2BS3B

Glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
239
structure length
239
Chain Sequence
b'MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUINOL-FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A
publication title Experimental Support for the E-Pathway Hypothesis of Coupled Transmembrane Electron and Proton Transfer in Dihemic Quinol:Fumarate Reductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 239
sequence length 239
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2bs3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bs3B01
2OHFA 1TKYA 3AEFB 1T3QA 3AN1A 1XLOA 2PVGC 1CJEA 1QOBA 2QIEB 3AV8A 3VRBB 1UWMA 2W54A 5EE0A 4US8A 1NYQA 1WGKA 4JX1C 3AEDB 4P6VF 2WS3B 1AYFA 5G5HA 4WQMA 5C2TB 3AE6B 3VR9B 5H92C 5EE9A 3AE1B 1WRIA 4WWMA 3AE7B 1TKGA 4YSXB 2K5PA 2Y5CA 3DWGC 1DOYA 1NI3A 1JWBD 3BIID 1FO4A 1PDXA 1N5WA 1GTHA 1QOAA 2H88B 1GPXA 3PO0A 3B2FA 3P4RB 3NS1A 1OQQA 1L0VB 4IDIA 1FXIA 1E0ZA 1FM0D 4FXCA 1FMAD 2EKIA 1FIQA 3ETRA 3RPFC 3CIRB 1FFUA 1WWTA 3NVYA 3W5VB 1F0ZA 3SFEB 4YTPB 1OFFA 1N61A 1QOFA 4HROA 1YJIA 2BS2B 2DBYA 3VRAB 4ZHPA 2MJDA 3LXFA 2WDRB 2KMMA 1VJKA 3FAHA 3NVVA 2WDVB 5AUIA 1L5PA 2WU2B 3P4PB 1NVID 1EWYC 2MJEA 2WLBA 2AX5A 1CZPA 1H7WA 3ABVB 2WP9B 5EE3A 1GAQB 1L6VA 4C80A 2WU5B 4ZHOA 1A70A 5C3JB 3L4PA 1WXQA 2B76B 3AE5B 3P4QB 1KFYB 5AUKA 4YTNB 1RFKA 1JROA 2BT6A 2W3SA 1N62A 1FFVA 2K22A 1XO3A 1L6UA 2BS4B 1E7PB 1FRDA 3CWIA 3LB8C 3AECB 1KF6B 1XLNA 3FC4A 1QOGA 1DGJA 1PFDA 2CJNA 1QF6A 2MJ3A 4N59A 2G1EA 3NVWA 3AE2B 1JW9D 4N6EB 4C7YA 3CF4A 4C7ZA 1B9RA 2DWQA 2K9XA 4KX6B 2LEKA 2W55A 2CJOA 3AMZA 3AE3B 4YXDB 2M56B 1JQ4A 1I7HA 1SIJA 2FBWB 2L83A 3W5UB 1RYJA 1DOIA 1JWAD 4YSYB 1N60A 1RM6C 2CU3A 1WYGA 3AH7A 3B9JA 3NRZA 4JWUC 4LTUA 1E10A 1FXAA 2ACZB 2JX5A 1E9MA 3AEEB 1XLPA 2M19A 1GTEA 4YT0B 3P4SB 4YSZB 1TKEA 3WCQA 1RWSA 3HUIA 3VR8B 3AEGB 4YTMB 1JRPA 1ZOYB 1SF0A 1VDVA 2Q5WD 2PKOA 1TYGB 2E3TA 4HRSA 3AE4B 1TJEA 1SB3C 2KAJA 2PVOD 3AM9A 3HRDD 3AE9B 3HVZA 4JWSC 5EE1A 1ZXIA 3AB5A 4A9AA 1V8CA 2WQYB 1ROEA 3AEAB 1JALA 1N5XA 1YQ4B 1VLBA 3DWMA 2W3RA 4ZOHC 3ZYYX 2BS3B 1QLBB 1R7SA 1KRHA 4ITKA 3W9CB 2N0SB 1J7CA 1NENB 4USAA 1AWDA 1XLQA 3KWLA 3P1MA 1YQ3B 1QT9A 1NEKB 2PIAA 2MH7A 5G5GA 2JQRB 3B2GA 1OQRA 3P63A 2HTME 2L52A 1FRRA 1J7AA 1NYRA 5H8YE 1H7XA 1V97A 3AE8B 4N58A 3AEBB 5GXGB 1E6EB 1ZUD2 2QJLA 3SR6A 1J7BA 3NVZA 5MPOA 1ZP0B 1IUEA 1GT8A 1N63A 1DOXA 3SFDB 2H89B 1PUTA 2WDQB 3EUB2 1YJJA 4US9A
chains in the Genus database with same CATH superfamily
1T3QA 2RDGA 2QIEB 3VRBB 1M4VA 4BOSC 2D3AA 2KWCA 2CKHB 4CQNA 3R7QA 3VR9B 4NAWB 3AE1B 4IM3A 3IG3A 2MA9B 2KHWB 3QCAA 5C23A 2L1AA 2LD9A 2NCNA 2LGIA 1TY0A 4DHZB 1LXDA 2JZZA 2BWFA 4ZHPA 3FAHA 2M17A 2LHDA 5JH5C 5LXIB 2LGXA 4C80A 4RNAA 5LLIA 4GSWA 2BYVE 4K3CA 2KMAA 2J0MA 4BKSD 3ZUNA 2UYZB 4MM3A 3DPDA 2L0TA 2MP2A 5IKCM 1QZEA 1MHXA 3T3OA 3VUXA 1WXVA 5AZFA 3W1YA 2LWPA 2L83A 1JWAD 3X23A 1UH6A 1I4QA 2C60A 4A9AA 2DLBA 3H1UA 3QWZB 3SD5A 1OTRB 3TL5A 2KJRA 3NHEB 2DZIA 2LVPA 4UDUC 3VFKA 4LJOB 1J7AA 2ZEQA 2BVCA 4WJQA 2W9NA 2WXQA 1P98A 1IUEA 2KFKB 4ZRQA 1J8CA 5KHQA 2KN4A 3TEXA 3IAS1 3AEDB 4GDKB 4ANUA 4BVUC 4M0WB 4WIPA 4GDLB 2K5PA 5DPWA 5IAAC 2NR2A 1P0RA 4AP4C 3UQBA 2OOBB 1QOAA 1GPXA 3B2FA 3PT2B 4KIKA 3NVYA 3DVGX 4G0NB 4BBNF 1OFFA 1YJIA 4K7WA 3P2BA 1V5TA 1NVID 2TSSA 3Q8CA 4LNFA 4E71A 4WAAA 4ZHOA 2FIDA 3KH0A 3L4PA 1WM3A 4LCDE 4RCOA 4XE0A 2MSED 3NUHB 2DYBA 4ZDVA 3DVNU 3CWIA 4M8NA 3ALBA 1KLVA 2MQJA 2AQ1B 2KJ6A 1ZXHA 4MACA 3QJZA 3A9KA 3DHGC 1OEYJ 1F1HA 3MC8A 4RGMA 2DAJA 2LZ6A 5DCNA 1ZKHA 1L2NA 4MJSB 4XX5A 1Q5WB 2RGFA 4G11A 2I1JA 4BAXA 4EOYA 1FXAA 3KUZA 3KYCD 1I35A 1MI0A 3P42A 1Z2MA 1GTEA 4ARCA 2GBNA 3VUWA 2DZJA 1ESFA 1TS3A 3T9LA 3AE9B 2J4XA 1ZXIA 2M1MA 1R4NI 4FULA 3R66C 1HEZE 4A3PA 3W1SC 3BK1A 2I38A 3NZ3A 4C00A 3P1MA 3PPAA 2DYOA 4BOZB 3N9YC 2KN5A 2KDIA 1MG8A 1V1OA 1E6EB 1YN4A 5FK9C 3SR6A 3QA8A 1IBXA 1R4NB 2NBVB 1XLOA 3AV8A 1IPGA 3DVGY 4CO7A 3IT6B 3DBHI 1PGXA 2D2QA 1MPEA 4W9HA 1KLGD 1UBQA 4A20A 3NZUA 4FJYA 2V9HA 3WAMA 4KSLC 4W9IA 1FFUA 3CSTA 3DBHB 2LGYA 3IFWB 2WDRB 3VDZA 1WX7A 2JXTA 1ACCA 3VXWA 3PRZA 2UU7A 4DK5A 3WAOA 2GRIA 2NTTA 4MGYE 3NG0A 3ZTCA 3GE8C 5E6PA 3ZW3A 4LNKA 1XLNA 5BMGA 2C7HA 2DHZA 2WXGA 2MWSB 2BKRB 2O6VB 2KOXA 3UI3A 2G4DB 4C7ZA 2QILA 2BPSA 5G2NA 3DBSA 4B9KA 2LEKA 1UF0A 3KWVA 4OVUA 4X57B 1RYJA 1UELA 3EA6A 1HZ5A 3AI5A 1XF5L 2ZCCA 2PKOA 3L17A 3AXCA 4LK0M 1TJEA 3U30A 1E7UA 3HM6X 3EFCA 1V8CA 3A9JA 4A6QA 3S2AA 2YVCA 3M63B 3DDCB 1FD6A 1L4DB 2N4FA 3ZDMC 3PRMB 4WWNA 1MG4A 2WXPA 1K52A 3R2IA 2BTEA 3N30A 5FR3A 4EUTA 1MHHE 2VZKD 3FILA 4HDOA 1YJJA 1KH0A 1RFAA 3MJWA 2IBIB 2LGSA 4II3B 2LRWA 2JPHA 3U7DA 1WGYA 2WXJA 2LJIA 4II2B 1ZGUB 3APDA 1YJ1A 4HXDA 1D5ZC 3VTVA 2KVRA 1VCBA 3Q8FA 2UWQA 5DPTA 2IO3B 3ZTDA 5TSSA 2K8BA 1WWTA 3PZ8A 3ZLZA 1KM7A 4ICVA 1VZ8A 2KZRA 5HHDG 3EFUA 1IYFA 1WMHB 2J0JA 2J0KA 1V1PA 5HFYA 4YTNB 2RPVA 1ZDXA 2N7JA 3DCGA 4ZRPA 1L6UA 2RDBC 4RGTA 1GOZA 2OJWA 3EGRA 1RLFA 1STEA 2W55A 3VUYA 3AE3B 1EM7A 4GMVA 4F8CB 2WXOA 2FBWB 3SU8X 5L95C 4LTUA 2ACZB 2OJRA 1E9MA 1XLPA 4ACFA 3P4SB 2Z0DB 4EZKA 3BK2A 2LASA 4GIVA 3J9CA 2FUG1 2Y5BB 3QHTA 2ZPYA 3AB5A 1ROEA 5E6JA 2EKEC 3L54A 4KDLB 3NOBA 3JW0X 3NZSA 3M3JA 2VH2A 1AWDA 2D3BA 2R2OA 1E90A 2ICIA 2IPKD 1SE2A 2MBEA 4FN2A 2L8JA 2IGDA 2IGGA 4H2AA 2KKCA 2KC2A 1TZOA 2WDQB 5J17A 3H6NA 3QAQA 1TKYA 3TIXA 5EDSA 2FUHB 1FXTB 1P3QU 2Z8LA 1NYQA 1TBEA 3U7ZA 5H92C 3TJPA 3DWGC 3EECA 1UGJA 2KDFB 1N5WA 3TEYA 1FXIA 2JVCA 4FXCA 4JE3B 4WAFA 3ETRA 3GZNI 3LDZE 1SIFA 3IAM1 5J2RA 2RD0A 3H7PA 5D3IB 2XBBC 1WSPA 3H7SA 1H7WA 1HQRD 2WP9B 1WFYA 3A1QB 1D5XC 1WJ6A 2G4SA 1KFYB 4PS7A 4HPLB 1WR6E 3DHHC 2VRRB 3GZNB 3ZRCA 2G3QB 2AEHA 2WXRA 4GN1A 2HJ1A 4N59A 1VR9A 2G1EA 2NPTA 2FAZA 1FCCC 4WWPA 3ZKJC 1P1AA 2JYTA 2WXNA 3R7RA 2X8XX 4BFRA 3VQIA 3RCZA 1LM8B 1S1QB 1CMXB 4M00A 1F2RI 2E3TA 4FLHA 1T5XD 1SB3C 3HRDD 4JWSC 1BXTA 1WZ0A 4HPMB 1QQRA 2CHZA 1AN8A 1WGHA 3A4RA 4IC7B 3ZXVA 4ITKA 3JYUA 1NENB 3RNEC 4YL8A 1XLQA 1SJED 1NEKB 2KQ4X 4IWQA 3P63A 1LGRA 1SGHA 2WXHA 5MPOA 3PHWB 1PUTA 1ZE3D 2ZVNA 4US9A 5BMHA 2YEPB 2WYQA 1C77A 1AYFA 3UIOB 4WQMA 5E6OA 3MHZA 3W2DA 2ZZPB 4HK2A 3AE7B 2N1WA 4WWOA 5JZEB 3RNAC 2VH1A 4MGZE 4RM9A 1S3SG 2R61A 3RPFC 3Q3OC 1K51A 4YTPB 1N61A 3VHTC 3NVVA 2BWES 2K8HA 3T8MA 1Y8RC 1L4ZB 2Y3AA 2BYEA 1Y56A 2QC8A 1E8YA 4F1SA 1A70A 4JIOU 3ZNHB 1L7YA 4MSMB 1T0YA 2WXMA 5AUKA 2BT6A 1IGCA 2JYEA 4L2YA 1T6BX 2SEBD 4NQLB 1TS2A 4MH0E 1OGWA 4RF0A 2KDBA 1SSNA 2MJ3A 3NVWA 2O2VA 4BKGA 1A5RA 2MBOA 4YXDB 5JHAA 2JT4B 3KQ4A 2IY1B 2REXA 1H8CA 3PGEA 2O6VD 1ISNA 1TYGB 3RZWC 2KAJA 5EE1A 3TEZA 4LNIA 1G6JA 1YX5B 2MBQA 5CHFA 4C4VB 4TQ1A 4KKJA 3SEBA 2KFJA 1HE8A 1HTQA 2NBUA 2MH7A 2JQRB 3BWUD 2DX5B 3Q2AC 4GB9A 1F2RC 2NBWB 4MELA 1YNTE 2GBRA 2ZW0A 3DVNV 1FPYA 3RFZB 2DZMA 2KTRB 4KSKC 5D2MB 3SFDB 5TR5A 4MEMA 4LDTB 3BVGA 2PVGC 4KKIA 4US8A 4K7SA 4ANWA 2J7QB 4E3CA 2AYOB 2XK5B 2Z59B 1WRIA 2PTLA 4JLCA 4YSXB 1E5WA 2KWVB 4BKTA 1WXAA 4TV3A 4PYUA 2BW2A 5AZGA 4M8MA 4FA6A 2LVOA 4W9CA 3ZRFA 3ML8A 2EKIA 4EEWA 2NS5A 1C4PA 3VAWA 2RDHA 2D3CA 3Q6BA 2MJDA 3LXFA 2KMMA 3L16A 2GB1A 1N6ZA 2WXIA 4IW0A 1WX9A 2E6XA 2L00B 1JROA 2LJ5A 1DGJA 1QF6A 1WYWB 4OZCA 2RR9A 2ONQA 4CHKA 3OJ3A 3BVMA 4MGIE 1N60A 1E10A 1WYGA 2V0GA 1V81A 2XN9C 1GUAB 1RWSA 4HEA1 4TQ0A 4YTMB 2LUEA 1ZOYB 2Q5WD 2ASQA 3H8HA 2X38A 2MCNB 1MJDA 2KX3A 3OJ4B 4BKSA 5HI1A 4NZLB 4ZOHC 1FNUA 3ZXRA 3PSEB 5BYQA 2NMQA 2N9XA 2BKFA 2LGDA 1E8XA 3HVDA 1EWCA 1SE3A 1BT0A 2WHIA 4KGTA 3LJ3A 4EE2A 1IGDA 1NYRA 1KLUD 1V97A 3VTWA 4D2KA 4YWGG 4K81A 1J7BA 4MM3B 1H4RA 3AULA 3APCA 3EUB2 2BBCA 3VVWB 4JPSA 2MP2B 3RN9C 2I1KA 5BYRA 3DQVA 3DBRI 3GOEA 3V6CB 2WS3B 2QDFA 2KDMA 4MGKE 1QILA 2L05A 3BYTB 2FNJB 3E9SA 2AQ3B 3BIID 2YLMA 3JVZX 1AW7A 1V9JA 1EO6A 3C0RB 4DDGD 3MC9A 3N1ZC 3Q3JA 3ZJUA 4K1RB 4PK1A 4MH8A 4W9FA 2D07B 2D10A 3DBRB 4HCPB 1WJNA 4FJVB 1EF5A 1GAQB 1E7VA 5GMVA 4MT5A 1XO3A 2RMMA 1FRDA 3NY5A 1XEEA 4LNOA 4XWTA 1JWMD 5D94A 4M01A 4KX6B 2WNMA 4NJ6A 1JQ4A 3WALA 2BYFA 3RNBC 3AU5A 1WX8A 1C4AA 2V3SA 4AS1A 3I9V1 3UGBB 3WCQA 2DYMA 3HUIA 3VR8B 3BZDB 4HRSA 3AE4B 3RT3B 5J18A 2WQYB 1N5XA 4KIKB 3DWMA 3Q3NC 3Q69A 3OG5A 5CHWA 4AQ7A 4WJNA 2KC1A 2N9KA 2XEWA 3UF8A 2ON8A 4DDID 2PIAA 1YN3A 1VRAB 3B2GA 3M95A 4B6WA 1HXYD 3U2SC 2JWZA 2HD5B 4J3OD 5I4DA 2K39A 4NPNA 4AUQC 4HJGE 3V05A 2KACA 1T0SC 2KQ7A 3MHSD 3A9KB 2V3PA 4GOCA 2MBHA 1E8ZA 4ZRJA 2L7RA 4JL9A 1WGKA 4L23A 1T0RC 1I4GA 1YOVB 3KLSX 4KDIC 3I57A 5EE9A 4OHJA 4WWMA 1WXMA 2A4ZA 1YMHE 2CS4A 2PJHA 2JWUA 2L3ZA 2GLSA 2BS2B 2MLBA 1BUIC 1L5PA 4G3XB 3QQ8B 2RSUA 4XC2A 1WH3A 5HG2A 2N9LA 1UUPA 2K22A 2WXKA 1RAXA 1IBXB 1PFDA 3DHIC 1JW9D 1C79A 2DWQA 3I3TB 3CMMB 1V2YA 4ASWC 3AH7A 4AOFA 2MEKA 1V5OA 4IOIE 1TKEA 1WR1A 3AM9A 4B0EA 3N1YC 4AJWA 4XGAB 2W3RA 3B1LX 3JSVA 1LQBA 3PLUA 2J52A 1OQYA 1GB4A 1SE4A 4CYEA 2DENB 4USAA 3U8ZA 4W9LA 1GJZA 1T0QC 4OZAA 1ZDVA 4IUMB 4FBJB 3A33B 5CHVC 2QHOA 4OVVA 4RF1A 3OWEB 1CJEA 3L08A 5EE0A 3QARA 4HPPA 2HJ8A 3PTFC 3ENEA 1TKGA 2K6QA 3B08A 1WGGA 4KGSA 4LDTD 2H88B 2C5LC 3NS1A 1E0ZA 5BO4B 1FIQA 3BINA 4URKA 3CIRB 4HKZE 1F0ZA 3SFEB 2BF8B 3A9JB 2WDVB 1UBIA 3HHMA 1HA5A 3HK0A 1GNUA 4REZA 1YN5A 4TKNA 3MP9A 3P4QB 3KW5B 2GI9A 5GXGB 4EKUA 3AECB 2G9HD 3L10B 1I4RA 3FILB 3N32A 1QOGA 3RNGC 1LO5D 1PGAA 3R3MA 3AMZA 2CJOA 4QAYA 2M56B 4NAWA 2INNE 2KD0A 4YT0B 2Z0EB 2A5UA 1OEYA 1K53A 2QMTA 3AEGB 1JRPA 3X0WA 1WZ3A 3ZNID 3A4SC 3HVZA 3ONSA 3R2TA 3ZYYX 2D11A 4IG7B 4XZ4A 2KK8A 1QLBB 2JY6A 1PQSA 2RPQA 1EUVB 1ET6A 1ENFA 2EMSA 2C9WB 2LVQA 5E6NA 5D3DA 5LNK1 2JU6X 1VZ7A 1V1PB 2C7MB 2IO2B 4P1BC 2AQ2B 1JWUD 3WIMA 3AEBB 1XQQA 1ZUD2 4AWJA 3EC8A 5BYSA 1SXTA 2WGSA 3Q3MC 1QKZA 2L32A 1TIFA 2AL3A 4KV2A 3GP7A 4WURA 4GGQA 4XDDA 3BYYB 5C2TB 3DBLI 2INPE 3B0AA 3TUOA 3BY4B 1WGDA 2YEPF 3PO0A 3P4RB 2N9EB 2PLPA 3MFGA 1FEHA 2C7NB 3ZO5B 3URYA 1QOFA 1EU3A 2M8SA 4RM8A 4P16A 3U52E 1JCKB 4A3OA 2D3GA 2KDEB 1XXGA 2MJEA 2KNBA 1U4AA 3APFA 3Q14C 1FNVA 1EU4A 1SE9A 2WU5B 1TY2A 1TGZB 1WXQA 5CX3A 5FR6A 3RD2A 1M94A 1RFKA 4HVBA 1JMLA 2IGHA 1ET9A 2D5GA 2GBJA 2KFKA 3PS6A 1D5MC 2GOWA 3KUCB 3MC0B 4GDKA 4KZ0A 1XT9B 4M0WA 1I7HA 1SIJA 3R8BA 4ZYSA 3NRZA 4GDLA 2EMTA 4DHZE 2JX5A 3IT4B 3AEEB 4I6LB 2KMCA 4W9JA 4DXGA 1IP9A 1FO4A 2KWUB 3RI7C 4XDCA 5C1ZA 4MSQB 3TMPB 2PVOD 1HZ6A 1YD8U 5T8IA 3AEAB 2FIFA 2ZNVC 2BYTA 1ZW7A 4L1BA 2IJ0A 1V49A 2J53A 3W9CB 3H7PB 1GB1A 4W9EA 3KWLA 2HTHA 1QT9A 2R2QA 2IY0B 1R4MI 3RULA 4GLSC 4FHKA 3Q8EA 3L13A 1D6EC 1FRRA 4XYCA 1H7XA 2K25A 3E56A 3NVZA 2LXAA 3Q3FA 5AEKB 3U4EG 3V6EB 3ML9A 4MJSA 1UNSA 2NPTB 1TZ1A 2KXJA 4JX1C 4P6VF 1I4HA 3SDLC 1R4MB 4B0MA 2Y5CA 1TT5B 1DOYA 2KQSA 1GTHA 2FCMA 4O1NA 2WXFA 4W9GA 3WANA 5JHBA 2DBYA 3WAPA 2ZPNA 2WU2B 4I6NB 2IDYA 4FJZA 3SHQA 2IYDB 2BQQA 3AE5B 4HCNB 2PE6B 4RGNA 3RNFC 1FFVA 4Q2JA 3LYYA 3PZ7A 2LFIA 2MX2A 3UINB 3BVZA 1GG3A 4RGOS 1XD3B 3B9JA 4YSYB 2CU3A 2DZKA 1I42A 2LXCA 3GS2A 3VH3B 3N1XC 1VDVA 2GMIC 1CQVA 3ZDTA 2KO3A 3KVFB 3O65B 4ZRIA 3IVFA 1Q1OA 1R7SA 1J19A 2V3NA 1KJTA 4HKQA 4A8XC 1CK1A 2L76A 5H8YE 1YQBA 1WJUA 2OEDA 5D6JB 4NY0A 2O6VA 1DOXA 4W9DA 3AEFB 2O2VB 2V4IB 1UD7A 2M0AA 5KHOA 4DXAB 2MBBB 4PS8A 2IZVB 3AE6B 2QSDA 2N7DA 1YX6B 5HKHA 2BGFA 3MJ5A 3TEWA 5LXHA 3AU4A 1NBFC 1J0GA 2LUMA 2M0XA 1WM2A 4HROA 3V3XA 4FHJA 4K3BA 4JGHB 3ZJTA 2SAKA 3ABVB 2JZ3B 4NJCA 1L6VA 1WI0A 2IO1B 1TS4A 3Q8AA 1PGBA 2KANA 2PPHA 3T3NA 3NS8A 4ANVA 3H9DA 4EZJA 4LNNA 3TBLD 1E7PB 3NJTA 4NNJB 4ANXA 3FC4A 1D4BA 2GBMA 4W9KA 3I63C 3UIPB 4DQOC 2CJNA 3AE2B 3CF4A 1WY8A 3HIZA 3RUIB 1F9JA 3W5UB 1RM6C 1Q10A 2K1FA 3IHPC 1FNWA 4HDQA 1L0XB 1C76A 4P7IA 2N1VA 2ZVOA 1P7EA 2HDEA 2WDTB 1NI2A 2KYWA 1C1YB 1WJ4A 4IM0A 1JALA 3TSSA 4S17A 2BS3B 4PYZA 1WMHA 3WA0A 1KRHA 2INDC 4DHJD 4FADA 4E74A 5AZHA 2ZJDA 2JSVX 3UQAA 4GXBA 2L52A 3ZNGC 4P1CC 3L0WB 3TCAA 1KOTA 3AE8B 3K9PB 4J6IA 2JRIB 2IO0B 2OHFA 3DOWA 1UWMA 4N9F4 2QCZA 1RRBA 2N7EA 5IN7A 4BBNC 1WRDB 3V61A 1HTOA 2CHWA 2KVZA 1YIWA 1JWBD 3O13A 1UWXA 2L0FA 3ZVVA 2CR5A 1FMAD 2V4LA 1JWSD 3VRAB 1F52A 2KT7A 2FCQA 3RZFA 1B1ZA 1VJKA 4LLGM 2PW9A 3D32A 1EWYC 4R3DA 2PMVA 3PZDA 2NTSA 5EE3A 2INCC 4K7UA 5C3JB 2N9PC 1E8WA 1XCQL 2AWTA 2W3SA 4A55A 1KF6B 1BMLC 1C78A 4IWPA 3OLMD 2I2YA 1WXSA 1MVKA 4N6EB 4G50A 3C8YA 3I5JC 1DOIA 4IWOA 2K8CA 2JXXA 1SF0A 4IM2A 5CTRC 4WJOA 2KX0A 2K0PA 4OZBA 3PV1A 2MRPA 1WIAA 1UGMA 5DPRA 3V60A 2J42A 2N0SB 1J7CA 2KJHB 3A1QA 4XWWA 4OVZA 1KTKA 3FKYA 1OQRA 2HTME 2KLGA 5IP4D 3ZGZA 1JRUA 4JQWC 3ZNZB 3Q8BA 3PRPB 5IOIA 3ECIA 2JF5A 3CSFA 1GT8A 1EF1A 3AN1A 2JUOA 1QOBA 2W54A 1D3ZA 1WE7A 5G5HA 2WWZA 2GBKA 2FCNA 4IKGA 2JZPA 1P9DU 2LHEA 1C3TA 1NI3A 2CHXA 1AARA 3RNCC 1PDXA 5JXVA 4KGRA 4EZLA 3KUDB 4S0RA 4RFBA 5FKAC 4F7ZA 1FM0D 2W82A 4HLEA 3W5VB 4GU2A 2QEJC 4TMAB 1SEBD 2WLBA 1LFDA 3HM3A 1GC7A 2KLCA 1SJHD 4ZYNA 4A90A 5IO9A 3RYTA 1MFWA 3RMKC 2KTFA 1VD2A 2BS4B 2KWDA 2ZCBA 3K9OB 4C7YA 5BMIA 3GE3C 1K8RB 1VZ6A 4JWUC 1V80A 4OW0A 2M19A 3IBEA 4YSZB 4TUUA 1F77A 1V86A 5G55A 4I6PA 2NVUI 5IA7A 1C9FA 2DAFA 2JRHA 4AJYB 4ARIA 4DWFA 2LMCA 1VLBA 1YQ4B 3V62A 2XNAC 3C19A 3QK0A 4DBGA 1XCTL 4EFOA 4NJ7A 1PYWD 5G5GA 1Z5SB 4LJPB 4WH4A 4RMAA 3ZJVA 1C4CA 1WGRA 4DHJB 2PE9A 2V1YA 4NAMA 2MW5A 2G45B 1ZP0B 3ZQ4A 1GC6A 4HJKA 3PLVA 2ZNVB 3PREA 3QC8B 4DXFA 1WE6A 1FCLA 4PS3A 2HE7A 2ZW1A 3N3KB 5L83A 4PT5A 1SBBB 1TS5A 4NQKE 1OQQA 1L0VB 4IDIA 1DYQA 1V6EA 4C4VA 1TTNA 2DNFA 3JSVB 5D7GA 5AUIA 3P4PB 2AX5A 1CZPA 2WXLA 1I4XA 3N20C 2B76B 1L0YB 2MHJA 3VH4B 1UZXB 1N62A 2FCSA 2KTRA 3LB8C 5DPSA 4MDKE 3PHXB 2LI5A 2FE8A 1B9RA 2K9XA 2Y5PA 4B95A 1WF9A 2WX1A 3QX1A 1X1MA 2XK5A 3DBLB 4KZCA 3W1SA 3VTUA 4RH6A 2AL6A 3OAWA 3IXSA 2BB6A 4BZAA 3ZIMA 2LRUA 4KVGB 1P7FA 4ZRKA 2WX0A 3PVLA 3M62B 3KYDD 2PEAA 4C56C 2BB5A 3MTNB 1NDDA 2VZKB 3QIJA 3EHVA 4ICUA 4HWIB 2EELA 1YQ3B 2CU1A 1I4PA 1Q0WB 1K50A 4WQOB 4M02A 2K3UA 2K6DB 4N58A 2M4NA 3GB1A 2QJLA 2B3AA 4TSSA 1N63A 4WJPA 3CF6E 2H89B 1ZPSA
chains in the Genus database with same CATH topology
1TKYA 3AEFB 1T3QA 2V3PA 2RDGA 2QIEB 3VRBB 2V4IB 2Z8LA 1M4VA 2M0AA 1NYQA 1WGKA 4L23A 1I4GA 4CQNA 3U7ZA 3KLSX 5H92C 3AE6B 3VR9B 3I57A 4NAWB 5EE9A 3AE1B 4OHJA 4WWMA 3DWGC 2QSDA 1UGJA 2L1AA 1N5WA 1YMHE 2LGIA 3MJ5A 3TEYA 1TY0A 2JWUA 3TEWA 1FXIA 4FXCA 4JE3B 4WAFA 2LUMA 3ETRA 4HROA 3V3XA 2BS2B 4ZHPA 3IAM1 1BUIC 3FAHA 5D3IB 1L5PA 1WSPA 3ZJTA 2SAKA 1H7WA 3ABVB 1HQRD 2WP9B 2LHDA 4NJCA 1L6VA 4C80A 4RNAA 1D5XC 1TS4A 3Q8AA 5HG2A 2N9LA 1KFYB 1PGBA 1UUPA 3T3NA 2K22A 2WXKA 1D4BA 1E7PB 3FC4A 2WXRA 4DQOC 1IBXB 1PFDA 2CJNA 1MHXA 4N59A 1VR9A 2G1EA 3AE2B 1JW9D 3CF4A 1C79A 3T3OA 1FCCC 2DWQA 2JYTA 2L83A 3W5UB 1JWAD 1RM6C 2WXNA 3AH7A 1Q10A 3VQIA 2MEKA 1FNWA 4IOIE 1L0XB 1TKEA 1C76A 1I4QA 1F2RI 1P7EA 2HDEA 2E3TA 1T5XD 1SB3C 3AM9A 3HRDD 4B0EA 4JWSC 4A9AA 2DLBA 1BXTA 1JALA 1QQRA 3TSSA 2W3RA 1AN8A 2BS3B 1KRHA 2J52A 4ITKA 1GB4A 1SE4A 1NENB 4USAA 1XLQA 1SJED 1NEKB 2KQ4X 2JSVX 3P63A 2L52A 4OZAA 1ZDVA 4UDUC 1J7AA 3AE8B 2WXHA 5MPOA 2WXQA 1IUEA 1PUTA 1ZE3D 4ZRQA 4RF1A 4US9A 5BMHA 2OHFA 3OWEB 2YEPB 1CJEA 2KN4A 3TEXA 1UWMA 5EE0A 1C77A 3IAS1 3AEDB 4GDKB 1AYFA 4WQMA 4WIPA 3MHZA 3W2DA 4GDLB 3AE7B 1TKGA 2K5PA 1JWBD 1QOAA 4KGSA 1GPXA 2H88B 3O13A 3B2FA 1UWXA 3NS1A 1E0ZA 1FMAD 1FIQA 2R61A 3CIRB 4HKZE 3NVYA 3RPFC 1F0ZA 1K51A 3SFEB 4YTPB 1OFFA 1N61A 1JWSD 1YJIA 3VRAB 1B1ZA 1VJKA 4LLGM 3NVVA 2WDVB 1NVID 2TSSA 2PW9A 3Q8CA 1EWYC 4R3DA 1HA5A 1L4ZB 2Y3AA 1Y56A 2PMVA 4REZA 2NTSA 1YN5A 5EE3A 4ZHOA 1A70A 5C3JB 3L4PA 3MP9A 3P4QB 2WXMA 5AUKA 2GI9A 1XCQL 2W3SA 2BT6A 4RCOA 4XE0A 1IGCA 5GXGB 3NUHB 3CWIA 3AECB 1KF6B 2G9HD 2AQ1B 1BMLC 1C78A 1T6BX 2JYEA 2SEBD 1I4RA 1TS2A 1ZXHA 1QOGA 3FILB 4MACA 4RF0A 2I2YA 1SSNA 1LO5D 1MVKA 2MJ3A 4N6EB 3NVWA 4RGMA 1PGAA 3C8YA 2CJOA 3AMZA 4YXDB 2M56B 2INNE 1DOIA 1FXAA 3KQ4A 1MI0A 3P42A 1GTEA 4YT0B 1K53A 2QMTA 4ARCA 3AEGB 1JRPA 1SF0A 1TYGB 1ESFA 1TS3A 2KAJA 2K0PA 4OZBA 5EE1A 3AE9B 3HVZA 3TEZA 2J4XA 1ZXIA 3R2TA 4TQ1A 3ZYYX 1HEZE 4KKJA 1QLBB 3SEBA 1ET6A 2J42A 2N0SB 1J7CA 1ENFA 3BK1A 2I38A 3NZ3A 3P1MA 2MH7A 2DYOA 2JQRB 3BWUD 5D3DA 4XWWA 4OVZA 1KTKA 3N9YC 2JU6X 5LNK1 1OQRA 2HTME 1F2RC 1VZ7A 1YNTE 1V1PB 3ZGZA 2AQ2B 1JWUD 3Q8BA 2ZW0A 3AEBB 1V1OA 1E6EB 1YN4A 1ZUD2 5FK9C 3SR6A 3RFZB 1IBXA 5BYSA 1GT8A 1SXTA 3SFDB 3BVGA 3AN1A 1XLOA 2PVGC 1QOBA 1QKZA 3AV8A 3IT6B 2W54A 4KKIA 2L32A 4US8A 1PGXA 3GP7A 5G5HA 4WURA 4XDDA 3BYYB 5C2TB 4IKGA 1MPEA 2JZPA 1WRIA 2PTLA 1KLGD 4YSXB 2LHEA 2INPE 1NI3A 3TUOA 1PDXA 2YEPF 2BW2A 4KGRA 5JXVA 3PO0A 3P4RB 4RFBA 5FKAC 2PLPA 1FM0D 3MFGA 2W82A 2EKIA 1FEHA 3W5VB 1FFUA 1C4PA 2RDHA 3URYA 1QOFA 1EU3A 4P16A 3U52E 2QEJC 1JCKB 2MJDA 3LXFA 4TMAB 2WDRB 2KMMA 1XXGA 1SEBD 2MJEA 2WLBA 2GB1A 2JXTA 2WXIA 1ACCA 1FNVA 1EU4A 2WU5B 1TY2A 1SJHD 2E6XA 1WXQA 4A90A 2GRIA 2NTTA 1RFKA 1JROA 1JMLA 2IGHA 1ET9A 2D5GA 2BS4B 1XLNA 5BMGA 2WXGA 1D5MC 1DGJA 2KWDA 1QF6A 4OZCA 3MC0B 3UI3A 4C7YA 2ONQA 4C7ZA 2QILA 5BMIA 2LEKA 3KWVA 4M0WA 1I7HA 1SIJA 3BVMA 3R8BA 1RYJA 3NRZA 4ZYSA 1N60A 1E10A 1WYGA 1VZ6A 3EA6A 1HZ5A 4JWUC 4OW0A 2JX5A 2M19A 3AEEB 3IT4B 2V0GA 1XF5L 4DXGA 4YSZB 2XN9C 1F77A 1RWSA 4HEA1 4TQ0A 1FO4A 4YTMB 2Q5WD 1ZOYB 3H8HA 1C9FA 2PKOA 4XDCA 4LK0M 1TJEA 2X38A 2PVOD 4ARIA 1HZ6A 1V8CA 2LMCA 5HI1A 5T8IA 4A6QA 3AEAB 1VLBA 1YQ4B 2BYTA 4NZLB 4ZOHC 4L1BA 1FD6A 2XNAC 1L4DB 1FNUA 2IJ0A 2J53A 5BYQA 3W9CB 1XCTL 1GB1A 2NMQA 1PYWD 2WXPA 3KWLA 1K52A 3R2IA 3HVDA 1QT9A 2BTEA 1EWCA 1SE3A 5G5GA 4GLSC 4WH4A 5FR3A 4KGTA 3Q8EA 4EE2A 1D6EC 1FRRA 1IGDA 3ZJVA 1NYRA 1C4CA 1KLUD 1H7XA 1V97A 4NAMA 1MHHE 4D2KA 2VZKD 3E56A 4YWGG 3FILA 1J7BA 3NVZA 4MM3B 1ZP0B 3ZQ4A 3EUB2 2BBCA 1YJJA 4JPSA 3U4EG 1KH0A 1UNSA 5BYRA 4JX1C 4DXFA 2WXJA 1FCLA 4P6VF 2WS3B 1I4HA 2LJIA 2KDMA 2ZW1A 1QILA 3BYTB 4B0MA 2Y5CA 3E9SA 1D5ZC 2AQ3B 1DOYA 3BIID 4PT5A 1SBBB 1TS5A 1AW7A 4A55A 1GTHA 1OQQA 1L0VB 4IDIA 4O1NA 3Q8FA 3ZJUA 5TSSA 1DYQA 1WWTA 3PZ8A 2WXFA 4MH8A 2DBYA 1VZ8A 5D7GA 5HHDG 5AUIA 2WU2B 3P4PB 2IDYA 2AX5A 1CZPA 2WXLA 1GAQB 1I4XA 1V1PA 5HFYA 2B76B 3AE5B 1L0YB 4YTNB 2RPVA 4RGNA 1ZDXA 2N7JA 1N62A 1FFVA 4MT5A 1XO3A 1L6UA 1FRDA 2RMMA 3LB8C 4Q2JA 4ZRPA 1XEEA 4RGTA 1GOZA 4XWTA 1JWMD 3LYYA 3PZ7A 2FE8A 3EGRA 1B9RA 2LFIA 2K9XA 4KX6B 2WNMA 1STEA 2W55A 2Y5PA 3AE3B 1JQ4A 1EM7A 3W1SA 2WXOA 3BVZA 2FBWB 4RGOS 3B9JA 4YSYB 2CU3A 4RH6A 1C4AA 4LTUA 4AS1A 2ACZB 3I9V1 3IXSA 1E9MA 1XLPA 3GS2A 2BB6A 3P4SB 3WCQA 2DYMA 3HUIA 3VR8B 1VDVA 3BK2A 3BZDB 4HRSA 3AE4B 3J9CA 1CQVA 2FUG1 1P7FA 3AB5A 2WQYB 1ROEA 5E6JA 1N5XA 3DWMA 3Q69A 4C56C 2BB5A 4AQ7A 1R7SA 2N9KA 2VZKB 2V3NA 2ON8A 1AWDA 2EELA 1YQ3B 2PIAA 4HKQA 4A8XC 1YN3A 1I4PA 1VRAB 3B2GA 2ICIA 1K50A 2IPKD 1CK1A 1SE2A 1HXYD 5H8YE 3U2SC 4J3OD 2K3UA 5I4DA 4L2YA 2OEDA 2IGDA 4N58A 2IGGA 3GB1A 2QJLA 4HJGE 3V05A 4H2AA 2KACA 4TSSA 1N63A 1DOXA 2H89B 1TZOA 2WDQB 1ZPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHF A;  1TKY A;  3AEF B;  1T3Q A;  3AN1 A;  1XLO A;  2PVG C;  1CJE A;  1QOB A;  2QIE B;  3AV8 A;  3VRB B;  1UWM A;  2W54 A;  5EE0 A;  4US8 A;  1NYQ A;  1WGK A;  4JX1 C;  3AED B;  4P6V F;  2WS3 B;  1AYF A;  5G5H A;  4WQM A;  5C2T B;  3AE6 B;  3VR9 B;  5H92 C;  5EE9 A;  3AE1 B;  1WRI A;  4WWM A;  3AE7 B;  1TKG A;  4YSX B;  2K5P A;  2Y5C A;  3DWG C;  1DOY A;  1NI3 A;  1JWB D;  3BII D;  1FO4 A;  1PDX A;  1N5W A;  1GTH A;  1QOA A;  2H88 B;  1GPX A;  3PO0 A;  3B2F A;  3P4R B;  3NS1 A;  1OQQ A;  1L0V B;  4IDI A;  1FXI A;  1E0Z A;  1FM0 D;  4FXC A;  1FMA D;  2EKI A;  1FIQ A;  3ETR A;  3RPF C;  3CIR B;  1FFU A;  1WWT A;  3NVY A;  3W5V B;  1F0Z A;  3SFE B;  4YTP B;  1OFF A;  1N61 A;  1QOF A;  4HRO A;  1YJI A;  2BS2 B;  2DBY A;  3VRA B;  4ZHP A;  2MJD A;  3LXF A;  2WDR B;  2KMM A;  1VJK A;  3FAH A;  3NVV A;  2WDV B;  5AUI A;  1L5P A;  2WU2 B;  3P4P B;  1NVI D;  1EWY C;  2MJE A;  2WLB A;  2AX5 A;  1CZP A;  1H7W A;  3ABV B;  2WP9 B;  5EE3 A;  1GAQ B;  1L6V A;  4C80 A;  2WU5 B;  4ZHO A;  1A70 A;  5C3J B;  3L4P A;  1WXQ A;  2B76 B;  3AE5 B;  3P4Q B;  1KFY B;  5AUK A;  4YTN B;  1RFK A;  1JRO A;  2BT6 A;  2W3S A;  1N62 A;  1FFV A;  2K22 A;  1XO3 A;  1L6U A;  2BS4 B;  1E7P B;  1FRD A;  3CWI A;  3LB8 C;  3AEC B;  1KF6 B;  1XLN A;  3FC4 A;  1QOG A;  1DGJ A;  1PFD A;  2CJN A;  1QF6 A;  2MJ3 A;  4N59 A;  2G1E A;  3NVW A;  3AE2 B;  1JW9 D;  4N6E B;  4C7Y A;  3CF4 A;  4C7Z A;  1B9R A;  2DWQ A;  2K9X A;  4KX6 B;  2LEK A;  2W55 A;  2CJO A;  3AMZ A;  3AE3 B;  4YXD B;  2M56 B;  1JQ4 A;  1I7H A;  1SIJ A;  2FBW B;  2L83 A;  3W5U B;  1RYJ A;  1DOI A;  1JWA D;  4YSY B;  1N60 A;  1RM6 C;  2CU3 A;  1WYG A;  3AH7 A;  3B9J A;  3NRZ A;  4JWU C;  4LTU A;  1E10 A;  1FXA A;  2ACZ B;  2JX5 A;  1E9M A;  3AEE B;  1XLP A;  2M19 A;  1GTE A;  4YT0 B;  3P4S B;  4YSZ B;  1TKE A;  3WCQ A;  1RWS A;  3HUI A;  3VR8 B;  3AEG B;  4YTM B;  1JRP A;  1ZOY B;  1SF0 A;  1VDV A;  2Q5W D;  2PKO A;  1TYG B;  2E3T A;  4HRS A;  3AE4 B;  1TJE A;  1SB3 C;  2KAJ A;  2PVO D;  3AM9 A;  3HRD D;  3AE9 B;  3HVZ A;  4JWS C;  5EE1 A;  1ZXI A;  3AB5 A;  4A9A A;  1V8C A;  2WQY B;  1ROE A;  3AEA B;  1JAL A;  1N5X A;  1YQ4 B;  1VLB A;  3DWM A;  2W3R A;  4ZOH C;  3ZYY X;  2BS3 B;  1QLB B;  1R7S A;  1KRH A;  4ITK A;  3W9C B;  2N0S B;  1J7C A;  1NEN B;  4USA A;  1AWD A;  1XLQ A;  3KWL A;  3P1M A;  1YQ3 B;  1QT9 A;  1NEK B;  2PIA A;  2MH7 A;  5G5G A;  2JQR B;  3B2G A;  1OQR A;  3P63 A;  2HTM E;  2L52 A;  1FRR A;  1J7A A;  1NYR A;  5H8Y E;  1H7X A;  1V97 A;  3AE8 B;  4N58 A;  3AEB B;  5GXG B;  1E6E B;  1ZUD 2;  2QJL A;  3SR6 A;  1J7B A;  3NVZ A;  5MPO A;  1ZP0 B;  1IUE A;  1GT8 A;  1N63 A;  1DOX A;  3SFD B;  2H89 B;  1PUT A;  2WDQ B;  3EUB 2;  1YJJ A;  4US9 A; 
#chains in the Genus database with same CATH topology
 1T3Q A;  2RDG A;  2QIE B;  3VRB B;  1M4V A;  4BOS C;  2D3A A;  2KWC A;  2CKH B;  4CQN A;  3R7Q A;  3VR9 B;  4NAW B;  3AE1 B;  4IM3 A;  3IG3 A;  2MA9 B;  2KHW B;  3QCA A;  5C23 A;  2L1A A;  2LD9 A;  2NCN A;  2LGI A;  1TY0 A;  4DHZ B;  1LXD A;  2JZZ A;  2BWF A;  4ZHP A;  3FAH A;  2M17 A;  2LHD A;  5JH5 C;  5LXI B;  2LGX A;  4C80 A;  4RNA A;  5LLI A;  4GSW A;  2BYV E;  4K3C A;  2KMA A;  2J0M A;  4BKS D;  3ZUN A;  2UYZ B;  4MM3 A;  3DPD A;  2L0T A;  2MP2 A;  5IKC M;  1QZE A;  1MHX A;  3T3O A;  3VUX A;  1WXV A;  5AZF A;  3W1Y A;  2LWP A;  2L83 A;  1JWA D;  3X23 A;  1UH6 A;  1I4Q A;  2C60 A;  4A9A A;  2DLB A;  3H1U A;  3QWZ B;  3SD5 A;  1OTR B;  3TL5 A;  2KJR A;  3NHE B;  2DZI A;  2LVP A;  4UDU C;  3VFK A;  4LJO B;  1J7A A;  2ZEQ A;  2BVC A;  4WJQ A;  2W9N A;  2WXQ A;  1P98 A;  1IUE A;  2KFK B;  4ZRQ A;  1J8C A;  5KHQ A;  2KN4 A;  3TEX A;  3IAS 1;  3AED B;  4GDK B;  4ANU A;  4BVU C;  4M0W B;  4WIP A;  4GDL B;  2K5P A;  5DPW A;  5IAA C;  2NR2 A;  1P0R A;  4AP4 C;  3UQB A;  2OOB B;  1QOA A;  1GPX A;  3B2F A;  3PT2 B;  4KIK A;  3NVY A;  3DVG X;  4G0N B;  4BBN F;  1OFF A;  1YJI A;  4K7W A;  3P2B A;  1V5T A;  1NVI D;  2TSS A;  3Q8C A;  4LNF A;  4E71 A;  4WAA A;  4ZHO A;  2FID A;  3KH0 A;  3L4P A;  1WM3 A;  4LCD E;  4RCO A;  4XE0 A;  2MSE D;  3NUH B;  2DYB A;  4ZDV A;  3DVN U;  3CWI A;  4M8N A;  3ALB A;  1KLV A;  2MQJ A;  2AQ1 B;  2KJ6 A;  1ZXH A;  4MAC A;  3QJZ A;  3A9K A;  3DHG C;  1OEY J;  1F1H A;  3MC8 A;  4RGM A;  2DAJ A;  2LZ6 A;  5DCN A;  1ZKH A;  1L2N A;  4MJS B;  4XX5 A;  1Q5W B;  2RGF A;  4G11 A;  2I1J A;  4BAX A;  4EOY A;  1FXA A;  3KUZ A;  3KYC D;  1I35 A;  1MI0 A;  3P42 A;  1Z2M A;  1GTE A;  4ARC A;  2GBN A;  3VUW A;  2DZJ A;  1ESF A;  1TS3 A;  3T9L A;  3AE9 B;  2J4X A;  1ZXI A;  2M1M A;  1R4N I;  4FUL A;  3R66 C;  1HEZ E;  4A3P A;  3W1S C;  3BK1 A;  2I38 A;  3NZ3 A;  4C00 A;  3P1M A;  3PPA A;  2DYO A;  4BOZ B;  3N9Y C;  2KN5 A;  2KDI A;  1MG8 A;  1V1O A;  1E6E B;  1YN4 A;  5FK9 C;  3SR6 A;  3QA8 A;  1IBX A;  1R4N B;  2NBV B;  1XLO A;  3AV8 A;  1IPG A;  3DVG Y;  4CO7 A;  3IT6 B;  3DBH I;  1PGX A;  2D2Q A;  1MPE A;  4W9H A;  1KLG D;  1UBQ A;  4A20 A;  3NZU A;  4FJY A;  2V9H A;  3WAM A;  4KSL C;  4W9I A;  1FFU A;  3CST A;  3DBH B;  2LGY A;  3IFW B;  2WDR B;  3VDZ A;  1WX7 A;  2JXT A;  1ACC A;  3VXW A;  3PRZ A;  2UU7 A;  4DK5 A;  3WAO A;  2GRI A;  2NTT A;  4MGY E;  3NG0 A;  3ZTC A;  3GE8 C;  5E6P A;  3ZW3 A;  4LNK A;  1XLN A;  5BMG A;  2C7H A;  2DHZ A;  2WXG A;  2MWS B;  2BKR B;  2O6V B;  2KOX A;  3UI3 A;  2G4D B;  4C7Z A;  2QIL A;  2BPS A;  5G2N A;  3DBS A;  4B9K A;  2LEK A;  1UF0 A;  3KWV A;  4OVU A;  4X57 B;  1RYJ A;  1UEL A;  3EA6 A;  1HZ5 A;  3AI5 A;  1XF5 L;  2ZCC A;  2PKO A;  3L17 A;  3AXC A;  4LK0 M;  1TJE A;  3U30 A;  1E7U A;  3HM6 X;  3EFC A;  1V8C A;  3A9J A;  4A6Q A;  3S2A A;  2YVC A;  3M63 B;  3DDC B;  1FD6 A;  1L4D B;  2N4F A;  3ZDM C;  3PRM B;  4WWN A;  1MG4 A;  2WXP A;  1K52 A;  3R2I A;  2BTE A;  3N30 A;  5FR3 A;  4EUT A;  1MHH E;  2VZK D;  3FIL A;  4HDO A;  1YJJ A;  1KH0 A;  1RFA A;  3MJW A;  2IBI B;  2LGS A;  4II3 B;  2LRW A;  2JPH A;  3U7D A;  1WGY A;  2WXJ A;  2LJI A;  4II2 B;  1ZGU B;  3APD A;  1YJ1 A;  4HXD A;  1D5Z C;  3VTV A;  2KVR A;  1VCB A;  3Q8F A;  2UWQ A;  5DPT A;  2IO3 B;  3ZTD A;  5TSS A;  2K8B A;  1WWT A;  3PZ8 A;  3ZLZ A;  1KM7 A;  4ICV A;  1VZ8 A;  2KZR A;  5HHD G;  3EFU A;  1IYF A;  1WMH B;  2J0J A;  2J0K A;  1V1P A;  5HFY A;  4YTN B;  2RPV A;  1ZDX A;  2N7J A;  3DCG A;  4ZRP A;  1L6U A;  2RDB C;  4RGT A;  1GOZ A;  2OJW A;  3EGR A;  1RLF A;  1STE A;  2W55 A;  3VUY A;  3AE3 B;  1EM7 A;  4GMV A;  4F8C B;  2WXO A;  2FBW B;  3SU8 X;  5L95 C;  4LTU A;  2ACZ B;  2OJR A;  1E9M A;  1XLP A;  4ACF A;  3P4S B;  2Z0D B;  4EZK A;  3BK2 A;  2LAS A;  4GIV A;  3J9C A;  2FUG 1;  2Y5B B;  3QHT A;  2ZPY A;  3AB5 A;  1ROE A;  5E6J A;  2EKE C;  3L54 A;  4KDL B;  3NOB A;  3JW0 X;  3NZS A;  3M3J A;  2VH2 A;  1AWD A;  2D3B A;  2R2O A;  1E90 A;  2ICI A;  2IPK D;  1SE2 A;  2MBE A;  4FN2 A;  2L8J A;  2IGD A;  2IGG A;  4H2A A;  2KKC A;  2KC2 A;  1TZO A;  2WDQ B;  5J17 A;  3H6N A;  3QAQ A;  1TKY A;  3TIX A;  5EDS A;  2FUH B;  1FXT B;  1P3Q U;  2Z8L A;  1NYQ A;  1TBE A;  3U7Z A;  5H92 C;  3TJP A;  3DWG C;  3EEC A;  1UGJ A;  2KDF B;  1N5W A;  3TEY A;  1FXI A;  2JVC A;  4FXC A;  4JE3 B;  4WAF A;  3ETR A;  3GZN I;  3LDZ E;  1SIF A;  3IAM 1;  5J2R A;  2RD0 A;  3H7P A;  5D3I B;  2XBB C;  1WSP A;  3H7S A;  1H7W A;  1HQR D;  2WP9 B;  1WFY A;  3A1Q B;  1D5X C;  1WJ6 A;  2G4S A;  1KFY B;  4PS7 A;  4HPL B;  1WR6 E;  3DHH C;  2VRR B;  3GZN B;  3ZRC A;  2G3Q B;  2AEH A;  2WXR A;  4GN1 A;  2HJ1 A;  4N59 A;  1VR9 A;  2G1E A;  2NPT A;  2FAZ A;  1FCC C;  4WWP A;  3ZKJ C;  1P1A A;  2JYT A;  2WXN A;  3R7R A;  2X8X X;  4BFR A;  3VQI A;  3RCZ A;  1LM8 B;  1S1Q B;  1CMX B;  4M00 A;  1F2R I;  2E3T A;  4FLH A;  1T5X D;  1SB3 C;  3HRD D;  4JWS C;  1BXT A;  1WZ0 A;  4HPM B;  1QQR A;  2CHZ A;  1AN8 A;  1WGH A;  3A4R A;  4IC7 B;  3ZXV A;  4ITK A;  3JYU A;  1NEN B;  3RNE C;  4YL8 A;  1XLQ A;  1SJE D;  1NEK B;  2KQ4 X;  4IWQ A;  3P63 A;  1LGR A;  1SGH A;  2WXH A;  5MPO A;  3PHW B;  1PUT A;  1ZE3 D;  2ZVN A;  4US9 A;  5BMH A;  2YEP B;  2WYQ A;  1C77 A;  1AYF A;  3UIO B;  4WQM A;  5E6O A;  3MHZ A;  3W2D A;  2ZZP B;  4HK2 A;  3AE7 B;  2N1W A;  4WWO A;  5JZE B;  3RNA C;  2VH1 A;  4MGZ E;  4RM9 A;  1S3S G;  2R61 A;  3RPF C;  3Q3O C;  1K51 A;  4YTP B;  1N61 A;  3VHT C;  3NVV A;  2BWE S;  2K8H A;  3T8M A;  1Y8R C;  1L4Z B;  2Y3A A;  2BYE A;  1Y56 A;  2QC8 A;  1E8Y A;  4F1S A;  1A70 A;  4JIO U;  3ZNH B;  1L7Y A;  4MSM B;  1T0Y A;  2WXM A;  5AUK A;  2BT6 A;  1IGC A;  2JYE A;  4L2Y A;  1T6B X;  2SEB D;  4NQL B;  1TS2 A;  4MH0 E;  1OGW A;  4RF0 A;  2KDB A;  1SSN A;  2MJ3 A;  3NVW A;  2O2V A;  4BKG A;  1A5R A;  2MBO A;  4YXD B;  5JHA A;  2JT4 B;  3KQ4 A;  2IY1 B;  2REX A;  1H8C A;  3PGE A;  2O6V D;  1ISN A;  1TYG B;  3RZW C;  2KAJ A;  5EE1 A;  3TEZ A;  4LNI A;  1G6J A;  1YX5 B;  2MBQ A;  5CHF A;  4C4V B;  4TQ1 A;  4KKJ A;  3SEB A;  2KFJ A;  1HE8 A;  1HTQ A;  2NBU A;  2MH7 A;  2JQR B;  3BWU D;  2DX5 B;  3Q2A C;  4GB9 A;  1F2R C;  2NBW B;  4MEL A;  1YNT E;  2GBR A;  2ZW0 A;  3DVN V;  1FPY A;  3RFZ B;  2DZM A;  2KTR B;  4KSK C;  5D2M B;  3SFD B;  5TR5 A;  4MEM A;  4LDT B;  3BVG A;  2PVG C;  4KKI A;  4US8 A;  4K7S A;  4ANW A;  2J7Q B;  4E3C A;  2AYO B;  2XK5 B;  2Z59 B;  1WRI A;  2PTL A;  4JLC A;  4YSX B;  1E5W A;  2KWV B;  4BKT A;  1WXA A;  4TV3 A;  4PYU A;  2BW2 A;  5AZG A;  4M8M A;  4FA6 A;  2LVO A;  4W9C A;  3ZRF A;  3ML8 A;  2EKI A;  4EEW A;  2NS5 A;  1C4P A;  3VAW A;  2RDH A;  2D3C A;  3Q6B A;  2MJD A;  3LXF A;  2KMM A;  3L16 A;  2GB1 A;  1N6Z A;  2WXI A;  4IW0 A;  1WX9 A;  2E6X A;  2L00 B;  1JRO A;  2LJ5 A;  1DGJ A;  1QF6 A;  1WYW B;  4OZC A;  2RR9 A;  2ONQ A;  4CHK A;  3OJ3 A;  3BVM A;  4MGI E;  1N60 A;  1E10 A;  1WYG A;  2V0G A;  1V81 A;  2XN9 C;  1GUA B;  1RWS A;  4HEA 1;  4TQ0 A;  4YTM B;  2LUE A;  1ZOY B;  2Q5W D;  2ASQ A;  3H8H A;  2X38 A;  2MCN B;  1MJD A;  2KX3 A;  3OJ4 B;  4BKS A;  5HI1 A;  4NZL B;  4ZOH C;  1FNU A;  3ZXR A;  3PSE B;  5BYQ A;  2NMQ A;  2N9X A;  2BKF A;  2LGD A;  1E8X A;  3HVD A;  1EWC A;  1SE3 A;  1BT0 A;  2WHI A;  4KGT A;  3LJ3 A;  4EE2 A;  1IGD A;  1NYR A;  1KLU D;  1V97 A;  3VTW A;  4D2K A;  4YWG G;  4K81 A;  1J7B A;  4MM3 B;  1H4R A;  3AUL A;  3APC A;  3EUB 2;  2BBC A;  3VVW B;  4JPS A;  2MP2 B;  3RN9 C;  2I1K A;  5BYR A;  3DQV A;  3DBR I;  3GOE A;  3V6C B;  2WS3 B;  2QDF A;  2KDM A;  4MGK E;  1QIL A;  2L05 A;  3BYT B;  2FNJ B;  3E9S A;  2AQ3 B;  3BII D;  2YLM A;  3JVZ X;  1AW7 A;  1V9J A;  1EO6 A;  3C0R B;  4DDG D;  3MC9 A;  3N1Z C;  3Q3J A;  3ZJU A;  4K1R B;  4PK1 A;  4MH8 A;  4W9F A;  2D07 B;  2D10 A;  3DBR B;  4HCP B;  1WJN A;  4FJV B;  1EF5 A;  1GAQ B;  1E7V A;  5GMV A;  4MT5 A;  1XO3 A;  2RMM A;  1FRD A;  3NY5 A;  1XEE A;  4LNO A;  4XWT A;  1JWM D;  5D94 A;  4M01 A;  4KX6 B;  2WNM A;  4NJ6 A;  1JQ4 A;  3WAL A;  2BYF A;  3RNB C;  3AU5 A;  1WX8 A;  1C4A A;  2V3S A;  4AS1 A;  3I9V 1;  3UGB B;  3WCQ A;  2DYM A;  3HUI A;  3VR8 B;  3BZD B;  4HRS A;  3AE4 B;  3RT3 B;  5J18 A;  2WQY B;  1N5X A;  4KIK B;  3DWM A;  3Q3N C;  3Q69 A;  3OG5 A;  5CHW A;  4AQ7 A;  4WJN A;  2KC1 A;  2N9K A;  2XEW A;  3UF8 A;  2ON8 A;  4DDI D;  2PIA A;  1YN3 A;  1VRA B;  3B2G A;  3M95 A;  4B6W A;  1HXY D;  3U2S C;  2JWZ A;  2HD5 B;  4J3O D;  5I4D A;  2K39 A;  4NPN A;  4AUQ C;  4HJG E;  3V05 A;  2KAC A;  1T0S C;  2KQ7 A;  3MHS D;  3A9K B;  2V3P A;  4GOC A;  2MBH A;  1E8Z A;  4ZRJ A;  2L7R A;  4JL9 A;  1WGK A;  4L23 A;  1T0R C;  1I4G A;  1YOV B;  3KLS X;  4KDI C;  3I57 A;  5EE9 A;  4OHJ A;  4WWM A;  1WXM A;  2A4Z A;  1YMH E;  2CS4 A;  2PJH A;  2JWU A;  2L3Z A;  2GLS A;  2BS2 B;  2MLB A;  1BUI C;  1L5P A;  4G3X B;  3QQ8 B;  2RSU A;  4XC2 A;  1WH3 A;  5HG2 A;  2N9L A;  1UUP A;  2K22 A;  2WXK A;  1RAX A;  1IBX B;  1PFD A;  3DHI C;  1JW9 D;  1C79 A;  2DWQ A;  3I3T B;  3CMM B;  1V2Y A;  4ASW C;  3AH7 A;  4AOF A;  2MEK A;  1V5O A;  4IOI E;  1TKE A;  1WR1 A;  3AM9 A;  4B0E A;  3N1Y C;  4AJW A;  4XGA B;  2W3R A;  3B1L X;  3JSV A;  1LQB A;  3PLU A;  2J52 A;  1OQY A;  1GB4 A;  1SE4 A;  4CYE A;  2DEN B;  4USA A;  3U8Z A;  4W9L A;  1GJZ A;  1T0Q C;  4OZA A;  1ZDV A;  4IUM B;  4FBJ B;  3A33 B;  5CHV C;  2QHO A;  4OVV A;  4RF1 A;  3OWE B;  1CJE A;  3L08 A;  5EE0 A;  3QAR A;  4HPP A;  2HJ8 A;  3PTF C;  3ENE A;  1TKG A;  2K6Q A;  3B08 A;  1WGG A;  4KGS A;  4LDT D;  2H88 B;  2C5L C;  3NS1 A;  1E0Z A;  5BO4 B;  1FIQ A;  3BIN A;  4URK A;  3CIR B;  4HKZ E;  1F0Z A;  3SFE B;  2BF8 B;  3A9J B;  2WDV B;  1UBI A;  3HHM A;  1HA5 A;  3HK0 A;  1GNU A;  4REZ A;  1YN5 A;  4TKN A;  3MP9 A;  3P4Q B;  3KW5 B;  2GI9 A;  5GXG B;  4EKU A;  3AEC B;  2G9H D;  3L10 B;  1I4R A;  3FIL B;  3N32 A;  1QOG A;  3RNG C;  1LO5 D;  1PGA A;  3R3M A;  3AMZ A;  2CJO A;  4QAY A;  2M56 B;  4NAW A;  2INN E;  2KD0 A;  4YT0 B;  2Z0E B;  2A5U A;  1OEY A;  1K53 A;  2QMT A;  3AEG B;  1JRP A;  3X0W A;  1WZ3 A;  3ZNI D;  3A4S C;  3HVZ A;  3ONS A;  3R2T A;  3ZYY X;  2D11 A;  4IG7 B;  4XZ4 A;  2KK8 A;  1QLB B;  2JY6 A;  1PQS A;  2RPQ A;  1EUV B;  1ET6 A;  1ENF A;  2EMS A;  2C9W B;  2LVQ A;  5E6N A;  5D3D A;  5LNK 1;  2JU6 X;  1VZ7 A;  1V1P B;  2C7M B;  2IO2 B;  4P1B C;  2AQ2 B;  1JWU D;  3WIM A;  3AEB B;  1XQQ A;  1ZUD 2;  4AWJ A;  3EC8 A;  5BYS A;  1SXT A;  2WGS A;  3Q3M C;  1QKZ A;  2L32 A;  1TIF A;  2AL3 A;  4KV2 A;  3GP7 A;  4WUR A;  4GGQ A;  4XDD A;  3BYY B;  5C2T B;  3DBL I;  2INP E;  3B0A A;  3TUO A;  3BY4 B;  1WGD A;  2YEP F;  3PO0 A;  3P4R B;  2N9E B;  2PLP A;  3MFG A;  1FEH A;  2C7N B;  3ZO5 B;  3URY A;  1QOF A;  1EU3 A;  2M8S A;  4RM8 A;  4P16 A;  3U52 E;  1JCK B;  4A3O A;  2D3G A;  2KDE B;  1XXG A;  2MJE A;  2KNB A;  1U4A A;  3APF A;  3Q14 C;  1FNV A;  1EU4 A;  1SE9 A;  2WU5 B;  1TY2 A;  1TGZ B;  1WXQ A;  5CX3 A;  5FR6 A;  3RD2 A;  1M94 A;  1RFK A;  4HVB A;  1JML A;  2IGH A;  1ET9 A;  2D5G A;  2GBJ A;  2KFK A;  3PS6 A;  1D5M C;  2GOW A;  3KUC B;  3MC0 B;  4GDK A;  4KZ0 A;  1XT9 B;  4M0W A;  1I7H A;  1SIJ A;  3R8B A;  4ZYS A;  3NRZ A;  4GDL A;  2EMT A;  4DHZ E;  2JX5 A;  3IT4 B;  3AEE B;  4I6L B;  2KMC A;  4W9J A;  4DXG A;  1IP9 A;  1FO4 A;  2KWU B;  3RI7 C;  4XDC A;  5C1Z A;  4MSQ B;  3TMP B;  2PVO D;  1HZ6 A;  1YD8 U;  5T8I A;  3AEA B;  2FIF A;  2ZNV C;  2BYT A;  1ZW7 A;  4L1B A;  2IJ0 A;  1V49 A;  2J53 A;  3W9C B;  3H7P B;  1GB1 A;  4W9E A;  3KWL A;  2HTH A;  1QT9 A;  2R2Q A;  2IY0 B;  1R4M I;  3RUL A;  4GLS C;  4FHK A;  3Q8E A;  3L13 A;  1D6E C;  1FRR A;  4XYC A;  1H7X A;  2K25 A;  3E56 A;  3NVZ A;  2LXA A;  3Q3F A;  5AEK B;  3U4E G;  3V6E B;  3ML9 A;  4MJS A;  1UNS A;  2NPT B;  1TZ1 A;  2KXJ A;  4JX1 C;  4P6V F;  1I4H A;  3SDL C;  1R4M B;  4B0M A;  2Y5C A;  1TT5 B;  1DOY A;  2KQS A;  1GTH A;  2FCM A;  4O1N A;  2WXF A;  4W9G A;  3WAN A;  5JHB A;  2DBY A;  3WAP A;  2ZPN A;  2WU2 B;  4I6N B;  2IDY A;  4FJZ A;  3SHQ A;  2IYD B;  2BQQ A;  3AE5 B;  4HCN B;  2PE6 B;  4RGN A;  3RNF C;  1FFV A;  4Q2J A;  3LYY A;  3PZ7 A;  2LFI A;  2MX2 A;  3UIN B;  3BVZ A;  1GG3 A;  4RGO S;  1XD3 B;  3B9J A;  4YSY B;  2CU3 A;  2DZK A;  1I42 A;  2LXC A;  3GS2 A;  3VH3 B;  3N1X C;  1VDV A;  2GMI C;  1CQV A;  3ZDT A;  2KO3 A;  3KVF B;  3O65 B;  4ZRI A;  3IVF A;  1Q1O A;  1R7S A;  1J19 A;  2V3N A;  1KJT A;  4HKQ A;  4A8X C;  1CK1 A;  2L76 A;  5H8Y E;  1YQB A;  1WJU A;  2OED A;  5D6J B;  4NY0 A;  2O6V A;  1DOX A;  4W9D A;  3AEF B;  2O2V B;  2V4I B;  1UD7 A;  2M0A A;  5KHO A;  4DXA B;  2MBB B;  4PS8 A;  2IZV B;  3AE6 B;  2QSD A;  2N7D A;  1YX6 B;  5HKH A;  2BGF A;  3MJ5 A;  3TEW A;  5LXH A;  3AU4 A;  1NBF C;  1J0G A;  2LUM A;  2M0X A;  1WM2 A;  4HRO A;  3V3X A;  4FHJ A;  4K3B A;  4JGH B;  3ZJT A;  2SAK A;  3ABV B;  2JZ3 B;  4NJC A;  1L6V A;  1WI0 A;  2IO1 B;  1TS4 A;  3Q8A A;  1PGB A;  2KAN A;  2PPH A;  3T3N A;  3NS8 A;  4ANV A;  3H9D A;  4EZJ A;  4LNN A;  3TBL D;  1E7P B;  3NJT A;  4NNJ B;  4ANX A;  3FC4 A;  1D4B A;  2GBM A;  4W9K A;  3I63 C;  3UIP B;  4DQO C;  2CJN A;  3AE2 B;  3CF4 A;  1WY8 A;  3HIZ A;  3RUI B;  1F9J A;  3W5U B;  1RM6 C;  1Q10 A;  2K1F A;  3IHP C;  1FNW A;  4HDQ A;  1L0X B;  1C76 A;  4P7I A;  2N1V A;  2ZVO A;  1P7E A;  2HDE A;  2WDT B;  1NI2 A;  2KYW A;  1C1Y B;  1WJ4 A;  4IM0 A;  1JAL A;  3TSS A;  4S17 A;  2BS3 B;  4PYZ A;  1WMH A;  3WA0 A;  1KRH A;  2IND C;  4DHJ D;  4FAD A;  4E74 A;  5AZH A;  2ZJD A;  2JSV X;  3UQA A;  4GXB A;  2L52 A;  3ZNG C;  4P1C C;  3L0W B;  3TCA A;  1KOT A;  3AE8 B;  3K9P B;  4J6I A;  2JRI B;  2IO0 B;  2OHF A;  3DOW A;  1UWM A;  4N9F 4;  2QCZ A;  1RRB A;  2N7E A;  5IN7 A;  4BBN C;  1WRD B;  3V61 A;  1HTO A;  2CHW A;  2KVZ A;  1YIW A;  1JWB D;  3O13 A;  1UWX A;  2L0F A;  3ZVV A;  2CR5 A;  1FMA D;  2V4L A;  1JWS D;  3VRA B;  1F52 A;  2KT7 A;  2FCQ A;  3RZF A;  1B1Z A;  1VJK A;  4LLG M;  2PW9 A;  3D32 A;  1EWY C;  4R3D A;  2PMV A;  3PZD A;  2NTS A;  5EE3 A;  2INC C;  4K7U A;  5C3J B;  2N9P C;  1E8W A;  1XCQ L;  2AWT A;  2W3S A;  4A55 A;  1KF6 B;  1BML C;  1C78 A;  4IWP A;  3OLM D;  2I2Y A;  1WXS A;  1MVK A;  4N6E B;  4G50 A;  3C8Y A;  3I5J C;  1DOI A;  4IWO A;  2K8C A;  2JXX A;  1SF0 A;  4IM2 A;  5CTR C;  4WJO A;  2KX0 A;  2K0P A;  4OZB A;  3PV1 A;  2MRP A;  1WIA A;  1UGM A;  5DPR A;  3V60 A;  2J42 A;  2N0S B;  1J7C A;  2KJH B;  3A1Q A;  4XWW A;  4OVZ A;  1KTK A;  3FKY A;  1OQR A;  2HTM E;  2KLG A;  5IP4 D;  3ZGZ A;  1JRU A;  4JQW C;  3ZNZ B;  3Q8B A;  3PRP B;  5IOI A;  3ECI A;  2JF5 A;  3CSF A;  1GT8 A;  1EF1 A;  3AN1 A;  2JUO A;  1QOB A;  2W54 A;  1D3Z A;  1WE7 A;  5G5H A;  2WWZ A;  2GBK A;  2FCN A;  4IKG A;  2JZP A;  1P9D U;  2LHE A;  1C3T A;  1NI3 A;  2CHX A;  1AAR A;  3RNC C;  1PDX A;  5JXV A;  4KGR A;  4EZL A;  3KUD B;  4S0R A;  4RFB A;  5FKA C;  4F7Z A;  1FM0 D;  2W82 A;  4HLE A;  3W5V B;  4GU2 A;  2QEJ C;  4TMA B;  1SEB D;  2WLB A;  1LFD A;  3HM3 A;  1GC7 A;  2KLC A;  1SJH D;  4ZYN A;  4A90 A;  5IO9 A;  3RYT A;  1MFW A;  3RMK C;  2KTF A;  1VD2 A;  2BS4 B;  2KWD A;  2ZCB A;  3K9O B;  4C7Y A;  5BMI A;  3GE3 C;  1K8R B;  1VZ6 A;  4JWU C;  1V80 A;  4OW0 A;  2M19 A;  3IBE A;  4YSZ B;  4TUU A;  1F77 A;  1V86 A;  5G55 A;  4I6P A;  2NVU I;  5IA7 A;  1C9F A;  2DAF A;  2JRH A;  4AJY B;  4ARI A;  4DWF A;  2LMC A;  1VLB A;  1YQ4 B;  3V62 A;  2XNA C;  3C19 A;  3QK0 A;  4DBG A;  1XCT L;  4EFO A;  4NJ7 A;  1PYW D;  5G5G A;  1Z5S B;  4LJP B;  4WH4 A;  4RMA A;  3ZJV A;  1C4C A;  1WGR A;  4DHJ B;  2PE9 A;  2V1Y A;  4NAM A;  2MW5 A;  2G45 B;  1ZP0 B;  3ZQ4 A;  1GC6 A;  4HJK A;  3PLV A;  2ZNV B;  3PRE A;  3QC8 B;  4DXF A;  1WE6 A;  1FCL A;  4PS3 A;  2HE7 A;  2ZW1 A;  3N3K B;  5L83 A;  4PT5 A;  1SBB B;  1TS5 A;  4NQK E;  1OQQ A;  1L0V B;  4IDI A;  1DYQ A;  1V6E A;  4C4V A;  1TTN A;  2DNF A;  3JSV B;  5D7G A;  5AUI A;  3P4P B;  2AX5 A;  1CZP A;  2WXL A;  1I4X A;  3N20 C;  2B76 B;  1L0Y B;  2MHJ A;  3VH4 B;  1UZX B;  1N62 A;  2FCS A;  2KTR A;  3LB8 C;  5DPS A;  4MDK E;  3PHX B;  2LI5 A;  2FE8 A;  1B9R A;  2K9X A;  2Y5P A;  4B95 A;  1WF9 A;  2WX1 A;  3QX1 A;  1X1M A;  2XK5 A;  3DBL B;  4KZC A;  3W1S A;  3VTU A;  4RH6 A;  2AL6 A;  3OAW A;  3IXS A;  2BB6 A;  4BZA A;  3ZIM A;  2LRU A;  4KVG B;  1P7F A;  4ZRK A;  2WX0 A;  3PVL A;  3M62 B;  3KYD D;  2PEA A;  4C56 C;  2BB5 A;  3MTN B;  1NDD A;  2VZK B;  3QIJ A;  3EHV A;  4ICU A;  4HWI B;  2EEL A;  1YQ3 B;  2CU1 A;  1I4P A;  1Q0W B;  1K50 A;  4WQO B;  4M02 A;  2K3U A;  2K6D B;  4N58 A;  2M4N A;  3GB1 A;  2QJL A;  2B3A A;  4TSS A;  1N63 A;  4WJP A;  3CF6 E;  2H89 B;  1ZPS A; 
#chains in the Genus database with same CATH homology
 1TKY A;  3AEF B;  1T3Q A;  2V3P A;  2RDG A;  2QIE B;  3VRB B;  2V4I B;  2Z8L A;  1M4V A;  2M0A A;  1NYQ A;  1WGK A;  4L23 A;  1I4G A;  4CQN A;  3U7Z A;  3KLS X;  5H92 C;  3AE6 B;  3VR9 B;  3I57 A;  4NAW B;  5EE9 A;  3AE1 B;  4OHJ A;  4WWM A;  3DWG C;  2QSD A;  1UGJ A;  2L1A A;  1N5W A;  1YMH E;  2LGI A;  3MJ5 A;  3TEY A;  1TY0 A;  2JWU A;  3TEW A;  1FXI A;  4FXC A;  4JE3 B;  4WAF A;  2LUM A;  3ETR A;  4HRO A;  3V3X A;  2BS2 B;  4ZHP A;  3IAM 1;  1BUI C;  3FAH A;  5D3I B;  1L5P A;  1WSP A;  3ZJT A;  2SAK A;  1H7W A;  3ABV B;  1HQR D;  2WP9 B;  2LHD A;  4NJC A;  1L6V A;  4C80 A;  4RNA A;  1D5X C;  1TS4 A;  3Q8A A;  5HG2 A;  2N9L A;  1KFY B;  1PGB A;  1UUP A;  3T3N A;  2K22 A;  2WXK A;  1D4B A;  1E7P B;  3FC4 A;  2WXR A;  4DQO C;  1IBX B;  1PFD A;  2CJN A;  1MHX A;  4N59 A;  1VR9 A;  2G1E A;  3AE2 B;  1JW9 D;  3CF4 A;  1C79 A;  3T3O A;  1FCC C;  2DWQ A;  2JYT A;  2L83 A;  3W5U B;  1JWA D;  1RM6 C;  2WXN A;  3AH7 A;  1Q10 A;  3VQI A;  2MEK A;  1FNW A;  4IOI E;  1L0X B;  1TKE A;  1C76 A;  1I4Q A;  1F2R I;  1P7E A;  2HDE A;  2E3T A;  1T5X D;  1SB3 C;  3AM9 A;  3HRD D;  4B0E A;  4JWS C;  4A9A A;  2DLB A;  1BXT A;  1JAL A;  1QQR A;  3TSS A;  2W3R A;  1AN8 A;  2BS3 B;  1KRH A;  2J52 A;  4ITK A;  1GB4 A;  1SE4 A;  1NEN B;  4USA A;  1XLQ A;  1SJE D;  1NEK B;  2KQ4 X;  2JSV X;  3P63 A;  2L52 A;  4OZA A;  1ZDV A;  4UDU C;  1J7A A;  3AE8 B;  2WXH A;  5MPO A;  2WXQ A;  1IUE A;  1PUT A;  1ZE3 D;  4ZRQ A;  4RF1 A;  4US9 A;  5BMH A;  2OHF A;  3OWE B;  2YEP B;  1CJE A;  2KN4 A;  3TEX A;  1UWM A;  5EE0 A;  1C77 A;  3IAS 1;  3AED B;  4GDK B;  1AYF A;  4WQM A;  4WIP A;  3MHZ A;  3W2D A;  4GDL B;  3AE7 B;  1TKG A;  2K5P A;  1JWB D;  1QOA A;  4KGS A;  1GPX A;  2H88 B;  3O13 A;  3B2F A;  1UWX A;  3NS1 A;  1E0Z A;  1FMA D;  1FIQ A;  2R61 A;  3CIR B;  4HKZ E;  3NVY A;  3RPF C;  1F0Z A;  1K51 A;  3SFE B;  4YTP B;  1OFF A;  1N61 A;  1JWS D;  1YJI A;  3VRA B;  1B1Z A;  1VJK A;  4LLG M;  3NVV A;  2WDV B;  1NVI D;  2TSS A;  2PW9 A;  3Q8C A;  1EWY C;  4R3D A;  1HA5 A;  1L4Z B;  2Y3A A;  1Y56 A;  2PMV A;  4REZ A;  2NTS A;  1YN5 A;  5EE3 A;  4ZHO A;  1A70 A;  5C3J B;  3L4P A;  3MP9 A;  3P4Q B;  2WXM A;  5AUK A;  2GI9 A;  1XCQ L;  2W3S A;  2BT6 A;  4RCO A;  4XE0 A;  1IGC A;  5GXG B;  3NUH B;  3CWI A;  3AEC B;  1KF6 B;  2G9H D;  2AQ1 B;  1BML C;  1C78 A;  1T6B X;  2JYE A;  2SEB D;  1I4R A;  1TS2 A;  1ZXH A;  1QOG A;  3FIL B;  4MAC A;  4RF0 A;  2I2Y A;  1SSN A;  1LO5 D;  1MVK A;  2MJ3 A;  4N6E B;  3NVW A;  4RGM A;  1PGA A;  3C8Y A;  2CJO A;  3AMZ A;  4YXD B;  2M56 B;  2INN E;  1DOI A;  1FXA A;  3KQ4 A;  1MI0 A;  3P42 A;  1GTE A;  4YT0 B;  1K53 A;  2QMT A;  4ARC A;  3AEG B;  1JRP A;  1SF0 A;  1TYG B;  1ESF A;  1TS3 A;  2KAJ A;  2K0P A;  4OZB A;  5EE1 A;  3AE9 B;  3HVZ A;  3TEZ A;  2J4X A;  1ZXI A;  3R2T A;  4TQ1 A;  3ZYY X;  1HEZ E;  4KKJ A;  1QLB B;  3SEB A;  1ET6 A;  2J42 A;  2N0S B;  1J7C A;  1ENF A;  3BK1 A;  2I38 A;  3NZ3 A;  3P1M A;  2MH7 A;  2DYO A;  2JQR B;  3BWU D;  5D3D A;  4XWW A;  4OVZ A;  1KTK A;  3N9Y C;  2JU6 X;  5LNK 1;  1OQR A;  2HTM E;  1F2R C;  1VZ7 A;  1YNT E;  1V1P B;  3ZGZ A;  2AQ2 B;  1JWU D;  3Q8B A;  2ZW0 A;  3AEB B;  1V1O A;  1E6E B;  1YN4 A;  1ZUD 2;  5FK9 C;  3SR6 A;  3RFZ B;  1IBX A;  5BYS A;  1GT8 A;  1SXT A;  3SFD B;  3BVG A;  3AN1 A;  1XLO A;  2PVG C;  1QOB A;  1QKZ A;  3AV8 A;  3IT6 B;  2W54 A;  4KKI A;  2L32 A;  4US8 A;  1PGX A;  3GP7 A;  5G5H A;  4WUR A;  4XDD A;  3BYY B;  5C2T B;  4IKG A;  1MPE A;  2JZP A;  1WRI A;  2PTL A;  1KLG D;  4YSX B;  2LHE A;  2INP E;  1NI3 A;  3TUO A;  1PDX A;  2YEP F;  2BW2 A;  4KGR A;  5JXV A;  3PO0 A;  3P4R B;  4RFB A;  5FKA C;  2PLP A;  1FM0 D;  3MFG A;  2W82 A;  2EKI A;  1FEH A;  3W5V B;  1FFU A;  1C4P A;  2RDH A;  3URY A;  1QOF A;  1EU3 A;  4P16 A;  3U52 E;  2QEJ C;  1JCK B;  2MJD A;  3LXF A;  4TMA B;  2WDR B;  2KMM A;  1XXG A;  1SEB D;  2MJE A;  2WLB A;  2GB1 A;  2JXT A;  2WXI A;  1ACC A;  1FNV A;  1EU4 A;  2WU5 B;  1TY2 A;  1SJH D;  2E6X A;  1WXQ A;  4A90 A;  2GRI A;  2NTT A;  1RFK A;  1JRO A;  1JML A;  2IGH A;  1ET9 A;  2D5G A;  2BS4 B;  1XLN A;  5BMG A;  2WXG A;  1D5M C;  1DGJ A;  2KWD A;  1QF6 A;  4OZC A;  3MC0 B;  3UI3 A;  4C7Y A;  2ONQ A;  4C7Z A;  2QIL A;  5BMI A;  2LEK A;  3KWV A;  4M0W A;  1I7H A;  1SIJ A;  3BVM A;  3R8B A;  1RYJ A;  3NRZ A;  4ZYS A;  1N60 A;  1E10 A;  1WYG A;  1VZ6 A;  3EA6 A;  1HZ5 A;  4JWU C;  4OW0 A;  2JX5 A;  2M19 A;  3AEE B;  3IT4 B;  2V0G A;  1XF5 L;  4DXG A;  4YSZ B;  2XN9 C;  1F77 A;  1RWS A;  4HEA 1;  4TQ0 A;  1FO4 A;  4YTM B;  2Q5W D;  1ZOY B;  3H8H A;  1C9F A;  2PKO A;  4XDC A;  4LK0 M;  1TJE A;  2X38 A;  2PVO D;  4ARI A;  1HZ6 A;  1V8C A;  2LMC A;  5HI1 A;  5T8I A;  4A6Q A;  3AEA B;  1VLB A;  1YQ4 B;  2BYT A;  4NZL B;  4ZOH C;  4L1B A;  1FD6 A;  2XNA C;  1L4D B;  1FNU A;  2IJ0 A;  2J53 A;  5BYQ A;  3W9C B;  1XCT L;  1GB1 A;  2NMQ A;  1PYW D;  2WXP A;  3KWL A;  1K52 A;  3R2I A;  3HVD A;  1QT9 A;  2BTE A;  1EWC A;  1SE3 A;  5G5G A;  4GLS C;  4WH4 A;  5FR3 A;  4KGT A;  3Q8E A;  4EE2 A;  1D6E C;  1FRR A;  1IGD A;  3ZJV A;  1NYR A;  1C4C A;  1KLU D;  1H7X A;  1V97 A;  4NAM A;  1MHH E;  4D2K A;  2VZK D;  3E56 A;  4YWG G;  3FIL A;  1J7B A;  3NVZ A;  4MM3 B;  1ZP0 B;  3ZQ4 A;  3EUB 2;  2BBC A;  1YJJ A;  4JPS A;  3U4E G;  1KH0 A;  1UNS A;  5BYR A;  4JX1 C;  4DXF A;  2WXJ A;  1FCL A;  4P6V F;  2WS3 B;  1I4H A;  2LJI A;  2KDM A;  2ZW1 A;  1QIL A;  3BYT B;  4B0M A;  2Y5C A;  3E9S A;  1D5Z C;  2AQ3 B;  1DOY A;  3BII D;  4PT5 A;  1SBB B;  1TS5 A;  1AW7 A;  4A55 A;  1GTH A;  1OQQ A;  1L0V B;  4IDI A;  4O1N A;  3Q8F A;  3ZJU A;  5TSS A;  1DYQ A;  1WWT A;  3PZ8 A;  2WXF A;  4MH8 A;  2DBY A;  1VZ8 A;  5D7G A;  5HHD G;  5AUI A;  2WU2 B;  3P4P B;  2IDY A;  2AX5 A;  1CZP A;  2WXL A;  1GAQ B;  1I4X A;  1V1P A;  5HFY A;  2B76 B;  3AE5 B;  1L0Y B;  4YTN B;  2RPV A;  4RGN A;  1ZDX A;  2N7J A;  1N62 A;  1FFV A;  4MT5 A;  1XO3 A;  1L6U A;  1FRD A;  2RMM A;  3LB8 C;  4Q2J A;  4ZRP A;  1XEE A;  4RGT A;  1GOZ A;  4XWT A;  1JWM D;  3LYY A;  3PZ7 A;  2FE8 A;  3EGR A;  1B9R A;  2LFI A;  2K9X A;  4KX6 B;  2WNM A;  1STE A;  2W55 A;  2Y5P A;  3AE3 B;  1JQ4 A;  1EM7 A;  3W1S A;  2WXO A;  3BVZ A;  2FBW B;  4RGO S;  3B9J A;  4YSY B;  2CU3 A;  4RH6 A;  1C4A A;  4LTU A;  4AS1 A;  2ACZ B;  3I9V 1;  3IXS A;  1E9M A;  1XLP A;  3GS2 A;  2BB6 A;  3P4S B;  3WCQ A;  2DYM A;  3HUI A;  3VR8 B;  1VDV A;  3BK2 A;  3BZD B;  4HRS A;  3AE4 B;  3J9C A;  1CQV A;  2FUG 1;  1P7F A;  3AB5 A;  2WQY B;  1ROE A;  5E6J A;  1N5X A;  3DWM A;  3Q69 A;  4C56 C;  2BB5 A;  4AQ7 A;  1R7S A;  2N9K A;  2VZK B;  2V3N A;  2ON8 A;  1AWD A;  2EEL A;  1YQ3 B;  2PIA A;  4HKQ A;  4A8X C;  1YN3 A;  1I4P A;  1VRA B;  3B2G A;  2ICI A;  1K50 A;  2IPK D;  1CK1 A;  1SE2 A;  1HXY D;  5H8Y E;  3U2S C;  4J3O D;  2K3U A;  5I4D A;  4L2Y A;  2OED A;  2IGD A;  4N58 A;  2IGG A;  3GB1 A;  2QJL A;  4HJG E;  3V05 A;  4H2A A;  2KAC A;  4TSS A;  1N63 A;  1DOX A;  2H89 B;  1TZO A;  2WDQ B;  1ZPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...