2BS2B

Quinol:fumarate reductase from wolinella succinogenes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUINOL-FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A
publication title Evidence for Transmembrane Proton Transfer in a Dihaem-Containing Membrane Protein Complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 239
sequence length 239
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2bs2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bs2B01
1L0VB 1E7PB 1FIQA 3LB8C 1R7SA 2WU5B 2L52A 2BT6A 5GXGB 1H7WA 5C2TB 3P4RB 1XO3A 2HTME 2WQYB 1ROEA 1XLPA 2PVGC 3CF4A 1B9RA 2MH7A 1DOYA 3AEGB 5G5GA 1NI3A 1TKGA 1N60A 3SFDB 2JQRB 3L4PA 1J7CA 4P6VF 4C7YA 3VR8B 1JALA 1QOBA 1FFUA 1YJJA 1QOGA 3VRBB 2LEKA 2Q5WD 1RM6C 5AUIA 3AEBB 2AX5A 3ETRA 1NYRA 1WXQA 1ZP0B 4USAA 3BIID 3SR6A 1QOAA 4JWUC 3AE5B 1IUEA 3FAHA 3NS1A 3AB5A 1DOIA 2QJLA 5EE9A 1I7HA 3P1MA 2B76B 3AE2B 1L5PA 3FC4A 1KF6B 1OFFA 2CJOA 3WCQA 3AE6B 3AN1A 1OQQA 1T3QA 1CJEA 2QIEB 1QOFA 1TKYA 3HVZA 4HROA 1ZUD2 3HRDD 3AM9A 1GTEA 1E6EB 1V8CA 1WGKA 2CJNA 1WYGA 3AMZA 4WQMA 4YSXB 4WWMA 1XLNA 3AE1B 1AYFA 2DWQA 2EKIA 2BS4B 3AEFB 2N0SB 3AE9B 2W55A 2CU3A 1RFKA 3HUIA 1VLBA 4N59A 2L83A 1VDVA 2WDRB 4YTPB 1KFYB 3VRAB 1N61A 5C3JB 1FRRA 1XLOA 2K22A 1NVID 3W5VB 4YSZB 1YQ3B 1YQ4B 1N63A 1QLBB 4A9AA 1EWYC 4N58A 1NYQA 1FO4A 2KMMA 1TKEA 2E3TA 1E0ZA 1RWSA 2WP9B 2ACZB 2BS3B 2PKOA 4LTUA 3AECB 3B2FA 4C80A 1A70A 3CIRB 2WDQB 4IDIA 3P4PB 1JROA 2PVOD 1JQ4A 3ABVB 1J7AA 5H8YE 2K9XA 1VJKA 2W3SA 4ITKA 3VR9B 3NVZA 1TJEA 3PO0A 2WS3B 4YT0B 2M19A 4C7ZA 2BS2B 2DBYA 1XLQA 4YTNB 3AE4B 1KRHA 1N5XA 2G1EA 2JX5A 5MPOA 1QF6A 3AE8B 4YSYB 3DWMA 2FBWB 1RYJA 5EE1A 1CZPA 2W3RA 4ZOHC 1JW9D 3B2GA 1QT9A 1PUTA 2KAJA 2WLBA 3NVWA 3EUB2 3AV8A 1FM0D 1FFVA 2WDVB 1FXAA 2PIAA 3AEDB 4HRSA 5EE0A 2Y5CA 3NRZA 1DOXA 1V97A 3W9CB 3W5UB 1NEKB 2K5PA 1E10A 3NVVA 3P4QB 3DWGC 1GAQB 1GPXA 3CWIA 3AE3B 1UWMA 1N5WA 2WU2B 1E9MA 2MJ3A 4US8A 3AE7B 1GT8A 1SB3C 5EE3A 3ZYYX 5AUKA 4ZHOA 1F0ZA 1ZOYB 3KWLA 1FRDA 5H92C 5G5HA 3AEEB 3LXFA 2H89B 2H88B 1TYGB 3AEAB 3NVYA 1JWAD 1PDXA 2OHFA 1ZXIA 4JX1C 1NENB 3P4SB 2MJEA 1H7XA 1GTHA 1JRPA 3P63A 1L6UA 3RPFC 1FXIA 1AWDA 2MJDA 4JWSC 1L6VA 4YTMB 1DGJA 1FMAD 1JWBD 1SIJA 1WWTA 1J7BA 4N6EB 1N62A 3SFEB 4KX6B 4YXDB 1WRIA 1YJIA 4ZHPA 4FXCA 3AH7A 1SF0A 3B9JA 2M56B 2W54A 1OQRA 1PFDA 4US9A
chains in the Genus database with same CATH superfamily
1YMHE 3RT3B 1WI0A 1V9JA 4AJWA 5CTRC 3EHVA 2WXQA 1RAXA 4P6VF 3NZUA 1QOGA 3VRBB 4IC7B 2ZNVB 3FILA 1UZXB 3BIID 4JWUC 1IUEA 3BWUD 3KYDD 3TEYA 5EE9A 2J0MA 3DBSA 1UGMA 4GDLA 2QIEB 1V2YA 2KJ6A 2RPVA 1HXYD 4EZJA 1MI0A 1LQBA 3A9JA 1ZPSA 3PLUA 2QEJC 4YTPB 3V6CB 4A9AA 1QLBB 1E0ZA 3OWEB 1YJ1A 4P1BC 4HCPB 2CR5A 2ZCBA 2IO1B 4IDIA 5L95C 1MHHE 1Q0WB 3RD2A 1WIAA 2BGFA 3QJZA 4C7ZA 2BS2B 2KWCA 4Q2JA 1KRHA 4TUUA 1CQVA 5MPOA 1L7YA 2L8JA 1C4AA 2MQJA 3BYTB 1CZPA 3URYA 2XN9C 5EE0A 1I4QA 3NOBA 1EM7A 3IAM1 4RGOS 5C1ZA 3KH0A 1S1QB 3ZJUA 5E6PA 4ANWA 2VH2A 3LYYA 1EO6A 2KWUB 2ZJDA 2KQ7A 1QKZA 3LDZE 3ONSA 4W9EA 4WJNA 1FXIA 2DAFA 5HI1A 4YTMB 1J0GA 1WRIA 3MFGA 4MJSA 2W54A 1YN4A 2BT6A 1FNWA 4HCNB 1KLVA 2LVQA 3RULA 1DYQA 1NI3A 3ZXVA 2WGSA 4C7YA 2SEBD 2KK8A 2LEKA 1R4NI 4C4VA 3JYUA 1MVKA 4LK0M 2BTEA 3L17A 2QILA 3SR6A 3MJ5A 1UELA 1FNUA 1WJNA 3H7PA 1DOIA 3WCQA 2KFKA 1CJEA 2AEHA 3RNCC 3Q6BA 1NBFC 3RCZA 1TS4A 4IM3A 4C56C 4IWPA 2L83A 4LDTB 2KKCA 1Z2MA 4HDOA 1KTKA 3J9CA 4YSZB 2L1AA 2FCNA 3HM6X 3GE8C 3VUXA 3CIRB 1N6ZA 4TQ0A 3QAQA 1WZ0A 5BYSA 1WY8A 1XLQA 3I63C 1IBXB 3DOWA 4M8MA 4LNOA 3L16A 1E8WA 5JHAA 3RNFC 2DZIA 1E7UA 3TIXA 1WR1A 1Q1OA 3MJWA 3P4QB 1LO5D 4TV3A 1KOTA 3AE3B 3SU8X 4QAYA 2RD0A 1L0XB 2L7RA 3GZNB 4MSQB 1HA5A 1XCTL 2K1FA 4PS7A 2ONQA 4XDDA 3TCAA 4OZAA 2XBBC 2BB6A 3U4EG 3L54A 1ZE3D 4US9A 5BMGA 4LNKA 5JXVA 2MBBB 2KT7A 3QA8A 1XLPA 4RMAA 3A9KB 3I57A 1C9FA 1T0RC 2ICIA 1I4RA 4C00A 4RCOA 1FFUA 4EOYA 2AX5A 3L08A 1EWCA 4RGTA 1IBXA 4ICVA 2GBKA 3U7ZA 4DXAB 1L5PA 1ZXHA 2WXIA 1XXGA 2WWZA 4WH4A 2HTHA 2KN4A 4CYEA 1AYFA 2EKIA 3AEFB 2GB1A 3DBHI 3IFWB 2PLPA 1KFYB 2AL6A 4N58A 2KC1A 2ZVOA 2X8XX 3ABVB 4HVBA 2ZW1A 3Q3FA 3VAWA 2JRHA 4JL9A 3VTWA 2L76A 3A4RA 3PZ7A 3RFZB 3U30A 3BVZA 2HE7A 2W3RA 2W82A 3N9YC 4FLHA 2KJHB 5BMHA 1KLGD 3IVFA 3AULA 1L4DB 2PMVA 4II3B 1GPXA 1WH3A 2HJ8A 5EE3A 1U4AA 4ZRKA 3AEEB 1PDXA 2V9HA 3WIMA 4M01A 2MJEA 5TSSA 3P63A 2KLGA 3QHTA 2ZVNA 1SJED 4JWSC 4NAWB 1MG8A 3JW0X 1YOVB 2MSED 1GB1A 4K3CA 1UNSA 1VRAB 1F2RI 3P4RB 1SJHD 2BWFA 2IGHA 1D4BA 1JALA 4LJPB 2NBVB 1UUPA 1C1YB 2BYEA 1IYFA 3N3KB 4O1NA 2KWDA 1ZW7A 2RDBC 3TEWA 1ZDVA 2EELA 3Q14C 2RMMA 2LJ5A 1C79A 4YL8A 1E6EB 2MBQA 4WQMA 5D3DA 1F1HA 1C76A 4B6WA 2CHZA 2VH1A 1N63A 4AUQC 1SE2A 1ZKHA 3BZDB 2PW9A 4B9KA 3NJTA 1UGJA 4XWTA 4DXGA 1JQ4A 2ZPYA 2W3SA 3W1SA 3NVZA 4JLCA 1N5XA 5J18A 1H4RA 3MHSD 1FXAA 2PIAA 1T6BX 2L00B 3QARA 5D94A 4W9JA 1RLFA 4US8A 2K39A 2Y5PA 3Q8BA 5HHDG 4K7WA 3ZTDA 2V3SA 3L0WB 4BAXA 1YIWA 1HTOA 2O2VA 1BXTA 1YNTE 2RDGA 3MC8A 3QC8B 4B0EA 4LCDE 2YEPF 4GSWA 1N62A 4KX6B 1JWUD 2K25A 3VTVA 1OQRA 5BYQA 3GB1A 4DBGA 1WE6A 1WR6E 5BMIA 4EZLA 5C2TB 3DVGY 1XO3A 1EU3A 1Y56A 5DCNA 2MH7A 3DBLB 4ARCA 2JWUA 4DDID 5KHOA 3PS6A 4M8NA 2MX2A 1TGZB 3ETRA 2J52A 1PYWD 1P3QU 1UH6A 4RF1A 3BY4B 3KWVA 2D07B 4MM3B 2QJLA 1BMLC 4E71A 3AE2B 3L10B 1TS3A 5DPSA 4HPMB 2INPE 3DVGX 3APFA 4RGMA 4ANXA 2CJNA 1WX9A 3ZNGC 3GS2A 2BS4B 1IPGA 2BF8B 5E6NA 3HUIA 3IAS1 4ZRJA 2RGFA 1P1AA 3VRAB 2K22A 5FKAC 1FNVA 2MBHA 3I5JC 2ZW0A 4HEA1 4C80A 4DHZE 1BT0A 2DYBA 2K9XA 1C4PA 2KVZA 2UU7A 4S0RA 1K8RB 1E5WA 3UI3A 4NY0A 1WXSA 3DWMA 4K7SA 4ZOHC 3A33B 2KZRA 2V0GA 4MGZE 3B2GA 4XDCA 3RN9C 3RNBC 2MP2B 5GMVA 1DOXA 3VUYA 2WXKA 4DHJB 1LGRA 3RYTA 2NPTB 3RI7C 4MGIE 2OHFA 4JX1C 4RNAA 4WQOB 3HHMA 3A4SC 1E8YA 2LD9A 4ZYSA 4FHKA 1Q5WB 3PTFC 2DX5B 3ZRFA 1WJ4A 3ZNZB 2AWTA 2G4SA 5D6JB 2M56B 4A8XC 3BK1A 4IOIE 3PREA 3VTUA 1TBEA 1V49A 2BYVE 4DK5A 3VDZA 4A20A 3TMPB 2JZPA 4RH6A 3DVNU 3QX1A 3ALBA 2K0PA 4A55A 2WDTB 3NG0A 3EECA 3IBEA 3M3JA 4HPLB 2RSUA 3ZW3A 1WRDB 5KHQA 4RGNA 4BKGA 1L4ZB 2K8HA 1J19A 1TIFA 2NS5A 3AU5A 1XLNA 3T3OA 4YWGG 4JIOU 2CHWA 1N61A 2CHXA 2Z0DB 2KMMA 1TKEA 3PLVA 4CQNA 2WP9B 2O6VB 2DZJA 3U2SC 4E74A 4RFBA 1LXDA 1K53A 1V86A 5D7GA 1WM3A 4ZYNA 1I4HA 4YT0B 2LFIA 4YTNB 3ENEA 1XCQL 1YD8U 2I1JA 4AQ7A 2JF5A 2V4LA 5E6JA 2WXOA 2ZPNA 2KQ4X 3C19A 1D6EC 3BVGA 1GNUA 1FCCC 2WLBA 2DZKA 1R4NB 4IG7B 3EFCA 1V97A 5IA7A 1NEKB 3EA6A 1D5MC 3MC0B 2L05A 1F9JA 4F8CB 4IUMB 5H92C 2WXMA 5G5HA 4HXDA 2KVRA 3PHWB 3WA0A 4W9FA 4MELA 1F77A 1JWAD 1ZXIA 2GBRA 2N9LA 3RPFC 2BYFA 2JRIB 4KDLB 4IW0A 1GG3A 4YXDB 5CHVC 3ZVVA 2ASQA 4L23A 3X0WA 1L0VB 1R7SA 1ET6A 1F2RC 1H7WA 2Z0EB 2AL3A 3B0AA 3M95A 3ZDMC 4KGTA 1GC6A 1UD7A 3ZUNA 1LM8B 1V1PB 2IO0B 5AEKB 3AB5A 3QIJA 3UIOB 2B76B 2QC8A 4OVZA 1E8XA 3APDA 4HROA 2L32A 2KC2A 2IO3B 2MHJA 3R66C 5AZGA 4G50A 4ZRIA 2Y5BB 4JPSA 4OZCA 4ZDVA 4TQ1A 2V3NA 1PGXA 3RZWC 2E3TA 1SSNA 2DZMA 3O65B 3P4PB 3X23A 3UQBA 1I35A 1D3ZA 5IN7A 2FE8A 3WAOA 2FUG1 3AE4B 1UWXA 1WXAA 4PS3A 3KVFB 3VQIA 1L0YB 3NVWA 3VH3B 1FM0D 1TS5A 1Y8RC 5IAAC 2WXHA 4NZLB 2K5PA 2V1YA 4BZAA 1UWMA 3ZIMA 1K50A 1V1PA 2WXPA 5J2RA 1I42A 1HEZE 5AZFA 1ZOYB 1FRDA 1MG4A 3Q3NC 1P7EA 4WJQA 1C3TA 1C4CA 2BKFA 1EF1A 3N20C 1GJZA 5TR5A 1E8ZA 2C9WB 1DGJA 1SF0A 3DBHB 2DHZA 1PFDA 1FIQA 2XK5B 3AXCA 2IBIB 1WGDA 5GXGB 4ICUA 1WMHB 2L3ZA 4XE0A 2N7DA 3C8YA 2IY1B 1M94A 1J7CA 4JE3B 1SEBD 5AUIA 5FR3A 4RF0A 3Q2AC 3Q8FA 1ZP0B 4NQLB 3N1YC 4W9LA 3P42A 1STEA 2AQ3B 3TUOA 2GI9A 1UF0A 2FIFA 3ZLZA 4KDIC 3AMZA 1MFWA 3AE1B 3MHZA 1PGAA 4EUTA 1ENFA 2N0SB 2N1WA 3R8BA 3W2DA 3SDLC 3WAMA 4R3DA 5CX3A 5DPTA 3BVMA 4BOSC 4NPNA 2NBWB 2W9NA 2BS3B 4NAMA 1FEHA 2J0JA 4ITKA 4PK1A 1VZ6A 3RUIB 1FCLA 1WMHA 4EKUA 2MBOA 5JHBA 5LLIA 1JW9D 1AARA 1GB4A 3OLMD 1MPEA 1FFVA 3ZJTA 3AEDB 1K51A 2M0XA 2Y5CA 4PYUA 4GXBA 4GOCA 2BKRB 1V5OA 2WU2B 2PEAA 3AE7B 3ZYYX 2HD5B 2LHDA 3KYCD 2BQQA 2I2YA 3GOEA 4AWJA 4WIPA 1VD2A 3NVYA 1H8CA 1H7XA 3A9KA 2UYZB 2OJRA 4FXCA 3E56A 2FUHB 3S2AA 4FBJB 2KDMA 2WX0A 4N9F4 2L52A 2INDC 3K9PB 5IP4D 4BKTA 2WQYB 1ROEA 5CHWA 5G5GA 3V6EB 1AW7A 3QQ8B 1IGCA 3SFDB 3NS8A 2WNMA 4REZA 2TSSA 2G45B 2BPSA 3PHXB 2KN5A 2JXXA 1FPYA 3GE3C 1OFFA 4LNFA 4J3OD 1V5TA 3NY5A 2KHWB 2QHOA 4YSXB 2PE6B 3VHTC 3AE9B 4GB9A 1QILA 4N59A 3UQAA 3LJ3A 2LI5A 1HZ5A 2WXLA 5C3JB 2KDFB 4HJGE 1TZ1A 2GOWA 3JSVB 4DHZB 2LXAA 3QK0A 1RWSA 4W9IA 4EE2A 4LTUA 4G3XB 3IT6B 2D3BA 5H8YE 1OEYA 3PO0A 1P0RA 2VZKD 3AE8B 2WHIA 2FCSA 1KM7A 2PPHA 1I4GA 1D5ZC 3WALA 2V3PA 2QDFA 4DDGD 1JRUA 2G4DB 2LVPA 1ZGUB 3IHPC 4EFOA 3BK2A 4B0MA 4NAWA 2JUOA 2HJ1A 3R3MA 5G2NA 1SB3C 2MRPA 2WX1A 2KTRB 4BVUC 4ANVA 4NQKE 2LVOA 1VZ8A 4B95A 3B1LX 2NBUA 3B9JA 2IO2B 2MEKA 2IDYA 1GOZA 3ZTCA 1TY0A 2IY0B 3H1UA 4F1SA 5D2MB 3EFUA 3ZNID 3RNEC 2R61A 2HTME 2LXCA 4G11A 3ML9A 2Y3AA 1M4VA 3KLSX 4ACFA 3UIPB 3ZXRA 2JT4B 2Q5WD 1XF5L 4IWOA 1T5XD 4USAA 3AE5B 1WSPA 3V60A 4EEWA 1I7HA 4PT5A 3HIZA 3ZDTA 2L0FA 2YLMA 2DLBA 2V4IB 3KUCB 1GTEA 2ZNVC 2SAKA 1E90A 3KW5B 4MACA 5DPWA 3TBLD 2WYQA 4WJPA 4L1BA 4BBNF 4GMVA 2KLCA 4TMAB 2NTTA 4FJYA 4OHJA 2D10A 4A6QA 4W9KA 3N32A 4WAFA 2IYDB 3TL5A 1QQRA 4K81A 3EC8A 2LZ6A 5LXIB 4TSSA 2FIDA 3DBRI 4XX5A 1E10A 3EUB2 3RMKC 4HKQA 3V05A 4P16A 2N9XA 3FKYA 2BVCA 2DYOA 4GDKB 2OOBB 3R2TA 4A3OA 2BWES 2XEWA 1TYGB 2IZVB 3WAPA 1GTHA 3H9DA 3ML8A 4FN2A 1BUIC 4URKA 4W9GA 1LFDA 1J7BA 3SFEB 4MEMA 1FXTB 4GIVA 2J0KA 3CWIA 3N1XC 2YVCA 1ESFA 2GLSA 2WU5B 2JWZA 3H6NA 2PVGC 4IKGA 3CF4A 5C23A 2D3CA 1SGHA 4MM3A 4KIKB 2JSVX 5J17A 2JQRB 3L4PA 5HKHA 4CO7A 2HDEA 2BW2A 4UDUC 1MJDA 1ZDXA 1WXQA 3PVLA 1TT5B 3HVDA 5CHFA 4KGRA 3RZFA 2FNJB 1T3QA 4MGYE 1I4PA 4G0NB 2JYTA 4II2B 3FILB 1HQRD 2KNBA 3E9SA 3L13A 1WX7A 4GU2A 2QMTA 1X1MA 4J6IA 1K52A 3PSEB 4OZBA 1Q10A 4GDLB 1YQ3B 2M4NA 4HDQA 2N9PC 2PKOA 2ZZPB 1I4XA 2WDQB 2WXNA 4NNJB 2OJWA 2MP2A 3A9JB 3VR9B 2J7QB 2LHEA 3T3NA 1V81A 5JH5C 3OJ4B 1A5RA 1WX8A 1QT9A 2NPTA 3AV8A 3HM3A 3ZGZA 3W1YA 3W5UB 2N9KA 3DWGC 2AQ1B 4ZHOA 2GMIC 2LRWA 1ISNA 2IGDA 1SE4A 2H89B 1TY2A 1WGGA 1NENB 4W9CA 5EDSA 4XGAB 1SE3A 4A3PA 4P1CC 1R4MI 2KTFA 4AS1A 1AWDA 1J8CA 2DENB 4KSKC 2CU1A 3NZ3A 2JU6X 2JPHA 3ZO5B 2J4XA 2JZZA 3I9V1 2N7EA 2GBJA 4D2KA 1OTRB 1WXVA 3RNAC 4DXFA 2DAJA 2AQ2B 3VUWA 2UWQA 4FJVB 3TJPA 1V1OA 3CMMB 2Z8LA 4BKSA 2EMTA 4MJSB 3UINB 1B1ZA 4LDTD 3DCGA 2IJ0A 1WJUA 1NYRA 2RR9A 4XWWA 3N30A 2LGSA 4I6NB 2LGXA 4LJOB 3DHGC 3U52E 1WGHA 1EF5A 3NZSA 3IT4B 4M02A 3P2BA 4LLGM 2WXGA 4HLEA 3N1ZC 1XEEA 4C4VB 1Z5SB 2O6VA 1V8CA 1WGKA 2KX0A 2B3AA 3H7PB 3SD5A 1PQSA 2JZ3B 3H8HA 5HFYA 1FRRA 1XLOA 1NVID 2KFKB 4ASWC 1YQ4B 2IPKD 4KZCA 2MW5A 4KKIA 1T0SC 1YX5B 4F7ZA 2PVOD 4ZRQA 1TJEA 1XD3B 2FAZA 2JX5A 2XNAC 4IM0A 1SE9A 2D11A 4FA6A 4PYZA 2KAJA 1F0ZA 3Q3OC 2WDVB 4HRSA 2C60A 2R2OA 1WM2A 2KJRA 1QZEA 1OQYA 1WZ3A 4KKJA 2K6DB 2KFJA 1CK1A 2D3GA 3AEAB 2OEDA 3P4SB 1JRPA 3DHHC 3KUDB 1ET9A 3PRMB 2INCC 3NHEB 1TTNA 2C7MB 2MBEA 4L2YA 2KDIA 2E6XA 1UBIA 2BYTA 1E7PB 2X38A 3KUZA 1HE8A 5BYRA 1CMXB 1SXTA 2NVUI 2NMQA 3Q8CA 1N60A 3PGEA 4XYCA 5I4DA 2A4ZA 3DQVA 3HK0A 3AEBB 3W1SC 2DYMA 1C78A 1QOAA 3SHQA 3Q3MC 3R7RA 2NCNA 3P1MA 2CJOA 4PS8A 1OQQA 4P7IA 3M62B 3HRDD 4WWMA 3VFKA 3V3XA 3OG5A 1VLBA 4K1RB 1GUAB 5G55A 3VH4B 1GC7A 1WJ6A 1VR9A 3B2FA 1A70A 1WF9A 5BO4B 4WAAA 3DHIC 4KSLC 2D2QA 5AZHA 4I6LB 4WURA 1E7VA 2WS3B 2DBYA 5FK9C 2C7HA 2G3QB 3B08A 1RYJA 2J53A 3AU4A 3Q3JA 1V6EA 5E6OA 2IGGA 2LGYA 3PPAA 1N5WA 4FULA 1E9MA 1XQQA 2MJ3A 5IOIA 2CKHB 5HG2A 2DNFA 4FHJA 3TEXA 3CF6E 3PV1A 4KGSA 2XK5A 2KO3A 4IWQA 3V62A 4WWPA 2KANA 2M8SA 2ZCCA 1WE7A 3R2IA 1L6VA 2WXRA 1WWTA 3ZNHB 4ZHPA 2CS4A 4W9HA 2C5LC 4E3CA 2INNE 2MA9B 3CSFA 2KYWA 1NDDA 1DOYA 1B9RA 3D32A 1AN8A 5JZEB 2KD0A 1TKGA 4GN1A 2EKEC 1QOBA 2PTLA 1RM6C 1OEYJ 1YN3A 2MWSB 3H7SA 3MP9A 3Q69A 3FAHA 2D5GA 3GZNI 2LWPA 3R7QA 2M0AA 1KF6B 5LXHA 2KQSA 3AE6B 1P98A 3AI5A 2GBMA 3I3TB 4X57B 1QOFA 1TKYA 4W9DA 1ZUD2 3AM9A 4MDKE 1T0YA 1SBBB 1T0QC 2LMCA 4BOZB 2N9EB 4NJCA 1KLUD 2ON8A 4WWNA 1JWSD 2K8CA 3O13A 1NI2A 3ZKJC 2JY6A 2PJHA 3PZ8A 1NYQA 1FO4A 2ACZB 4K7UA 1FD6A 1PGBA 4MT5A 1TZOA 4XC2A 1JROA 3TEZA 1JWMD 2M1MA 1QF6A 3A1QB 3MTNB 1TS2A 2KOXA 3SEBA 3T8MA 4MSMB 1L2NA 4EZKA 3NRZA 1VCBA 2KDEB 3W9CB 1GAQB 3DDCB 3OAWA 1WFYA 2BB5A 4RM9A 2LUEA 3BYYB 2VRRB 4NJ7A 1RFAA 3LXFA 3TSSA 4WJOA 2MJDA 2NR2A 1YX6B 3IG3A 3NUHB 3RNGC 1YJIA 2FCQA 2LGDA 3K9OB 5FR6A 1MHXA 3ECIA 3QCAA 3LB8C 2O2VB 3PT2B 3WANA 3AEGB 2R2QA 1WXMA 2MLBA 3APCA 4KZ0A 4CHKA 1C77A 3VR8B 1YN5A 2KX3A 4FJZA 3CSTA 3DVNV 4KV2A 4M0WB 3U7DA 3PZDA 3A1QA 2KACA 3DBRB 2LRUA 2KWVB 3FC4A 2I1KA 3AN1A 1HTQA 3JSVA 1JCKB 1P9DU 2DWQA 2W55A 3GP7A 4MGKE 1VDVA 1G6JA 3ZRCA 3W5VB 3JVZX 2N4FA 3U8ZA 4DWFA 2LGIA 3V61A 2WXFA 4K3BA 4DHJD 5LNK1 1J7AA 1VJKA 3KQ4A 1JMLA 3C0RB 4AP4C 2M19A 4HK2A 2JVCA 4ZRPA 4I6PA 1KH0A 4BBNC 4YSYB 2FBWB 4LNIA 4GLSC 1IP9A 1F52A 1PUTA 3M63B 2KTRA 2L0TA 1HZ6A 3Q8EA 2I38A 4OVUA 2KXJA 1S3SG 3NVVA 1ACCA 4M0WA 3UGBB 4FADA 1V80A 2EMSA 3EGRA 2QSDA 4NJ6A 4XZ4A 1EUVB 1IGDA 3ZJVA 1EU4A 4JQWC 2KDBA 2VZKB 4RM8A 2C7NB 1WGRA 1FMAD 4H2AA 5L83A 1VZ7A 4BKSD 5DPRA 2D3AA 1SIFA 5IKCM 2KMCA 4A90A 4AJYB 1YJJA 4KVGB 1YQBA 2WXJA 3DPDA 2LASA 2G9HD 1RRBA 4AOFA 2RDHA 2LUMA 4DQOC 5D3IB 2O6VD 3NS1A 3PRPB 4WWOA 2QCZA 2ZEQA 4ARIA 4S17A 3Q8AA 3QWZB 2AYOB 3HVZA 1OGWA 4HJKA 2N1VA 1WYGA 2K6QA 2PE9A 2CU3A 1RFKA 3VVWB 2K3UA 4LNNA 2WDRB 2NTSA 4MH8A 4IM2A 1WYWB 1R4MB 2N7JA 1EWYC 2J42A 5IO9A 3T9LA 2RPQA 4HPPA 3AECB 3DBLI 3MC9A 4HWIB 4TKNA 1UBQA 1KJTA 4MH0E 2GRIA 2GBNA 2G1EA 4JGHB 4BFRA 2MCNB 4GGQA 2BBCA 4GDKA 5EE1A 4OVVA 3PRZA 4M00A 1P7FA 4HKZE 2K8BA 3UF8A 3VXWA 3IXSA 1GT8A 1XT9B 2JYEA 5AUKA 3KWLA 5T8IA 2Z59B 2H88B 2FCMA 3BINA 4OW0A 1L6UA 2REXA 1D5XC 2KMAA 2M17A 1SIJA 1JWBD 1WGYA 4KIKA 2YEPB 4N6EB 3ZQ4A 3OJ3A 2JXTA 3AH7A 2LJIA 4ANUA 2A5UA
chains in the Genus database with same CATH topology
3GB1A 1E7PB 1YMHE 2X38A 5BMIA 2KDMA 2L52A 5C2TB 5BYRA 1XO3A 1SXTA 1EU3A 1Y56A 2WQYB 1ROEA 2MH7A 2NMQA 5G5GA 1AW7A 4ARCA 1IGCA 3Q8CA 2JWUA 1N60A 3SFDB 2WXQA 4P6VF 5I4DA 2WNMA 1QOGA 3VRBB 3AEBB 3ETRA 3FILA 4REZA 2TSSA 2J52A 1PYWD 2DYMA 3BIID 1C78A 1QOAA 4JWUC 4RF1A 1IUEA 3BWUD 3KWVA 4MM3B 2QJLA 3TEYA 5EE9A 1BMLC 3P1MA 3AE2B 1OFFA 2CJOA 1TS3A 1OQQA 2QIEB 4J3OD 2RPVA 2INPE 3HRDD 4RGMA 4WWMA 2CJNA 1HXYD 4YSXB 3V3XA 3GS2A 2BS4B 1MI0A 3AE9B 3HUIA 1QILA 1ZPSA 3IAS1 1VLBA 2QEJC 4N59A 4YTPB 1HZ5A 3VRAB 2K22A 2WXLA 5C3JB 5FKAC 4HJGE 1FNVA 4A9AA 1QLBB 2ZW0A 1E0ZA 4HEA1 3OWEB 1RWSA 4EE2A 4LTUA 1VR9A 3B2FA 4C80A 1A70A 3IT6B 4IDIA 1MHHE 5H8YE 2K9XA 1C4PA 4WURA 3PO0A 2WS3B 4C7ZA 2BS2B 3UI3A 2DBYA 4Q2JA 1KRHA 2VZKD 5FK9C 1CQVA 5MPOA 3AE8B 3DWMA 1C4AA 1RYJA 3BYTB 1CZPA 4ZOHC 2V0GA 3URYA 3B2GA 2J53A 4XDCA 1I4GA 2IGGA 1D5ZC 2XN9C 5EE0A 2V3PA 1I4QA 1DOXA 3BK2A 4B0MA 1EM7A 3IAM1 2WXKA 4RGOS 1N5WA 1E9MA 2MJ3A 1SB3C 3ZJUA 5HG2A 3TEXA 4KGSA 3LYYA 2OHFA 4JX1C 4RNAA 1QKZA 1FXIA 1VZ8A 3R2IA 5HI1A 4ZYSA 1L6VA 4YTMB 2WXRA 1WWTA 1WRIA 4ZHPA 3MFGA 3B9JA 2M56B 2W54A 2MEKA 2IDYA 1GOZA 1TY0A 4A8XC 3BK1A 2INNE 4IOIE 1YN4A 2R61A 2BT6A 1FNWA 2HTME 1DOYA 1B9RA 1AN8A 1DYQA 2Y3AA 1NI3A 1TKGA 1M4VA 2JZPA 3KLSX 1QOBA 4C7YA 4RH6A 2SEBD 2PTLA 2LEKA 2Q5WD 1RM6C 1XF5L 2K0PA 1MVKA 1YN3A 4LK0M 2BTEA 1T5XD 4A55A 4USAA 2QILA 3SR6A 3MJ5A 3MP9A 3AE5B 1WSPA 1FNUA 3FAHA 2D5GA 3Q69A 1DOIA 2M0AA 1I7HA 4RGNA 1KF6B 3WCQA 3AE6B 1L4ZB 1CJEA 4PT5A 1QOFA 1TKYA 1ZUD2 2DLBA 2V4IB 3AM9A 1GTEA 2SAKA 1SBBB 2LMCA 1XLNA 1TS4A 3T3OA 4YWGG 4MACA 4NJCA 1KLUD 2ON8A 4C56C 2L83A 1JWSD 1N61A 3O13A 4L1BA 1KTKA 3J9CA 4YSZB 2L1AA 3PZ8A 1FO4A 1NYQA 2KMMA 1TKEA 4CQNA 2WP9B 4TMAB 2ACZB 1FD6A 2NTTA 3U2SC 1PGBA 4MT5A 3CIRB 1TZOA 4OHJA 4RFBA 1JROA 4A6QA 4TQ0A 1K53A 4WAFA 3TEZA 5D7GA 5BYSA 1I4HA 4YT0B 1QQRA 2LFIA 1JWMD 1XLQA 4YTNB 1XCQL 1QF6A 4AQ7A 5E6JA 2WXOA 2KQ4X 4TSSA 1IBXB 1D6EC 3BVGA 1TS2A 1FCCC 2WLBA 1E10A 3SEBA 3EUB2 4HKQA 3NRZA 1V97A 3W9CB 1NEKB 3V05A 3P4QB 1GAQB 1LO5D 4P16A 3EA6A 3AE3B 1D5MC 2BB5A 3MC0B 3BYYB 1L0XB 2DYOA 4GDKB 3R2TA 5H92C 2WXMA 5G5HA 1HA5A 3LXFA 1TYGB 3TSSA 1F77A 1JWAD 1XCTL 1ZXIA 1GTHA 2N9LA 1BUIC 2ONQA 4XDDA 3RPFC 2MJDA 4OZAA 3NUHB 1J7BA 3SFEB 4YXDB 1YJIA 2BB6A 3U4EG 4L23A 3CWIA 1MHXA 1ZE3D 4US9A 5BMGA 1L0VB 1ESFA 3LB8C 1R7SA 1ET6A 2WU5B 5JXVA 1F2RC 1H7WA 2PVGC 4IKGA 1XLPA 3CF4A 3I57A 1C9FA 3AEGB 2ICIA 1I4RA 2JSVX 2JQRB 3L4PA 4KGTA 1C77A 3VR8B 1YN5A 2HDEA 4RCOA 1FFUA 2BW2A 4UDUC 2AX5A 1ZDXA 1WXQA 1EWCA 2KACA 4RGTA 1V1PB 3HVDA 1IBXA 3AB5A 3U7ZA 2B76B 1L5PA 3FC4A 1ZXHA 4KGRA 3AN1A 1T3QA 2WXIA 1I4PA 1XXGA 4OVZA 4HROA 2L32A 2JYTA 3FILB 1HQRD 3E9SA 1JCKB 4WH4A 2KN4A 4JPSA 4OZCA 1AYFA 2DWQA 2EKIA 3AEFB 2QMTA 2W55A 3GP7A 2GB1A 1VDVA 2PLPA 2V3NA 4TQ1A 1KFYB 1K52A 1PGXA 4OZBA 3W5VB 1Q10A 4GDLB 1YQ3B 2LGIA 4N58A 2E3TA 2WXFA 2PKOA 1I4XA 1SSNA 2WDQB 3P4PB 3ABVB 5LNK1 1J7AA 2ZW1A 2WXNA 1VJKA 3KQ4A 1JMLA 2FE8A 3VR9B 2LHEA 2M19A 3PZ7A 2FUG1 3AE4B 1UWXA 4ZRPA 3T3NA 3RFZB 1KH0A 3BVZA 4YSYB 2FBWB 2W3RA 2W82A 3VQIA 3N9YC 4GLSC 1L0YB 1PUTA 1QT9A 3NVWA 3AV8A 1TS5A 1FM0D 5BMHA 1KLGD 1HZ6A 3Q8EA 2I38A 3ZGZA 2WXHA 1L4DB 4NZLB 3W5UB 2K5PA 2PMVA 3NVVA 2N9KA 3DWGC 2AQ1B 1ACCA 4M0WA 1GPXA 1UWMA 1K50A 1V1PA 2WXPA 3EGRA 5EE3A 4ZHOA 1HEZE 1ZOYB 2QSDA 1FRDA 2IGDA 3AEEB 1SE4A 1P7EA 2H89B 1IGDA 1TY2A 1C4CA 3ZJVA 1PDXA 1EU4A 2VZKB 1NENB 2MJEA 5TSSA 1SE3A 3P63A 4AS1A 1AWDA 1SJED 4JWSC 4NAWB 1DGJA 1FMAD 3NZ3A 2JU6X 1SF0A 4H2AA 1PFDA 2J4XA 3I9V1 1FIQA 1GB1A 1VZ7A 1UNSA 4D2KA 1VRAB 4DXFA 1F2RI 5GXGB 3P4RB 2AQ2B 1SJHD 4XE0A 2IGHA 3C8YA 1D4BA 1V1OA 1J7CA 2Z8LA 4JE3B 4A90A 1JALA 1SEBD 1YJJA 1B1ZA 5AUIA 2IJ0A 5FR3A 4RF0A 1NYRA 1UUPA 2WXJA 3Q8FA 4XWWA 1ZP0B 2G9HD 4O1NA 2RDHA 2LUMA 4DQOC 2KWDA 5D3IB 3NS1A 3P42A 3TEWA 1ZDVA 3U52E 2EELA 1STEA 2AQ3B 4ARIA 3Q8AA 3IT4B 2RMMA 4LLGM 2WXGA 3TUOA 2GI9A 3HVZA 1XEEA 1C79A 1E6EB 1V8CA 1WGKA 3AMZA 1WYGA 4WQMA 3AE1B 5D3DA 3MHZA 1PGAA 1ENFA 2N0SB 3R8BA 3W2DA 2CU3A 1RFKA 1C76A 2K3UA 4R3DA 2WDRB 2NTSA 3H8HA 4MH8A 1FRRA 1XLOA 3BVMA 5HFYA 1NVID 1YQ4B 1N63A 1SE2A 2N7JA 1EWYC 2IPKD 3BZDB 2J42A 4KKIA 2BS3B 2PW9A 3AECB 1UGJA 4XWTA 4DXGA 4NAMA 1FEHA 1JQ4A 2PVOD 4ZRQA 2W3SA 4ITKA 3W1SA 3NVZA 1TJEA 1VZ6A 2GRIA 1N5XA 2JX5A 2G1EA 1FCLA 2XNAC 2BBCA 5EE1A 1JW9D 2KAJA 1F0ZA 1GB4A 1MPEA 1FFVA 2WDVB 1FXAA 1P7FA 2PIAA 3AEDB 1K51A 3ZJTA 1T6BX 4HRSA 2Y5CA 4HKZE 2WU2B 4US8A 3IXSA 3AE7B 1GT8A 2Y5PA 3ZYYX 2LHDA 2JYEA 3Q8BA 4KKJA 3KWLA 5AUKA 5HHDG 5T8IA 2I2YA 1CK1A 2H88B 4WIPA 3AEAB 2OEDA 3NVYA 1BXTA 1YNTE 3P4SB 2RDGA 4OW0A 1H7XA 1JRPA 1L6UA 4B0EA 1ET9A 1D5XC 1SIJA 1JWBD 2YEPF 2YEPB 4N6EB 3ZQ4A 1N62A 4KX6B 2JXTA 4FXCA 3AH7A 2LJIA 1JWUD 4L2YA 3E56A 1OQRA 2E6XA 2BYTA 5BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0V B;  1E7P B;  1FIQ A;  3LB8 C;  1R7S A;  2WU5 B;  2L52 A;  2BT6 A;  5GXG B;  1H7W A;  5C2T B;  3P4R B;  1XO3 A;  2HTM E;  2WQY B;  1ROE A;  1XLP A;  2PVG C;  3CF4 A;  1B9R A;  2MH7 A;  1DOY A;  3AEG B;  5G5G A;  1NI3 A;  1TKG A;  1N60 A;  3SFD B;  2JQR B;  3L4P A;  1J7C A;  4P6V F;  4C7Y A;  3VR8 B;  1JAL A;  1QOB A;  1FFU A;  1YJJ A;  1QOG A;  3VRB B;  2LEK A;  2Q5W D;  1RM6 C;  5AUI A;  3AEB B;  2AX5 A;  3ETR A;  1NYR A;  1WXQ A;  1ZP0 B;  4USA A;  3BII D;  3SR6 A;  1QOA A;  4JWU C;  3AE5 B;  1IUE A;  3FAH A;  3NS1 A;  3AB5 A;  1DOI A;  2QJL A;  5EE9 A;  1I7H A;  3P1M A;  2B76 B;  3AE2 B;  1L5P A;  3FC4 A;  1KF6 B;  1OFF A;  2CJO A;  3WCQ A;  3AE6 B;  3AN1 A;  1OQQ A;  1T3Q A;  1CJE A;  2QIE B;  1QOF A;  1TKY A;  3HVZ A;  4HRO A;  1ZUD 2;  3HRD D;  3AM9 A;  1GTE A;  1E6E B;  1V8C A;  1WGK A;  2CJN A;  1WYG A;  3AMZ A;  4WQM A;  4YSX B;  4WWM A;  1XLN A;  3AE1 B;  1AYF A;  2DWQ A;  2EKI A;  2BS4 B;  3AEF B;  2N0S B;  3AE9 B;  2W55 A;  2CU3 A;  1RFK A;  3HUI A;  1VLB A;  4N59 A;  2L83 A;  1VDV A;  2WDR B;  4YTP B;  1KFY B;  3VRA B;  1N61 A;  5C3J B;  1FRR A;  1XLO A;  2K22 A;  1NVI D;  3W5V B;  4YSZ B;  1YQ3 B;  1YQ4 B;  1N63 A;  1QLB B;  4A9A A;  1EWY C;  4N58 A;  1NYQ A;  1FO4 A;  2KMM A;  1TKE A;  2E3T A;  1E0Z A;  1RWS A;  2WP9 B;  2ACZ B;  2BS3 B;  2PKO A;  4LTU A;  3AEC B;  3B2F A;  4C80 A;  1A70 A;  3CIR B;  2WDQ B;  4IDI A;  3P4P B;  1JRO A;  2PVO D;  1JQ4 A;  3ABV B;  1J7A A;  5H8Y E;  2K9X A;  1VJK A;  2W3S A;  4ITK A;  3VR9 B;  3NVZ A;  1TJE A;  3PO0 A;  2WS3 B;  4YT0 B;  2M19 A;  4C7Z A;  2BS2 B;  2DBY A;  1XLQ A;  4YTN B;  3AE4 B;  1KRH A;  1N5X A;  2G1E A;  2JX5 A;  5MPO A;  1QF6 A;  3AE8 B;  4YSY B;  3DWM A;  2FBW B;  1RYJ A;  5EE1 A;  1CZP A;  2W3R A;  4ZOH C;  1JW9 D;  3B2G A;  1QT9 A;  1PUT A;  2KAJ A;  2WLB A;  3NVW A;  3EUB 2;  3AV8 A;  1FM0 D;  1FFV A;  2WDV B;  1FXA A;  2PIA A;  3AED B;  4HRS A;  5EE0 A;  2Y5C A;  3NRZ A;  1DOX A;  1V97 A;  3W9C B;  3W5U B;  1NEK B;  2K5P A;  1E10 A;  3NVV A;  3P4Q B;  3DWG C;  1GAQ B;  1GPX A;  3CWI A;  3AE3 B;  1UWM A;  1N5W A;  2WU2 B;  1E9M A;  2MJ3 A;  4US8 A;  3AE7 B;  1GT8 A;  1SB3 C;  5EE3 A;  3ZYY X;  5AUK A;  4ZHO A;  1F0Z A;  1ZOY B;  3KWL A;  1FRD A;  5H92 C;  5G5H A;  3AEE B;  3LXF A;  2H89 B;  2H88 B;  1TYG B;  3AEA B;  3NVY A;  1JWA D;  1PDX A;  2OHF A;  1ZXI A;  4JX1 C;  1NEN B;  3P4S B;  2MJE A;  1H7X A;  1GTH A;  1JRP A;  3P63 A;  1L6U A;  3RPF C;  1FXI A;  1AWD A;  2MJD A;  4JWS C;  1L6V A;  4YTM B;  1DGJ A;  1FMA D;  1JWB D;  1SIJ A;  1WWT A;  1J7B A;  4N6E B;  1N62 A;  3SFE B;  4KX6 B;  4YXD B;  1WRI A;  1YJI A;  4ZHP A;  4FXC A;  3AH7 A;  1SF0 A;  3B9J A;  2M56 B;  2W54 A;  1OQR A;  1PFD A;  4US9 A; 
#chains in the Genus database with same CATH topology
 1YMH E;  3RT3 B;  1WI0 A;  1V9J A;  4AJW A;  5CTR C;  3EHV A;  2WXQ A;  1RAX A;  4P6V F;  3NZU A;  1QOG A;  3VRB B;  4IC7 B;  2ZNV B;  3FIL A;  1UZX B;  3BII D;  4JWU C;  1IUE A;  3BWU D;  3KYD D;  3TEY A;  5EE9 A;  2J0M A;  3DBS A;  1UGM A;  4GDL A;  2QIE B;  1V2Y A;  2KJ6 A;  2RPV A;  1HXY D;  4EZJ A;  1MI0 A;  1LQB A;  3A9J A;  1ZPS A;  3PLU A;  2QEJ C;  4YTP B;  3V6C B;  4A9A A;  1QLB B;  1E0Z A;  3OWE B;  1YJ1 A;  4P1B C;  4HCP B;  2CR5 A;  2ZCB A;  2IO1 B;  4IDI A;  5L95 C;  1MHH E;  1Q0W B;  3RD2 A;  1WIA A;  2BGF A;  3QJZ A;  4C7Z A;  2BS2 B;  2KWC A;  4Q2J A;  1KRH A;  4TUU A;  1CQV A;  5MPO A;  1L7Y A;  2L8J A;  1C4A A;  2MQJ A;  3BYT B;  1CZP A;  3URY A;  2XN9 C;  5EE0 A;  1I4Q A;  3NOB A;  1EM7 A;  3IAM 1;  4RGO S;  5C1Z A;  3KH0 A;  1S1Q B;  3ZJU A;  5E6P A;  4ANW A;  2VH2 A;  3LYY A;  1EO6 A;  2KWU B;  2ZJD A;  2KQ7 A;  1QKZ A;  3LDZ E;  3ONS A;  4W9E A;  4WJN A;  1FXI A;  2DAF A;  5HI1 A;  4YTM B;  1J0G A;  1WRI A;  3MFG A;  4MJS A;  2W54 A;  1YN4 A;  2BT6 A;  1FNW A;  4HCN B;  1KLV A;  2LVQ A;  3RUL A;  1DYQ A;  1NI3 A;  3ZXV A;  2WGS A;  4C7Y A;  2SEB D;  2KK8 A;  2LEK A;  1R4N I;  4C4V A;  3JYU A;  1MVK A;  4LK0 M;  2BTE A;  3L17 A;  2QIL A;  3SR6 A;  3MJ5 A;  1UEL A;  1FNU A;  1WJN A;  3H7P A;  1DOI A;  3WCQ A;  2KFK A;  1CJE A;  2AEH A;  3RNC C;  3Q6B A;  1NBF C;  3RCZ A;  1TS4 A;  4IM3 A;  4C56 C;  4IWP A;  2L83 A;  4LDT B;  2KKC A;  1Z2M A;  4HDO A;  1KTK A;  3J9C A;  4YSZ B;  2L1A A;  2FCN A;  3HM6 X;  3GE8 C;  3VUX A;  3CIR B;  1N6Z A;  4TQ0 A;  3QAQ A;  1WZ0 A;  5BYS A;  1WY8 A;  1XLQ A;  3I63 C;  1IBX B;  3DOW A;  4M8M A;  4LNO A;  3L16 A;  1E8W A;  5JHA A;  3RNF C;  2DZI A;  1E7U A;  3TIX A;  1WR1 A;  1Q1O A;  3MJW A;  3P4Q B;  1LO5 D;  4TV3 A;  1KOT A;  3AE3 B;  3SU8 X;  4QAY A;  2RD0 A;  1L0X B;  2L7R A;  3GZN B;  4MSQ B;  1HA5 A;  1XCT L;  2K1F A;  4PS7 A;  2ONQ A;  4XDD A;  3TCA A;  4OZA A;  2XBB C;  2BB6 A;  3U4E G;  3L54 A;  1ZE3 D;  4US9 A;  5BMG A;  4LNK A;  5JXV A;  2MBB B;  2KT7 A;  3QA8 A;  1XLP A;  4RMA A;  3A9K B;  3I57 A;  1C9F A;  1T0R C;  2ICI A;  1I4R A;  4C00 A;  4RCO A;  1FFU A;  4EOY A;  2AX5 A;  3L08 A;  1EWC A;  4RGT A;  1IBX A;  4ICV A;  2GBK A;  3U7Z A;  4DXA B;  1L5P A;  1ZXH A;  2WXI A;  1XXG A;  2WWZ A;  4WH4 A;  2HTH A;  2KN4 A;  4CYE A;  1AYF A;  2EKI A;  3AEF B;  2GB1 A;  3DBH I;  3IFW B;  2PLP A;  1KFY B;  2AL6 A;  4N58 A;  2KC1 A;  2ZVO A;  2X8X X;  3ABV B;  4HVB A;  2ZW1 A;  3Q3F A;  3VAW A;  2JRH A;  4JL9 A;  3VTW A;  2L76 A;  3A4R A;  3PZ7 A;  3RFZ B;  3U30 A;  3BVZ A;  2HE7 A;  2W3R A;  2W82 A;  3N9Y C;  4FLH A;  2KJH B;  5BMH A;  1KLG D;  3IVF A;  3AUL A;  1L4D B;  2PMV A;  4II3 B;  1GPX A;  1WH3 A;  2HJ8 A;  5EE3 A;  1U4A A;  4ZRK A;  3AEE B;  1PDX A;  2V9H A;  3WIM A;  4M01 A;  2MJE A;  5TSS A;  3P63 A;  2KLG A;  3QHT A;  2ZVN A;  1SJE D;  4JWS C;  4NAW B;  1MG8 A;  3JW0 X;  1YOV B;  2MSE D;  1GB1 A;  4K3C A;  1UNS A;  1VRA B;  1F2R I;  3P4R B;  1SJH D;  2BWF A;  2IGH A;  1D4B A;  1JAL A;  4LJP B;  2NBV B;  1UUP A;  1C1Y B;  2BYE A;  1IYF A;  3N3K B;  4O1N A;  2KWD A;  1ZW7 A;  2RDB C;  3TEW A;  1ZDV A;  2EEL A;  3Q14 C;  2RMM A;  2LJ5 A;  1C79 A;  4YL8 A;  1E6E B;  2MBQ A;  4WQM A;  5D3D A;  1F1H A;  1C76 A;  4B6W A;  2CHZ A;  2VH1 A;  1N63 A;  4AUQ C;  1SE2 A;  1ZKH A;  3BZD B;  2PW9 A;  4B9K A;  3NJT A;  1UGJ A;  4XWT A;  4DXG A;  1JQ4 A;  2ZPY A;  2W3S A;  3W1S A;  3NVZ A;  4JLC A;  1N5X A;  5J18 A;  1H4R A;  3MHS D;  1FXA A;  2PIA A;  1T6B X;  2L00 B;  3QAR A;  5D94 A;  4W9J A;  1RLF A;  4US8 A;  2K39 A;  2Y5P A;  3Q8B A;  5HHD G;  4K7W A;  3ZTD A;  2V3S A;  3L0W B;  4BAX A;  1YIW A;  1HTO A;  2O2V A;  1BXT A;  1YNT E;  2RDG A;  3MC8 A;  3QC8 B;  4B0E A;  4LCD E;  2YEP F;  4GSW A;  1N62 A;  4KX6 B;  1JWU D;  2K25 A;  3VTV A;  1OQR A;  5BYQ A;  3GB1 A;  4DBG A;  1WE6 A;  1WR6 E;  5BMI A;  4EZL A;  5C2T B;  3DVG Y;  1XO3 A;  1EU3 A;  1Y56 A;  5DCN A;  2MH7 A;  3DBL B;  4ARC A;  2JWU A;  4DDI D;  5KHO A;  3PS6 A;  4M8N A;  2MX2 A;  1TGZ B;  3ETR A;  2J52 A;  1PYW D;  1P3Q U;  1UH6 A;  4RF1 A;  3BY4 B;  3KWV A;  2D07 B;  4MM3 B;  2QJL A;  1BML C;  4E71 A;  3AE2 B;  3L10 B;  1TS3 A;  5DPS A;  4HPM B;  2INP E;  3DVG X;  3APF A;  4RGM A;  4ANX A;  2CJN A;  1WX9 A;  3ZNG C;  3GS2 A;  2BS4 B;  1IPG A;  2BF8 B;  5E6N A;  3HUI A;  3IAS 1;  4ZRJ A;  2RGF A;  1P1A A;  3VRA B;  2K22 A;  5FKA C;  1FNV A;  2MBH A;  3I5J C;  2ZW0 A;  4HEA 1;  4C80 A;  4DHZ E;  1BT0 A;  2DYB A;  2K9X A;  1C4P A;  2KVZ A;  2UU7 A;  4S0R A;  1K8R B;  1E5W A;  3UI3 A;  4NY0 A;  1WXS A;  3DWM A;  4K7S A;  4ZOH C;  3A33 B;  2KZR A;  2V0G A;  4MGZ E;  3B2G A;  4XDC A;  3RN9 C;  3RNB C;  2MP2 B;  5GMV A;  1DOX A;  3VUY A;  2WXK A;  4DHJ B;  1LGR A;  3RYT A;  2NPT B;  3RI7 C;  4MGI E;  2OHF A;  4JX1 C;  4RNA A;  4WQO B;  3HHM A;  3A4S C;  1E8Y A;  2LD9 A;  4ZYS A;  4FHK A;  1Q5W B;  3PTF C;  2DX5 B;  3ZRF A;  1WJ4 A;  3ZNZ B;  2AWT A;  2G4S A;  5D6J B;  2M56 B;  4A8X C;  3BK1 A;  4IOI E;  3PRE A;  3VTU A;  1TBE A;  1V49 A;  2BYV E;  4DK5 A;  3VDZ A;  4A20 A;  3TMP B;  2JZP A;  4RH6 A;  3DVN U;  3QX1 A;  3ALB A;  2K0P A;  4A55 A;  2WDT B;  3NG0 A;  3EEC A;  3IBE A;  3M3J A;  4HPL B;  2RSU A;  3ZW3 A;  1WRD B;  5KHQ A;  4RGN A;  4BKG A;  1L4Z B;  2K8H A;  1J19 A;  1TIF A;  2NS5 A;  3AU5 A;  1XLN A;  3T3O A;  4YWG G;  4JIO U;  2CHW A;  1N61 A;  2CHX A;  2Z0D B;  2KMM A;  1TKE A;  3PLV A;  4CQN A;  2WP9 B;  2O6V B;  2DZJ A;  3U2S C;  4E74 A;  4RFB A;  1LXD A;  1K53 A;  1V86 A;  5D7G A;  1WM3 A;  4ZYN A;  1I4H A;  4YT0 B;  2LFI A;  4YTN B;  3ENE A;  1XCQ L;  1YD8 U;  2I1J A;  4AQ7 A;  2JF5 A;  2V4L A;  5E6J A;  2WXO A;  2ZPN A;  2KQ4 X;  3C19 A;  1D6E C;  3BVG A;  1GNU A;  1FCC C;  2WLB A;  2DZK A;  1R4N B;  4IG7 B;  3EFC A;  1V97 A;  5IA7 A;  1NEK B;  3EA6 A;  1D5M C;  3MC0 B;  2L05 A;  1F9J A;  4F8C B;  4IUM B;  5H92 C;  2WXM A;  5G5H A;  4HXD A;  2KVR A;  3PHW B;  3WA0 A;  4W9F A;  4MEL A;  1F77 A;  1JWA D;  1ZXI A;  2GBR A;  2N9L A;  3RPF C;  2BYF A;  2JRI B;  4KDL B;  4IW0 A;  1GG3 A;  4YXD B;  5CHV C;  3ZVV A;  2ASQ A;  4L23 A;  3X0W A;  1L0V B;  1R7S A;  1ET6 A;  1F2R C;  1H7W A;  2Z0E B;  2AL3 A;  3B0A A;  3M95 A;  3ZDM C;  4KGT A;  1GC6 A;  1UD7 A;  3ZUN A;  1LM8 B;  1V1P B;  2IO0 B;  5AEK B;  3AB5 A;  3QIJ A;  3UIO B;  2B76 B;  2QC8 A;  4OVZ A;  1E8X A;  3APD A;  4HRO A;  2L32 A;  2KC2 A;  2IO3 B;  2MHJ A;  3R66 C;  5AZG A;  4G50 A;  4ZRI A;  2Y5B B;  4JPS A;  4OZC A;  4ZDV A;  4TQ1 A;  2V3N A;  1PGX A;  3RZW C;  2E3T A;  1SSN A;  2DZM A;  3O65 B;  3P4P B;  3X23 A;  3UQB A;  1I35 A;  1D3Z A;  5IN7 A;  2FE8 A;  3WAO A;  2FUG 1;  3AE4 B;  1UWX A;  1WXA A;  4PS3 A;  3KVF B;  3VQI A;  1L0Y B;  3NVW A;  3VH3 B;  1FM0 D;  1TS5 A;  1Y8R C;  5IAA C;  2WXH A;  4NZL B;  2K5P A;  2V1Y A;  4BZA A;  1UWM A;  3ZIM A;  1K50 A;  1V1P A;  2WXP A;  5J2R A;  1I42 A;  1HEZ E;  5AZF A;  1ZOY B;  1FRD A;  1MG4 A;  3Q3N C;  1P7E A;  4WJQ A;  1C3T A;  1C4C A;  2BKF A;  1EF1 A;  3N20 C;  1GJZ A;  5TR5 A;  1E8Z A;  2C9W B;  1DGJ A;  1SF0 A;  3DBH B;  2DHZ A;  1PFD A;  1FIQ A;  2XK5 B;  3AXC A;  2IBI B;  1WGD A;  5GXG B;  4ICU A;  1WMH B;  2L3Z A;  4XE0 A;  2N7D A;  3C8Y A;  2IY1 B;  1M94 A;  1J7C A;  4JE3 B;  1SEB D;  5AUI A;  5FR3 A;  4RF0 A;  3Q2A C;  3Q8F A;  1ZP0 B;  4NQL B;  3N1Y C;  4W9L A;  3P42 A;  1STE A;  2AQ3 B;  3TUO A;  2GI9 A;  1UF0 A;  2FIF A;  3ZLZ A;  4KDI C;  3AMZ A;  1MFW A;  3AE1 B;  3MHZ A;  1PGA A;  4EUT A;  1ENF A;  2N0S B;  2N1W A;  3R8B A;  3W2D A;  3SDL C;  3WAM A;  4R3D A;  5CX3 A;  5DPT A;  3BVM A;  4BOS C;  4NPN A;  2NBW B;  2W9N A;  2BS3 B;  4NAM A;  1FEH A;  2J0J A;  4ITK A;  4PK1 A;  1VZ6 A;  3RUI B;  1FCL A;  1WMH A;  4EKU A;  2MBO A;  5JHB A;  5LLI A;  1JW9 D;  1AAR A;  1GB4 A;  3OLM D;  1MPE A;  1FFV A;  3ZJT A;  3AED B;  1K51 A;  2M0X A;  2Y5C A;  4PYU A;  4GXB A;  4GOC A;  2BKR B;  1V5O A;  2WU2 B;  2PEA A;  3AE7 B;  3ZYY X;  2HD5 B;  2LHD A;  3KYC D;  2BQQ A;  2I2Y A;  3GOE A;  4AWJ A;  4WIP A;  1VD2 A;  3NVY A;  1H8C A;  1H7X A;  3A9K A;  2UYZ B;  2OJR A;  4FXC A;  3E56 A;  2FUH B;  3S2A A;  4FBJ B;  2KDM A;  2WX0 A;  4N9F 4;  2L52 A;  2IND C;  3K9P B;  5IP4 D;  4BKT A;  2WQY B;  1ROE A;  5CHW A;  5G5G A;  3V6E B;  1AW7 A;  3QQ8 B;  1IGC A;  3SFD B;  3NS8 A;  2WNM A;  4REZ A;  2TSS A;  2G45 B;  2BPS A;  3PHX B;  2KN5 A;  2JXX A;  1FPY A;  3GE3 C;  1OFF A;  4LNF A;  4J3O D;  1V5T A;  3NY5 A;  2KHW B;  2QHO A;  4YSX B;  2PE6 B;  3VHT C;  3AE9 B;  4GB9 A;  1QIL A;  4N59 A;  3UQA A;  3LJ3 A;  2LI5 A;  1HZ5 A;  2WXL A;  5C3J B;  2KDF B;  4HJG E;  1TZ1 A;  2GOW A;  3JSV B;  4DHZ B;  2LXA A;  3QK0 A;  1RWS A;  4W9I A;  4EE2 A;  4LTU A;  4G3X B;  3IT6 B;  2D3B A;  5H8Y E;  1OEY A;  3PO0 A;  1P0R A;  2VZK D;  3AE8 B;  2WHI A;  2FCS A;  1KM7 A;  2PPH A;  1I4G A;  1D5Z C;  3WAL A;  2V3P A;  2QDF A;  4DDG D;  1JRU A;  2G4D B;  2LVP A;  1ZGU B;  3IHP C;  4EFO A;  3BK2 A;  4B0M A;  4NAW A;  2JUO A;  2HJ1 A;  3R3M A;  5G2N A;  1SB3 C;  2MRP A;  2WX1 A;  2KTR B;  4BVU C;  4ANV A;  4NQK E;  2LVO A;  1VZ8 A;  4B95 A;  3B1L X;  2NBU A;  3B9J A;  2IO2 B;  2MEK A;  2IDY A;  1GOZ A;  3ZTC A;  1TY0 A;  2IY0 B;  3H1U A;  4F1S A;  5D2M B;  3EFU A;  3ZNI D;  3RNE C;  2R61 A;  2HTM E;  2LXC A;  4G11 A;  3ML9 A;  2Y3A A;  1M4V A;  3KLS X;  4ACF A;  3UIP B;  3ZXR A;  2JT4 B;  2Q5W D;  1XF5 L;  4IWO A;  1T5X D;  4USA A;  3AE5 B;  1WSP A;  3V60 A;  4EEW A;  1I7H A;  4PT5 A;  3HIZ A;  3ZDT A;  2L0F A;  2YLM A;  2DLB A;  2V4I B;  3KUC B;  1GTE A;  2ZNV C;  2SAK A;  1E90 A;  3KW5 B;  4MAC A;  5DPW A;  3TBL D;  2WYQ A;  4WJP A;  4L1B A;  4BBN F;  4GMV A;  2KLC A;  4TMA B;  2NTT A;  4FJY A;  4OHJ A;  2D10 A;  4A6Q A;  4W9K A;  3N32 A;  4WAF A;  2IYD B;  3TL5 A;  1QQR A;  4K81 A;  3EC8 A;  2LZ6 A;  5LXI B;  4TSS A;  2FID A;  3DBR I;  4XX5 A;  1E10 A;  3EUB 2;  3RMK C;  4HKQ A;  3V05 A;  4P16 A;  2N9X A;  3FKY A;  2BVC A;  2DYO A;  4GDK B;  2OOB B;  3R2T A;  4A3O A;  2BWE S;  2XEW A;  1TYG B;  2IZV B;  3WAP A;  1GTH A;  3H9D A;  3ML8 A;  4FN2 A;  1BUI C;  4URK A;  4W9G A;  1LFD A;  1J7B A;  3SFE B;  4MEM A;  1FXT B;  4GIV A;  2J0K A;  3CWI A;  3N1X C;  2YVC A;  1ESF A;  2GLS A;  2WU5 B;  2JWZ A;  3H6N A;  2PVG C;  4IKG A;  3CF4 A;  5C23 A;  2D3C A;  1SGH A;  4MM3 A;  4KIK B;  2JSV X;  5J17 A;  2JQR B;  3L4P A;  5HKH A;  4CO7 A;  2HDE A;  2BW2 A;  4UDU C;  1MJD A;  1ZDX A;  1WXQ A;  3PVL A;  1TT5 B;  3HVD A;  5CHF A;  4KGR A;  3RZF A;  2FNJ B;  1T3Q A;  4MGY E;  1I4P A;  4G0N B;  2JYT A;  4II2 B;  3FIL B;  1HQR D;  2KNB A;  3E9S A;  3L13 A;  1WX7 A;  4GU2 A;  2QMT A;  1X1M A;  4J6I A;  1K52 A;  3PSE B;  4OZB A;  1Q10 A;  4GDL B;  1YQ3 B;  2M4N A;  4HDQ A;  2N9P C;  2PKO A;  2ZZP B;  1I4X A;  2WDQ B;  2WXN A;  4NNJ B;  2OJW A;  2MP2 A;  3A9J B;  3VR9 B;  2J7Q B;  2LHE A;  3T3N A;  1V81 A;  5JH5 C;  3OJ4 B;  1A5R A;  1WX8 A;  1QT9 A;  2NPT A;  3AV8 A;  3HM3 A;  3ZGZ A;  3W1Y A;  3W5U B;  2N9K A;  3DWG C;  2AQ1 B;  4ZHO A;  2GMI C;  2LRW A;  1ISN A;  2IGD A;  1SE4 A;  2H89 B;  1TY2 A;  1WGG A;  1NEN B;  4W9C A;  5EDS A;  4XGA B;  1SE3 A;  4A3P A;  4P1C C;  1R4M I;  2KTF A;  4AS1 A;  1AWD A;  1J8C A;  2DEN B;  4KSK C;  2CU1 A;  3NZ3 A;  2JU6 X;  2JPH A;  3ZO5 B;  2J4X A;  2JZZ A;  3I9V 1;  2N7E A;  2GBJ A;  4D2K A;  1OTR B;  1WXV A;  3RNA C;  4DXF A;  2DAJ A;  2AQ2 B;  3VUW A;  2UWQ A;  4FJV B;  3TJP A;  1V1O A;  3CMM B;  2Z8L A;  4BKS A;  2EMT A;  4MJS B;  3UIN B;  1B1Z A;  4LDT D;  3DCG A;  2IJ0 A;  1WJU A;  1NYR A;  2RR9 A;  4XWW A;  3N30 A;  2LGS A;  4I6N B;  2LGX A;  4LJO B;  3DHG C;  3U52 E;  1WGH A;  1EF5 A;  3NZS A;  3IT4 B;  4M02 A;  3P2B A;  4LLG M;  2WXG A;  4HLE A;  3N1Z C;  1XEE A;  4C4V B;  1Z5S B;  2O6V A;  1V8C A;  1WGK A;  2KX0 A;  2B3A A;  3H7P B;  3SD5 A;  1PQS A;  2JZ3 B;  3H8H A;  5HFY A;  1FRR A;  1XLO A;  1NVI D;  2KFK B;  4ASW C;  1YQ4 B;  2IPK D;  4KZC A;  2MW5 A;  4KKI A;  1T0S C;  1YX5 B;  4F7Z A;  2PVO D;  4ZRQ A;  1TJE A;  1XD3 B;  2FAZ A;  2JX5 A;  2XNA C;  4IM0 A;  1SE9 A;  2D11 A;  4FA6 A;  4PYZ A;  2KAJ A;  1F0Z A;  3Q3O C;  2WDV B;  4HRS A;  2C60 A;  2R2O A;  1WM2 A;  2KJR A;  1QZE A;  1OQY A;  1WZ3 A;  4KKJ A;  2K6D B;  2KFJ A;  1CK1 A;  2D3G A;  3AEA B;  2OED A;  3P4S B;  1JRP A;  3DHH C;  3KUD B;  1ET9 A;  3PRM B;  2INC C;  3NHE B;  1TTN A;  2C7M B;  2MBE A;  4L2Y A;  2KDI A;  2E6X A;  1UBI A;  2BYT A;  1E7P B;  2X38 A;  3KUZ A;  1HE8 A;  5BYR A;  1CMX B;  1SXT A;  2NVU I;  2NMQ A;  3Q8C A;  1N60 A;  3PGE A;  4XYC A;  5I4D A;  2A4Z A;  3DQV A;  3HK0 A;  3AEB B;  3W1S C;  2DYM A;  1C78 A;  1QOA A;  3SHQ A;  3Q3M C;  3R7R A;  2NCN A;  3P1M A;  2CJO A;  4PS8 A;  1OQQ A;  4P7I A;  3M62 B;  3HRD D;  4WWM A;  3VFK A;  3V3X A;  3OG5 A;  1VLB A;  4K1R B;  1GUA B;  5G55 A;  3VH4 B;  1GC7 A;  1WJ6 A;  1VR9 A;  3B2F A;  1A70 A;  1WF9 A;  5BO4 B;  4WAA A;  3DHI C;  4KSL C;  2D2Q A;  5AZH A;  4I6L B;  4WUR A;  1E7V A;  2WS3 B;  2DBY A;  5FK9 C;  2C7H A;  2G3Q B;  3B08 A;  1RYJ A;  2J53 A;  3AU4 A;  3Q3J A;  1V6E A;  5E6O A;  2IGG A;  2LGY A;  3PPA A;  1N5W A;  4FUL A;  1E9M A;  1XQQ A;  2MJ3 A;  5IOI A;  2CKH B;  5HG2 A;  2DNF A;  4FHJ A;  3TEX A;  3CF6 E;  3PV1 A;  4KGS A;  2XK5 A;  2KO3 A;  4IWQ A;  3V62 A;  4WWP A;  2KAN A;  2M8S A;  2ZCC A;  1WE7 A;  3R2I A;  1L6V A;  2WXR A;  1WWT A;  3ZNH B;  4ZHP A;  2CS4 A;  4W9H A;  2C5L C;  4E3C A;  2INN E;  2MA9 B;  3CSF A;  2KYW A;  1NDD A;  1DOY A;  1B9R A;  3D32 A;  1AN8 A;  5JZE B;  2KD0 A;  1TKG A;  4GN1 A;  2EKE C;  1QOB A;  2PTL A;  1RM6 C;  1OEY J;  1YN3 A;  2MWS B;  3H7S A;  3MP9 A;  3Q69 A;  3FAH A;  2D5G A;  3GZN I;  2LWP A;  3R7Q A;  2M0A A;  1KF6 B;  5LXH A;  2KQS A;  3AE6 B;  1P98 A;  3AI5 A;  2GBM A;  3I3T B;  4X57 B;  1QOF A;  1TKY A;  4W9D A;  1ZUD 2;  3AM9 A;  4MDK E;  1T0Y A;  1SBB B;  1T0Q C;  2LMC A;  4BOZ B;  2N9E B;  4NJC A;  1KLU D;  2ON8 A;  4WWN A;  1JWS D;  2K8C A;  3O13 A;  1NI2 A;  3ZKJ C;  2JY6 A;  2PJH A;  3PZ8 A;  1NYQ A;  1FO4 A;  2ACZ B;  4K7U A;  1FD6 A;  1PGB A;  4MT5 A;  1TZO A;  4XC2 A;  1JRO A;  3TEZ A;  1JWM D;  2M1M A;  1QF6 A;  3A1Q B;  3MTN B;  1TS2 A;  2KOX A;  3SEB A;  3T8M A;  4MSM B;  1L2N A;  4EZK A;  3NRZ A;  1VCB A;  2KDE B;  3W9C B;  1GAQ B;  3DDC B;  3OAW A;  1WFY A;  2BB5 A;  4RM9 A;  2LUE A;  3BYY B;  2VRR B;  4NJ7 A;  1RFA A;  3LXF A;  3TSS A;  4WJO A;  2MJD A;  2NR2 A;  1YX6 B;  3IG3 A;  3NUH B;  3RNG C;  1YJI A;  2FCQ A;  2LGD A;  3K9O B;  5FR6 A;  1MHX A;  3ECI A;  3QCA A;  3LB8 C;  2O2V B;  3PT2 B;  3WAN A;  3AEG B;  2R2Q A;  1WXM A;  2MLB A;  3APC A;  4KZ0 A;  4CHK A;  1C77 A;  3VR8 B;  1YN5 A;  2KX3 A;  4FJZ A;  3CST A;  3DVN V;  4KV2 A;  4M0W B;  3U7D A;  3PZD A;  3A1Q A;  2KAC A;  3DBR B;  2LRU A;  2KWV B;  3FC4 A;  2I1K A;  3AN1 A;  1HTQ A;  3JSV A;  1JCK B;  1P9D U;  2DWQ A;  2W55 A;  3GP7 A;  4MGK E;  1VDV A;  1G6J A;  3ZRC A;  3W5V B;  3JVZ X;  2N4F A;  3U8Z A;  4DWF A;  2LGI A;  3V61 A;  2WXF A;  4K3B A;  4DHJ D;  5LNK 1;  1J7A A;  1VJK A;  3KQ4 A;  1JML A;  3C0R B;  4AP4 C;  2M19 A;  4HK2 A;  2JVC A;  4ZRP A;  4I6P A;  1KH0 A;  4BBN C;  4YSY B;  2FBW B;  4LNI A;  4GLS C;  1IP9 A;  1F52 A;  1PUT A;  3M63 B;  2KTR A;  2L0T A;  1HZ6 A;  3Q8E A;  2I38 A;  4OVU A;  2KXJ A;  1S3S G;  3NVV A;  1ACC A;  4M0W A;  3UGB B;  4FAD A;  1V80 A;  2EMS A;  3EGR A;  2QSD A;  4NJ6 A;  4XZ4 A;  1EUV B;  1IGD A;  3ZJV A;  1EU4 A;  4JQW C;  2KDB A;  2VZK B;  4RM8 A;  2C7N B;  1WGR A;  1FMA D;  4H2A A;  5L83 A;  1VZ7 A;  4BKS D;  5DPR A;  2D3A A;  1SIF A;  5IKC M;  2KMC A;  4A90 A;  4AJY B;  1YJJ A;  4KVG B;  1YQB A;  2WXJ A;  3DPD A;  2LAS A;  2G9H D;  1RRB A;  4AOF A;  2RDH A;  2LUM A;  4DQO C;  5D3I B;  2O6V D;  3NS1 A;  3PRP B;  4WWO A;  2QCZ A;  2ZEQ A;  4ARI A;  4S17 A;  3Q8A A;  3QWZ B;  2AYO B;  3HVZ A;  1OGW A;  4HJK A;  2N1V A;  1WYG A;  2K6Q A;  2PE9 A;  2CU3 A;  1RFK A;  3VVW B;  2K3U A;  4LNN A;  2WDR B;  2NTS A;  4MH8 A;  4IM2 A;  1WYW B;  1R4M B;  2N7J A;  1EWY C;  2J42 A;  5IO9 A;  3T9L A;  2RPQ A;  4HPP A;  3AEC B;  3DBL I;  3MC9 A;  4HWI B;  4TKN A;  1UBQ A;  1KJT A;  4MH0 E;  2GRI A;  2GBN A;  2G1E A;  4JGH B;  4BFR A;  2MCN B;  4GGQ A;  2BBC A;  4GDK A;  5EE1 A;  4OVV A;  3PRZ A;  4M00 A;  1P7F A;  4HKZ E;  2K8B A;  3UF8 A;  3VXW A;  3IXS A;  1GT8 A;  1XT9 B;  2JYE A;  5AUK A;  3KWL A;  5T8I A;  2Z59 B;  2H88 B;  2FCM A;  3BIN A;  4OW0 A;  1L6U A;  2REX A;  1D5X C;  2KMA A;  2M17 A;  1SIJ A;  1JWB D;  1WGY A;  4KIK A;  2YEP B;  4N6E B;  3ZQ4 A;  3OJ3 A;  2JXT A;  3AH7 A;  2LJI A;  4ANU A;  2A5U A; 
#chains in the Genus database with same CATH homology
 3GB1 A;  1E7P B;  1YMH E;  2X38 A;  5BMI A;  2KDM A;  2L52 A;  5C2T B;  5BYR A;  1XO3 A;  1SXT A;  1EU3 A;  1Y56 A;  2WQY B;  1ROE A;  2MH7 A;  2NMQ A;  5G5G A;  1AW7 A;  4ARC A;  1IGC A;  3Q8C A;  2JWU A;  1N60 A;  3SFD B;  2WXQ A;  4P6V F;  5I4D A;  2WNM A;  1QOG A;  3VRB B;  3AEB B;  3ETR A;  3FIL A;  4REZ A;  2TSS A;  2J52 A;  1PYW D;  2DYM A;  3BII D;  1C78 A;  1QOA A;  4JWU C;  4RF1 A;  1IUE A;  3BWU D;  3KWV A;  4MM3 B;  2QJL A;  3TEY A;  5EE9 A;  1BML C;  3P1M A;  3AE2 B;  1OFF A;  2CJO A;  1TS3 A;  1OQQ A;  2QIE B;  4J3O D;  2RPV A;  2INP E;  3HRD D;  4RGM A;  4WWM A;  2CJN A;  1HXY D;  4YSX B;  3V3X A;  3GS2 A;  2BS4 B;  1MI0 A;  3AE9 B;  3HUI A;  1QIL A;  1ZPS A;  3IAS 1;  1VLB A;  2QEJ C;  4N59 A;  4YTP B;  1HZ5 A;  3VRA B;  2K22 A;  2WXL A;  5C3J B;  5FKA C;  4HJG E;  1FNV A;  4A9A A;  1QLB B;  2ZW0 A;  1E0Z A;  4HEA 1;  3OWE B;  1RWS A;  4EE2 A;  4LTU A;  1VR9 A;  3B2F A;  4C80 A;  1A70 A;  3IT6 B;  4IDI A;  1MHH E;  5H8Y E;  2K9X A;  1C4P A;  4WUR A;  3PO0 A;  2WS3 B;  4C7Z A;  2BS2 B;  3UI3 A;  2DBY A;  4Q2J A;  1KRH A;  2VZK D;  5FK9 C;  1CQV A;  5MPO A;  3AE8 B;  3DWM A;  1C4A A;  1RYJ A;  3BYT B;  1CZP A;  4ZOH C;  2V0G A;  3URY A;  3B2G A;  2J53 A;  4XDC A;  1I4G A;  2IGG A;  1D5Z C;  2XN9 C;  5EE0 A;  2V3P A;  1I4Q A;  1DOX A;  3BK2 A;  4B0M A;  1EM7 A;  3IAM 1;  2WXK A;  4RGO S;  1N5W A;  1E9M A;  2MJ3 A;  1SB3 C;  3ZJU A;  5HG2 A;  3TEX A;  4KGS A;  3LYY A;  2OHF A;  4JX1 C;  4RNA A;  1QKZ A;  1FXI A;  1VZ8 A;  3R2I A;  5HI1 A;  4ZYS A;  1L6V A;  4YTM B;  2WXR A;  1WWT A;  1WRI A;  4ZHP A;  3MFG A;  3B9J A;  2M56 B;  2W54 A;  2MEK A;  2IDY A;  1GOZ A;  1TY0 A;  4A8X C;  3BK1 A;  2INN E;  4IOI E;  1YN4 A;  2R61 A;  2BT6 A;  1FNW A;  2HTM E;  1DOY A;  1B9R A;  1AN8 A;  1DYQ A;  2Y3A A;  1NI3 A;  1TKG A;  1M4V A;  2JZP A;  3KLS X;  1QOB A;  4C7Y A;  4RH6 A;  2SEB D;  2PTL A;  2LEK A;  2Q5W D;  1RM6 C;  1XF5 L;  2K0P A;  1MVK A;  1YN3 A;  4LK0 M;  2BTE A;  1T5X D;  4A55 A;  4USA A;  2QIL A;  3SR6 A;  3MJ5 A;  3MP9 A;  3AE5 B;  1WSP A;  1FNU A;  3FAH A;  2D5G A;  3Q69 A;  1DOI A;  2M0A A;  1I7H A;  4RGN A;  1KF6 B;  3WCQ A;  3AE6 B;  1L4Z B;  1CJE A;  4PT5 A;  1QOF A;  1TKY A;  1ZUD 2;  2DLB A;  2V4I B;  3AM9 A;  1GTE A;  2SAK A;  1SBB B;  2LMC A;  1XLN A;  1TS4 A;  3T3O A;  4YWG G;  4MAC A;  4NJC A;  1KLU D;  2ON8 A;  4C56 C;  2L83 A;  1JWS D;  1N61 A;  3O13 A;  4L1B A;  1KTK A;  3J9C A;  4YSZ B;  2L1A A;  3PZ8 A;  1FO4 A;  1NYQ A;  2KMM A;  1TKE A;  4CQN A;  2WP9 B;  4TMA B;  2ACZ B;  1FD6 A;  2NTT A;  3U2S C;  1PGB A;  4MT5 A;  3CIR B;  1TZO A;  4OHJ A;  4RFB A;  1JRO A;  4A6Q A;  4TQ0 A;  1K53 A;  4WAF A;  3TEZ A;  5D7G A;  5BYS A;  1I4H A;  4YT0 B;  1QQR A;  2LFI A;  1JWM D;  1XLQ A;  4YTN B;  1XCQ L;  1QF6 A;  4AQ7 A;  5E6J A;  2WXO A;  2KQ4 X;  4TSS A;  1IBX B;  1D6E C;  3BVG A;  1TS2 A;  1FCC C;  2WLB A;  1E10 A;  3SEB A;  3EUB 2;  4HKQ A;  3NRZ A;  1V97 A;  3W9C B;  1NEK B;  3V05 A;  3P4Q B;  1GAQ B;  1LO5 D;  4P16 A;  3EA6 A;  3AE3 B;  1D5M C;  2BB5 A;  3MC0 B;  3BYY B;  1L0X B;  2DYO A;  4GDK B;  3R2T A;  5H92 C;  2WXM A;  5G5H A;  1HA5 A;  3LXF A;  1TYG B;  3TSS A;  1F77 A;  1JWA D;  1XCT L;  1ZXI A;  1GTH A;  2N9L A;  1BUI C;  2ONQ A;  4XDD A;  3RPF C;  2MJD A;  4OZA A;  3NUH B;  1J7B A;  3SFE B;  4YXD B;  1YJI A;  2BB6 A;  3U4E G;  4L23 A;  3CWI A;  1MHX A;  1ZE3 D;  4US9 A;  5BMG A;  1L0V B;  1ESF A;  3LB8 C;  1R7S A;  1ET6 A;  2WU5 B;  5JXV A;  1F2R C;  1H7W A;  2PVG C;  4IKG A;  1XLP A;  3CF4 A;  3I57 A;  1C9F A;  3AEG B;  2ICI A;  1I4R A;  2JSV X;  2JQR B;  3L4P A;  4KGT A;  1C77 A;  3VR8 B;  1YN5 A;  2HDE A;  4RCO A;  1FFU A;  2BW2 A;  4UDU C;  2AX5 A;  1ZDX A;  1WXQ A;  1EWC A;  2KAC A;  4RGT A;  1V1P B;  3HVD A;  1IBX A;  3AB5 A;  3U7Z A;  2B76 B;  1L5P A;  3FC4 A;  1ZXH A;  4KGR A;  3AN1 A;  1T3Q A;  2WXI A;  1I4P A;  1XXG A;  4OVZ A;  4HRO A;  2L32 A;  2JYT A;  3FIL B;  1HQR D;  3E9S A;  1JCK B;  4WH4 A;  2KN4 A;  4JPS A;  4OZC A;  1AYF A;  2DWQ A;  2EKI A;  3AEF B;  2QMT A;  2W55 A;  3GP7 A;  2GB1 A;  1VDV A;  2PLP A;  2V3N A;  4TQ1 A;  1KFY B;  1K52 A;  1PGX A;  4OZB A;  3W5V B;  1Q10 A;  4GDL B;  1YQ3 B;  2LGI A;  4N58 A;  2E3T A;  2WXF A;  2PKO A;  1I4X A;  1SSN A;  2WDQ B;  3P4P B;  3ABV B;  5LNK 1;  1J7A A;  2ZW1 A;  2WXN A;  1VJK A;  3KQ4 A;  1JML A;  2FE8 A;  3VR9 B;  2LHE A;  2M19 A;  3PZ7 A;  2FUG 1;  3AE4 B;  1UWX A;  4ZRP A;  3T3N A;  3RFZ B;  1KH0 A;  3BVZ A;  4YSY B;  2FBW B;  2W3R A;  2W82 A;  3VQI A;  3N9Y C;  4GLS C;  1L0Y B;  1PUT A;  1QT9 A;  3NVW A;  3AV8 A;  1TS5 A;  1FM0 D;  5BMH A;  1KLG D;  1HZ6 A;  3Q8E A;  2I38 A;  3ZGZ A;  2WXH A;  1L4D B;  4NZL B;  3W5U B;  2K5P A;  2PMV A;  3NVV A;  2N9K A;  3DWG C;  2AQ1 B;  1ACC A;  4M0W A;  1GPX A;  1UWM A;  1K50 A;  1V1P A;  2WXP A;  3EGR A;  5EE3 A;  4ZHO A;  1HEZ E;  1ZOY B;  2QSD A;  1FRD A;  2IGD A;  3AEE B;  1SE4 A;  1P7E A;  2H89 B;  1IGD A;  1TY2 A;  1C4C A;  3ZJV A;  1PDX A;  1EU4 A;  2VZK B;  1NEN B;  2MJE A;  5TSS A;  1SE3 A;  3P63 A;  4AS1 A;  1AWD A;  1SJE D;  4JWS C;  4NAW B;  1DGJ A;  1FMA D;  3NZ3 A;  2JU6 X;  1SF0 A;  4H2A A;  1PFD A;  2J4X A;  3I9V 1;  1FIQ A;  1GB1 A;  1VZ7 A;  1UNS A;  4D2K A;  1VRA B;  4DXF A;  1F2R I;  5GXG B;  3P4R B;  2AQ2 B;  1SJH D;  4XE0 A;  2IGH A;  3C8Y A;  1D4B A;  1V1O A;  1J7C A;  2Z8L A;  4JE3 B;  4A90 A;  1JAL A;  1SEB D;  1YJJ A;  1B1Z A;  5AUI A;  2IJ0 A;  5FR3 A;  4RF0 A;  1NYR A;  1UUP A;  2WXJ A;  3Q8F A;  4XWW A;  1ZP0 B;  2G9H D;  4O1N A;  2RDH A;  2LUM A;  4DQO C;  2KWD A;  5D3I B;  3NS1 A;  3P42 A;  3TEW A;  1ZDV A;  3U52 E;  2EEL A;  1STE A;  2AQ3 B;  4ARI A;  3Q8A A;  3IT4 B;  2RMM A;  4LLG M;  2WXG A;  3TUO A;  2GI9 A;  3HVZ A;  1XEE A;  1C79 A;  1E6E B;  1V8C A;  1WGK A;  3AMZ A;  1WYG A;  4WQM A;  3AE1 B;  5D3D A;  3MHZ A;  1PGA A;  1ENF A;  2N0S B;  3R8B A;  3W2D A;  2CU3 A;  1RFK A;  1C76 A;  2K3U A;  4R3D A;  2WDR B;  2NTS A;  3H8H A;  4MH8 A;  1FRR A;  1XLO A;  3BVM A;  5HFY A;  1NVI D;  1YQ4 B;  1N63 A;  1SE2 A;  2N7J A;  1EWY C;  2IPK D;  3BZD B;  2J42 A;  4KKI A;  2BS3 B;  2PW9 A;  3AEC B;  1UGJ A;  4XWT A;  4DXG A;  4NAM A;  1FEH A;  1JQ4 A;  2PVO D;  4ZRQ A;  2W3S A;  4ITK A;  3W1S A;  3NVZ A;  1TJE A;  1VZ6 A;  2GRI A;  1N5X A;  2JX5 A;  2G1E A;  1FCL A;  2XNA C;  2BBC A;  5EE1 A;  1JW9 D;  2KAJ A;  1F0Z A;  1GB4 A;  1MPE A;  1FFV A;  2WDV B;  1FXA A;  1P7F A;  2PIA A;  3AED B;  1K51 A;  3ZJT A;  1T6B X;  4HRS A;  2Y5C A;  4HKZ E;  2WU2 B;  4US8 A;  3IXS A;  3AE7 B;  1GT8 A;  2Y5P A;  3ZYY X;  2LHD A;  2JYE A;  3Q8B A;  4KKJ A;  3KWL A;  5AUK A;  5HHD G;  5T8I A;  2I2Y A;  1CK1 A;  2H88 B;  4WIP A;  3AEA B;  2OED A;  3NVY A;  1BXT A;  1YNT E;  3P4S B;  2RDG A;  4OW0 A;  1H7X A;  1JRP A;  1L6U A;  4B0E A;  1ET9 A;  1D5X C;  1SIJ A;  1JWB D;  2YEP F;  2YEP B;  4N6E B;  3ZQ4 A;  1N62 A;  4KX6 B;  2JXT A;  4FXC A;  3AH7 A;  2LJI A;  1JWU D;  4L2Y A;  3E56 A;  1OQR A;  2E6X A;  2BYT A;  5BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...