2BS2B

Quinol:fumarate reductase from wolinella succinogenes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Transmembrane Proton Transfer in a Dihaem-Containing Membrane Protein Complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords QUINOL-FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A
total genus 64
structure length 239
sequence length 239
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2bs2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bs2B01
2DBYA 1QLBB 1DGJA 1E9MA 1E6EB 1QOFA 2QIEB 3B9JA 1AYFA 1L6VA 3NVVA 1JQ4A 2MJEA 4N59A 1NENB 2FBWB 3AV8A 5H92C 1YQ4B 3AE2B 4KX6B 2B76B 1DOXA 5G5HA 4LTUA 4N6EB 1TJEA 2JQRB 1J7BA 2E3TA 3AM9A 4ZHOA 2N0SB 2WLBA 3AEGB 3PO0A 2WU5B 1IUEA 1NYQA 2AX5A 5EE1A 1TYGB 2WDVB 1J7AA 1GPXA 3VRAB 1UWMA 1N5WA 2QJLA 2W3RA 3AE8B 1GTHA 4YSYB 1JWBD 1WGKA 1DOIA 4YXDB 4YTNB 1GAQB 1OQRA 1V8CA 3L4PA 2W3SA 1QT9A 2BS3B 4HRSA 1R7SA 3CF4A 2M56B 2EKIA 1FIQA 1TKYA 3P1MA 3SR6A 2BS2B 3BIID 5AUIA 3VR8B 1TKGA 3DWGC 4C7YA 3P4RB 1SB3C 5H8YE 4YT0B 1FFVA 3VR9B 3LXFA 2G1EA 2WDQB 1J7CA 5C2TB 2LEKA 2MJ3A 2PVOD 2W55A 3P4QB 4A9AA 1FMAD 3CIRB 1FRRA 1ZP0B 3WCQA 3AB5A 1NYRA 1E0ZA 3B2GA 4C80A 1XLOA 2JX5A 1VDVA 1N61A 1QOBA 1SIJA 2L52A 5EE0A 2DWQA 4P6VF 1N60A 2MJDA 1FFUA 1SF0A 5MPOA 1CJEA 4HROA 1RWSA 1WXQA 1T3QA 4WQMA 1RYJA 3AMZA 3SFEB 1V97A 3VRBB 2PVGC 4YTMB 2WS3B 1OQQA 1JRPA 3P4PB 1H7XA 3NVWA 1I7HA 2BS4B 2WQYB 3AE1B 2BT6A 3AN1A 5EE9A 1JW9D 1QOAA 3AEEB 3AH7A 2H89B 1JALA 1N5XA 4ZOHC 2CJOA 2MH7A 1QF6A 1GT8A 2K9XA 3AE4B 1A70A 3AE5B 4C7ZA 1FXIA 1AWDA 1OFFA 3P4SB 1ROEA 5G5GA 1FXAA 1ZOYB 4JX1C 1PDXA 4JWSC 1L5PA 1KF6B 2HTME 3NS1A 4US8A 1WWTA 1H7WA 5EE3A 5C3JB 1RFKA 2OHFA 3FC4A 1XLQA 3W5UB 1VLBA 1NI3A 3AE9B 1QOGA 2CJNA 3AE3B 4ZHPA 3SFDB 1N63A 2W54A 1TKEA 1EWYC 1E10A 4US9A 1WYGA 3ZYYX 2M19A 1KRHA 1ZUD2 1XO3A 4ITKA 3AEFB 1JROA 5GXGB 3RPFC 3AECB 1VJKA 1NEKB 1PFDA 2CU3A 1NVID 3P63A 4IDIA 3AE7B 3NVZA 1L0VB 1WRIA 1YJJA 4YSXB 3CWIA 3HRDD 1B9RA 3DWMA 3AEAB 3AE6B 1ZXIA 2K22A 1GTEA 1E7PB 3W9CB 1L6UA 4FXCA 2Q5WD 3AEBB 2K5PA 3KWLA 3LB8C 3EUB2 4JWUC 2KMMA 1YQ3B 3B2FA 4YTPB 1CZPA 1FM0D 3ETRA 2WDRB 4USAA 1KFYB 1DOYA 3NVYA 2KAJA 2Y5CA 2WU2B 4YSZB 1XLPA 2PIAA 2ACZB 1YJIA 5AUKA 3W5VB 1F0ZA 1PUTA 3HUIA 1N62A 3HVZA 4WWMA 3ABVB 1FO4A 3AEDB 2PKOA 2H88B 2WP9B 1FRDA 2L83A 3NRZA 4N58A 1XLNA 1JWAD 1RM6C 3FAHA
chains in the Genus database with same CATH superfamily
1P1AA 1A5RA 2PMVA 1YIWA 2M17A 4ZHOA 2WU5B 2K8CA 2WXIA 3A4SC 1J7AA 3A9KA 5CHWA 4I6NB 3C8YA 2LRUA 1YD8U 1WY8A 1LFDA 5L95C 3Q3MC 2KMCA 2INCC 2MA9B 3TEYA 5AZHA 2OOBB 1TKGA 3ZGZA 1SEBD 4KZ0A 1WXVA 1AW7A 3T8MA 1VZ8A 4ZYSA 2JX5A 3DBLB 1T5XD 3D32A 2MJDA 4A3PA 1WXQA 1T3QA 2KLGA 2NPTB 4NJCA 4FADA 3VH3B 1UZXB 1C4AA 4KDIC 1GJZA 1FPYA 3Q14C 1JALA 5D3DA 3BINA 4MGIE 1B1ZA 1SE9A 1AWDA 2J52A 2KWDA 4TQ1A 3V61A 1WIAA 4MDKE 1WZ3A 2R2OA 1UGJA 2IO1B 3QA8A 2W9NA 1KJTA 4M0WB 4ANVA 1KM7A 2CU3A 2D3BA 5C1ZA 2FE8A 2IO3B 3CWIA 1HTOA 2KACA 3AI5A 5BMIA 5DCNA 4NQKE 4NPNA 3CF6E 1NBFC 1C76A 2R2QA 3LYYA 2UWQA 2V4IB 3TMPB 2WDRB 1WX7A 1I4XA 1YX5B 1DOYA 2KVRA 3MFGA 1FD6A 1UH6A 1WZ0A 3LDZE 3RMKC 2KQSA 1E8WA 3EHVA 2WP9B 4MGZE 1DGJA 4S17A 3PTFC 2KDEB 1RLFA 4DXGA 1E8XA 2BTEA 4DXAB 3FILA 1K8RB 3P63A 2AYOB 2O2VA 3ZXRA 2KDBA 3ZJTA 4DQOC 5IN7A 2BS2B 2WDQB 3P4QB 2KOXA 4JQWC 1I42A 1N61A 2HJ1A 3EECA 1H8CA 3WAMA 2KK8A 4AQ7A 1RYJA 3AMZA 1L4DB 4IWQA 3SD5A 3TJPA 4MSMB 2MSED 2BT6A 3AH7A 3KUZA 2PLPA 1QF6A 3VVWB 2BWFA 4ZRQA 2I2YA 3DHGC 1LXDA 3OJ3A 4MELA 5DPWA 4GN1A 1KF6B 2D5GA 1H7WA 3R2IA 5C3JB 4BKSD 1NI3A 3P2BA 1DYQA 3QJZA 3PPAA 3UIOB 1HQRD 3U30A 4C00A 3RPFC 1NEKB 2BB6A 2SAKA 4IWPA 2WWZA 3B0AA 3NVZA 3GE3C 3W1YA 4XYCA 2FCQA 1EM7A 2MLBA 3AE6B 1NDDA 2KD0A 1V2YA 2HE7A 5JXVA 3WALA 2C7NB 3BVZA 3RNAC 1WM3A 1TZ1A 4RM8A 4GSWA 3J9CA 2DZIA 1XQQA 4A90A 1FEHA 2NTTA 3A1QA 2KQ7A 3NRZA 4L2YA 1JQ4A 2MJEA 5DPRA 3ECIA 2XN9C 1TJEA 2LVOA 2G4DB 4HWIB 2SEBD 4ANXA 3DVGX 2M1MA 1T0SC 2PPHA 5JHAA 2IGGA 2AL3A 3BK1A 3W2DA 1R7SA 2YEPB 2LXAA 3LXFA 3VR9B 3H9DA 3DVNV 4S0RA 4EZJA 2KX0A 3BK2A 1WX8A 2GI9A 3O65B 1SIFA 3A9KB 1QOBA 4K7SA 1VZ6A 4EUTA 2WXPA 1FFUA 4AWJA 3NZ3A 3VRBB 2UYZB 3P4PB 2BYVE 4M8NA 3MJWA 5EE9A 4GDKA 2NS5A 4ICUA 4K7WA 5BYQA 1D3ZA 5JZEB 1OFFA 4JX1C 3U8ZA 1L5PA 4LCDE 4XWWA 2OHFA 5EDSA 3AE9B 2CJNA 1C77A 4AS1A 2W54A 4REZA 1E10A 2GBJA 2N7DA 4ITKA 1JROA 3H7PA 2JXXA 4XC2A 4PK1A 1VJKA 4IUMB 5GMVA 1JMLA 1L0VB 3APCA 4RH6A 4FA6A 1TY2A 2GMIC 4BZAA 4XE0A 2WXHA 3ML8A 1FM0D 3EFCA 3H6NA 2MP2B 4WAAA 2JF5A 4RM9A 4NJ6A 2L0FA 2C60A 2WU2B 5C23A 3T3OA 2IJ0A 2INNE 1M94A 4KIKA 1TS5A 1TS3A 1FRDA 2D11A 3AV8A 3AU5A 5CTRC 1E9MA 4HDOA 4MEMA 2MW5A 5D2MB 1NENB 4OZCA 3IAS1 2B76B 2G3QB 3QAQA 2IO2B 2WXOA 2QJLA 3M62B 1YX6B 4YXDB 4HDQA 4K3CA 3C0RB 3A9JA 2KZRA 3ZNZB 1D5XC 4YT0B 2G4SA 2PVOD 2IZVB 2LGDA 3HK0A 4E74A 4NQLB 1SIJA 1QKZA 4MGYE 3AXCA 2M8SA 2L0TA 1ZPSA 4HK2A 1EU3A 4NAWA 2MH7A 5KHOA 3P42A 2Y5PA 2J4XA 1A70A 1D6EC 3KYCD 3V6CB 1WGHA 4IM0A 2KJHB 2PJHA 5D7GA 5D6JB 4DBGA 1EF1A 1C9FA 3FC4A 2XK5B 4RGTA 2KFJA 3ZRCA 2DZMA 1WYGA 2A5UA 3DBRI 3DOWA 5HHDG 5LXHA 2JRIB 1P0RA 3EC8A 5D3IB 2DZKA 3H7PB 5LXIB 2G45B 4ICVA 3X23A 1B9RA 3NUHB 1ZXIA 2XNAC 2ZW0A 4AJYB 4P16A 2Q5WD 3NHEB 3KWLA 4KGTA 2N9EB 4FHKA 3NVYA 2FNJB 5IKCM 2INPE 2Z8LA 2RD0A 1VZ7A 3HVZA 2JPHA 4WWMA 3ABVB 3GZNB 3AEDB 1MG4A 2PKOA 1UUPA 2WXGA 4XWTA 5D94A 3UQBA 2J0MA 2D3GA 3VAWA 2C9WB 3GZNI 1HXYD 2WX0A 1FNWA 1HZ6A 4JL9A 3N20C 3PO0A 3TEWA 1KLVA 2KDMA 1TYGB 4RGOS 3NG0A 1WE6A 3B2GA 4YSYB 1WXSA 1XF5L 2O6VD 4GU2A 3Q8EA 1YQBA 1FIQA 3PV1A 1UWXA 1WJNA 3DWGC 2N9LA 2QEJC 3IBEA 4FULA 4AJWA 4L1BA 3Q2AC 3L13A 3NS8A 1XLOA 1MHHE 1J19A 4WH4A 2JWZA 1TS4A 3WAOA 2V3PA 4HROA 2J42A 4WQMA 3ONSA 5AZFA 1V97A 2N9XA 1FXTB 1JRPA 2KFKB 3RNBC 3APDA 1P3QU 3MC0B 3A1QB 4NJ7A 3AE4B 1Y8RC 1YOVB 4EEWA 3QQ8B 4PT5A 1ROEA 4RNAA 4HVBA 4II2B 4J6IA 5G5GA 3IHPC 2LGIA 2LUMA 3NS1A 1C3TA 5EE3A 4URKA 1VLBA 1ZGUB 4W9DA 2LJIA 2MBOA 1K50A 3QCAA 1IP9A 3AECB 2QC8A 2RR9A 1TBEA 3MJ5A 4W9KA 4L23A 1GTEA 4MACA 3QARA 3KUCB 1T6BX 2PIAA 1XLPA 3DQVA 4M00A 3IT4B 4OVZA 3HUIA 1FO4A 1R4NI 3PZ8A 1Y56A 2WXLA 3BWUD 1R4NB 4GDLA 4B6WA 2J53A 2KWUB 4N59A 3AE2B 4EOYA 5G5HA 2N0SB 2WLBA 4GB9A 4HPLB 2DHZA 3Q8CA 3BZDB 1UWMA 2W3RA 5EE0A 1MVKA 4WAFA 2RDBC 3L10B 2MCNB 1GC7A 2KDIA 5TSSA 2M56B 2L76A 1UNSA 4ZDVA 1S1QB 4YWGG 2LEKA 2QMTA 2JYTA 1GNUA 2Z0DB 1ZP0B 3Q8BA 4C80A 2RPQA 2L52A 3RULA 1ZXHA 3QC8B 3C19A 2DENB 3ZDTA 4EZKA 5BO4B 3Q3FA 2V3NA 2NBUA 4GDLB 2Y5BB 2N1WA 2PE9A 1QOAA 1WMHB 2OJWA 3PS6A 2D2QA 1L0XB 1JRUA 4K7UA 2LD9A 4ANWA 2N7EA 1WM2A 1L2NA 1F2RI 1BXTA 5CHFA 3JSVB 3L54A 4OZBA 2KYWA 1I4HA 1TGZB 3AE3B 1EWYC 3MC8A 1KRHA 3HM3A 1XO3A 2BYFA 4BAXA 4FJZA 4WJPA 5GXGB 1E5WA 1PFDA 2BPSA 3I63C 4M0WA 1VD2A 1PGXA 2LASA 4F7ZA 1C4PA 1TS2A 3HRDD 3L17A 5LLIA 1WJ4A 2K22A 3PLVA 1K53A 4FXCA 4KSLC 4RCOA 1CZPA 1D4BA 4PS3A 2X8XX 2KXJA 2KAJA 2Y5CA 1WGDA 3ZTCA 2K39A 4A8XC 5BYSA 2PE6B 5I4DA 4M01A 3TIXA 4ZRJA 2CKHB 3NVVA 2L05A 2EELA 3KQ4A 4RF0A 4LTUA 4P1CC 3DBRB 3U7DA 4B0MA 4P1BC 1E7VA 5AZGA 1WXMA 3VH4B 1QT9A 4CO7A 3B08A 1HEZE 5HFYA 4HKQA 2ON8A 2KNBA 2LHDA 3A9JB 2NMQA 1QQRA 2L1AA 4F1SA 3JSVA 3W1SC 3RN9C 2BWES 2HDEA 1XT9B 1VDVA 3PHXB 4LJOB 4MGKE 3ZNHB 1SF0A 5MPOA 1RWSA 1P9DU 4K1RB 3SFEB 2K1FA 2WXFA 3MTNB 2O6VB 1YMHE 2BKFA 4KV2A 2BS4B 3AE1B 4BKGA 2RMMA 1KOTA 2K25A 2D3AA 1FXAA 1ZOYB 2W82A 1MPEA 3A4RA 4US8A 2ZVNA 1WWTA 1RFKA 1XLQA 2LVPA 3SFDB 3NJTA 5J2RA 3TCAA 1VCBA 4PS7A 2DX5B 2WXMA 4LNKA 2KTFA 2FAZA 1F52A 2KTRB 2GBNA 5FR3A 3R3MA 4LJPB 3W1SA 1C79A 4DHJB 1K52A 4E3CA 1M4VA 2AQ3B 2M0AA 3Q3JA 1XLNA 1RM6C 4HCPB 2XEWA 1C1YB 2RSUA 1AYFA 4TMAB 1RAXA 4ASWC 4R3DA 3ZKJC 1E90A 4DDID 2ZNVB 4MT5A 3PREA 2MX2A 1P7FA 2WDVB 1N5WA 1GOZA 2VH1A 3L4PA 1IYFA 4W9FA 2KHWB 4HRSA 1XCTL 1SBBB 3ZNGC 2L32A 2ZPYA 1T0QC 3I9V1 3FKYA 4HPPA 4A9AA 2IGDA 1PQSA 2K6DB 1E0ZA 1WRDB 2JT4B 4JE3B 1XCQL 4II3B 4IKGA 5T8IA 3R7QA 1GB1A 4ANUA 4MM3B 4X57B 2AQ2B 3VTUA 2NPTA 2KN5A 3M95A 3N3KB 4DHJD 4C4VA 3ZIMA 3MP9A 4WIPA 2K8HA 4MSQB 4O1NA 4JWSC 3RFZB 2BW2A 3UINB 4HJKA 4EE2A 3N32A 1IGCA 2WXJA 4FLHA 1N63A 1EUVB 4HLEA 1YJ1A 2WXKA 2FCMA 4WQOB 3DWMA 2V0GA 2JVCA 4BFRA 2KC1A 2YVCA 3ZVVA 4BOSC 2FCNA 1ISNA 1HZ5A 4USAA 2M4NA 2ZJDA 1YJIA 3WAPA 4JGHB 2H88B 1WX9A 3ZJUA 1F1HA 5E6PA 2QCZA 1V5OA 3B9JA 1JWSD 2NVUI 3PZDA 2JQRB 1WGRA 4DDGD 2V9HA 2VZKD 1FCLA 5EE1A 1PYWD 3V62A 1WGKA 3VHTC 1OQRA 1V8CA 2LXCA 4C56C 4BBNC 2MBBB 4CYEA 2XK5A 1I4QA 3Q3NC 4LNOA 3BVGA 3RNFC 1YN4A 3AU4A 1J8CA 1S3SG 1N6ZA 2BQQA 1SE3A 2ZW1A 3GB1A 1QZEA 3MHSD 1OQYA 3GP7A 1Q10A 4NNJB 5CHVC 1HA5A 1ZW7A 4WWOA 2IY0B 2WXRA 2AQ1B 2B3AA 4WWPA 3IVFA 2BKRB 1GT8A 2JYEA 1D5MC 1FXIA 2BGFA 3ZW3A 2KN4A 1E8ZA 1SJED 3H8HA 1KH0A 1P7EA 2KLCA 4PS8A 5JHBA 3ZRFA 2N7JA 4ZHPA 2DAFA 2KTRA 4FBJB 1YNTE 4IM3A 3VFKA 2V1YA 1IBXB 4HXDA 1FNVA 3A33B 2INDC 1Q1OA 4KGSA 5IP4D 2K5PA 2MHJA 1V86A 1F9JA 1CMXB 4B95A 1YQ3B 3ETRA 2AL6A 4K3BA 3R8BA 2ACZB 2JZPA 1OTRB 4DXFA 2R61A 3PZ7A 1WI0A 2QIEB 1K51A 2HTHA 1EF5A 3RZFA 1V6EA 2MWSB 2RDGA 1DOXA 4HPMB 4W9GA 2D07B 3JVZX 1WGGA 3WANA 2LGXA 3U7ZA 1DOIA 3DBLI 4RF1A 3QHTA 2DLBA 3CF4A 3P1MA 3SR6A 3E56A 5AUIA 1LM8B 2WGSA 3T9LA 3P4RB 1SB3C 3PT2B 4A6QA 1ZDXA 3WCQA 3AB5A 1STEA 4OVVA 2O2VB 2GBRA 4NAWB 4I6PA 4ZRIA 2O6VA 3DVNU 3HIZA 4YTMB 2WS3B 2CS4A 4MH0E 4M8MA 4MM3A 3ZNID 4OVUA 1BMLC 2C5LC 3TBLD 4IM2A 1UELA 3DBHI 2LGSA 4A3OA 3DBHB 3DPDA 1CK1A 3IFWB 3KYDD 4P7IA 5DPTA 3RI7C 2M19A 5HKHA 2NR2A 1I4PA 2FIDA 1NVID 4PYUA 3L08A 1WRIA 1FCCC 2JU6X 2VRRB 1WR1A 3PRMB 2N9PC 3CSTA 3OWEB 3RNEC 2DYBA 1SE4A 1UF0A 2ICIA 3EFUA 2J0KA 5G2NA 2DZJA 1KLUD 3SU8X 3BVMA 3U2SC 2LZ6A 2LFIA 2L7RA 2LMCA 4A20A 4N58A 4GDKB 1I35A 2LI5A 4XDCA 2J7QB 5JH5C 4F8CB 1WGYA 1J7BA 5AEKB 1YN5A 1NYQA 2KKCA 3TSSA 4YL8A 1XD3B 3VQIA 4BVUC 4ZRKA 3T3NA 4B0EA 2IBIB 4HCNB 1ZDVA 2WXNA 2WHIA 3UQAA 4EKUA 4RGNA 2W55A 1NYRA 2K0PA 3OLMD 3URYA 3O13A 3E9SA 1ZKHA 2GBMA 1PGAA 3IXSA 4I6LB 5J17A 2DNFA 2I1KA 2K6QA 5LNK1 4M02A 5HG2A 3IAM1 2ZCBA 3KW5B 2KQ4X 1GB4A 1AN8A 2HTME 4IW0A 1P98A 3IT6B 3APFA 3V05A 1I4RA 4OZAA 4E71A 3PRPB 1LO5D 1SE2A 3ZTDA 1L7YA 3HM6X 4YSXB 1IGDA 4KKIA 1E7PB 2ASQA 4AOFA 2NBWB 4KGRA 1V1OA 4IG7B 1EWCA 2C7HA 2GB1A 1H4RA 4ZRPA 4A55A 4KKJA 2MRPA 1WMHA 4BOZB 1JWAD 2AEHA 3S2AA 1WH3A 2ZCCA 1E6EB 3N1YC 2LGYA 2ONQA 5FK9C 1GC6A 4OHJA 5H92C 1V9JA 4MJSB 2KWCA 4N6EB 4G0NB 3JYUA 1IUEA 1Q5WB 2D10A 2DYOA 3KH0A 1T0YA 1GPXA 2E3TA 1JWBD 3I57A 1ENFA 2GBKA 4W9CA 4PYZA 3N9YC 2ZVOA 3EA6A 2BYEA 4WJOA 2KDFB 3SDLC 4AUQC 2V4LA 1J7CA 2GLSA 3H7SA 3CSFA 3Q3OC 1FRRA 1ET6A 3OJ4B 3WA0A 4IC7B 3Q69A 2DAJA 3ZQ4A 2KANA 3RD2A 4FJVB 1G6JA 3FILB 1N60A 4TKNA 2NBVB 4DK5A 3ZUNA 2EMTA 2KJ6A 4J3OD 3TL5A 3VUYA 2FUHB 4BKTA 1OEYJ 1LQBA 1I7HA 5BMHA 4XDDA 1JW9D 3AEEB 2REXA 3ENEA 2KMAA 4ZOHC 3GS2A 1TIFA 3K9OB 1PGBA 3AE5B 5E6OA 3BYTB 3TEZA 2KVZA 1SJHD 5CX3A 1U4AA 1BT0A 1QOGA 2BB5A 3PHWB 2JWUA 2IGHA 2LUEA 5G55A 4GOCA 1E8YA 4NZLB 3AE7B 1EO6A 2VZKB 4WWNA 3JW0X 3M63B 5BYRA 4TV3A 2NCNA 3NOBA 1L6UA 2KO3A 4RGMA 4LDTD 3M3JA 4W9LA 3EUB2 2KMMA 2GOWA 3B2FA 1HTQA 2JXTA 3PVLA 4LNNA 3HVDA 2N4FA 1R4MI 4JPSA 4K81A 1JCKB 1C78A 2YEPF 1CQVA 1L6VA 4XGAB 1UGMA 5FR6A 4CHKA 3H1UA 4XZ4A 1RFAA 1IPGA 2AX5A 2IPKD 1WJ6A 3VRAB 1GTHA 2PEAA 2CHXA 3R2TA 1WJUA 4FHJA 2EKIA 1TKYA 3VR8B 4GMVA 4CQNA 1FFVA 3HHMA 2MJ3A 5C2TB 2BBCA 1FMAD 4NY0A 2CU1A 3L0WB 2K3UA 4GLSC 3SHQA 2RPVA 4B9KA 1T0RC 1V80A 2DWQA 4P6VF 1CJEA 3N1XC 4LDTB 3DDCB 3RT3B 4RMAA 1LGRA 2ZZPB 5IOIA 2Z59B 1OEYA 4KDLB 1OQQA 5L83A 2K9XA 3TEXA 2KT7A 2XBBC 3OAWA 4N9F4 4OW0A 2X38A 2N1VA 4IOIE 2I38A 3VDZA 1ZE3D 2WX1A 4FN2A 2CHZA 2KWVB 1D5ZC 4NAMA 2QDFA 5E6NA 3R66C 2IDYA 5TR5A 3CMMB 5HI1A 3RUIB 5IA7A 2BF8B 4IDIA 3R7RA 3DBSA 3EGRA 4HEA1 1V5TA 3W9CB 3UGBB 1JWUD 4ARIA 2FIFA 1KFYB 4WJQA 3DHIC 4YSZB 4C4VB 1Z5SB 4MH8A 1MJDA 2L83A 2D3CA 2CHWA 1QLBB 3QK0A 1RRBA 2L8JA 2FBWB 1UBIA 1YQ4B 1Q0WB 2MBQA 2M0XA 3TUOA 3AM9A 3MHZA 3UIPB 2QILA 1SGHA 3V3XA 3AE8B 4YTNB 2BVCA 3UI3A 3B1LX 2TSSA 3K9PB 1VRAB 1YN3A 3QWZB 3BIID 5H8YE 1I4GA 1XXGA 2G1EA 4QAYA 1TT5B 2WYQA 3CIRB 4W9IA 3Q6BA 1MFWA 2RGFA 3U4EG 1R4MB 3ZO5B 3MC9A 2JZZA 3VUWA 1V1PB 2PVGC 1V49A 1WYWB 1GUAB 2JRHA 4BBNF 2WQYB 4WJNA 1L0YB 2IO0B 3VTWA 3GE8C 4C7ZA 2LWPA 4AP4C 4ZYNA 3ZXVA 2PTLA 1SSNA 3P4SB 3LJ3A 2ZNVC 3PLUA 4W9JA 2LHEA 5J18A 4LNIA 1TKEA 1MHXA 5DPSA 4US9A 2DYMA 2LJ5A 2WNMA 3ZYYX 2FCSA 2VH2A 1WF9A 2GRIA 3PSEB 2C7MB 2I1JA 3KWVA 3GOEA 2FUG1 2L00B 3L16A 4KSKC 3X0WA 3UF8A 1HE8A 2HD5B 4TUUA 4W9HA 5AUKA 4HKZE 3DVGY 2IYDB 3NZSA 2K8BA 2KX3A 3DCGA 3BY4B 1TY0A 4G3XB 1BUIC 2J0JA 3AEGB 4H2AA 2E6XA 3ML9A 1GAQB 3RNCC 3KUDB 2BS3B 1GG3A 2WXQA 2OJRA 4TQ0A 4KVGB 1TZOA 1EU4A 3Q8AA 1ESFA 3QX1A 4RFBA 2HJ8A 4G50A 3VXWA 1WFYA 3KVFB 2MBEA 4GXBA 3WIMA 4KZCA 1E7UA 2V3SA 3N30A 2Z0EB 3NVWA 3VTVA 3AN1A 4HJGE 3N1ZC 2JSVX 2H89B 2KC2A 1F77A 4KIKB 4GGQA 4XX5A 3Q8FA 1PDXA 1UBQA 1NI2A 3PRZA 3ZDMC 4DWFA 2MBHA 4DHZB 3NY5A 3AEFB 3RNGC 4EZLA 3RZWC 2LRWA 4ARCA 1YJJA 1Z2MA 5BMGA 1FNUA 3RCZA 4JIOU 4MJSA 1C4CA 4D2KA 1XEEA 2JUOA 3AEBB 4YTPB 5IAAC 2NTSA 4UDUC 4BKSA 2L3ZA 1VR9A 1PUTA 1KLGD 3OG5A 2DBYA 1QOFA 1KTKA 1ACCA 4WURA 2BYTA 1MI0A 3V6EB 4KX6B 1V1PA 1AARA 3RYTA 1WSPA 4LK0M 4FJYA 1F2RC 1WE7A 2W3SA 3AULA 2LVQA 4W9EA 4ACFA 3SEBA 2N9KA 4C7YA 4LNFA 3IG3A 4GIVA 3ZLZA 4IWOA 2JY6A 4DHZE 1TTNA 2RDHA 4Q2JA 3BYYB 2CR5A 3I3TB 2KFKA 3I5JC 1ET9A 2EKEC 1H7XA 2UU7A 2MQJA 1N5XA 3PGEA 2CJOA 3V60A 2PW9A 4LLGM 2YLMA 4EFOA 2QSDA 2ZEQA 1J0GA 1X1MA 2MP2A 3KLSX 2Y3AA 1WXAA 3W5UB 2AWTA 1L4ZB 2JZ3B 1MG8A 1UD7A 3VUXA 2ZPNA 2EMSA 1QILA 3QIJA 5FKAC 1SXTA 1ZUD2 4JLCA 1OGWA 2KJRA 2QHOA 1V81A 1IBXA 2OEDA 5KHQA 3AEAB 1JWMD 1WR6E 2IY1B 3DHHC 2MEKA 3LB8C 4JWUC 5IO9A 3ALBA 4TSSA 5E6JA 3NZUA 2G9HD 2A4ZA 3W5VB 1F0ZA 1N62A 2WDTB 3U52E 4G11A 3ZJVA 3FAHA
chains in the Genus database with same CATH topology
2YEPF 1CQVA 1HXYD 3B9JA 1JWSD 1L6VA 2PMVA 1FNWA 1HZ6A 2JQRB 4ZHOA 3PO0A 3TEWA 2WU5B 2VZKD 2AX5A 2IPKD 2KDMA 2WXIA 1TYGB 5EE1A 1FCLA 4RGOS 1J7AA 3VRAB 3B2GA 3C8YA 1PYWD 1GTHA 4YSYB 1WGKA 1OQRA 1V8CA 1XF5L 4C56C 3R2TA 3Q8EA 2EKIA 1FIQA 1I4QA 1TKYA 3TEYA 1UWXA 3BVGA 3VR8B 1TKGA 3DWGC 1YN4A 4CQNA 3ZGZA 1FFVA 1SEBD 2N9LA 2QEJC 2MJ3A 5C2TB 1SE3A 2BBCA 2ZW1A 3GB1A 1FMAD 1AW7A 4L1BA 1VZ8A 4ZYSA 2K3UA 4GLSC 1XLOA 2JX5A 2RPVA 3GP7A 1Q10A 2DWQA 4P6VF 1T5XD 1MHHE 2MJDA 4WH4A 1TS4A 1CJEA 2V3PA 4HROA 1HA5A 1WXQA 1T3QA 2J42A 4WQMA 4NJCA 1V97A 1OQQA 1JRPA 2WXRA 1C4AA 2AQ1B 1JALA 5D3DA 3MC0B 1GT8A 2JYEA 2K9XA 3AE4B 1D5MC 3TEXA 1B1ZA 1FXIA 4PT5A 1AWDA 2J52A 2KN4A 1ROEA 2KWDA 2X38A 4OW0A 4RNAA 5G5GA 4IOIE 2I38A 4TQ1A 1ZE3D 2LGIA 1SJED 2LUMA 3H8HA 1KH0A 3NS1A 5EE3A 1P7EA 1D5ZC 4NAMA 1VLBA 2N7JA 4ZHPA 1UGJA 2LJIA 2IDYA 1YNTE 1K50A 5HI1A 3AECB 2CU3A 1IBXB 4IDIA 2FE8A 3CWIA 2KACA 1FNVA 3MJ5A 4L23A 5BMIA 1GTEA 3EGRA 4HEA1 4KGSA 3W9CB 4MACA 2K5PA 1C76A 1YQ3B 1JWUD 3LYYA 2V4IB 3ETRA 4ARIA 2WDRB 1KFYB 1I4XA 1DOYA 3R8BA 1T6BX 4YSZB 1XLPA 2PIAA 3MFGA 2ACZB 3IT4B 2JZPA 4MH8A 4OVZA 3HUIA 1FO4A 4DXFA 1FD6A 3PZ8A 2R61A 1Y56A 2WP9B 2L83A 3PZ7A 2WXLA 3BWUD 1QLBB 1DGJA 2QIEB 1K51A 2J53A 4N59A 2FBWB 1YQ4B 3AE2B 2RDGA 1DOXA 5G5HA 3TUOA 3AM9A 2N0SB 2WLBA 3MHZA 4DXGA 2BTEA 3FILA 3Q8CA 2QILA 3BZDB 3U7ZA 1UWMA 2W3RA 3P63A 5EE0A 3V3XA 3AE8B 1MVKA 1DOIA 4YTNB 4WAFA 4RF1A 2DLBA 3UI3A 3ZJTA 4DQOC 3CF4A 5TSSA 2M56B 2TSSA 3P1MA 3SR6A 1VRAB 1YN3A 3E56A 2BS2B 3BIID 5AUIA 1UNSA 3P4RB 1SB3C 5H8YE 4YWGG 4A6QA 1I4GA 2WDQB 1XXGA 2G1EA 2LEKA 2QMTA 2JYTA 3P4QB 1ZDXA 3CIRB 1ZP0B 3WCQA 3AB5A 1STEA 3Q8BA 4C80A 1N61A 4NAWB 2L52A 3U4EG 1ZXHA 4AQ7A 1RYJA 1V1PB 3AMZA 1L4DB 2PVGC 4YTMB 2WS3B 2V3NA 4GDLB 2WQYB 2BT6A 1BMLC 3AH7A 1QOAA 1L0YB 2PLPA 1L0XB 1QF6A 4C7ZA 2PTLA 4ZRQA 2I2YA 1SSNA 1F2RI 1BXTA 3P4SB 4OZBA 1I4HA 1KF6B 2D5GA 1CK1A 2LHEA 1H7WA 3R2IA 5C3JB 1NI3A 1DYQA 3AE3B 1TKEA 1EWYC 1MHXA 4US9A 2DYMA 2WNMA 1HQRD 3ZYYX 2M19A 1KRHA 1XO3A 2GRIA 5GXGB 3RPFC 1I4PA 1NEKB 1PFDA 2BB6A 1NVID 2SAKA 3NVZA 4M0WA 1PGXA 1WRIA 1FCCC 1C4PA 1TS2A 3HRDD 1EM7A 3KWVA 3AE6B 2JU6X 2K22A 1K53A 5JXVA 4FXCA 3BVZA 2FUG1 4RCOA 3OWEB 1CZPA 1D4BA 2ICIA 1SE4A 3J9CA 2KAJA 2Y5CA 4A90A 1KLUD 5AUKA 1FEHA 2NTTA 3BVMA 3U2SC 4HKZE 2LFIA 4A8XC 2LMCA 5BYSA 3NRZA 4N58A 4GDKB 4L2YA 5I4DA 4XDCA 3NVVA 1JQ4A 2MJEA 1TY0A 2EELA 3KQ4A 4RF0A 2XN9C 4LTUA 1TJEA 1BUIC 1J7BA 3AEGB 1YN5A 1NYQA 3TSSA 4H2AA 2E6XA 4B0MA 2SEBD 1GAQB 3VQIA 3T3NA 1QT9A 2IGGA 4B0EA 2BS3B 2WXQA 3BK1A 3W2DA 1R7SA 1HEZE 2YEPB 4TQ0A 1ZDVA 5HFYA 4HKQA 2WXNA 2ON8A 1TZOA 2LHDA 1EU4A 3Q8AA 2NMQA 1ESFA 1QQRA 3VR9B 3LXFA 4RGNA 2L1AA 2W55A 4RFBA 1NYRA 2K0PA 2HDEA 3BK2A 3URYA 2GI9A 3O13A 1VDVA 1QOBA 3E9SA 1VZ6A 1PGAA 3IXSA 2WXPA 1FFUA 3NZ3A 1SF0A 5MPOA 1RWSA 3SFEB 3VRBB 2WXFA 3P4PB 3NVWA 1YMHE 5HG2A 5LNK1 3IAM1 2BS4B 3AN1A 3AE1B 4HJGE 5EE9A 2JSVX 2RMMA 2H89B 5BYQA 1F77A 2KQ4X 1OFFA 1GB4A 1FXAA 1ZOYB 2W82A 1AN8A 3Q8FA 4JX1C 1PDXA 1MPEA 1L5PA 2HTME 4US8A 4XWWA 1WWTA 1RFKA 2OHFA 1XLQA 3IT6B 3V05A 3AE9B 1I4RA 2CJNA 1C77A 4AS1A 3SFDB 2W54A 4OZAA 4REZA 1E10A 1LO5D 1SE2A 4ITKA 3AEFB 1JROA 1VJKA 4ARCA 1JMLA 2WXMA 1L0VB 1YJJA 4YSXB 1IGDA 5BMGA 1FNUA 4KKIA 1C4CA 1E7PB 4D2KA 1XEEA 4RH6A 3AEBB 1TY2A 5FR3A 4KGRA 1V1OA 4XE0A 2WXHA 1EWCA 4YTPB 1FM0D 2GB1A 2NTSA 4UDUC 4ZRPA 3W1SA 4A55A 1C79A 1VR9A 2WU2B 3T3OA 1K52A 1PUTA 4KKJA 2IJ0A 2INNE 1KLGD 1TS5A 1FRDA 1M4VA 1TS3A 2AQ3B 2M0AA 1XLNA 1JWAD 3AV8A 1RM6C 2DBYA 1E9MA 1E6EB 1QOFA 1KTKA 1ACCA 2ONQA 4WURA 5FK9C 1AYFA 4TMAB 4OHJA 2BYTA 1NENB 4OZCA 4R3DA 1MI0A 5H92C 3IAS1 4KX6B 1V1PA 2B76B 4N6EB 4MT5A 1IUEA 1WSPA 4LK0M 1P7FA 2WDVB 2DYOA 1GPXA 2WXOA 1N5WA 2QJLA 1GOZA 2E3TA 1JWBD 3L4PA 4YXDB 3I57A 1F2RC 2W3SA 1ENFA 4HRSA 3N9YC 3SEBA 1XCTL 1SBBB 2L32A 2N9KA 3EA6A 4C7YA 1D5XC 3I9V1 4YT0B 1J7CA 2PVOD 4A9AA 2IGDA 2RDHA 1FRRA 1ET6A 3Q69A 1E0ZA 4Q2JA 3ZQ4A 3BYYB 1SIJA 4JE3B 1XCQL 4IKGA 5T8IA 1GB1A 3FILB 1N60A 4MM3B 1ET9A 1QKZA 4J3OD 2AQ2B 1ZPSA 1H7XA 1I7HA 5BMHA 3FAHA 4XDDA 1EU3A 1JW9D 3AEEB 1N5XA 4ZOHC 2CJOA 2MH7A 3P42A 2Y5PA 3GS2A 2J4XA 1A70A 1PGBA 3AE5B 1D6EC 2PW9A 4LLGM 3BYTB 3MP9A 4WIPA 3TEZA 1SJHD 2QSDA 5D7GA 4O1NA 4JWSC 3KLSX 2Y3AA 3RFZB 1C9FA 2BW2A 3W5UB 3FC4A 1L4ZB 4EE2A 1IGCA 1QOGA 2WXJA 4RGTA 1N63A 2BB5A 1QILA 5FKAC 2JWUA 1WYGA 2IGHA 1SXTA 1ZUD2 5HHDG 2WXKA 1IBXA 5D3IB 4NZLB 3AE7B 2VZKB 2OEDA 1B9RA 3DWMA 2V0GA 3AEAB 1JWMD 1ZXIA 2XNAC 3NUHB 5BYRA 2ZW0A 1L6UA 2Q5WD 4P16A 4RGMA 2MEKA 3KWLA 3LB8C 3EUB2 4JWUC 1HZ5A 2KMMA 4KGTA 3B2FA 4TSSA 4USAA 5E6JA 2JXTA 3NVYA 2INPE 2Z8LA 2G9HD 1YJIA 1VZ7A 3W5VB 1F0ZA 3HVZA 1N62A 4WWMA 3ABVB 3AEDB 3HVDA 2PKOA 1UUPA 2H88B 2WXGA 4JPSA 4XWTA 3U52E 3ZJUA 1JCKB 3ZJVA 1C78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBY A;  1QLB B;  1DGJ A;  1E9M A;  1E6E B;  1QOF A;  2QIE B;  3B9J A;  1AYF A;  1L6V A;  3NVV A;  1JQ4 A;  2MJE A;  4N59 A;  1NEN B;  2FBW B;  3AV8 A;  5H92 C;  1YQ4 B;  3AE2 B;  4KX6 B;  2B76 B;  1DOX A;  5G5H A;  4LTU A;  4N6E B;  1TJE A;  2JQR B;  1J7B A;  2E3T A;  3AM9 A;  4ZHO A;  2N0S B;  2WLB A;  3AEG B;  3PO0 A;  2WU5 B;  1IUE A;  1NYQ A;  2AX5 A;  5EE1 A;  1TYG B;  2WDV B;  1J7A A;  1GPX A;  3VRA B;  1UWM A;  1N5W A;  2QJL A;  2W3R A;  3AE8 B;  1GTH A;  4YSY B;  1JWB D;  1WGK A;  1DOI A;  4YXD B;  4YTN B;  1GAQ B;  1OQR A;  1V8C A;  3L4P A;  2W3S A;  1QT9 A;  2BS3 B;  4HRS A;  1R7S A;  3CF4 A;  2M56 B;  2EKI A;  1FIQ A;  1TKY A;  3P1M A;  3SR6 A;  2BS2 B;  3BII D;  5AUI A;  3VR8 B;  1TKG A;  3DWG C;  4C7Y A;  3P4R B;  1SB3 C;  5H8Y E;  4YT0 B;  1FFV A;  3VR9 B;  3LXF A;  2G1E A;  2WDQ B;  1J7C A;  5C2T B;  2LEK A;  2MJ3 A;  2PVO D;  2W55 A;  3P4Q B;  4A9A A;  1FMA D;  3CIR B;  1FRR A;  1ZP0 B;  3WCQ A;  3AB5 A;  1NYR A;  1E0Z A;  3B2G A;  4C80 A;  1XLO A;  2JX5 A;  1VDV A;  1N61 A;  1QOB A;  1SIJ A;  2L52 A;  5EE0 A;  2DWQ A;  4P6V F;  1N60 A;  2MJD A;  1FFU A;  1SF0 A;  5MPO A;  1CJE A;  4HRO A;  1RWS A;  1WXQ A;  1T3Q A;  4WQM A;  1RYJ A;  3AMZ A;  3SFE B;  1V97 A;  3VRB B;  2PVG C;  4YTM B;  2WS3 B;  1OQQ A;  1JRP A;  3P4P B;  1H7X A;  3NVW A;  1I7H A;  2BS4 B;  2WQY B;  3AE1 B;  2BT6 A;  3AN1 A;  5EE9 A;  1JW9 D;  1QOA A;  3AEE B;  3AH7 A;  2H89 B;  1JAL A;  1N5X A;  4ZOH C;  2CJO A;  2MH7 A;  1QF6 A;  1GT8 A;  2K9X A;  3AE4 B;  1A70 A;  3AE5 B;  4C7Z A;  1FXI A;  1AWD A;  1OFF A;  3P4S B;  1ROE A;  5G5G A;  1FXA A;  1ZOY B;  4JX1 C;  1PDX A;  4JWS C;  1L5P A;  1KF6 B;  2HTM E;  3NS1 A;  4US8 A;  1WWT A;  1H7W A;  5EE3 A;  5C3J B;  1RFK A;  2OHF A;  3FC4 A;  1XLQ A;  3W5U B;  1VLB A;  1NI3 A;  3AE9 B;  1QOG A;  2CJN A;  3AE3 B;  4ZHP A;  3SFD B;  1N63 A;  2W54 A;  1TKE A;  1EWY C;  1E10 A;  4US9 A;  1WYG A;  3ZYY X;  2M19 A;  1KRH A;  1ZUD 2;  1XO3 A;  4ITK A;  3AEF B;  1JRO A;  5GXG B;  3RPF C;  3AEC B;  1VJK A;  1NEK B;  1PFD A;  2CU3 A;  1NVI D;  3P63 A;  4IDI A;  3AE7 B;  3NVZ A;  1L0V B;  1WRI A;  1YJJ A;  4YSX B;  3CWI A;  3HRD D;  1B9R A;  3DWM A;  3AEA B;  3AE6 B;  1ZXI A;  2K22 A;  1GTE A;  1E7P B;  3W9C B;  1L6U A;  4FXC A;  2Q5W D;  3AEB B;  2K5P A;  3KWL A;  3LB8 C;  3EUB 2;  4JWU C;  2KMM A;  1YQ3 B;  3B2F A;  4YTP B;  1CZP A;  1FM0 D;  3ETR A;  2WDR B;  4USA A;  1KFY B;  1DOY A;  3NVY A;  2KAJ A;  2Y5C A;  2WU2 B;  4YSZ B;  1XLP A;  2PIA A;  2ACZ B;  1YJI A;  5AUK A;  3W5V B;  1F0Z A;  1PUT A;  3HUI A;  1N62 A;  3HVZ A;  4WWM A;  3ABV B;  1FO4 A;  3AED B;  2PKO A;  2H88 B;  2WP9 B;  1FRD A;  2L83 A;  3NRZ A;  4N58 A;  1XLN A;  1JWA D;  1RM6 C;  3FAH A; 
#chains in the Genus database with same CATH topology
 1P1A A;  1A5R A;  2PMV A;  1YIW A;  2M17 A;  4ZHO A;  2WU5 B;  2K8C A;  2WXI A;  3A4S C;  1J7A A;  3A9K A;  5CHW A;  4I6N B;  3C8Y A;  2LRU A;  1YD8 U;  1WY8 A;  1LFD A;  5L95 C;  3Q3M C;  2KMC A;  2INC C;  2MA9 B;  3TEY A;  5AZH A;  2OOB B;  1TKG A;  3ZGZ A;  1SEB D;  4KZ0 A;  1WXV A;  1AW7 A;  3T8M A;  1VZ8 A;  4ZYS A;  2JX5 A;  3DBL B;  1T5X D;  3D32 A;  2MJD A;  4A3P A;  1WXQ A;  1T3Q A;  2KLG A;  2NPT B;  4NJC A;  4FAD A;  3VH3 B;  1UZX B;  1C4A A;  4KDI C;  1GJZ A;  1FPY A;  3Q14 C;  1JAL A;  5D3D A;  3BIN A;  4MGI E;  1B1Z A;  1SE9 A;  1AWD A;  2J52 A;  2KWD A;  4TQ1 A;  3V61 A;  1WIA A;  4MDK E;  1WZ3 A;  2R2O A;  1UGJ A;  2IO1 B;  3QA8 A;  2W9N A;  1KJT A;  4M0W B;  4ANV A;  1KM7 A;  2CU3 A;  2D3B A;  5C1Z A;  2FE8 A;  2IO3 B;  3CWI A;  1HTO A;  2KAC A;  3AI5 A;  5BMI A;  5DCN A;  4NQK E;  4NPN A;  3CF6 E;  1NBF C;  1C76 A;  2R2Q A;  3LYY A;  2UWQ A;  2V4I B;  3TMP B;  2WDR B;  1WX7 A;  1I4X A;  1YX5 B;  1DOY A;  2KVR A;  3MFG A;  1FD6 A;  1UH6 A;  1WZ0 A;  3LDZ E;  3RMK C;  2KQS A;  1E8W A;  3EHV A;  2WP9 B;  4MGZ E;  1DGJ A;  4S17 A;  3PTF C;  2KDE B;  1RLF A;  4DXG A;  1E8X A;  2BTE A;  4DXA B;  3FIL A;  1K8R B;  3P63 A;  2AYO B;  2O2V A;  3ZXR A;  2KDB A;  3ZJT A;  4DQO C;  5IN7 A;  2BS2 B;  2WDQ B;  3P4Q B;  2KOX A;  4JQW C;  1I42 A;  1N61 A;  2HJ1 A;  3EEC A;  1H8C A;  3WAM A;  2KK8 A;  4AQ7 A;  1RYJ A;  3AMZ A;  1L4D B;  4IWQ A;  3SD5 A;  3TJP A;  4MSM B;  2MSE D;  2BT6 A;  3AH7 A;  3KUZ A;  2PLP A;  1QF6 A;  3VVW B;  2BWF A;  4ZRQ A;  2I2Y A;  3DHG C;  1LXD A;  3OJ3 A;  4MEL A;  5DPW A;  4GN1 A;  1KF6 B;  2D5G A;  1H7W A;  3R2I A;  5C3J B;  4BKS D;  1NI3 A;  3P2B A;  1DYQ A;  3QJZ A;  3PPA A;  3UIO B;  1HQR D;  3U30 A;  4C00 A;  3RPF C;  1NEK B;  2BB6 A;  2SAK A;  4IWP A;  2WWZ A;  3B0A A;  3NVZ A;  3GE3 C;  3W1Y A;  4XYC A;  2FCQ A;  1EM7 A;  2MLB A;  3AE6 B;  1NDD A;  2KD0 A;  1V2Y A;  2HE7 A;  5JXV A;  3WAL A;  2C7N B;  3BVZ A;  3RNA C;  1WM3 A;  1TZ1 A;  4RM8 A;  4GSW A;  3J9C A;  2DZI A;  1XQQ A;  4A90 A;  1FEH A;  2NTT A;  3A1Q A;  2KQ7 A;  3NRZ A;  4L2Y A;  1JQ4 A;  2MJE A;  5DPR A;  3ECI A;  2XN9 C;  1TJE A;  2LVO A;  2G4D B;  4HWI B;  2SEB D;  4ANX A;  3DVG X;  2M1M A;  1T0S C;  2PPH A;  5JHA A;  2IGG A;  2AL3 A;  3BK1 A;  3W2D A;  1R7S A;  2YEP B;  2LXA A;  3LXF A;  3VR9 B;  3H9D A;  3DVN V;  4S0R A;  4EZJ A;  2KX0 A;  3BK2 A;  1WX8 A;  2GI9 A;  3O65 B;  1SIF A;  3A9K B;  1QOB A;  4K7S A;  1VZ6 A;  4EUT A;  2WXP A;  1FFU A;  4AWJ A;  3NZ3 A;  3VRB B;  2UYZ B;  3P4P B;  2BYV E;  4M8N A;  3MJW A;  5EE9 A;  4GDK A;  2NS5 A;  4ICU A;  4K7W A;  5BYQ A;  1D3Z A;  5JZE B;  1OFF A;  4JX1 C;  3U8Z A;  1L5P A;  4LCD E;  4XWW A;  2OHF A;  5EDS A;  3AE9 B;  2CJN A;  1C77 A;  4AS1 A;  2W54 A;  4REZ A;  1E10 A;  2GBJ A;  2N7D A;  4ITK A;  1JRO A;  3H7P A;  2JXX A;  4XC2 A;  4PK1 A;  1VJK A;  4IUM B;  5GMV A;  1JML A;  1L0V B;  3APC A;  4RH6 A;  4FA6 A;  1TY2 A;  2GMI C;  4BZA A;  4XE0 A;  2WXH A;  3ML8 A;  1FM0 D;  3EFC A;  3H6N A;  2MP2 B;  4WAA A;  2JF5 A;  4RM9 A;  4NJ6 A;  2L0F A;  2C60 A;  2WU2 B;  5C23 A;  3T3O A;  2IJ0 A;  2INN E;  1M94 A;  4KIK A;  1TS5 A;  1TS3 A;  1FRD A;  2D11 A;  3AV8 A;  3AU5 A;  5CTR C;  1E9M A;  4HDO A;  4MEM A;  2MW5 A;  5D2M B;  1NEN B;  4OZC A;  3IAS 1;  2B76 B;  2G3Q B;  3QAQ A;  2IO2 B;  2WXO A;  2QJL A;  3M62 B;  1YX6 B;  4YXD B;  4HDQ A;  4K3C A;  3C0R B;  3A9J A;  2KZR A;  3ZNZ B;  1D5X C;  4YT0 B;  2G4S A;  2PVO D;  2IZV B;  2LGD A;  3HK0 A;  4E74 A;  4NQL B;  1SIJ A;  1QKZ A;  4MGY E;  3AXC A;  2M8S A;  2L0T A;  1ZPS A;  4HK2 A;  1EU3 A;  4NAW A;  2MH7 A;  5KHO A;  3P42 A;  2Y5P A;  2J4X A;  1A70 A;  1D6E C;  3KYC D;  3V6C B;  1WGH A;  4IM0 A;  2KJH B;  2PJH A;  5D7G A;  5D6J B;  4DBG A;  1EF1 A;  1C9F A;  3FC4 A;  2XK5 B;  4RGT A;  2KFJ A;  3ZRC A;  2DZM A;  1WYG A;  2A5U A;  3DBR I;  3DOW A;  5HHD G;  5LXH A;  2JRI B;  1P0R A;  3EC8 A;  5D3I B;  2DZK A;  3H7P B;  5LXI B;  2G45 B;  4ICV A;  3X23 A;  1B9R A;  3NUH B;  1ZXI A;  2XNA C;  2ZW0 A;  4AJY B;  4P16 A;  2Q5W D;  3NHE B;  3KWL A;  4KGT A;  2N9E B;  4FHK A;  3NVY A;  2FNJ B;  5IKC M;  2INP E;  2Z8L A;  2RD0 A;  1VZ7 A;  3HVZ A;  2JPH A;  4WWM A;  3ABV B;  3GZN B;  3AED B;  1MG4 A;  2PKO A;  1UUP A;  2WXG A;  4XWT A;  5D94 A;  3UQB A;  2J0M A;  2D3G A;  3VAW A;  2C9W B;  3GZN I;  1HXY D;  2WX0 A;  1FNW A;  1HZ6 A;  4JL9 A;  3N20 C;  3PO0 A;  3TEW A;  1KLV A;  2KDM A;  1TYG B;  4RGO S;  3NG0 A;  1WE6 A;  3B2G A;  4YSY B;  1WXS A;  1XF5 L;  2O6V D;  4GU2 A;  3Q8E A;  1YQB A;  1FIQ A;  3PV1 A;  1UWX A;  1WJN A;  3DWG C;  2N9L A;  2QEJ C;  3IBE A;  4FUL A;  4AJW A;  4L1B A;  3Q2A C;  3L13 A;  3NS8 A;  1XLO A;  1MHH E;  1J19 A;  4WH4 A;  2JWZ A;  1TS4 A;  3WAO A;  2V3P A;  4HRO A;  2J42 A;  4WQM A;  3ONS A;  5AZF A;  1V97 A;  2N9X A;  1FXT B;  1JRP A;  2KFK B;  3RNB C;  3APD A;  1P3Q U;  3MC0 B;  3A1Q B;  4NJ7 A;  3AE4 B;  1Y8R C;  1YOV B;  4EEW A;  3QQ8 B;  4PT5 A;  1ROE A;  4RNA A;  4HVB A;  4II2 B;  4J6I A;  5G5G A;  3IHP C;  2LGI A;  2LUM A;  3NS1 A;  1C3T A;  5EE3 A;  4URK A;  1VLB A;  1ZGU B;  4W9D A;  2LJI A;  2MBO A;  1K50 A;  3QCA A;  1IP9 A;  3AEC B;  2QC8 A;  2RR9 A;  1TBE A;  3MJ5 A;  4W9K A;  4L23 A;  1GTE A;  4MAC A;  3QAR A;  3KUC B;  1T6B X;  2PIA A;  1XLP A;  3DQV A;  4M00 A;  3IT4 B;  4OVZ A;  3HUI A;  1FO4 A;  1R4N I;  3PZ8 A;  1Y56 A;  2WXL A;  3BWU D;  1R4N B;  4GDL A;  4B6W A;  2J53 A;  2KWU B;  4N59 A;  3AE2 B;  4EOY A;  5G5H A;  2N0S B;  2WLB A;  4GB9 A;  4HPL B;  2DHZ A;  3Q8C A;  3BZD B;  1UWM A;  2W3R A;  5EE0 A;  1MVK A;  4WAF A;  2RDB C;  3L10 B;  2MCN B;  1GC7 A;  2KDI A;  5TSS A;  2M56 B;  2L76 A;  1UNS A;  4ZDV A;  1S1Q B;  4YWG G;  2LEK A;  2QMT A;  2JYT A;  1GNU A;  2Z0D B;  1ZP0 B;  3Q8B A;  4C80 A;  2RPQ A;  2L52 A;  3RUL A;  1ZXH A;  3QC8 B;  3C19 A;  2DEN B;  3ZDT A;  4EZK A;  5BO4 B;  3Q3F A;  2V3N A;  2NBU A;  4GDL B;  2Y5B B;  2N1W A;  2PE9 A;  1QOA A;  1WMH B;  2OJW A;  3PS6 A;  2D2Q A;  1L0X B;  1JRU A;  4K7U A;  2LD9 A;  4ANW A;  2N7E A;  1WM2 A;  1L2N A;  1F2R I;  1BXT A;  5CHF A;  3JSV B;  3L54 A;  4OZB A;  2KYW A;  1I4H A;  1TGZ B;  3AE3 B;  1EWY C;  3MC8 A;  1KRH A;  3HM3 A;  1XO3 A;  2BYF A;  4BAX A;  4FJZ A;  4WJP A;  5GXG B;  1E5W A;  1PFD A;  2BPS A;  3I63 C;  4M0W A;  1VD2 A;  1PGX A;  2LAS A;  4F7Z A;  1C4P A;  1TS2 A;  3HRD D;  3L17 A;  5LLI A;  1WJ4 A;  2K22 A;  3PLV A;  1K53 A;  4FXC A;  4KSL C;  4RCO A;  1CZP A;  1D4B A;  4PS3 A;  2X8X X;  2KXJ A;  2KAJ A;  2Y5C A;  1WGD A;  3ZTC A;  2K39 A;  4A8X C;  5BYS A;  2PE6 B;  5I4D A;  4M01 A;  3TIX A;  4ZRJ A;  2CKH B;  3NVV A;  2L05 A;  2EEL A;  3KQ4 A;  4RF0 A;  4LTU A;  4P1C C;  3DBR B;  3U7D A;  4B0M A;  4P1B C;  1E7V A;  5AZG A;  1WXM A;  3VH4 B;  1QT9 A;  4CO7 A;  3B08 A;  1HEZ E;  5HFY A;  4HKQ A;  2ON8 A;  2KNB A;  2LHD A;  3A9J B;  2NMQ A;  1QQR A;  2L1A A;  4F1S A;  3JSV A;  3W1S C;  3RN9 C;  2BWE S;  2HDE A;  1XT9 B;  1VDV A;  3PHX B;  4LJO B;  4MGK E;  3ZNH B;  1SF0 A;  5MPO A;  1RWS A;  1P9D U;  4K1R B;  3SFE B;  2K1F A;  2WXF A;  3MTN B;  2O6V B;  1YMH E;  2BKF A;  4KV2 A;  2BS4 B;  3AE1 B;  4BKG A;  2RMM A;  1KOT A;  2K25 A;  2D3A A;  1FXA A;  1ZOY B;  2W82 A;  1MPE A;  3A4R A;  4US8 A;  2ZVN A;  1WWT A;  1RFK A;  1XLQ A;  2LVP A;  3SFD B;  3NJT A;  5J2R A;  3TCA A;  1VCB A;  4PS7 A;  2DX5 B;  2WXM A;  4LNK A;  2KTF A;  2FAZ A;  1F52 A;  2KTR B;  2GBN A;  5FR3 A;  3R3M A;  4LJP B;  3W1S A;  1C79 A;  4DHJ B;  1K52 A;  4E3C A;  1M4V A;  2AQ3 B;  2M0A A;  3Q3J A;  1XLN A;  1RM6 C;  4HCP B;  2XEW A;  1C1Y B;  2RSU A;  1AYF A;  4TMA B;  1RAX A;  4ASW C;  4R3D A;  3ZKJ C;  1E90 A;  4DDI D;  2ZNV B;  4MT5 A;  3PRE A;  2MX2 A;  1P7F A;  2WDV B;  1N5W A;  1GOZ A;  2VH1 A;  3L4P A;  1IYF A;  4W9F A;  2KHW B;  4HRS A;  1XCT L;  1SBB B;  3ZNG C;  2L32 A;  2ZPY A;  1T0Q C;  3I9V 1;  3FKY A;  4HPP A;  4A9A A;  2IGD A;  1PQS A;  2K6D B;  1E0Z A;  1WRD B;  2JT4 B;  4JE3 B;  1XCQ L;  4II3 B;  4IKG A;  5T8I A;  3R7Q A;  1GB1 A;  4ANU A;  4MM3 B;  4X57 B;  2AQ2 B;  3VTU A;  2NPT A;  2KN5 A;  3M95 A;  3N3K B;  4DHJ D;  4C4V A;  3ZIM A;  3MP9 A;  4WIP A;  2K8H A;  4MSQ B;  4O1N A;  4JWS C;  3RFZ B;  2BW2 A;  3UIN B;  4HJK A;  4EE2 A;  3N32 A;  1IGC A;  2WXJ A;  4FLH A;  1N63 A;  1EUV B;  4HLE A;  1YJ1 A;  2WXK A;  2FCM A;  4WQO B;  3DWM A;  2V0G A;  2JVC A;  4BFR A;  2KC1 A;  2YVC A;  3ZVV A;  4BOS C;  2FCN A;  1ISN A;  1HZ5 A;  4USA A;  2M4N A;  2ZJD A;  1YJI A;  3WAP A;  4JGH B;  2H88 B;  1WX9 A;  3ZJU A;  1F1H A;  5E6P A;  2QCZ A;  1V5O A;  3B9J A;  1JWS D;  2NVU I;  3PZD A;  2JQR B;  1WGR A;  4DDG D;  2V9H A;  2VZK D;  1FCL A;  5EE1 A;  1PYW D;  3V62 A;  1WGK A;  3VHT C;  1OQR A;  1V8C A;  2LXC A;  4C56 C;  4BBN C;  2MBB B;  4CYE A;  2XK5 A;  1I4Q A;  3Q3N C;  4LNO A;  3BVG A;  3RNF C;  1YN4 A;  3AU4 A;  1J8C A;  1S3S G;  1N6Z A;  2BQQ A;  1SE3 A;  2ZW1 A;  3GB1 A;  1QZE A;  3MHS D;  1OQY A;  3GP7 A;  1Q10 A;  4NNJ B;  5CHV C;  1HA5 A;  1ZW7 A;  4WWO A;  2IY0 B;  2WXR A;  2AQ1 B;  2B3A A;  4WWP A;  3IVF A;  2BKR B;  1GT8 A;  2JYE A;  1D5M C;  1FXI A;  2BGF A;  3ZW3 A;  2KN4 A;  1E8Z A;  1SJE D;  3H8H A;  1KH0 A;  1P7E A;  2KLC A;  4PS8 A;  5JHB A;  3ZRF A;  2N7J A;  4ZHP A;  2DAF A;  2KTR A;  4FBJ B;  1YNT E;  4IM3 A;  3VFK A;  2V1Y A;  1IBX B;  4HXD A;  1FNV A;  3A33 B;  2IND C;  1Q1O A;  4KGS A;  5IP4 D;  2K5P A;  2MHJ A;  1V86 A;  1F9J A;  1CMX B;  4B95 A;  1YQ3 B;  3ETR A;  2AL6 A;  4K3B A;  3R8B A;  2ACZ B;  2JZP A;  1OTR B;  4DXF A;  2R61 A;  3PZ7 A;  1WI0 A;  2QIE B;  1K51 A;  2HTH A;  1EF5 A;  3RZF A;  1V6E A;  2MWS B;  2RDG A;  1DOX A;  4HPM B;  4W9G A;  2D07 B;  3JVZ X;  1WGG A;  3WAN A;  2LGX A;  3U7Z A;  1DOI A;  3DBL I;  4RF1 A;  3QHT A;  2DLB A;  3CF4 A;  3P1M A;  3SR6 A;  3E56 A;  5AUI A;  1LM8 B;  2WGS A;  3T9L A;  3P4R B;  1SB3 C;  3PT2 B;  4A6Q A;  1ZDX A;  3WCQ A;  3AB5 A;  1STE A;  4OVV A;  2O2V B;  2GBR A;  4NAW B;  4I6P A;  4ZRI A;  2O6V A;  3DVN U;  3HIZ A;  4YTM B;  2WS3 B;  2CS4 A;  4MH0 E;  4M8M A;  4MM3 A;  3ZNI D;  4OVU A;  1BML C;  2C5L C;  3TBL D;  4IM2 A;  1UEL A;  3DBH I;  2LGS A;  4A3O A;  3DBH B;  3DPD A;  1CK1 A;  3IFW B;  3KYD D;  4P7I A;  5DPT A;  3RI7 C;  2M19 A;  5HKH A;  2NR2 A;  1I4P A;  2FID A;  1NVI D;  4PYU A;  3L08 A;  1WRI A;  1FCC C;  2JU6 X;  2VRR B;  1WR1 A;  3PRM B;  2N9P C;  3CST A;  3OWE B;  3RNE C;  2DYB A;  1SE4 A;  1UF0 A;  2ICI A;  3EFU A;  2J0K A;  5G2N A;  2DZJ A;  1KLU D;  3SU8 X;  3BVM A;  3U2S C;  2LZ6 A;  2LFI A;  2L7R A;  2LMC A;  4A20 A;  4N58 A;  4GDK B;  1I35 A;  2LI5 A;  4XDC A;  2J7Q B;  5JH5 C;  4F8C B;  1WGY A;  1J7B A;  5AEK B;  1YN5 A;  1NYQ A;  2KKC A;  3TSS A;  4YL8 A;  1XD3 B;  3VQI A;  4BVU C;  4ZRK A;  3T3N A;  4B0E A;  2IBI B;  4HCN B;  1ZDV A;  2WXN A;  2WHI A;  3UQA A;  4EKU A;  4RGN A;  2W55 A;  1NYR A;  2K0P A;  3OLM D;  3URY A;  3O13 A;  3E9S A;  1ZKH A;  2GBM A;  1PGA A;  3IXS A;  4I6L B;  5J17 A;  2DNF A;  2I1K A;  2K6Q A;  5LNK 1;  4M02 A;  5HG2 A;  3IAM 1;  2ZCB A;  3KW5 B;  2KQ4 X;  1GB4 A;  1AN8 A;  2HTM E;  4IW0 A;  1P98 A;  3IT6 B;  3APF A;  3V05 A;  1I4R A;  4OZA A;  4E71 A;  3PRP B;  1LO5 D;  1SE2 A;  3ZTD A;  1L7Y A;  3HM6 X;  4YSX B;  1IGD A;  4KKI A;  1E7P B;  2ASQ A;  4AOF A;  2NBW B;  4KGR A;  1V1O A;  4IG7 B;  1EWC A;  2C7H A;  2GB1 A;  1H4R A;  4ZRP A;  4A55 A;  4KKJ A;  2MRP A;  1WMH A;  4BOZ B;  1JWA D;  2AEH A;  3S2A A;  1WH3 A;  2ZCC A;  1E6E B;  3N1Y C;  2LGY A;  2ONQ A;  5FK9 C;  1GC6 A;  4OHJ A;  5H92 C;  1V9J A;  4MJS B;  2KWC A;  4N6E B;  4G0N B;  3JYU A;  1IUE A;  1Q5W B;  2D10 A;  2DYO A;  3KH0 A;  1T0Y A;  1GPX A;  2E3T A;  1JWB D;  3I57 A;  1ENF A;  2GBK A;  4W9C A;  4PYZ A;  3N9Y C;  2ZVO A;  3EA6 A;  2BYE A;  4WJO A;  2KDF B;  3SDL C;  4AUQ C;  2V4L A;  1J7C A;  2GLS A;  3H7S A;  3CSF A;  3Q3O C;  1FRR A;  1ET6 A;  3OJ4 B;  3WA0 A;  4IC7 B;  3Q69 A;  2DAJ A;  3ZQ4 A;  2KAN A;  3RD2 A;  4FJV B;  1G6J A;  3FIL B;  1N60 A;  4TKN A;  2NBV B;  4DK5 A;  3ZUN A;  2EMT A;  2KJ6 A;  4J3O D;  3TL5 A;  3VUY A;  2FUH B;  4BKT A;  1OEY J;  1LQB A;  1I7H A;  5BMH A;  4XDD A;  1JW9 D;  3AEE B;  2REX A;  3ENE A;  2KMA A;  4ZOH C;  3GS2 A;  1TIF A;  3K9O B;  1PGB A;  3AE5 B;  5E6O A;  3BYT B;  3TEZ A;  2KVZ A;  1SJH D;  5CX3 A;  1U4A A;  1BT0 A;  1QOG A;  2BB5 A;  3PHW B;  2JWU A;  2IGH A;  2LUE A;  5G55 A;  4GOC A;  1E8Y A;  4NZL B;  3AE7 B;  1EO6 A;  2VZK B;  4WWN A;  3JW0 X;  3M63 B;  5BYR A;  4TV3 A;  2NCN A;  3NOB A;  1L6U A;  2KO3 A;  4RGM A;  4LDT D;  3M3J A;  4W9L A;  3EUB 2;  2KMM A;  2GOW A;  3B2F A;  1HTQ A;  2JXT A;  3PVL A;  4LNN A;  3HVD A;  2N4F A;  1R4M I;  4JPS A;  4K81 A;  1JCK B;  1C78 A;  2YEP F;  1CQV A;  1L6V A;  4XGA B;  1UGM A;  5FR6 A;  4CHK A;  3H1U A;  4XZ4 A;  1RFA A;  1IPG A;  2AX5 A;  2IPK D;  1WJ6 A;  3VRA B;  1GTH A;  2PEA A;  2CHX A;  3R2T A;  1WJU A;  4FHJ A;  2EKI A;  1TKY A;  3VR8 B;  4GMV A;  4CQN A;  1FFV A;  3HHM A;  2MJ3 A;  5C2T B;  2BBC A;  1FMA D;  4NY0 A;  2CU1 A;  3L0W B;  2K3U A;  4GLS C;  3SHQ A;  2RPV A;  4B9K A;  1T0R C;  1V80 A;  2DWQ A;  4P6V F;  1CJE A;  3N1X C;  4LDT B;  3DDC B;  3RT3 B;  4RMA A;  1LGR A;  2ZZP B;  5IOI A;  2Z59 B;  1OEY A;  4KDL B;  1OQQ A;  5L83 A;  2K9X A;  3TEX A;  2KT7 A;  2XBB C;  3OAW A;  4N9F 4;  4OW0 A;  2X38 A;  2N1V A;  4IOI E;  2I38 A;  3VDZ A;  1ZE3 D;  2WX1 A;  4FN2 A;  2CHZ A;  2KWV B;  1D5Z C;  4NAM A;  2QDF A;  5E6N A;  3R66 C;  2IDY A;  5TR5 A;  3CMM B;  5HI1 A;  3RUI B;  5IA7 A;  2BF8 B;  4IDI A;  3R7R A;  3DBS A;  3EGR A;  4HEA 1;  1V5T A;  3W9C B;  3UGB B;  1JWU D;  4ARI A;  2FIF A;  1KFY B;  4WJQ A;  3DHI C;  4YSZ B;  4C4V B;  1Z5S B;  4MH8 A;  1MJD A;  2L83 A;  2D3C A;  2CHW A;  1QLB B;  3QK0 A;  1RRB A;  2L8J A;  2FBW B;  1UBI A;  1YQ4 B;  1Q0W B;  2MBQ A;  2M0X A;  3TUO A;  3AM9 A;  3MHZ A;  3UIP B;  2QIL A;  1SGH A;  3V3X A;  3AE8 B;  4YTN B;  2BVC A;  3UI3 A;  3B1L X;  2TSS A;  3K9P B;  1VRA B;  1YN3 A;  3QWZ B;  3BII D;  5H8Y E;  1I4G A;  1XXG A;  2G1E A;  4QAY A;  1TT5 B;  2WYQ A;  3CIR B;  4W9I A;  3Q6B A;  1MFW A;  2RGF A;  3U4E G;  1R4M B;  3ZO5 B;  3MC9 A;  2JZZ A;  3VUW A;  1V1P B;  2PVG C;  1V49 A;  1WYW B;  1GUA B;  2JRH A;  4BBN F;  2WQY B;  4WJN A;  1L0Y B;  2IO0 B;  3VTW A;  3GE8 C;  4C7Z A;  2LWP A;  4AP4 C;  4ZYN A;  3ZXV A;  2PTL A;  1SSN A;  3P4S B;  3LJ3 A;  2ZNV C;  3PLU A;  4W9J A;  2LHE A;  5J18 A;  4LNI A;  1TKE A;  1MHX A;  5DPS A;  4US9 A;  2DYM A;  2LJ5 A;  2WNM A;  3ZYY X;  2FCS A;  2VH2 A;  1WF9 A;  2GRI A;  3PSE B;  2C7M B;  2I1J A;  3KWV A;  3GOE A;  2FUG 1;  2L00 B;  3L16 A;  4KSK C;  3X0W A;  3UF8 A;  1HE8 A;  2HD5 B;  4TUU A;  4W9H A;  5AUK A;  4HKZ E;  3DVG Y;  2IYD B;  3NZS A;  2K8B A;  2KX3 A;  3DCG A;  3BY4 B;  1TY0 A;  4G3X B;  1BUI C;  2J0J A;  3AEG B;  4H2A A;  2E6X A;  3ML9 A;  1GAQ B;  3RNC C;  3KUD B;  2BS3 B;  1GG3 A;  2WXQ A;  2OJR A;  4TQ0 A;  4KVG B;  1TZO A;  1EU4 A;  3Q8A A;  1ESF A;  3QX1 A;  4RFB A;  2HJ8 A;  4G50 A;  3VXW A;  1WFY A;  3KVF B;  2MBE A;  4GXB A;  3WIM A;  4KZC A;  1E7U A;  2V3S A;  3N30 A;  2Z0E B;  3NVW A;  3VTV A;  3AN1 A;  4HJG E;  3N1Z C;  2JSV X;  2H89 B;  2KC2 A;  1F77 A;  4KIK B;  4GGQ A;  4XX5 A;  3Q8F A;  1PDX A;  1UBQ A;  1NI2 A;  3PRZ A;  3ZDM C;  4DWF A;  2MBH A;  4DHZ B;  3NY5 A;  3AEF B;  3RNG C;  4EZL A;  3RZW C;  2LRW A;  4ARC A;  1YJJ A;  1Z2M A;  5BMG A;  1FNU A;  3RCZ A;  4JIO U;  4MJS A;  1C4C A;  4D2K A;  1XEE A;  2JUO A;  3AEB B;  4YTP B;  5IAA C;  2NTS A;  4UDU C;  4BKS A;  2L3Z A;  1VR9 A;  1PUT A;  1KLG D;  3OG5 A;  2DBY A;  1QOF A;  1KTK A;  1ACC A;  4WUR A;  2BYT A;  1MI0 A;  3V6E B;  4KX6 B;  1V1P A;  1AAR A;  3RYT A;  1WSP A;  4LK0 M;  4FJY A;  1F2R C;  1WE7 A;  2W3S A;  3AUL A;  2LVQ A;  4W9E A;  4ACF A;  3SEB A;  2N9K A;  4C7Y A;  4LNF A;  3IG3 A;  4GIV A;  3ZLZ A;  4IWO A;  2JY6 A;  4DHZ E;  1TTN A;  2RDH A;  4Q2J A;  3BYY B;  2CR5 A;  3I3T B;  2KFK A;  3I5J C;  1ET9 A;  2EKE C;  1H7X A;  2UU7 A;  2MQJ A;  1N5X A;  3PGE A;  2CJO A;  3V60 A;  2PW9 A;  4LLG M;  2YLM A;  4EFO A;  2QSD A;  2ZEQ A;  1J0G A;  1X1M A;  2MP2 A;  3KLS X;  2Y3A A;  1WXA A;  3W5U B;  2AWT A;  1L4Z B;  2JZ3 B;  1MG8 A;  1UD7 A;  3VUX A;  2ZPN A;  2EMS A;  1QIL A;  3QIJ A;  5FKA C;  1SXT A;  1ZUD 2;  4JLC A;  1OGW A;  2KJR A;  2QHO A;  1V81 A;  1IBX A;  2OED A;  5KHQ A;  3AEA B;  1JWM D;  1WR6 E;  2IY1 B;  3DHH C;  2MEK A;  3LB8 C;  4JWU C;  5IO9 A;  3ALB A;  4TSS A;  5E6J A;  3NZU A;  2G9H D;  2A4Z A;  3W5V B;  1F0Z A;  1N62 A;  2WDT B;  3U52 E;  4G11 A;  3ZJV A;  3FAH A; 
#chains in the Genus database with same CATH homology
 2YEP F;  1CQV A;  1HXY D;  3B9J A;  1JWS D;  1L6V A;  2PMV A;  1FNW A;  1HZ6 A;  2JQR B;  4ZHO A;  3PO0 A;  3TEW A;  2WU5 B;  2VZK D;  2AX5 A;  2IPK D;  2KDM A;  2WXI A;  1TYG B;  5EE1 A;  1FCL A;  4RGO S;  1J7A A;  3VRA B;  3B2G A;  3C8Y A;  1PYW D;  1GTH A;  4YSY B;  1WGK A;  1OQR A;  1V8C A;  1XF5 L;  4C56 C;  3R2T A;  3Q8E A;  2EKI A;  1FIQ A;  1I4Q A;  1TKY A;  3TEY A;  1UWX A;  3BVG A;  3VR8 B;  1TKG A;  3DWG C;  1YN4 A;  4CQN A;  3ZGZ A;  1FFV A;  1SEB D;  2N9L A;  2QEJ C;  2MJ3 A;  5C2T B;  1SE3 A;  2BBC A;  2ZW1 A;  3GB1 A;  1FMA D;  1AW7 A;  4L1B A;  1VZ8 A;  4ZYS A;  2K3U A;  4GLS C;  1XLO A;  2JX5 A;  2RPV A;  3GP7 A;  1Q10 A;  2DWQ A;  4P6V F;  1T5X D;  1MHH E;  2MJD A;  4WH4 A;  1TS4 A;  1CJE A;  2V3P A;  4HRO A;  1HA5 A;  1WXQ A;  1T3Q A;  2J42 A;  4WQM A;  4NJC A;  1V97 A;  1OQQ A;  1JRP A;  2WXR A;  1C4A A;  2AQ1 B;  1JAL A;  5D3D A;  3MC0 B;  1GT8 A;  2JYE A;  2K9X A;  3AE4 B;  1D5M C;  3TEX A;  1B1Z A;  1FXI A;  4PT5 A;  1AWD A;  2J52 A;  2KN4 A;  1ROE A;  2KWD A;  2X38 A;  4OW0 A;  4RNA A;  5G5G A;  4IOI E;  2I38 A;  4TQ1 A;  1ZE3 D;  2LGI A;  1SJE D;  2LUM A;  3H8H A;  1KH0 A;  3NS1 A;  5EE3 A;  1P7E A;  1D5Z C;  4NAM A;  1VLB A;  2N7J A;  4ZHP A;  1UGJ A;  2LJI A;  2IDY A;  1YNT E;  1K50 A;  5HI1 A;  3AEC B;  2CU3 A;  1IBX B;  4IDI A;  2FE8 A;  3CWI A;  2KAC A;  1FNV A;  3MJ5 A;  4L23 A;  5BMI A;  1GTE A;  3EGR A;  4HEA 1;  4KGS A;  3W9C B;  4MAC A;  2K5P A;  1C76 A;  1YQ3 B;  1JWU D;  3LYY A;  2V4I B;  3ETR A;  4ARI A;  2WDR B;  1KFY B;  1I4X A;  1DOY A;  3R8B A;  1T6B X;  4YSZ B;  1XLP A;  2PIA A;  3MFG A;  2ACZ B;  3IT4 B;  2JZP A;  4MH8 A;  4OVZ A;  3HUI A;  1FO4 A;  4DXF A;  1FD6 A;  3PZ8 A;  2R61 A;  1Y56 A;  2WP9 B;  2L83 A;  3PZ7 A;  2WXL A;  3BWU D;  1QLB B;  1DGJ A;  2QIE B;  1K51 A;  2J53 A;  4N59 A;  2FBW B;  1YQ4 B;  3AE2 B;  2RDG A;  1DOX A;  5G5H A;  3TUO A;  3AM9 A;  2N0S B;  2WLB A;  3MHZ A;  4DXG A;  2BTE A;  3FIL A;  3Q8C A;  2QIL A;  3BZD B;  3U7Z A;  1UWM A;  2W3R A;  3P63 A;  5EE0 A;  3V3X A;  3AE8 B;  1MVK A;  1DOI A;  4YTN B;  4WAF A;  4RF1 A;  2DLB A;  3UI3 A;  3ZJT A;  4DQO C;  3CF4 A;  5TSS A;  2M56 B;  2TSS A;  3P1M A;  3SR6 A;  1VRA B;  1YN3 A;  3E56 A;  2BS2 B;  3BII D;  5AUI A;  1UNS A;  3P4R B;  1SB3 C;  5H8Y E;  4YWG G;  4A6Q A;  1I4G A;  2WDQ B;  1XXG A;  2G1E A;  2LEK A;  2QMT A;  2JYT A;  3P4Q B;  1ZDX A;  3CIR B;  1ZP0 B;  3WCQ A;  3AB5 A;  1STE A;  3Q8B A;  4C80 A;  1N61 A;  4NAW B;  2L52 A;  3U4E G;  1ZXH A;  4AQ7 A;  1RYJ A;  1V1P B;  3AMZ A;  1L4D B;  2PVG C;  4YTM B;  2WS3 B;  2V3N A;  4GDL B;  2WQY B;  2BT6 A;  1BML C;  3AH7 A;  1QOA A;  1L0Y B;  2PLP A;  1L0X B;  1QF6 A;  4C7Z A;  2PTL A;  4ZRQ A;  2I2Y A;  1SSN A;  1F2R I;  1BXT A;  3P4S B;  4OZB A;  1I4H A;  1KF6 B;  2D5G A;  1CK1 A;  2LHE A;  1H7W A;  3R2I A;  5C3J B;  1NI3 A;  1DYQ A;  3AE3 B;  1TKE A;  1EWY C;  1MHX A;  4US9 A;  2DYM A;  2WNM A;  1HQR D;  3ZYY X;  2M19 A;  1KRH A;  1XO3 A;  2GRI A;  5GXG B;  3RPF C;  1I4P A;  1NEK B;  1PFD A;  2BB6 A;  1NVI D;  2SAK A;  3NVZ A;  4M0W A;  1PGX A;  1WRI A;  1FCC C;  1C4P A;  1TS2 A;  3HRD D;  1EM7 A;  3KWV A;  3AE6 B;  2JU6 X;  2K22 A;  1K53 A;  5JXV A;  4FXC A;  3BVZ A;  2FUG 1;  4RCO A;  3OWE B;  1CZP A;  1D4B A;  2ICI A;  1SE4 A;  3J9C A;  2KAJ A;  2Y5C A;  4A90 A;  1KLU D;  5AUK A;  1FEH A;  2NTT A;  3BVM A;  3U2S C;  4HKZ E;  2LFI A;  4A8X C;  2LMC A;  5BYS A;  3NRZ A;  4N58 A;  4GDK B;  4L2Y A;  5I4D A;  4XDC A;  3NVV A;  1JQ4 A;  2MJE A;  1TY0 A;  2EEL A;  3KQ4 A;  4RF0 A;  2XN9 C;  4LTU A;  1TJE A;  1BUI C;  1J7B A;  3AEG B;  1YN5 A;  1NYQ A;  3TSS A;  4H2A A;  2E6X A;  4B0M A;  2SEB D;  1GAQ B;  3VQI A;  3T3N A;  1QT9 A;  2IGG A;  4B0E A;  2BS3 B;  2WXQ A;  3BK1 A;  3W2D A;  1R7S A;  1HEZ E;  2YEP B;  4TQ0 A;  1ZDV A;  5HFY A;  4HKQ A;  2WXN A;  2ON8 A;  1TZO A;  2LHD A;  1EU4 A;  3Q8A A;  2NMQ A;  1ESF A;  1QQR A;  3VR9 B;  3LXF A;  4RGN A;  2L1A A;  2W55 A;  4RFB A;  1NYR A;  2K0P A;  2HDE A;  3BK2 A;  3URY A;  2GI9 A;  3O13 A;  1VDV A;  1QOB A;  3E9S A;  1VZ6 A;  1PGA A;  3IXS A;  2WXP A;  1FFU A;  3NZ3 A;  1SF0 A;  5MPO A;  1RWS A;  3SFE B;  3VRB B;  2WXF A;  3P4P B;  3NVW A;  1YMH E;  5HG2 A;  5LNK 1;  3IAM 1;  2BS4 B;  3AN1 A;  3AE1 B;  4HJG E;  5EE9 A;  2JSV X;  2RMM A;  2H89 B;  5BYQ A;  1F77 A;  2KQ4 X;  1OFF A;  1GB4 A;  1FXA A;  1ZOY B;  2W82 A;  1AN8 A;  3Q8F A;  4JX1 C;  1PDX A;  1MPE A;  1L5P A;  2HTM E;  4US8 A;  4XWW A;  1WWT A;  1RFK A;  2OHF A;  1XLQ A;  3IT6 B;  3V05 A;  3AE9 B;  1I4R A;  2CJN A;  1C77 A;  4AS1 A;  3SFD B;  2W54 A;  4OZA A;  4REZ A;  1E10 A;  1LO5 D;  1SE2 A;  4ITK A;  3AEF B;  1JRO A;  1VJK A;  4ARC A;  1JML A;  2WXM A;  1L0V B;  1YJJ A;  4YSX B;  1IGD A;  5BMG A;  1FNU A;  4KKI A;  1C4C A;  1E7P B;  4D2K A;  1XEE A;  4RH6 A;  3AEB B;  1TY2 A;  5FR3 A;  4KGR A;  1V1O A;  4XE0 A;  2WXH A;  1EWC A;  4YTP B;  1FM0 D;  2GB1 A;  2NTS A;  4UDU C;  4ZRP A;  3W1S A;  4A55 A;  1C79 A;  1VR9 A;  2WU2 B;  3T3O A;  1K52 A;  1PUT A;  4KKJ A;  2IJ0 A;  2INN E;  1KLG D;  1TS5 A;  1FRD A;  1M4V A;  1TS3 A;  2AQ3 B;  2M0A A;  1XLN A;  1JWA D;  3AV8 A;  1RM6 C;  2DBY A;  1E9M A;  1E6E B;  1QOF A;  1KTK A;  1ACC A;  2ONQ A;  4WUR A;  5FK9 C;  1AYF A;  4TMA B;  4OHJ A;  2BYT A;  1NEN B;  4OZC A;  4R3D A;  1MI0 A;  5H92 C;  3IAS 1;  4KX6 B;  1V1P A;  2B76 B;  4N6E B;  4MT5 A;  1IUE A;  1WSP A;  4LK0 M;  1P7F A;  2WDV B;  2DYO A;  1GPX A;  2WXO A;  1N5W A;  2QJL A;  1GOZ A;  2E3T A;  1JWB D;  3L4P A;  4YXD B;  3I57 A;  1F2R C;  2W3S A;  1ENF A;  4HRS A;  3N9Y C;  3SEB A;  1XCT L;  1SBB B;  2L32 A;  2N9K A;  3EA6 A;  4C7Y A;  1D5X C;  3I9V 1;  4YT0 B;  1J7C A;  2PVO D;  4A9A A;  2IGD A;  2RDH A;  1FRR A;  1ET6 A;  3Q69 A;  1E0Z A;  4Q2J A;  3ZQ4 A;  3BYY B;  1SIJ A;  4JE3 B;  1XCQ L;  4IKG A;  5T8I A;  1GB1 A;  3FIL B;  1N60 A;  4MM3 B;  1ET9 A;  1QKZ A;  4J3O D;  2AQ2 B;  1ZPS A;  1H7X A;  1I7H A;  5BMH A;  3FAH A;  4XDD A;  1EU3 A;  1JW9 D;  3AEE B;  1N5X A;  4ZOH C;  2CJO A;  2MH7 A;  3P42 A;  2Y5P A;  3GS2 A;  2J4X A;  1A70 A;  1PGB A;  3AE5 B;  1D6E C;  2PW9 A;  4LLG M;  3BYT B;  3MP9 A;  4WIP A;  3TEZ A;  1SJH D;  2QSD A;  5D7G A;  4O1N A;  4JWS C;  3KLS X;  2Y3A A;  3RFZ B;  1C9F A;  2BW2 A;  3W5U B;  3FC4 A;  1L4Z B;  4EE2 A;  1IGC A;  1QOG A;  2WXJ A;  4RGT A;  1N63 A;  2BB5 A;  1QIL A;  5FKA C;  2JWU A;  1WYG A;  2IGH A;  1SXT A;  1ZUD 2;  5HHD G;  2WXK A;  1IBX A;  5D3I B;  4NZL B;  3AE7 B;  2VZK B;  2OED A;  1B9R A;  3DWM A;  2V0G A;  3AEA B;  1JWM D;  1ZXI A;  2XNA C;  3NUH B;  5BYR A;  2ZW0 A;  1L6U A;  2Q5W D;  4P16 A;  4RGM A;  2MEK A;  3KWL A;  3LB8 C;  3EUB 2;  4JWU C;  1HZ5 A;  2KMM A;  4KGT A;  3B2F A;  4TSS A;  4USA A;  5E6J A;  2JXT A;  3NVY A;  2INP E;  2Z8L A;  2G9H D;  1YJI A;  1VZ7 A;  3W5V B;  1F0Z A;  3HVZ A;  1N62 A;  4WWM A;  3ABV B;  3AED B;  3HVD A;  2PKO A;  1UUP A;  2H88 B;  2WXG A;  4JPS A;  4XWT A;  3U52 E;  3ZJU A;  1JCK B;  3ZJV A;  1C78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...