA 4IIGA 2D5BA 2C9ZA 4I5IA 1SQGA 1W5SA 2CXUA 3C7DB 1SVNA 5I9LA 1ZIDA 1XTKA 2H1WA 2XMGA 2ZIWB 3CG4A 4DIBA 5IKXA 1X7YA 4OUDB 4HZGA 3Q12A 4RD3A 4D9MA 3BC1A 1OQAA 1WSBA 1E79A 2AOTA 4QFCA 4X6YA 4DLYA 1CC1S 3MMNA 1O89A 3HMKA 2XQGA 3F5SA 1GZHB 3OUUA 4JA2A 2VEDA 1MO4A 2X5XA 5F73A 1SU4A 2WK1A 3ADBA 2GNOA 4HX9A 1UXGA 2WJ4A 4UXHA 1DVRA 2R6HA 3ZWOA 1ZUD1 4EYKA 1C7ZA 2FUNB 3B5EA 2O7NA 3NC4A 1TFUA 3ADKA 2C2MA 2E48A 5C52B 4MYUA 4FMBB 2NU6B 2QM0A 1PZGA 4ZXFA 4XIGS 1XN1A 2VT6A 4JODA 1UBUS 3L7IA 2GN4A 5IS2A 4BC0A 2J5BA 3FZEA 3W4KA 2H7YA 1BS9A 1PLKA 3ULKA 3AUKA 1ZMXA 5E0OA 2IH4A 4MAMA 1XTUA 3KKOA 4FFMA 4XJTA 3TTUA 3UKOA 3DSRA 5F5XA 1CQXA 4AW9A 1VIAA 1H2FA 1P4AA 2P6UA 2VHYA 4NHOA 4XIIA 4CMJA 3T7AA 2XXAA 1XB2A 1GPWB 1CEYA 2B4AA 3JQAB 4IGKA 3FYUA 3HFJA 1V48A 4CYMA 5CPBA 3X43A 1A97A 1G6OA 5DSXA 3TKAA 2PWBA 2VSXA 3OE7D 4MA4A 3UK2A 2PN1A 4U7JA 1NY6A 5GV7A 3RK4A 4B9AA 5EJ7A 3AYZB 1N3LA 1UQRA 3KXIA 4IDAA 5JDIC 4U2GA 3Q6MA 4L0DA 1ABFA 4Q4HB 3SP1A 1HDEA 1QZ3A 1AB5A 3HXPA 4WCFA 4DUZB 1GGHA 1ZD5A 3UXMA 3GRPA 4B17A 2N47A 3ODPA 5JANA 5FLXA 4U39A 3G13A 1A9YA 1K6IA 2E37A 3JARA 2FH5B 2BFDB 3PUWA 4F91B 1DPGA 4MS3A 2PKQP 3F3YA 4HWOA 1KI9A 1P61B 1EFVA 1T2CA 3WGKA 1Q17A 1WP4A 1CY4A 1SQ5A 2TMDA 2Y77A 3QITA 3UM9A 1XZQA 4GUDA 4CDRA 2HT1A 1XOIA 3PWKA 4TQAA 4I36A 5UKDA 5JDCC 1O97D 1MO2A 2SKDA 3NHPA 1WWKA 1GGNA 1TB4A 5EZ6B 3RAJA 1M2HA 3TQSA 3WL6A 4U6SA 4KQMA 1C9NA 2OMKA 3E2MA 2QQFA 1PEYA 5DTJA 1YQUA 2A8YA 4DLSA 3G79A 3OURA 2AG5A 5AW2A 3IA7A 1E3WB 2JLRA 4ERNA 1X7HA 5A4FS 3R0XA 4EKYA 2WQ6A 4N54A 5ALJA 2X8JA 4P4SB 4QG7A 1DRWA 2W43A 2YNMA 4L75A 4G1EB 1W9MA 5DWVA 1T0JB 4KOAA 4OB7A 1I7PA 1U0NA 1WF3A 1NDQA 2BZSA 3KHKA 4BC1A 4KPGA 1TM3E 4MXDA 4E2FA 5JC8A 1HTTA 1ULTA 3E03A 2AOUB 1J2YA 1M0TA 3A4NA 3H05A 5FV7A 4BNHA 3L1KA 4CW7A 5LXTF 3IUMA 1RSZA 1OFUX 2IY8A 3OCWA 3WP1B 4ISBA 3E58A 4X7RA 3U4DA 3ZYCA 4RE6A 4WKOA 1HX7A 4B32A 1U8XX 1ZIXA 4NQZA 3TYXA 2Y1LA 3BSWA 3UMFA 1GSIA 1ZESA 1H9BA 4AY4A 3TSYA 5IUKC 5KOIA 1RHQA 4EI7A 2QZ9A 4AP6A 2HJ9A 1PD0A 2L2QA 2WU0A 3OLYA 4MINA 3H3XA 4OXIA 1FYDA 2FW1A 4QREA 3UCFA 2W2KA 5EKUA 2P9FA 4V02A 4UDXX 1VIMA 3IDOA 5LMUB 2C77A 4IZIA 3WYFA 1ES9A 4BKRA 1GKKA 2QJOA 3RG2A 4DRXA 1UKZA 1Z73A 4LRUA 1B6GA 2IT1A 2J0UB 1I33A 3OT1A 1UM9B 1SVOA 1PAUA 4G41A 2AOUA 1ZCZA 4KMRA 4ZOLB 2NZWA 2W22A 2XMRA 4LRSB 5B4VA 5LDHA 4LJ5A 4TLDA 5F2OA 3A1DA 3FN4A 4PYMA 4TKUA 1YAJA 4A6XA 1YS9A 2B8JA 5AMXA 2BJHA 3RR2A 3GLIA 4D6YA 2XZLA 3BMCB 3I12A 4KFSA 5DB4A 4JWTA 4U2BA 2V0NA 4K9KA 3LO8A 5LJIA 3FCAA 4W82A 5DNUA 3GEIA 1AE1A 1JKJA 3S2SA 3MLAA 3PD7A 5CJ2A 4B40A 3MJHA 2XCSB 1HH4A 4YCLA 1LPNA 3ZXYA 1SCIA 4IPTA 1TU3A 2FF7A 1K7FB 2IKQA 1JA1A 3UMVA 1EVQA 1RXIA 3C8DA 2QN1A 1N7IA 4JS0A 4X5OA 1V8BA 2OWEA 2IHKA 2ZJ4A 1USVA 4A26A 3MGCA 1A98A 1CQIB 1NA5A 3CT6A 3AUSA 3L9XA 3DZBA 3DZGA 4IDBA 4BU0A 1YIOA 3CMMA 5I7WA 3RYFA 2X4GA 1QIKA 3G0GA 2DXIA 3RM3A 3ZWKA 3OZGA 2H1HA 3PZBA 4QXAA 4X1KA 4YMWA 4HLUA 5SZJA 4BO0A 1P3JA 3MXOA 1YZQA 4V03A 4ZYWA 2YJ6A 1B0ZA 1PGNA 4YVFA 4W5OA 1T4GA 3E4DA 3HYTA 1PJZA 3FI0A 4LEIA 2MYUA 3FNEA 1IK6A 1J7KA 2VEOA 4HH1A 5T6MA 3VISA 4YLYA 3S8EA 2JAOA 3TDNA 1PEDA 1HO3A 4LXGA 3EY9A 5DM0A 4E08A 2BZGA 5ITWA 4JI0B 1DJPA 3L92A 2AI3A 2DFPA 3X1MA 3CW9A 2JGEA 5ALDA 2WY2D 3A2LA 3GJYA 2JF0A 4PHFA 4Q4HA 1NVAA 3TX2A 3FDFA 4PY2A 3OCZA 4B8ZA 3IUSA 2O8FA 3FF1A 2CCGA 1XD2A 2H4JA 4YP7A 1IIBA 4DCPA 2WJGA 4IH4A 3K9BA 5FXMA 1YL5A 2ZJAA 3G7NA 3WO1A 1X7GA 2AVDA 1JHRA 4ZJPA 1J8MF 3BJEA 4IHJB 2X9GA 4EHHA 4IOJA 4PAMA 7GPBA 2EWMA 4UAGA 4QQ8A 2WJYA 3RK0A 3RU9A 5ADUS 1VJ5A 3KVOA 1XVTA 2ADMA 4Q1DA 2BI7A 5AVWA 3I30X 1GGJA 2VZ0A 3QUQA 3HL4A 2YJ3A 2A33A 3QU4A 2CXNA 4NCAA 2R84A 5HKOA 3BE5A 2KLHA 2AMJA 1Q3KA 2XDWA 3FVTA 3LSYA 3HJHA 3MJFA 3V32A 5ALEA 2BELA 4NFYA 4E2YA 2J85A 1NJSA 2FNAA 3GHHA 1RCTE 2R5NA 1I4EB 4AU1A 1J00A 1L7PA 2Y93A 2QSZA 2PX5A 1QJCA 1V43A 2W8BA 3KO8A 1O94C 3D5TA 1M1YA 5EZ5A 2ZT8A 4Z7OB 1DT5A 4RSHA 4D4LA 4E1AA 1JW9B 2X4IA 2WP8J 2HLHA 3CUVA 3BS4A 4HGNA 4N3BA 5KNCD 3KE9A 4P3OA 3HVIA 1ZD1A 4B7ZA 2BVNA 1GR0A 1KJZA 3VC2A 5ADVA 1VP9A 2XMCA 1FSZA 5FOXA 4BFCA 3QWAA 3IBGA 2W2PA 2EBHX 1GEGA 2QTVA 2YOHA 2WJ3A 4CQMB 1HDOA 3WGNA 4CU5A 1KRWA 4M0FA 5B3JA 4UBIA 4R2IA 3QYFA 2QJWA 1Y5RA 2DFKB 1JFVA 3DWEX 4XTRA 2GKOA 3ZCTA 3OQJA 4JBWA 4JJFA 3CYFA 1C1DB 1TYCA 2FZEA 2W93A 2WTBA 3ELUA 5J2UB 1T10A 3LIIA 4R1NA 5JOQA 3KXDA 1YJBA 3EZGA 4BNJA 3R7WB 3CRVA 4WMLA 5LOVB 2PUAA 4MVCA 3IAFA 3KELA 3FOFC 3K72B 3HKEA 3WBJA 1OWNA 1QFSA 4JP8A 1P1IA 4Q24A 4PZPA 1SK9A 1ADFA 3HSYA 3OU2A 3ZI4A 2ANCA 4ABTA 3PR1A 1YB5A 2EATA 2I33A 1Q57A 2A59A 1C29B 4MJ7A 3BQNB 5CDGA 2OLKA 5HQTA 4U2EA 1G66A 2IA5A 2GT1A 1MC4A 5M5BA 1P0FA 2DBRA 1PG0A 5HF6A 5KNCA 1KQFA 4DA9A 2D54A 1T3GA 4NFLA 1LTKA 2OBLA 3BCRA 3SS7X 3CX4A 1N77A 4GYYA 4CF7A 5CNKA 4O2AB 2J0VA 1N5JA 3T3GA 2ZI4A 1ZK2A 3MTJA 4LGYA 3AR3A 3CPHA 3DVAA 3RTDA 4DJFC 5KWSA 4HVTA 1CEQA 1K0UA 1W19A 4JUFA 1P7ZA 3PXDA 2DC1A 2DTDA 1D6NA 3LUDA 4K8RB 5DRYA 1ILWA 5CCDA 5H4HA 1CNMA 3ML1A 2LV8A 3WJ1A 3AF5A 2WFAA 4CCYB 4MV7A 2OCDA 2PU7A 4I08A 4X94A 4MQ5A 1PWYE 1VLJA 2BRUC 5LYYA 2HMTA 1K8XB 2VJPA 4UM5A 4C88A 5HCNA 4F4FA 1RJFA 3Q5EA 5EIAA 5CMLA 3L43A 3KK0A 2QR5A 3DMTA 3MEQA 5HIJA 5TB5A 3A9TA 3F98A 4BVLA 4CUZA 3E22B 4I5GA 3ESRA 3GGPA 4QOSA 4Y2SA 4LRXA 3BWYA 1IZ9A 2IEYA 1GN8A 2GA8A 4HUQB 5BR1A 1M8FA 5JXGA 1SCUB 1TQ2A 1XZCA 2ID7A 4LUCA 3GW8A 4EI9A 1TCUA 5K4AA 1IE3A 1F3LA 4KLRA 1PQ4A 2JVKA 2G1AA 4BOYA 3PGMA 3ERCA 4G3XA 3BTSA 5EOVA 3R20A 1BWRA 1LDYA 1HNNA 1XALA 3MHPA 3O83A 3SIXA 3RVSA 2F9LA 3STUA 4CU2A 4LYJA 3SVZA 2ETVA 2AKEA 2CK3D 1DLJA 2XQFA 2ZP1A 5JPIA 3ZZUA 2Q1SA 2R62A 5LQSA 3I6QA 3GJ7A 1BAPA 2I2BA 1RI1A 1UC4B 3WI7A 1C3OA 1QYRA 1UT8A 4PLHA 2V74B 4C78A 3SQXA 4AUEA 4BDSA 1EJ2A 1PL6A 1COWA 1PZMA 3H13A 4KU4A 3GA5A 4AB1A 4BVGA 2A9JA 4C21A 3BB3A 1IEVA 3RAEC 4ARUA 1SHJA 1RXVA 2W6ID 1ID1A 1YTLA 4U8GA 4MB2A 1JFFA 3PXBA 1XTQA 3PNMA 4NIMA 3AR5A 3BGIA 1C7RA 3B38A 3STTA 4X62B 3BXOA 1Z5GA 1T8SA 2HBQA 4BNLA 1RHKA 1KEWA 1KJ8A 1OD6A 2IYQA 3A06A 4HATA 4J2OA 4L8WB 1Z6XA 4Q4LA 4LSMA 3VNAA 4DOMA 2EF1A 3KQOA 4E12A 1M1ZA 3GY0A 5KPJA 2ZVPX 1JEYB 3GPBA 1QHHA 4UU7A 4IHJF 3FDXA 1R5BA 3H2KA 4P34A 5EXTA 1FFSA 1CF9A 1TTPB 1YIDA 2WIJA 3LYAA 2B6NA 2VRNA 2Q4EA 3FB4A 1XRLA 1KPGA 3GZ4A 4FZRA 4HH4A 4LE2A 2Q5EA 2AVNA 3KFLA 3DE4X 4UQPA 1F0YA 3I9NA 3TMAA 1VG0B 1WU7A 2HH9A 2RG1A 4RDHA 4UCQA 1FDTA 1K8QA 5G1NA 1I5OA 1I1NA 3D4LA 1PSWA 3ACCA 4ESHA 5JUWA 1XMXA 1Z0KA 2B8WA 3B78A 5BN4A 1N9KA 2CK3A 3LUHA 3OCUA 4G07A 3RT7A 2VNSA 3NT5A 3G1UA 3ZBTA 1E6UA 2A0WA 1MXFA 1ONPA 1JR4A 2C04A 5ISMA 3TIXB 3R8FA 2VXYA 1BIFA 4OXKA 2BE7A 4P98A 3MINB 4I4NA 5P21A 4F3YA 5JDCA 3GJTA 4IOLA 3EVZA 2C9DA 1GL7A 4AKSA 4PGAA 2G77B 1NF8A 4RZHA 1KMIY 4E4RA 4EJFA 1OTYA 1I7LA 3COSA 3T9BA 4AJHA 2JK0A 3VI4B 2I2AA 3L04A 5I3CA 4OAOA 3MA0A 4PZZA 3I8SA 2QY9A 2C5GA 3HI4A 2JATA 3QK7A 1OU0A 3NIDB 1H5NA 3WA6A 3OZUA 3PVCA 1T5BA 2FX2A 3LDAA 3V4RA 1JDZA 2FSFA 1L5GB 3F2IA 4B0OA 4RAQA 5H3HA 4L08A 1EP1B 3B6JA 2CGEA 2AQHA 2FP3A 1DSSG 1XROA 5AHRA 2RC6A 5LB4A 1S2OA 3H1FA 4KPFC 4BNZA 1KZ7B 1EKXA 1V5EA 1RWVA 3DCYA 1GN9A 1CRLA 4I6JA 3C8ZA 1WKCA 1JHUA 1P9NA 3L7DA 3QF4A 4MVXA 3WZ2A 4AZ3A 2PGAA 4MQEA 2G83A 2J33A 1T1IA 3AZQA 3GOHA 4G65A 4GPAA 5BWMA 3RSLA 1J70A 3NFRA 1B7GO 1ZLYA 1K6XA 2X42A 3C6XA 3O7WA 3OC6A 3A4IA 4YUVA 3SXUB 4EF5A 5KIAA 1F5NA 5JU6A 1KOGA 1G8SA 5DNEA 5A5EA 3JAMA 2D7DA 3K32A 3HB1A 3GLGE 4FW9A 4EPRA 1RD4A 3LQQA 3IEKA 3CEAA 3NHJA 4L9RA 4O1MA 1OT3A 4KWIA 5C31A 4GL2A 2R7LA 2V7GA 3UNXA 1FTGA 1M6WA 1PGOA 4FWIB 2Q7DA 3W1VA 5FULA 3AILA 4Y2PA 5DASA 3RYHA 2JJMA 3IALA 2UUOA 3KP1A 3NASA 1ADCA 1EGAA 3P45A 4NNOA 4PC2A 2EDCA 5B1SA 1Q1ZA 2G7ZA 3TCXB 2G82A 4DCVA 1VLHA 2FDXA 1KQOA