2BS4B

Glu c180 -> ile variant quinol:fumarate reductase fromwolinella succinogenes
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUINOL-FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A
publication title Experimental Support for the E-Pathway Hypothesis of Coupled Transmembrane Electron and Proton Transfer in Dihemic Quinol:Fumarate Reductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 239
sequence length 239
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2bs4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bs4B01
2WP9B 1VJKA 5EE9A 3SFEB 2M56B 5H8YE 3LXFA 3P4SB 1N60A 1QOBA 1ZXIA 2MJDA 2WQYB 3W5UB 1WYGA 1NEKB 3PO0A 1V8CA 2W55A 1SF0A 1WXQA 4YXDB 4JWSC 1UWMA 2G1EA 2W3RA 4HRSA 5G5GA 3DWMA 3P4QB 1ZP0B 2BS3B 2PKOA 1YQ4B 2EKIA 1AWDA 4FXCA 3AEDB 4N58A 1E0ZA 1JW9D 2B76B 1V97A 4C80A 3P1MA 1WGKA 1OQRA 1FIQA 2H89B 1YJIA 2MH7A 5H92C 1QLBB 1JQ4A 4YTMB 1JRPA 2JX5A 2E3TA 1TJEA 3AN1A 2WS3B 1NYRA 1CZPA 4A9AA 1RFKA 1N5XA 3LB8C 2BS4B 1FM0D 2CJOA 1GPXA 1FO4A 2K9XA 4ZOHC 3CF4A 5EE1A 2CJNA 1XLPA 3P4PB 4LTUA 1VDVA 2WU2B 1JWBD 2WDRB 2K5PA 3B9JA 4USAA 1DOXA 1KF6B 1FMAD 5EE3A 1AYFA 1QOFA 1B9RA 1NENB 3AMZA 3KWLA 3AE7B 3DWGC 5EE0A 3VRAB 1FRDA 1L6UA 3SFDB 1WRIA 1J7CA 2CU3A 2DWQA 3BIID 4P6VF 3NVVA 1OFFA 3RPFC 3W5VB 5GXGB 2ACZB 1XLOA 1N61A 2JQRB 3AE8B 1FFUA 1RM6C 3CWIA 1KRHA 1TYGB 3NRZA 1E10A 1N63A 1T3QA 3AEEB 3ETRA 1QF6A 1VLBA 1ZUD2 3B2FA 2M19A 3HUIA 1XO3A 3AEAB 2W54A 1E7PB 4YT0B 1QT9A 3WCQA 1SB3C 4ZHPA 1ZOYB 1L5PA 1YJJA 3NS1A 1XLQA 1H7WA 1FRRA 3W9CB 3AE3B 2MJ3A 2W3SA 4US9A 1L0VB 1JALA 4HROA 1DOIA 2H88B 2WLBA 1JWAD 1QOGA 4N59A 1JROA 3AH7A 3VR9B 1NYQA 4JX1C 3SR6A 1GT8A 1I7HA 2BS2B 3VR8B 1XLNA 5AUIA 2KAJA 2Q5WD 3AE5B 1GTHA 2HTME 3AE9B 2WU5B 1TKYA 2PVGC 1PUTA 3AB5A 2OHFA 2WDQB 3NVWA 1NI3A 3HVZA 1R7SA 2L52A 2BT6A 5AUKA 3ABVB 1QOAA 1FXIA 1TKEA 1OQQA 3ZYYX 4WQMA 2MJEA 2L83A 1SIJA 3HRDD 3AEBB 1IUEA 3AEGB 1N62A 1KFYB 4YSYB 1YQ3B 1WWTA 4ITKA 1EWYC 1H7XA 4YSZB 1PDXA 5C2TB 2K22A 2FBWB 1TKGA 4ZHOA 1RWSA 1FFVA 1NVID 2QIEB 4IDIA 1DOYA 2WDVB 1FXAA 3AM9A 3NVZA 2LEKA 3NVYA 4YTPB 3B2GA 3CIRB 3FC4A 4C7YA 1GAQB 3FAHA 4YTNB 1N5WA 4WWMA 3AE2B 2N0SB 2PVOD 4N6EB 1ROEA 2QJLA 1PFDA 3AEFB 4US8A 3AE1B 1J7AA 1GTEA 1E6EB 1L6VA 3AE6B 1J7BA 3AV8A 4C7ZA 2PIAA 2Y5CA 1A70A 1DGJA 4YSXB 3AE4B 5C3JB 3EUB2 1E9MA 5G5HA 3P4RB 3L4PA 3P63A 1F0ZA 4JWUC 3VRBB 2KMMA 1RYJA 4KX6B 1CJEA 3AECB 5MPOA 2AX5A 2DBYA
chains in the Genus database with same CATH superfamily
3PHWB 3H1UA 1VJKA 4W9IA 1IGCA 5TSSA 2UWQA 3ZNGC 1V8CA 1FXTB 2NTSA 3RYTA 2KO3A 1HTQA 3BWUD 2EKIA 4GDLB 1ESFA 2M0XA 4C80A 1YJIA 3N3KB 3N30A 3DHGC 2X8XX 1XD3B 2GBNA 1TJEA 2DHZA 3Q8BA 1F1HA 1MHHE 1KM7A 3M63B 4BOZB 1IPGA 4ASWC 2LFIA 3P4PB 5DPWA 3DDCB 5J18A 3TEWA 3GZNI 4DQOC 1EF1A 2JRIB 2V4LA 1G6JA 2INCC 3KYCD 4IM3A 3T8MA 3PLVA 4MELA 3W5VB 3DPDA 1E10A 5HG2A 4OVZA 5FK9C 2FUHB 2LGXA 2BWFA 3AXCA 1FCLA 2LVOA 2MWSB 3V05A 2WXHA 3W1SC 1UZXB 3C0RB 1XLNA 3AULA 4K7WA 3WANA 3KWVA 2WU5B 3MHSD 4P1BC 2WYQA 3HVZA 2C9WB 4LDTB 4XWWA 1XT9B 4HKZE 1KFYB 3BINA 3U4EG 2K0PA 4A3PA 2BTEA 4DHJD 1F9JA 3EECA 2KFKB 4BFRA 1YQBA 3CIRB 4KZ0A 1PGAA 4YTNB 2Y5CA 4M0WA 3OJ4B 3GP7A 3R2TA 1GOZA 1L0YB 5BMHA 4FBJB 4WAFA 2ZPYA 1WXQA 3O65B 5DPTA 1YQ4B 3AEDB 3MHZA 2DX5B 4W9HA 1CK1A 2KTRB 3CSFA 1WX8A 3GB1A 2HD5B 2J53A 1XQQA 3V3XA 4RCOA 2CJOA 2V3NA 3ZRCA 2K8HA 4AS1A 4XZ4A 4LTUA 1WR1A 5C23A 3L54A 2GMIC 4B95A 1V5OA 3B9JA 2KDBA 1DOXA 1RLFA 2O2VA 2LGSA 3OJ3A 3T3OA 3APDA 3PSEB 1J7CA 4WJQA 4RF1A 2O6VA 1FFUA 1WGDA 1KRHA 1YX5B 3V61A 1V9JA 3Q14C 4NJ7A 1ZOYB 1YJJA 5AZHA 3APFA 3Q3OC 4MH8A 3SU8X 4CQNA 3UQAA 2H88B 1QOGA 3AH7A 4JIOU 2KOXA 1GT8A 2FE8A 2KAJA 3HK0A 5EDSA 2YEPB 2UU7A 1PUTA 4XYCA 2ZNVB 4I6LB 3DHIC 1R4MI 4NNJB 1PYWD 4YSYB 1C77A 2MBHA 3A9KA 3KW5B 3A1QA 2JRHA 2DZMA 2WX0A 2DYBA 4C7YA 1WJUA 1SXTA 2BVCA 2QHOA 4EZJA 3AU4A 2O6VD 1DGJA 4DHZE 4JWUC 2KYWA 1C4AA 5EE9A 4C4VA 2Z59B 1I4QA 2BW2A 3ECIA 3NZ3A 3PLUA 2J7QB 1WX7A 1Q1OA 3NZSA 1ZP0B 2D3BA 4HJGE 2JWUA 2KVRA 4TSSA 4HCPB 2L76A 1JW9D 2B76B 1VZ6A 2FUG1 1B1ZA 1CZPA 4E3CA 5D7GA 3ZRFA 1YJ1A 5CHWA 1VD2A 4GU2A 5BMIA 4NPNA 1FMAD 3R7QA 3Q3NC 3ALBA 2BGFA 4DHJB 3AE7B 1JWSD 3VTWA 1GC7A 1WMHA 1K8RB 1IYFA 2MX2A 1QF6A 3KYDD 3ZQ4A 1LQBA 3TIXA 3VH3B 3R8BA 3WCQA 2VZKD 3ZJTA 3W9CB 1H7WA 1T6BX 4GIVA 2KC2A 1EWCA 4ANWA 4JX1C 1I7HA 4IWOA 1LXDA 3RZFA 1GG3A 1P9DU 3DVGX 2DNFA 3VH4B 2SAKA 4LJPB 4TKNA 4ZRQA 2ZCBA 1D3ZA 2C60A 4GDKA 3ZNHB 3RULA 2KDEB 1SE2A 2AEHA 1HE8A 3FC4A 2N9LA 3R2IA 3HM3A 4NY0A 2PVOD 2QJLA 1GNUA 1QKZA 2AL3A 4US8A 2OEDA 3WAOA 2BBCA 1Y56A 2YLMA 3ZDMC 1MI0A 4AJWA 2JWZA 2D3GA 4M0WB 1SF0A 2NS5A 2IBIB 2W3RA 4TMAB 4W9CA 4WJPA 4XE0A 3QC8B 4DDID 1OQRA 2GBJA 3DVNV 3IG3A 4FJYA 1FCCC 4ACFA 1F2RC 2WS3B 1GUAB 2DYMA 1TT5B 4LNOA 1AARA 1V5TA 3B08A 3DVGY 1D5MC 1TZOA 3KWLA 2ON8A 1I42A 3Q8FA 1SE9A 4ANUA 4TUUA 2FAZA 2C7NB 1EF5A 2O2VB 2PMVA 1A5RA 1TYGB 3C19A 4W9FA 2NPTA 3B2FA 2O6VB 3AEAB 4BKGA 1LFDA 3TUOA 4XDDA 1IBXA 2D10A 2MJ3A 4WIPA 2VRRB 1EU4A 3IAS1 1NYQA 4GLSC 2NCNA 3PS6A 3WIMA 2HTME 4IOIE 1TS5A 1WGRA 5BO4B 1SBBB 3AB5A 2L05A 3NS8A 2WXKA 1I4RA 4TQ1A 5CX3A 3BZDB 1OQQA 2V1YA 2BYFA 4HEA1 4ITKA 2DAJA 2R2OA 4YSZB 5AEKB 2QMTA 2WDVB 3N1ZC 3A9KB 2AQ2B 1L4DB 2KJ6A 4DXFA 4HDOA 3A1QB 1PFDA 2N9PC 3MC0B 2JSVX 1HA5A 2I1KA 4FN2A 4H2AA 2AX5A 3PHXB 3X23A 2DLBA 3VUYA 5IOIA 4DDGD 2W55A 4HXDA 3P4QB 4C4VB 2WXIA 5E6OA 5AZFA 3H7PA 4LNFA 1FIQA 3V6CB 2E3TA 2HE7A 3V62A 2KQ7A 3RNBC 2JT4B 2L00B 5EE1A 3PGEA 2CHWA 1MPEA 2CJNA 3RNGC 2DYOA 2RD0A 2N1VA 1WXSA 3UI3A 1NENB 1XCQL 1FRDA 1D4BA 3SFDB 2CHZA 2W82A 4LDTD 3T3NA 4HVBA 3UINB 4KGRA 3PZ8A 1N63A 2KX3A 1WMHB 4CO7A 2KVZA 3ZNZB 1UBIA 1FD6A 1XLQA 2FCQA 4RFBA 2N1WA 2RMMA 4OHJA 1P7FA 2M8SA 4HJKA 4KSLC 4EE2A 3NUHB 3LYYA 4XDCA 3TMPB 1C76A 2MBQA 2KMCA 5HHDG 2LGDA 1TKEA 4M8MA 4N9F4 4ICUA 4BOSC 4URKA 2XNAC 1FNUA 2GOWA 3GOEA 4IDIA 4GDKB 3I57A 4J6IA 1GAQB 4N6EB 1NI2A 3AE1B 1J7BA 4JGHB 2D2QA 3K9OB 1A70A 4A55A 1VCBA 3L4PA 4I6NB 2KMMA 5BYSA 2ZCCA 3AECB 3GS2A 4AP4C 3SFEB 1OTRB 1XXGA 5H8YE 3LXFA 3RZWC 2MJDA 2KWVB 4DHZB 1T0YA 3N9YC 2LASA 3W1YA 1E0ZA 4WAAA 1P1AA 1XEEA 4M00A 3P1MA 1E5WA 1WGKA 3VHTC 4MGYE 3MC8A 1K50A 2BKRB 2KZRA 2N9EB 4JPSA 4NAMA 4F8CB 2LVPA 1XLPA 4NAWA 1PGBA 1LM8B 4BBNC 1QOFA 4LJOB 1UNSA 1L6UA 3RPFC 3L17A 4UDUC 2MCNB 4OZAA 4E74A 2MP2A 1C4PA 1L5PA 2QDFA 3ZJUA 2EMSA 2HDEA 2W3SA 4US9A 4XWTA 2NPTB 1JWAD 2IGDA 2KN5A 5L83A 1D5ZC 3BK1A 4HDQA 3N20C 5AUIA 1IBXB 1UBQA 1GTHA 2LJ5A 5D94A 2OHFA 1OGWA 1NI3A 1R7SA 5DPSA 1QOAA 1JMLA 2EELA 2RPVA 3U7DA 1N62A 5BYRA 5LLIA 2ZVOA 5AZGA 1J8CA 2V9HA 1V86A 2FBWB 2AYOB 2K39A 1KLUD 4GXBA 3NVZA 1WE7A 4A90A 1WX9A 2N0SB 2KC1A 2WGSA 1BMLC 3P2BA 2WXMA 2INDC 3I5JC 5BMGA 1S1QB 5JH5C 1E8YA 2DBYA 2M4NA 4BVUC 2DENB 3TEXA 1ZXIA 3RT3B 4KIKA 3ONSA 4K81A 2WXFA 2AL6A 4FXCA 1AWDA 4GSWA 3EHVA 4LK0M 2A4ZA 3L08A 2I1JA 2KQ4X 3UIPB 3UF8A 2WXJA 5IA7A 2KANA 1FNVA 4ZRIA 3PREA 2KNBA 3H7PB 1FM0D 2K9XA 4ZOHC 3CF4A 4P16A 2D5GA 2L7RA 2WU2B 2BF8B 2PPHA 1AYFA 3BY4B 2J42A 2ZNVC 4RH6A 1STEA 4KGTA 3RD2A 2DAFA 1H4RA 3NVVA 1L2NA 4HCNB 1EM7A 1WE6A 3ZO5B 1JCKB 3AEEB 3IVFA 1VLBA 4EEWA 3PVLA 1HZ5A 3B1LX 3FKYA 4K7SA 2RPQA 2MLBA 2WLBA 1SJED 1Q5WB 3VR9B 2Z0DB 2IY0B 3CSTA 1I4GA 1WH3A 2PVGC 2I2YA 3M95A 3O13A 1UF0A 3RFZB 2EMTA 3KQ4A 1YN5A 4W9KA 2V3SA 5KHQA 1H7XA 5C2TB 1P98A 5L95C 1NVID 4NJCA 1MHXA 3ZNID 2IJ0A 3ZIMA 3H6NA 1TIFA 3IBEA 1TS2A 2LHEA 1E9MA 4DK5A 4RM9A 2NVUI 5IP4D 3PT2B 2JY6A 3IHPC 1MFWA 1NEKB 2LJIA 1WJ4A 2CHXA 3PV1A 2Y5BB 3KH0A 3ZW3A 1ZDXA 1EUVB 4K7UA 4IM0A 4YL8A 2KLCA 1C9FA 2J0JA 3UGBB 4MEMA 3LB8C 2BS4B 1NDDA 3KVFB 4DWFA 1JWBD 2WDRB 3RMKC 1WR6E 3KUCB 4MDKE 2KJRA 3VTUA 4NAWB 3RNAC 3ZUNA 1YD8U 4HPPA 3URYA 4B0EA 2RDHA 2GLSA 3LDZE 3NS1A 3QAQA 2KT7A 2MP2B 3PZDA 4N59A 2KLGA 5IN7A 3N32A 3R3MA 3OLMD 5IAAC 4XX5A 3VR8B 1L7YA 2HTHA 3NHEB 2RR9A 2IGGA 2PW9A 4O1NA 3AEBB 1CQVA 3WAMA 1UWXA 4EOYA 2ONQA 4ZHOA 1RWSA 1FFVA 1DOYA 1D5XC 1TBEA 3HM6X 2K1FA 3T9LA 1SJHD 4G0NB 3CMMB 4LNIA 2YEPF 4ZYSA 3V6EB 4C7ZA 1GB1A 3DBHI 2KFJA 3Q3JA 1V1OA 3VUXA 5LNK1 1CJEA 3DBRB 1IGDA 3QHTA 3DBHB 1TGZB 3P4SB 1N60A 2JZ3B 3MTNB 3X0WA 1QQRA 4YXDB 2K8BA 3L13A 2OOBB 4KIKB 1KOTA 3EFUA 1ET6A 1HTOA 2LUEA 3QA8A 5IO9A 2LXCA 3ZGZA 2JXTA 4DBGA 3PTFC 2WXRA 2KWDA 3B0AA 4AWJA 4I6PA 2IO3B 5FR3A 4KZCA 2RGFA 4G3XB 5CHVC 3H9DA 3Q6BA 5DPRA 2REXA 1K53A 3ZKJC 3IT4B 4DXGA 1TS3A 1JQ4A 3C8YA 1HEZE 2XK5A 3N1YC 1BUIC 2L1AA 1WSPA 5D2MB 1JWMD 4KGSA 1ZE3D 3QARA 2K3UA 1GJZA 1TY0A 1JALA 2BQQA 3MJWA 2KDMA 2BS2B 1P7EA 2WNMA 3HIZA 3ZVVA 1ET9A 3MP9A 2JZZA 3L16A 2ZVNA 4RGNA 4ARCA 1WZ0A 2WXNA 2BT6A 4B6WA 1KTKA 4WQMA 5HFYA 2K6DB 2IZVB 2QIEB 4W9EA 4FHKA 1XCTL 4OZCA 4OVUA 4WWMA 2WXQA 1ZDVA 4BAXA 3M62B 2IO2B 4L2YA 4R3DA 1SE4A 3QX1A 2XN9C 4ANVA 2MSED 4TV3A 1GPXA 5FKAC 2M56B 5CHFA 4C00A 4ANXA 4HRSA 5G5GA 3MJ5A 4ARIA 4FULA 4IWQA 1SGHA 1YX6B 1ZPSA 2JX5A 2BB6A 3AN1A 4F1SA 1S3SG 3A9JA 3Q8AA 4II3B 2E6XA 1FNWA 2DZIA 1FO4A 2KHWB 2KWCA 4EKUA 1VDVA 4XC2A 3Q3FA 2N4FA 3NJTA 4W9DA 3BIID 1KH0A 1WXAA 2L8JA 2FCSA 2JQRB 4OZBA 1RM6C 1WZ3A 2NR2A 5I4DA 1JWUD 2R2QA 2JPHA 3MC9A 4M02A 2FCMA 4WURA 1OQYA 4RGTA 1ZW7A 3TL5A 2WDQB 2L52A 4L23A 2OJRA 1TTNA 5JZEB 3ABVB 5JXVA 1FXIA 3HHMA 4YWGG 1HXYD 1Z5SB 4ZDVA 2CKHB 3AEGB 1AN8A 2BKFA 3KLSX 2IPKD 2J4XA 3E9SA 2INPE 2WXPA 1PDXA 4K3CA 4G50A 3W1SA 1V49A 4YTPB 1WGGA 3B2GA 3BK2A 4NJ6A 2GBKA 4OVVA 3AI5A 3QIJA 3ML9A 3AV8A 3DHHC 3AE6B 1RRBA 4GGQA 5G5HA 4YSXB 2AQ3B 2LHDA 2XEWA 3EUB2 1WI0A 4LLGM 1RYJA 2WP9B 1TZ1A 2KDFB 1QOBA 3NZUA 3A4RA 4IUMB 1ACCA 4ICVA 4AJYB 2RDGA 2Z0EB 2LRUA 1R4NB 3J9CA 3DWMA 3JSVA 4ZYNA 2KJHB 1V97A 3UIOB 2GBRA 1I4PA 2ASQA 4KDIC 3VDZA 2BYVE 5H92C 2ZW0A 3SEBA 3Q8CA 4F7ZA 1WM3A 2BPSA 4RM8A 3H7SA 4USAA 3SHQA 1YNTE 3EA6A 1NBFC 4GOCA 4FJVB 3FILA 4IG7B 4B9KA 3IXSA 5GXGB 1Q0WB 2PLPA 2N9KA 2JXXA 4FHJA 1T0QC 3D32A 2DZJA 2J52A 5JHAA 1ZUD2 2XK5B 1E7PB 4YT0B 1SB3C 1YN3A 2C5LC 3I3TB 4P7IA 2M0AA 1FRRA 1HQRD 4IWPA 2M17A 1WJ6A 2K25A 1DOIA 1LO5D 2IDYA 1WIAA 2KDIA 3QCAA 4FLHA 5D6JB 2EKEC 1UUPA 2NTTA 3ZJVA 3TEZA 2Q5WD 2Y3AA 5TR5A 3RCZA 4KDLB 3VAWA 2ZEQA 4WQOB 2Y5PA 4A20A 3EFCA 4GMVA 3ZLZA 1I4XA 2MJEA 4REZA 4D2KA 4DXAB 2LVQA 3DVNU 2QSDA 1KJTA 1C78A 2K22A 1WM2A 1VZ7A 3JYUA 2LEKA 4KVGB 3BYYB 3FAHA 2V0GA 3BYTB 5HI1A 4QAYA 2MRPA 1L6VA 4OW0A 2PJHA 4EZKA 2D07B 4HPMB 4JWSC 2KK8A 5LXIB 5D3IB 3TSSA 2LZ6A 4NZLB 2KD0A 1E90A 3GZNB 3WALA 1L0XB 1K52A 3JW0X 1IP9A 4ZRPA 1KLGD 3MFGA 2V3PA 2IYDB 3N1XC 3U30A 2PTLA 3AU5A 2B3AA 2BYTA 1C1YB 1SIFA 4HKQA 5C1ZA 4RGOS 1RAXA 3A33B 4GB9A 4RNAA 1BXTA 2K5PA 2QC8A 3VUWA 3A9JB 4CHKA 5JHBA 1B9RA 1OEYJ 2DZKA 1WGHA 1Q10A 4KSKC 4L1BA 3TEYA 4AOFA 3CWIA 4K1RB 2LD9A 3ETRA 4JLCA 4KKIA 2WDTB 3L10B 3EGRA 3HUIA 3APCA 2W54A 4IW0A 2RDBC 3DBSA 2IGHA 1YOVB 2MQJA 1WF9A 4HLEA 3SR6A 2XBBC 3AE5B 2JUOA 3ZTDA 1V1PA 1KLVA 3NG0A 3DBLI 2L3ZA 3IAM1 2L83A 4MJSA 1IUEA 3GE3C 3PPAA 1QILA 1WWTA 1H8CA 3DBLB 1TKGA 2LRWA 4A3OA 2N9XA 4KKJA 2X38A 2R61A 5E6PA 2QCZA 4W9JA 1N5WA 2WHIA 3AE2B 3VVWB 4KV2A 4FJZA 1ISNA 3AE4B 2GI9A 2YVCA 3OAWA 4WWPA 3P4RB 1EO6A 3P63A 2INNE 3ZXRA 1YN4A 1C3TA 2IY1B 4ZRJA 3KUZA 4HK2A 3BVMA 2G1EA 3QJZA 3M3JA 1YMHE 5G2NA 1E7VA 1SE3A 1EU3A 1E8XA 4N58A 4RMAA 1VR9A 2LMCA 4JE3B 4BBNF 3PRZA 2J0KA 3JSVB 2AQ1B 4TQ0A 4A9AA 3I9V1 2LUMA 1PQSA 2G4SA 4MACA 4M8NA 2D3CA 2MEKA 2M1MA 2MW5A 5DCNA 5EE3A 4MM3A 1WXMA 3AMZA 2L32A 1FEHA 2FCNA 3DWGC 2V4IB 2ZJDA 3Q2AC 2ACZB 3OG5A 4E71A 1N61A 3IFWB 4LNNA 5G55A 3FILB 2BYEA 2HJ8A 2UYZB 2M19A 1XO3A 4HWIB 1E8WA 1LGRA 4HPLB 1R4MB 2GRIA 3RN9C 1U4AA 3RNCC 1YIWA 2C7HA 4BZAA 1VZ8A 1WFYA 3AE9B 2W9NA 4B0MA 5E6JA 4P1CC 2LGIA 3RNEC 2LI5A 5J2RA 1SIJA 4JL9A 3R7RA 4WJOA 4W9LA 4XGAB 3ZDTA 2G4DB 1CMXB 1MVKA 4GN1A 5T8IA 2OJWA 4C56C 2MHJA 1FXAA 4EUTA 2MBOA 2L0TA 1F52A 4EFOA 1T0RC 2NMQA 2D3AA 1UH6A 3EC8A 1OEYA 1F0ZA 3Q8EA 3VRBB 3E56A 3VFKA 1TY2A 2D11A 3DCGA 4AUQC 3PO0A 2MA9B 1V2YA 2BS3B 2BB5A 3JVZX 3UQBA 2MH7A 3DBRI 2KACA 2SEBD 3Q69A 3A4SC 1V80A 4II2B 2QEJC 5KHOA 3SDLC 2JVCA 1GB4A 1X1MA 2K6QA 1KF6B 2LXAA 4Q2JA 3R66C 2CU1A 2JYTA 4S0RA 5IKCM 1WRIA 1UGMA 2MBEA 1I35A 4P6VF 2N7JA 1XLOA 2N7DA 3AE8B 1C4CA 4K3BA 5FR6A 2WXGA 4ZHPA 1MG4A 2WXOA 3AE3B 3BVGA 2TSSA 4MSQB 3PRPB 2WWZA 1UELA 2KKCA 4PK1A 1JROA 2RSUA 1Y8RC 1FPYA 4G11A 3VTVA 2FIDA 2IO0B 2GB1A 1TS4A 1E8ZA 5BYQA 3TJPA 4CYEA 2G3QB 1V1PB 1T5XD 4NQLB 2GBMA 4NQKE 4MJSB 5GMVA 2G45B 4PS8A 2FIFA 4PS3A 2KMAA 1GTEA 2KQSA 5C3JB 1MJDA 4PYUA 4KX6B 2ZW1A 4PYZA 2Z8LA 2KWUB 4GDLA 3U7ZA 3W5UB 4M01A 4MGIE 1WYGA 2CS4A 4WJNA 3CF6E 2PKOA 3NY5A 1P3QU 4ZRKA 2H89B 3PZ7A 1WGYA 5E6NA 2PE9A 1E7UA 3HVDA 4W9GA 4FA6A 2J0MA 1N6ZA 2HJ1A 2WXLA 1MG8A 2IO1B 3GE8C 3OWEB 3VQIA 3ML8A 1M94A 2C7MB 3NOBA 5EE0A 1RFAA 4BKSA 1WRDB 1WYWB 1PGXA 3RNFC 4MM3B 5D3DA 1T3QA 4AQ7A 1F2RI 1ZXHA 3I63C 2MBBB 4MGKE 4MH0E 3WAPA 3SD5A 2K8CA 2QILA 1UD7A 3DQVA 4HROA 1L0VB 3QQ8B 1F77A 1HZ6A 1QZEA 4A6QA 5LXHA 4MT5A 1VRAB 1V81A 1Z2MA 2CR5A 1JRUA 2ZZPB 5AUKA 1K51A 4A8XC 2AWTA 2KFKA 1WJNA 1EWYC 1D6EC 4J3OD 2VZKB 2ZPNA 4RGMA 3AM9A 2KX0A 3DOWA 4LNKA 3AEFB 1E6EB 1SSNA 4BKSD 4WWNA 1ZGUB 2PIAA 1WY8A 4WWOA 3TBLD 3W2DA 1OFFA 2NBWB 2NBUA 2PE6B 3NRZA 5MPOA 2LGYA 4RF0A 2WQYB 1J0GA 2KTRA 1UWMA 4MGZE 3ENEA 4PS7A 4EZLA 4IM2A 1WXVA 2KTFA 3RUIB 3RI7C 1ENFA 3U8ZA 1QLBB 3P42A 4YTMB 1JRPA 3U2SC 2N7EA 3K9PB 1NYRA 4JQWC 1RFKA 1N5XA 1UGJA 1R4NI 4S17A 1I4HA 4PT5A 3WA0A 2JYEA 1P0RA 2LWPA 2L0FA 2KN4A 2ICIA 3VRAB 2CU3A 2JZPA 2DWQA 3H8HA 2JF5A 4WH4A 4IC7B 3VXWA 2G9HD 3KUDB 2BWES 2NBVB 2PEAA 1BT0A 3L0WB 1QT9A 4IKGA 1DYQA 1GC6A 3ZXVA 3PRMB 3S2AA 5CTRC 4MSMB 2VH2A 1AW7A 1SEBD 2FNJB 3QK0A 5J17A 3V60A 3Q3MC 1TKYA 4LCDE 1C79A 3NVWA 2VH1A 2KXJA 3ZYYX 3HRDD 4BKTA 1XF5L 1L4ZB 1YQ3B 5HKHA 1ZKHA 3U52E 1M4VA 2A5UA 1V6EA 2I38A 3IT6B 3NVYA 1J19A 3BVZA 3QWZB 1ROEA 2WX1A 4X57B 1T0SC 1J7AA 2JU6X 3TCAA 3LJ3A 3ZTCA 4FADA
chains in the Genus database with same CATH topology
1IGDA 1VJKA 1IGCA 2DLBA 5TSSA 3P4SB 1N60A 3BVMA 1V8CA 1QQRA 2W55A 4YXDB 2NTSA 2G1EA 3P4QB 1YMHE 3BWUD 2EKIA 2WXIA 4GDLB 1SE3A 1EU3A 1ESFA 4N58A 1VR9A 2LMCA 4JE3B 1ET6A 4C80A 1FIQA 1YJIA 3ZGZA 2E3TA 2AQ1B 4TQ0A 1TJEA 2JXTA 3Q8BA 2WXRA 2KWDA 3I9V1 4A9AA 1MHHE 5FR3A 2LUMA 4MACA 5EE1A 1MPEA 2CJNA 2LFIA 3P4PB 3TEWA 1K53A 2MEKA 2DYOA 3IT4B 4DQOC 5EE3A 3UI3A 1NENB 4DXGA 3AMZA 2L32A 1FEHA 1XCQL 3DWGC 1FRDA 1D4BA 1TS3A 3SFDB 2V4IB 2W82A 1HEZE 3C8YA 1JQ4A 3T3NA 3W5VB 2ACZB 1BUIC 1N61A 1WSPA 2L1AA 1JWMD 4KGSA 3PZ8A 1ZE3D 4KGRA 3FILB 1E10A 1N63A 2M19A 5HG2A 2K3UA 1XO3A 1FD6A 4OVZA 5FK9C 1XLQA 1TY0A 1FCLA 4RFBA 3V05A 1JALA 2GRIA 2RMMA 4OHJA 2KDMA 2WXHA 1P7FA 2BS2B 1P7EA 1XLNA 2WNMA 3NUHB 4EE2A 3LYYA 1VZ8A 4XDCA 3KWVA 1C76A 3AE9B 1ET9A 2WU5B 3MP9A 5HHDG 4RGNA 4B0MA 4ARCA 5E6JA 3HVZA 2LGIA 2BT6A 2WXNA 1TKEA 4XWWA 1KTKA 4WQMA 1SIJA 4HKZE 5HFYA 1KFYB 3U4EG 2K0PA 2XNAC 1FNUA 2BTEA 1MVKA 5T8IA 2QIEB 4IDIA 4C56C 1FXAA 1XCTL 4OZCA 4GDKB 3CIRB 3I57A 1PGAA 1GAQB 4YTNB 4WWMA 4N6EB 2WXQA 1ZDVA 3AE1B 2NMQA 1J7BA 2Y5CA 4L2YA 4R3DA 4M0WA 1A70A 1SE4A 4A55A 1F0ZA 3GP7A 2XN9C 3L4PA 3R2TA 3Q8EA 3VRBB 2KMMA 5BYSA 3E56A 3AECB 1GPXA 1TY2A 3GS2A 3SFEB 5FKAC 1XXGA 2M56B 5H8YE 1GOZA 3LXFA 1L0YB 2MJDA 5BMHA 3PO0A 4WAFA 1WXQA 4HRSA 5G5GA 3MJ5A 3N9YC 2BS3B 2BB5A 1YQ4B 4ARIA 1E0ZA 3AEDB 3MHZA 1XEEA 3P1MA 1CK1A 1WGKA 2MH7A 1ZPSA 2KACA 2JX5A 2SEBD 3Q69A 3GB1A 2BB6A 2J53A 1K50A 3AN1A 3V3XA 3Q8AA 4RCOA 2E6XA 2QEJC 1FNWA 4JPSA 2CJOA 2V3NA 4NAMA 1FO4A 4AS1A 1GB4A 1XLPA 4LTUA 1VDVA 1PGBA 3B9JA 1DOXA 1KF6B 4Q2JA 1QOFA 1UNSA 2JYTA 3T3OA 1L6UA 1WRIA 1J7CA 3BIID 1KH0A 4P6VF 4RF1A 2N7JA 3RPFC 1XLOA 2JQRB 4OZBA 3AE8B 1FFUA 1RM6C 1C4CA 1KRHA 4UDUC 4OZAA 5I4DA 1JWUD 1C4PA 2WXGA 4ZHPA 1ZOYB 1L5PA 1YJJA 3ZJUA 4MH8A 2WXOA 3AE3B 2HDEA 2TSSA 3BVGA 2W3SA 4WURA 4US9A 4XWTA 4CQNA 2H88B 1JWAD 1QOGA 2IGDA 1JROA 3AH7A 1D5ZC 3BK1A 1GT8A 2FE8A 5AUIA 2KAJA 1IBXB 1GTHA 4RGTA 2YEPB 1PUTA 2OHFA 2WDQB 1NI3A 1R7SA 2GB1A 2L52A 4L23A 3ABVB 1TS4A 5JXVA 1QOAA 1FXIA 1JMLA 4YWGG 2EELA 1HXYD 5BYQA 2RPVA 1PYWD 3AEGB 1AN8A 1N62A 4YSYB 1C77A 3KLSX 5BYRA 2IPKD 2J4XA 1V1PB 1T5XD 3E9SA 2INPE 2WXPA 1PDXA 2FBWB 3W1SA 1KLUD 3NVZA 4YTPB 3B2GA 4C7YA 3BK2A 4A90A 2N0SB 1SXTA 3AV8A 1GTEA 3AE6B 1BMLC 2WXMA 1DGJA 5G5HA 4YSXB 5C3JB 2AQ3B 2LHDA 3EUB2 5BMGA 4JWUC 4LLGM 1RYJA 4KX6B 2ZW1A 2DBYA 2Z8LA 2WP9B 1C4AA 5EE9A 3TEXA 1QOBA 1ZXIA 3U7ZA 3W5UB 1ACCA 1WYGA 1I4QA 2BW2A 3NZ3A 2RDGA 3J9CA 3DWMA 1ZP0B 2JWUA 2WXFA 2PKOA 4HJGE 4FXCA 1AWDA 4TSSA 4LK0M 1JW9D 2B76B 1V97A 1I4PA 2H89B 3PZ7A 1VZ6A 2KQ4X 5H92C 2FUG1 2WXJA 2ZW0A 1FNVA 1B1ZA 3HVDA 1CZPA 5D7GA 1FM0D 3SEBA 3Q8CA 2K9XA 2WXLA 4ZOHC 3CF4A 4P16A 3OWEB 2D5GA 2WU2B 5BMIA 4USAA 3VQIA 1YNTE 1FMAD 3EA6A 1AYFA 3FILA 4RH6A 2J42A 3AE7B 5EE0A 1STEA 1JWSD 4KGTA 3NVVA 3IXSA 5GXGB 1PGXA 2PLPA 1EM7A 4MM3B 2N9KA 1JCKB 5D3DA 1QF6A 1T3QA 3AEEB 1F2RI 1ZXHA 3ZQ4A 4AQ7A 1VLBA 2J52A 1ZUD2 3R8BA 1E7PB 4YT0B 3WCQA 1SB3C 1YN3A 2VZKD 2M0AA 3ZJTA 3W9CB 1H7WA 1FRRA 1HZ5A 1T6BX 1HQRD 2QILA 1L0VB 4HROA 1DOIA 1EWCA 1LO5D 2IDYA 2WLBA 1F77A 1SJED 3VR9B 1HZ6A 4JX1C 2NTTA 1UUPA 3ZJVA 1I7HA 4A6QA 3TEZA 2Q5WD 2Y3AA 4MT5A 1VRAB 1I4GA 2PVGC 2I2YA 2SAKA 2Y5PA 3O13A 5AUKA 4ZRQA 1K51A 3RFZB 4A8XC 1I4XA 3KQ4A 2MJEA 1YN5A 4REZA 4D2KA 1EWYC 1D6EC 4J3OD 2QSDA 1H7XA 1C78A 5C2TB 2K22A 1NVID 2VZKB 4RGMA 1SE2A 1VZ7A 3AM9A 2LEKA 4NJCA 1MHXA 3FC4A 2N9LA 3R2IA 3BYYB 3FAHA 2V0GA 2PVOD 3BYTB 5HI1A 2QJLA 3AEFB 1QKZA 4US8A 2OEDA 1E6EB 1L6VA 1SSNA 4OW0A 2IJ0A 2PIAA 2BBCA 1TS2A 2LHEA 1E9MA 1Y56A 3W2DA 1MI0A 1OFFA 5MPOA 3NRZA 4RF0A 2WQYB 1NEKB 2LJIA 1SF0A 4JWSC 1UWMA 2W3RA 4TMAB 5D3IB 3TSSA 4NZLB 1ZDXA 4XE0A 1L0XB 1K52A 4ZRPA 1ENFA 1OQRA 1KLGD 3MFGA 2V3PA 1QLBB 3P42A 4YTMB 1JRPA 2PTLA 3U2SC 1FCCC 1C9FA 1F2RC 2WS3B 2BYTA 1NYRA 2DYMA 4HKQA 1RFKA 1N5XA 4RGOS 3LB8C 2BS4B 1UGJA 1I4HA 4PT5A 4RNAA 1BXTA 1JWBD 2WDRB 2JYEA 2K5PA 1D5MC 1B9RA 1TZOA 3KWLA 2ON8A 1Q10A 2KN4A 2ICIA 3VRAB 2CU3A 3Q8FA 2JZPA 2DWQA 4L1BA 3TEYA 4NAWB 3H8HA 3CWIA 4WH4A 2PMVA 1TYGB 3URYA 2G9HD 4B0EA 3ETRA 2RDHA 4KKIA 3B2FA 3EGRA 3HUIA 3AEAB 2W54A 1QT9A 2IGHA 3NS1A 4IKGA 1DYQA 3TUOA 4XDDA 1IBXA 2MJ3A 4WIPA 1EU4A 4N59A 3IAS1 1NYQA 4GLSC 1AW7A 3SR6A 3VR8B 1SEBD 3AE5B 2HTME 4IOIE 1TS5A 1SBBB 1TKYA 3AB5A 1C79A 3NVWA 2WXKA 1I4RA 1V1PA 4TQ1A 3BZDB 1OQQA 3ZYYX 3IAM1 2L83A 2IGGA 2PW9A 3HRDD 3AEBB 1IUEA 1XF5L 4HEA1 1L4ZB 1QILA 4O1NA 1YQ3B 1WWTA 1CQVA 4ITKA 3U52E 4YSZB 1M4VA 1UWXA 2QMTA 1TKGA 2ONQA 4ZHOA 1RWSA 1FFVA 1DOYA 2WDVB 1D5XC 2I38A 3IT6B 4KKJA 2X38A 2R61A 3NVYA 2AQ2B 3BVZA 1L4DB 1SJHD 1N5WA 3AE2B 4DXFA 1ROEA 1PFDA 3MC0B 2JSVX 2YEPF 1J7AA 4ZYSA 2JU6X 1HA5A 4C7ZA 1GB1A 2GI9A 3AE4B 3P4RB 3P63A 1V1OA 2INNE 1CJEA 5LNK1 4H2AA 1YN4A 2AX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 B;  1VJK A;  5EE9 A;  3SFE B;  2M56 B;  5H8Y E;  3LXF A;  3P4S B;  1N60 A;  1QOB A;  1ZXI A;  2MJD A;  2WQY B;  3W5U B;  1WYG A;  1NEK B;  3PO0 A;  1V8C A;  2W55 A;  1SF0 A;  1WXQ A;  4YXD B;  4JWS C;  1UWM A;  2G1E A;  2W3R A;  4HRS A;  5G5G A;  3DWM A;  3P4Q B;  1ZP0 B;  2BS3 B;  2PKO A;  1YQ4 B;  2EKI A;  1AWD A;  4FXC A;  3AED B;  4N58 A;  1E0Z A;  1JW9 D;  2B76 B;  1V97 A;  4C80 A;  3P1M A;  1WGK A;  1OQR A;  1FIQ A;  2H89 B;  1YJI A;  2MH7 A;  5H92 C;  1QLB B;  1JQ4 A;  4YTM B;  1JRP A;  2JX5 A;  2E3T A;  1TJE A;  3AN1 A;  2WS3 B;  1NYR A;  1CZP A;  4A9A A;  1RFK A;  1N5X A;  3LB8 C;  2BS4 B;  1FM0 D;  2CJO A;  1GPX A;  1FO4 A;  2K9X A;  4ZOH C;  3CF4 A;  5EE1 A;  2CJN A;  1XLP A;  3P4P B;  4LTU A;  1VDV A;  2WU2 B;  1JWB D;  2WDR B;  2K5P A;  3B9J A;  4USA A;  1DOX A;  1KF6 B;  1FMA D;  5EE3 A;  1AYF A;  1QOF A;  1B9R A;  1NEN B;  3AMZ A;  3KWL A;  3AE7 B;  3DWG C;  5EE0 A;  3VRA B;  1FRD A;  1L6U A;  3SFD B;  1WRI A;  1J7C A;  2CU3 A;  2DWQ A;  3BII D;  4P6V F;  3NVV A;  1OFF A;  3RPF C;  3W5V B;  5GXG B;  2ACZ B;  1XLO A;  1N61 A;  2JQR B;  3AE8 B;  1FFU A;  1RM6 C;  3CWI A;  1KRH A;  1TYG B;  3NRZ A;  1E10 A;  1N63 A;  1T3Q A;  3AEE B;  3ETR A;  1QF6 A;  1VLB A;  1ZUD 2;  3B2F A;  2M19 A;  3HUI A;  1XO3 A;  3AEA B;  2W54 A;  1E7P B;  4YT0 B;  1QT9 A;  3WCQ A;  1SB3 C;  4ZHP A;  1ZOY B;  1L5P A;  1YJJ A;  3NS1 A;  1XLQ A;  1H7W A;  1FRR A;  3W9C B;  3AE3 B;  2MJ3 A;  2W3S A;  4US9 A;  1L0V B;  1JAL A;  4HRO A;  1DOI A;  2H88 B;  2WLB A;  1JWA D;  1QOG A;  4N59 A;  1JRO A;  3AH7 A;  3VR9 B;  1NYQ A;  4JX1 C;  3SR6 A;  1GT8 A;  1I7H A;  2BS2 B;  3VR8 B;  1XLN A;  5AUI A;  2KAJ A;  2Q5W D;  3AE5 B;  1GTH A;  2HTM E;  3AE9 B;  2WU5 B;  1TKY A;  2PVG C;  1PUT A;  3AB5 A;  2OHF A;  2WDQ B;  3NVW A;  1NI3 A;  3HVZ A;  1R7S A;  2L52 A;  2BT6 A;  5AUK A;  3ABV B;  1QOA A;  1FXI A;  1TKE A;  1OQQ A;  3ZYY X;  4WQM A;  2MJE A;  2L83 A;  1SIJ A;  3HRD D;  3AEB B;  1IUE A;  3AEG B;  1N62 A;  1KFY B;  4YSY B;  1YQ3 B;  1WWT A;  4ITK A;  1EWY C;  1H7X A;  4YSZ B;  1PDX A;  5C2T B;  2K22 A;  2FBW B;  1TKG A;  4ZHO A;  1RWS A;  1FFV A;  1NVI D;  2QIE B;  4IDI A;  1DOY A;  2WDV B;  1FXA A;  3AM9 A;  3NVZ A;  2LEK A;  3NVY A;  4YTP B;  3B2G A;  3CIR B;  3FC4 A;  4C7Y A;  1GAQ B;  3FAH A;  4YTN B;  1N5W A;  4WWM A;  3AE2 B;  2N0S B;  2PVO D;  4N6E B;  1ROE A;  2QJL A;  1PFD A;  3AEF B;  4US8 A;  3AE1 B;  1J7A A;  1GTE A;  1E6E B;  1L6V A;  3AE6 B;  1J7B A;  3AV8 A;  4C7Z A;  2PIA A;  2Y5C A;  1A70 A;  1DGJ A;  4YSX B;  3AE4 B;  5C3J B;  3EUB 2;  1E9M A;  5G5H A;  3P4R B;  3L4P A;  3P63 A;  1F0Z A;  4JWU C;  3VRB B;  2KMM A;  1RYJ A;  4KX6 B;  1CJE A;  3AEC B;  5MPO A;  2AX5 A;  2DBY A; 
#chains in the Genus database with same CATH topology
 3PHW B;  3H1U A;  1VJK A;  4W9I A;  1IGC A;  5TSS A;  2UWQ A;  3ZNG C;  1V8C A;  1FXT B;  2NTS A;  3RYT A;  2KO3 A;  1HTQ A;  3BWU D;  2EKI A;  4GDL B;  1ESF A;  2M0X A;  4C80 A;  1YJI A;  3N3K B;  3N30 A;  3DHG C;  2X8X X;  1XD3 B;  2GBN A;  1TJE A;  2DHZ A;  3Q8B A;  1F1H A;  1MHH E;  1KM7 A;  3M63 B;  4BOZ B;  1IPG A;  4ASW C;  2LFI A;  3P4P B;  5DPW A;  3DDC B;  5J18 A;  3TEW A;  3GZN I;  4DQO C;  1EF1 A;  2JRI B;  2V4L A;  1G6J A;  2INC C;  3KYC D;  4IM3 A;  3T8M A;  3PLV A;  4MEL A;  3W5V B;  3DPD A;  1E10 A;  5HG2 A;  4OVZ A;  5FK9 C;  2FUH B;  2LGX A;  2BWF A;  3AXC A;  1FCL A;  2LVO A;  2MWS B;  3V05 A;  2WXH A;  3W1S C;  1UZX B;  3C0R B;  1XLN A;  3AUL A;  4K7W A;  3WAN A;  3KWV A;  2WU5 B;  3MHS D;  4P1B C;  2WYQ A;  3HVZ A;  2C9W B;  4LDT B;  4XWW A;  1XT9 B;  4HKZ E;  1KFY B;  3BIN A;  3U4E G;  2K0P A;  4A3P A;  2BTE A;  4DHJ D;  1F9J A;  3EEC A;  2KFK B;  4BFR A;  1YQB A;  3CIR B;  4KZ0 A;  1PGA A;  4YTN B;  2Y5C A;  4M0W A;  3OJ4 B;  3GP7 A;  3R2T A;  1GOZ A;  1L0Y B;  5BMH A;  4FBJ B;  4WAF A;  2ZPY A;  1WXQ A;  3O65 B;  5DPT A;  1YQ4 B;  3AED B;  3MHZ A;  2DX5 B;  4W9H A;  1CK1 A;  2KTR B;  3CSF A;  1WX8 A;  3GB1 A;  2HD5 B;  2J53 A;  1XQQ A;  3V3X A;  4RCO A;  2CJO A;  2V3N A;  3ZRC A;  2K8H A;  4AS1 A;  4XZ4 A;  4LTU A;  1WR1 A;  5C23 A;  3L54 A;  2GMI C;  4B95 A;  1V5O A;  3B9J A;  2KDB A;  1DOX A;  1RLF A;  2O2V A;  2LGS A;  3OJ3 A;  3T3O A;  3APD A;  3PSE B;  1J7C A;  4WJQ A;  4RF1 A;  2O6V A;  1FFU A;  1WGD A;  1KRH A;  1YX5 B;  3V61 A;  1V9J A;  3Q14 C;  4NJ7 A;  1ZOY B;  1YJJ A;  5AZH A;  3APF A;  3Q3O C;  4MH8 A;  3SU8 X;  4CQN A;  3UQA A;  2H88 B;  1QOG A;  3AH7 A;  4JIO U;  2KOX A;  1GT8 A;  2FE8 A;  2KAJ A;  3HK0 A;  5EDS A;  2YEP B;  2UU7 A;  1PUT A;  4XYC A;  2ZNV B;  4I6L B;  3DHI C;  1R4M I;  4NNJ B;  1PYW D;  4YSY B;  1C77 A;  2MBH A;  3A9K A;  3KW5 B;  3A1Q A;  2JRH A;  2DZM A;  2WX0 A;  2DYB A;  4C7Y A;  1WJU A;  1SXT A;  2BVC A;  2QHO A;  4EZJ A;  3AU4 A;  2O6V D;  1DGJ A;  4DHZ E;  4JWU C;  2KYW A;  1C4A A;  5EE9 A;  4C4V A;  2Z59 B;  1I4Q A;  2BW2 A;  3ECI A;  3NZ3 A;  3PLU A;  2J7Q B;  1WX7 A;  1Q1O A;  3NZS A;  1ZP0 B;  2D3B A;  4HJG E;  2JWU A;  2KVR A;  4TSS A;  4HCP B;  2L76 A;  1JW9 D;  2B76 B;  1VZ6 A;  2FUG 1;  1B1Z A;  1CZP A;  4E3C A;  5D7G A;  3ZRF A;  1YJ1 A;  5CHW A;  1VD2 A;  4GU2 A;  5BMI A;  4NPN A;  1FMA D;  3R7Q A;  3Q3N C;  3ALB A;  2BGF A;  4DHJ B;  3AE7 B;  1JWS D;  3VTW A;  1GC7 A;  1WMH A;  1K8R B;  1IYF A;  2MX2 A;  1QF6 A;  3KYD D;  3ZQ4 A;  1LQB A;  3TIX A;  3VH3 B;  3R8B A;  3WCQ A;  2VZK D;  3ZJT A;  3W9C B;  1H7W A;  1T6B X;  4GIV A;  2KC2 A;  1EWC A;  4ANW A;  4JX1 C;  1I7H A;  4IWO A;  1LXD A;  3RZF A;  1GG3 A;  1P9D U;  3DVG X;  2DNF A;  3VH4 B;  2SAK A;  4LJP B;  4TKN A;  4ZRQ A;  2ZCB A;  1D3Z A;  2C60 A;  4GDK A;  3ZNH B;  3RUL A;  2KDE B;  1SE2 A;  2AEH A;  1HE8 A;  3FC4 A;  2N9L A;  3R2I A;  3HM3 A;  4NY0 A;  2PVO D;  2QJL A;  1GNU A;  1QKZ A;  2AL3 A;  4US8 A;  2OED A;  3WAO A;  2BBC A;  1Y56 A;  2YLM A;  3ZDM C;  1MI0 A;  4AJW A;  2JWZ A;  2D3G A;  4M0W B;  1SF0 A;  2NS5 A;  2IBI B;  2W3R A;  4TMA B;  4W9C A;  4WJP A;  4XE0 A;  3QC8 B;  4DDI D;  1OQR A;  2GBJ A;  3DVN V;  3IG3 A;  4FJY A;  1FCC C;  4ACF A;  1F2R C;  2WS3 B;  1GUA B;  2DYM A;  1TT5 B;  4LNO A;  1AAR A;  1V5T A;  3B08 A;  3DVG Y;  1D5M C;  1TZO A;  3KWL A;  2ON8 A;  1I42 A;  3Q8F A;  1SE9 A;  4ANU A;  4TUU A;  2FAZ A;  2C7N B;  1EF5 A;  2O2V B;  2PMV A;  1A5R A;  1TYG B;  3C19 A;  4W9F A;  2NPT A;  3B2F A;  2O6V B;  3AEA B;  4BKG A;  1LFD A;  3TUO A;  4XDD A;  1IBX A;  2D10 A;  2MJ3 A;  4WIP A;  2VRR B;  1EU4 A;  3IAS 1;  1NYQ A;  4GLS C;  2NCN A;  3PS6 A;  3WIM A;  2HTM E;  4IOI E;  1TS5 A;  1WGR A;  5BO4 B;  1SBB B;  3AB5 A;  2L05 A;  3NS8 A;  2WXK A;  1I4R A;  4TQ1 A;  5CX3 A;  3BZD B;  1OQQ A;  2V1Y A;  2BYF A;  4HEA 1;  4ITK A;  2DAJ A;  2R2O A;  4YSZ B;  5AEK B;  2QMT A;  2WDV B;  3N1Z C;  3A9K B;  2AQ2 B;  1L4D B;  2KJ6 A;  4DXF A;  4HDO A;  3A1Q B;  1PFD A;  2N9P C;  3MC0 B;  2JSV X;  1HA5 A;  2I1K A;  4FN2 A;  4H2A A;  2AX5 A;  3PHX B;  3X23 A;  2DLB A;  3VUY A;  5IOI A;  4DDG D;  2W55 A;  4HXD A;  3P4Q B;  4C4V B;  2WXI A;  5E6O A;  5AZF A;  3H7P A;  4LNF A;  1FIQ A;  3V6C B;  2E3T A;  2HE7 A;  3V62 A;  2KQ7 A;  3RNB C;  2JT4 B;  2L00 B;  5EE1 A;  3PGE A;  2CHW A;  1MPE A;  2CJN A;  3RNG C;  2DYO A;  2RD0 A;  2N1V A;  1WXS A;  3UI3 A;  1NEN B;  1XCQ L;  1FRD A;  1D4B A;  3SFD B;  2CHZ A;  2W82 A;  4LDT D;  3T3N A;  4HVB A;  3UIN B;  4KGR A;  3PZ8 A;  1N63 A;  2KX3 A;  1WMH B;  4CO7 A;  2KVZ A;  3ZNZ B;  1UBI A;  1FD6 A;  1XLQ A;  2FCQ A;  4RFB A;  2N1W A;  2RMM A;  4OHJ A;  1P7F A;  2M8S A;  4HJK A;  4KSL C;  4EE2 A;  3NUH B;  3LYY A;  4XDC A;  3TMP B;  1C76 A;  2MBQ A;  2KMC A;  5HHD G;  2LGD A;  1TKE A;  4M8M A;  4N9F 4;  4ICU A;  4BOS C;  4URK A;  2XNA C;  1FNU A;  2GOW A;  3GOE A;  4IDI A;  4GDK B;  3I57 A;  4J6I A;  1GAQ B;  4N6E B;  1NI2 A;  3AE1 B;  1J7B A;  4JGH B;  2D2Q A;  3K9O B;  1A70 A;  4A55 A;  1VCB A;  3L4P A;  4I6N B;  2KMM A;  5BYS A;  2ZCC A;  3AEC B;  3GS2 A;  4AP4 C;  3SFE B;  1OTR B;  1XXG A;  5H8Y E;  3LXF A;  3RZW C;  2MJD A;  2KWV B;  4DHZ B;  1T0Y A;  3N9Y C;  2LAS A;  3W1Y A;  1E0Z A;  4WAA A;  1P1A A;  1XEE A;  4M00 A;  3P1M A;  1E5W A;  1WGK A;  3VHT C;  4MGY E;  3MC8 A;  1K50 A;  2BKR B;  2KZR A;  2N9E B;  4JPS A;  4NAM A;  4F8C B;  2LVP A;  1XLP A;  4NAW A;  1PGB A;  1LM8 B;  4BBN C;  1QOF A;  4LJO B;  1UNS A;  1L6U A;  3RPF C;  3L17 A;  4UDU C;  2MCN B;  4OZA A;  4E74 A;  2MP2 A;  1C4P A;  1L5P A;  2QDF A;  3ZJU A;  2EMS A;  2HDE A;  2W3S A;  4US9 A;  4XWT A;  2NPT B;  1JWA D;  2IGD A;  2KN5 A;  5L83 A;  1D5Z C;  3BK1 A;  4HDQ A;  3N20 C;  5AUI A;  1IBX B;  1UBQ A;  1GTH A;  2LJ5 A;  5D94 A;  2OHF A;  1OGW A;  1NI3 A;  1R7S A;  5DPS A;  1QOA A;  1JML A;  2EEL A;  2RPV A;  3U7D A;  1N62 A;  5BYR A;  5LLI A;  2ZVO A;  5AZG A;  1J8C A;  2V9H A;  1V86 A;  2FBW B;  2AYO B;  2K39 A;  1KLU D;  4GXB A;  3NVZ A;  1WE7 A;  4A90 A;  1WX9 A;  2N0S B;  2KC1 A;  2WGS A;  1BML C;  3P2B A;  2WXM A;  2IND C;  3I5J C;  5BMG A;  1S1Q B;  5JH5 C;  1E8Y A;  2DBY A;  2M4N A;  4BVU C;  2DEN B;  3TEX A;  1ZXI A;  3RT3 B;  4KIK A;  3ONS A;  4K81 A;  2WXF A;  2AL6 A;  4FXC A;  1AWD A;  4GSW A;  3EHV A;  4LK0 M;  2A4Z A;  3L08 A;  2I1J A;  2KQ4 X;  3UIP B;  3UF8 A;  2WXJ A;  5IA7 A;  2KAN A;  1FNV A;  4ZRI A;  3PRE A;  2KNB A;  3H7P B;  1FM0 D;  2K9X A;  4ZOH C;  3CF4 A;  4P16 A;  2D5G A;  2L7R A;  2WU2 B;  2BF8 B;  2PPH A;  1AYF A;  3BY4 B;  2J42 A;  2ZNV C;  4RH6 A;  1STE A;  4KGT A;  3RD2 A;  2DAF A;  1H4R A;  3NVV A;  1L2N A;  4HCN B;  1EM7 A;  1WE6 A;  3ZO5 B;  1JCK B;  3AEE B;  3IVF A;  1VLB A;  4EEW A;  3PVL A;  1HZ5 A;  3B1L X;  3FKY A;  4K7S A;  2RPQ A;  2MLB A;  2WLB A;  1SJE D;  1Q5W B;  3VR9 B;  2Z0D B;  2IY0 B;  3CST A;  1I4G A;  1WH3 A;  2PVG C;  2I2Y A;  3M95 A;  3O13 A;  1UF0 A;  3RFZ B;  2EMT A;  3KQ4 A;  1YN5 A;  4W9K A;  2V3S A;  5KHQ A;  1H7X A;  5C2T B;  1P98 A;  5L95 C;  1NVI D;  4NJC A;  1MHX A;  3ZNI D;  2IJ0 A;  3ZIM A;  3H6N A;  1TIF A;  3IBE A;  1TS2 A;  2LHE A;  1E9M A;  4DK5 A;  4RM9 A;  2NVU I;  5IP4 D;  3PT2 B;  2JY6 A;  3IHP C;  1MFW A;  1NEK B;  2LJI A;  1WJ4 A;  2CHX A;  3PV1 A;  2Y5B B;  3KH0 A;  3ZW3 A;  1ZDX A;  1EUV B;  4K7U A;  4IM0 A;  4YL8 A;  2KLC A;  1C9F A;  2J0J A;  3UGB B;  4MEM A;  3LB8 C;  2BS4 B;  1NDD A;  3KVF B;  4DWF A;  1JWB D;  2WDR B;  3RMK C;  1WR6 E;  3KUC B;  4MDK E;  2KJR A;  3VTU A;  4NAW B;  3RNA C;  3ZUN A;  1YD8 U;  4HPP A;  3URY A;  4B0E A;  2RDH A;  2GLS A;  3LDZ E;  3NS1 A;  3QAQ A;  2KT7 A;  2MP2 B;  3PZD A;  4N59 A;  2KLG A;  5IN7 A;  3N32 A;  3R3M A;  3OLM D;  5IAA C;  4XX5 A;  3VR8 B;  1L7Y A;  2HTH A;  3NHE B;  2RR9 A;  2IGG A;  2PW9 A;  4O1N A;  3AEB B;  1CQV A;  3WAM A;  1UWX A;  4EOY A;  2ONQ A;  4ZHO A;  1RWS A;  1FFV A;  1DOY A;  1D5X C;  1TBE A;  3HM6 X;  2K1F A;  3T9L A;  1SJH D;  4G0N B;  3CMM B;  4LNI A;  2YEP F;  4ZYS A;  3V6E B;  4C7Z A;  1GB1 A;  3DBH I;  2KFJ A;  3Q3J A;  1V1O A;  3VUX A;  5LNK 1;  1CJE A;  3DBR B;  1IGD A;  3QHT A;  3DBH B;  1TGZ B;  3P4S B;  1N60 A;  2JZ3 B;  3MTN B;  3X0W A;  1QQR A;  4YXD B;  2K8B A;  3L13 A;  2OOB B;  4KIK B;  1KOT A;  3EFU A;  1ET6 A;  1HTO A;  2LUE A;  3QA8 A;  5IO9 A;  2LXC A;  3ZGZ A;  2JXT A;  4DBG A;  3PTF C;  2WXR A;  2KWD A;  3B0A A;  4AWJ A;  4I6P A;  2IO3 B;  5FR3 A;  4KZC A;  2RGF A;  4G3X B;  5CHV C;  3H9D A;  3Q6B A;  5DPR A;  2REX A;  1K53 A;  3ZKJ C;  3IT4 B;  4DXG A;  1TS3 A;  1JQ4 A;  3C8Y A;  1HEZ E;  2XK5 A;  3N1Y C;  1BUI C;  2L1A A;  1WSP A;  5D2M B;  1JWM D;  4KGS A;  1ZE3 D;  3QAR A;  2K3U A;  1GJZ A;  1TY0 A;  1JAL A;  2BQQ A;  3MJW A;  2KDM A;  2BS2 B;  1P7E A;  2WNM A;  3HIZ A;  3ZVV A;  1ET9 A;  3MP9 A;  2JZZ A;  3L16 A;  2ZVN A;  4RGN A;  4ARC A;  1WZ0 A;  2WXN A;  2BT6 A;  4B6W A;  1KTK A;  4WQM A;  5HFY A;  2K6D B;  2IZV B;  2QIE B;  4W9E A;  4FHK A;  1XCT L;  4OZC A;  4OVU A;  4WWM A;  2WXQ A;  1ZDV A;  4BAX A;  3M62 B;  2IO2 B;  4L2Y A;  4R3D A;  1SE4 A;  3QX1 A;  2XN9 C;  4ANV A;  2MSE D;  4TV3 A;  1GPX A;  5FKA C;  2M56 B;  5CHF A;  4C00 A;  4ANX A;  4HRS A;  5G5G A;  3MJ5 A;  4ARI A;  4FUL A;  4IWQ A;  1SGH A;  1YX6 B;  1ZPS A;  2JX5 A;  2BB6 A;  3AN1 A;  4F1S A;  1S3S G;  3A9J A;  3Q8A A;  4II3 B;  2E6X A;  1FNW A;  2DZI A;  1FO4 A;  2KHW B;  2KWC A;  4EKU A;  1VDV A;  4XC2 A;  3Q3F A;  2N4F A;  3NJT A;  4W9D A;  3BII D;  1KH0 A;  1WXA A;  2L8J A;  2FCS A;  2JQR B;  4OZB A;  1RM6 C;  1WZ3 A;  2NR2 A;  5I4D A;  1JWU D;  2R2Q A;  2JPH A;  3MC9 A;  4M02 A;  2FCM A;  4WUR A;  1OQY A;  4RGT A;  1ZW7 A;  3TL5 A;  2WDQ B;  2L52 A;  4L23 A;  2OJR A;  1TTN A;  5JZE B;  3ABV B;  5JXV A;  1FXI A;  3HHM A;  4YWG G;  1HXY D;  1Z5S B;  4ZDV A;  2CKH B;  3AEG B;  1AN8 A;  2BKF A;  3KLS X;  2IPK D;  2J4X A;  3E9S A;  2INP E;  2WXP A;  1PDX A;  4K3C A;  4G50 A;  3W1S A;  1V49 A;  4YTP B;  1WGG A;  3B2G A;  3BK2 A;  4NJ6 A;  2GBK A;  4OVV A;  3AI5 A;  3QIJ A;  3ML9 A;  3AV8 A;  3DHH C;  3AE6 B;  1RRB A;  4GGQ A;  5G5H A;  4YSX B;  2AQ3 B;  2LHD A;  2XEW A;  3EUB 2;  1WI0 A;  4LLG M;  1RYJ A;  2WP9 B;  1TZ1 A;  2KDF B;  1QOB A;  3NZU A;  3A4R A;  4IUM B;  1ACC A;  4ICV A;  4AJY B;  2RDG A;  2Z0E B;  2LRU A;  1R4N B;  3J9C A;  3DWM A;  3JSV A;  4ZYN A;  2KJH B;  1V97 A;  3UIO B;  2GBR A;  1I4P A;  2ASQ A;  4KDI C;  3VDZ A;  2BYV E;  5H92 C;  2ZW0 A;  3SEB A;  3Q8C A;  4F7Z A;  1WM3 A;  2BPS A;  4RM8 A;  3H7S A;  4USA A;  3SHQ A;  1YNT E;  3EA6 A;  1NBF C;  4GOC A;  4FJV B;  3FIL A;  4IG7 B;  4B9K A;  3IXS A;  5GXG B;  1Q0W B;  2PLP A;  2N9K A;  2JXX A;  4FHJ A;  1T0Q C;  3D32 A;  2DZJ A;  2J52 A;  5JHA A;  1ZUD 2;  2XK5 B;  1E7P B;  4YT0 B;  1SB3 C;  1YN3 A;  2C5L C;  3I3T B;  4P7I A;  2M0A A;  1FRR A;  1HQR D;  4IWP A;  2M17 A;  1WJ6 A;  2K25 A;  1DOI A;  1LO5 D;  2IDY A;  1WIA A;  2KDI A;  3QCA A;  4FLH A;  5D6J B;  2EKE C;  1UUP A;  2NTT A;  3ZJV A;  3TEZ A;  2Q5W D;  2Y3A A;  5TR5 A;  3RCZ A;  4KDL B;  3VAW A;  2ZEQ A;  4WQO B;  2Y5P A;  4A20 A;  3EFC A;  4GMV A;  3ZLZ A;  1I4X A;  2MJE A;  4REZ A;  4D2K A;  4DXA B;  2LVQ A;  3DVN U;  2QSD A;  1KJT A;  1C78 A;  2K22 A;  1WM2 A;  1VZ7 A;  3JYU A;  2LEK A;  4KVG B;  3BYY B;  3FAH A;  2V0G A;  3BYT B;  5HI1 A;  4QAY A;  2MRP A;  1L6V A;  4OW0 A;  2PJH A;  4EZK A;  2D07 B;  4HPM B;  4JWS C;  2KK8 A;  5LXI B;  5D3I B;  3TSS A;  2LZ6 A;  4NZL B;  2KD0 A;  1E90 A;  3GZN B;  3WAL A;  1L0X B;  1K52 A;  3JW0 X;  1IP9 A;  4ZRP A;  1KLG D;  3MFG A;  2V3P A;  2IYD B;  3N1X C;  3U30 A;  2PTL A;  3AU5 A;  2B3A A;  2BYT A;  1C1Y B;  1SIF A;  4HKQ A;  5C1Z A;  4RGO S;  1RAX A;  3A33 B;  4GB9 A;  4RNA A;  1BXT A;  2K5P A;  2QC8 A;  3VUW A;  3A9J B;  4CHK A;  5JHB A;  1B9R A;  1OEY J;  2DZK A;  1WGH A;  1Q10 A;  4KSK C;  4L1B A;  3TEY A;  4AOF A;  3CWI A;  4K1R B;  2LD9 A;  3ETR A;  4JLC A;  4KKI A;  2WDT B;  3L10 B;  3EGR A;  3HUI A;  3APC A;  2W54 A;  4IW0 A;  2RDB C;  3DBS A;  2IGH A;  1YOV B;  2MQJ A;  1WF9 A;  4HLE A;  3SR6 A;  2XBB C;  3AE5 B;  2JUO A;  3ZTD A;  1V1P A;  1KLV A;  3NG0 A;  3DBL I;  2L3Z A;  3IAM 1;  2L83 A;  4MJS A;  1IUE A;  3GE3 C;  3PPA A;  1QIL A;  1WWT A;  1H8C A;  3DBL B;  1TKG A;  2LRW A;  4A3O A;  2N9X A;  4KKJ A;  2X38 A;  2R61 A;  5E6P A;  2QCZ A;  4W9J A;  1N5W A;  2WHI A;  3AE2 B;  3VVW B;  4KV2 A;  4FJZ A;  1ISN A;  3AE4 B;  2GI9 A;  2YVC A;  3OAW A;  4WWP A;  3P4R B;  1EO6 A;  3P63 A;  2INN E;  3ZXR A;  1YN4 A;  1C3T A;  2IY1 B;  4ZRJ A;  3KUZ A;  4HK2 A;  3BVM A;  2G1E A;  3QJZ A;  3M3J A;  1YMH E;  5G2N A;  1E7V A;  1SE3 A;  1EU3 A;  1E8X A;  4N58 A;  4RMA A;  1VR9 A;  2LMC A;  4JE3 B;  4BBN F;  3PRZ A;  2J0K A;  3JSV B;  2AQ1 B;  4TQ0 A;  4A9A A;  3I9V 1;  2LUM A;  1PQS A;  2G4S A;  4MAC A;  4M8N A;  2D3C A;  2MEK A;  2M1M A;  2MW5 A;  5DCN A;  5EE3 A;  4MM3 A;  1WXM A;  3AMZ A;  2L32 A;  1FEH A;  2FCN A;  3DWG C;  2V4I B;  2ZJD A;  3Q2A C;  2ACZ B;  3OG5 A;  4E71 A;  1N61 A;  3IFW B;  4LNN A;  5G55 A;  3FIL B;  2BYE A;  2HJ8 A;  2UYZ B;  2M19 A;  1XO3 A;  4HWI B;  1E8W A;  1LGR A;  4HPL B;  1R4M B;  2GRI A;  3RN9 C;  1U4A A;  3RNC C;  1YIW A;  2C7H A;  4BZA A;  1VZ8 A;  1WFY A;  3AE9 B;  2W9N A;  4B0M A;  5E6J A;  4P1C C;  2LGI A;  3RNE C;  2LI5 A;  5J2R A;  1SIJ A;  4JL9 A;  3R7R A;  4WJO A;  4W9L A;  4XGA B;  3ZDT A;  2G4D B;  1CMX B;  1MVK A;  4GN1 A;  5T8I A;  2OJW A;  4C56 C;  2MHJ A;  1FXA A;  4EUT A;  2MBO A;  2L0T A;  1F52 A;  4EFO A;  1T0R C;  2NMQ A;  2D3A A;  1UH6 A;  3EC8 A;  1OEY A;  1F0Z A;  3Q8E A;  3VRB B;  3E56 A;  3VFK A;  1TY2 A;  2D11 A;  3DCG A;  4AUQ C;  3PO0 A;  2MA9 B;  1V2Y A;  2BS3 B;  2BB5 A;  3JVZ X;  3UQB A;  2MH7 A;  3DBR I;  2KAC A;  2SEB D;  3Q69 A;  3A4S C;  1V80 A;  4II2 B;  2QEJ C;  5KHO A;  3SDL C;  2JVC A;  1GB4 A;  1X1M A;  2K6Q A;  1KF6 B;  2LXA A;  4Q2J A;  3R66 C;  2CU1 A;  2JYT A;  4S0R A;  5IKC M;  1WRI A;  1UGM A;  2MBE A;  1I35 A;  4P6V F;  2N7J A;  1XLO A;  2N7D A;  3AE8 B;  1C4C A;  4K3B A;  5FR6 A;  2WXG A;  4ZHP A;  1MG4 A;  2WXO A;  3AE3 B;  3BVG A;  2TSS A;  4MSQ B;  3PRP B;  2WWZ A;  1UEL A;  2KKC A;  4PK1 A;  1JRO A;  2RSU A;  1Y8R C;  1FPY A;  4G11 A;  3VTV A;  2FID A;  2IO0 B;  2GB1 A;  1TS4 A;  1E8Z A;  5BYQ A;  3TJP A;  4CYE A;  2G3Q B;  1V1P B;  1T5X D;  4NQL B;  2GBM A;  4NQK E;  4MJS B;  5GMV A;  2G45 B;  4PS8 A;  2FIF A;  4PS3 A;  2KMA A;  1GTE A;  2KQS A;  5C3J B;  1MJD A;  4PYU A;  4KX6 B;  2ZW1 A;  4PYZ A;  2Z8L A;  2KWU B;  4GDL A;  3U7Z A;  3W5U B;  4M01 A;  4MGI E;  1WYG A;  2CS4 A;  4WJN A;  3CF6 E;  2PKO A;  3NY5 A;  1P3Q U;  4ZRK A;  2H89 B;  3PZ7 A;  1WGY A;  5E6N A;  2PE9 A;  1E7U A;  3HVD A;  4W9G A;  4FA6 A;  2J0M A;  1N6Z A;  2HJ1 A;  2WXL A;  1MG8 A;  2IO1 B;  3GE8 C;  3OWE B;  3VQI A;  3ML8 A;  1M94 A;  2C7M B;  3NOB A;  5EE0 A;  1RFA A;  4BKS A;  1WRD B;  1WYW B;  1PGX A;  3RNF C;  4MM3 B;  5D3D A;  1T3Q A;  4AQ7 A;  1F2R I;  1ZXH A;  3I63 C;  2MBB B;  4MGK E;  4MH0 E;  3WAP A;  3SD5 A;  2K8C A;  2QIL A;  1UD7 A;  3DQV A;  4HRO A;  1L0V B;  3QQ8 B;  1F77 A;  1HZ6 A;  1QZE A;  4A6Q A;  5LXH A;  4MT5 A;  1VRA B;  1V81 A;  1Z2M A;  2CR5 A;  1JRU A;  2ZZP B;  5AUK A;  1K51 A;  4A8X C;  2AWT A;  2KFK A;  1WJN A;  1EWY C;  1D6E C;  4J3O D;  2VZK B;  2ZPN A;  4RGM A;  3AM9 A;  2KX0 A;  3DOW A;  4LNK A;  3AEF B;  1E6E B;  1SSN A;  4BKS D;  4WWN A;  1ZGU B;  2PIA A;  1WY8 A;  4WWO A;  3TBL D;  3W2D A;  1OFF A;  2NBW B;  2NBU A;  2PE6 B;  3NRZ A;  5MPO A;  2LGY A;  4RF0 A;  2WQY B;  1J0G A;  2KTR A;  1UWM A;  4MGZ E;  3ENE A;  4PS7 A;  4EZL A;  4IM2 A;  1WXV A;  2KTF A;  3RUI B;  3RI7 C;  1ENF A;  3U8Z A;  1QLB B;  3P42 A;  4YTM B;  1JRP A;  3U2S C;  2N7E A;  3K9P B;  1NYR A;  4JQW C;  1RFK A;  1N5X A;  1UGJ A;  1R4N I;  4S17 A;  1I4H A;  4PT5 A;  3WA0 A;  2JYE A;  1P0R A;  2LWP A;  2L0F A;  2KN4 A;  2ICI A;  3VRA B;  2CU3 A;  2JZP A;  2DWQ A;  3H8H A;  2JF5 A;  4WH4 A;  4IC7 B;  3VXW A;  2G9H D;  3KUD B;  2BWE S;  2NBV B;  2PEA A;  1BT0 A;  3L0W B;  1QT9 A;  4IKG A;  1DYQ A;  1GC6 A;  3ZXV A;  3PRM B;  3S2A A;  5CTR C;  4MSM B;  2VH2 A;  1AW7 A;  1SEB D;  2FNJ B;  3QK0 A;  5J17 A;  3V60 A;  3Q3M C;  1TKY A;  4LCD E;  1C79 A;  3NVW A;  2VH1 A;  2KXJ A;  3ZYY X;  3HRD D;  4BKT A;  1XF5 L;  1L4Z B;  1YQ3 B;  5HKH A;  1ZKH A;  3U52 E;  1M4V A;  2A5U A;  1V6E A;  2I38 A;  3IT6 B;  3NVY A;  1J19 A;  3BVZ A;  3QWZ B;  1ROE A;  2WX1 A;  4X57 B;  1T0S C;  1J7A A;  2JU6 X;  3TCA A;  3LJ3 A;  3ZTC A;  4FAD A; 
#chains in the Genus database with same CATH homology
 1IGD A;  1VJK A;  1IGC A;  2DLB A;  5TSS A;  3P4S B;  1N60 A;  3BVM A;  1V8C A;  1QQR A;  2W55 A;  4YXD B;  2NTS A;  2G1E A;  3P4Q B;  1YMH E;  3BWU D;  2EKI A;  2WXI A;  4GDL B;  1SE3 A;  1EU3 A;  1ESF A;  4N58 A;  1VR9 A;  2LMC A;  4JE3 B;  1ET6 A;  4C80 A;  1FIQ A;  1YJI A;  3ZGZ A;  2E3T A;  2AQ1 B;  4TQ0 A;  1TJE A;  2JXT A;  3Q8B A;  2WXR A;  2KWD A;  3I9V 1;  4A9A A;  1MHH E;  5FR3 A;  2LUM A;  4MAC A;  5EE1 A;  1MPE A;  2CJN A;  2LFI A;  3P4P B;  3TEW A;  1K53 A;  2MEK A;  2DYO A;  3IT4 B;  4DQO C;  5EE3 A;  3UI3 A;  1NEN B;  4DXG A;  3AMZ A;  2L32 A;  1FEH A;  1XCQ L;  3DWG C;  1FRD A;  1D4B A;  1TS3 A;  3SFD B;  2V4I B;  2W82 A;  1HEZ E;  3C8Y A;  1JQ4 A;  3T3N A;  3W5V B;  2ACZ B;  1BUI C;  1N61 A;  1WSP A;  2L1A A;  1JWM D;  4KGS A;  3PZ8 A;  1ZE3 D;  4KGR A;  3FIL B;  1E10 A;  1N63 A;  2M19 A;  5HG2 A;  2K3U A;  1XO3 A;  1FD6 A;  4OVZ A;  5FK9 C;  1XLQ A;  1TY0 A;  1FCL A;  4RFB A;  3V05 A;  1JAL A;  2GRI A;  2RMM A;  4OHJ A;  2KDM A;  2WXH A;  1P7F A;  2BS2 B;  1P7E A;  1XLN A;  2WNM A;  3NUH B;  4EE2 A;  3LYY A;  1VZ8 A;  4XDC A;  3KWV A;  1C76 A;  3AE9 B;  1ET9 A;  2WU5 B;  3MP9 A;  5HHD G;  4RGN A;  4B0M A;  4ARC A;  5E6J A;  3HVZ A;  2LGI A;  2BT6 A;  2WXN A;  1TKE A;  4XWW A;  1KTK A;  4WQM A;  1SIJ A;  4HKZ E;  5HFY A;  1KFY B;  3U4E G;  2K0P A;  2XNA C;  1FNU A;  2BTE A;  1MVK A;  5T8I A;  2QIE B;  4IDI A;  4C56 C;  1FXA A;  1XCT L;  4OZC A;  4GDK B;  3CIR B;  3I57 A;  1PGA A;  1GAQ B;  4YTN B;  4WWM A;  4N6E B;  2WXQ A;  1ZDV A;  3AE1 B;  2NMQ A;  1J7B A;  2Y5C A;  4L2Y A;  4R3D A;  4M0W A;  1A70 A;  1SE4 A;  4A55 A;  1F0Z A;  3GP7 A;  2XN9 C;  3L4P A;  3R2T A;  3Q8E A;  3VRB B;  2KMM A;  5BYS A;  3E56 A;  3AEC B;  1GPX A;  1TY2 A;  3GS2 A;  3SFE B;  5FKA C;  1XXG A;  2M56 B;  5H8Y E;  1GOZ A;  3LXF A;  1L0Y B;  2MJD A;  5BMH A;  3PO0 A;  4WAF A;  1WXQ A;  4HRS A;  5G5G A;  3MJ5 A;  3N9Y C;  2BS3 B;  2BB5 A;  1YQ4 B;  4ARI A;  1E0Z A;  3AED B;  3MHZ A;  1XEE A;  3P1M A;  1CK1 A;  1WGK A;  2MH7 A;  1ZPS A;  2KAC A;  2JX5 A;  2SEB D;  3Q69 A;  3GB1 A;  2BB6 A;  2J53 A;  1K50 A;  3AN1 A;  3V3X A;  3Q8A A;  4RCO A;  2E6X A;  2QEJ C;  1FNW A;  4JPS A;  2CJO A;  2V3N A;  4NAM A;  1FO4 A;  4AS1 A;  1GB4 A;  1XLP A;  4LTU A;  1VDV A;  1PGB A;  3B9J A;  1DOX A;  1KF6 B;  4Q2J A;  1QOF A;  1UNS A;  2JYT A;  3T3O A;  1L6U A;  1WRI A;  1J7C A;  3BII D;  1KH0 A;  4P6V F;  4RF1 A;  2N7J A;  3RPF C;  1XLO A;  2JQR B;  4OZB A;  3AE8 B;  1FFU A;  1RM6 C;  1C4C A;  1KRH A;  4UDU C;  4OZA A;  5I4D A;  1JWU D;  1C4P A;  2WXG A;  4ZHP A;  1ZOY B;  1L5P A;  1YJJ A;  3ZJU A;  4MH8 A;  2WXO A;  3AE3 B;  2HDE A;  2TSS A;  3BVG A;  2W3S A;  4WUR A;  4US9 A;  4XWT A;  4CQN A;  2H88 B;  1JWA D;  1QOG A;  2IGD A;  1JRO A;  3AH7 A;  1D5Z C;  3BK1 A;  1GT8 A;  2FE8 A;  5AUI A;  2KAJ A;  1IBX B;  1GTH A;  4RGT A;  2YEP B;  1PUT A;  2OHF A;  2WDQ B;  1NI3 A;  1R7S A;  2GB1 A;  2L52 A;  4L23 A;  3ABV B;  1TS4 A;  5JXV A;  1QOA A;  1FXI A;  1JML A;  4YWG G;  2EEL A;  1HXY D;  5BYQ A;  2RPV A;  1PYW D;  3AEG B;  1AN8 A;  1N62 A;  4YSY B;  1C77 A;  3KLS X;  5BYR A;  2IPK D;  2J4X A;  1V1P B;  1T5X D;  3E9S A;  2INP E;  2WXP A;  1PDX A;  2FBW B;  3W1S A;  1KLU D;  3NVZ A;  4YTP B;  3B2G A;  4C7Y A;  3BK2 A;  4A90 A;  2N0S B;  1SXT A;  3AV8 A;  1GTE A;  3AE6 B;  1BML C;  2WXM A;  1DGJ A;  5G5H A;  4YSX B;  5C3J B;  2AQ3 B;  2LHD A;  3EUB 2;  5BMG A;  4JWU C;  4LLG M;  1RYJ A;  4KX6 B;  2ZW1 A;  2DBY A;  2Z8L A;  2WP9 B;  1C4A A;  5EE9 A;  3TEX A;  1QOB A;  1ZXI A;  3U7Z A;  3W5U B;  1ACC A;  1WYG A;  1I4Q A;  2BW2 A;  3NZ3 A;  2RDG A;  3J9C A;  3DWM A;  1ZP0 B;  2JWU A;  2WXF A;  2PKO A;  4HJG E;  4FXC A;  1AWD A;  4TSS A;  4LK0 M;  1JW9 D;  2B76 B;  1V97 A;  1I4P A;  2H89 B;  3PZ7 A;  1VZ6 A;  2KQ4 X;  5H92 C;  2FUG 1;  2WXJ A;  2ZW0 A;  1FNV A;  1B1Z A;  3HVD A;  1CZP A;  5D7G A;  1FM0 D;  3SEB A;  3Q8C A;  2K9X A;  2WXL A;  4ZOH C;  3CF4 A;  4P16 A;  3OWE B;  2D5G A;  2WU2 B;  5BMI A;  4USA A;  3VQI A;  1YNT E;  1FMA D;  3EA6 A;  1AYF A;  3FIL A;  4RH6 A;  2J42 A;  3AE7 B;  5EE0 A;  1STE A;  1JWS D;  4KGT A;  3NVV A;  3IXS A;  5GXG B;  1PGX A;  2PLP A;  1EM7 A;  4MM3 B;  2N9K A;  1JCK B;  5D3D A;  1QF6 A;  1T3Q A;  3AEE B;  1F2R I;  1ZXH A;  3ZQ4 A;  4AQ7 A;  1VLB A;  2J52 A;  1ZUD 2;  3R8B A;  1E7P B;  4YT0 B;  3WCQ A;  1SB3 C;  1YN3 A;  2VZK D;  2M0A A;  3ZJT A;  3W9C B;  1H7W A;  1FRR A;  1HZ5 A;  1T6B X;  1HQR D;  2QIL A;  1L0V B;  4HRO A;  1DOI A;  1EWC A;  1LO5 D;  2IDY A;  2WLB A;  1F77 A;  1SJE D;  3VR9 B;  1HZ6 A;  4JX1 C;  2NTT A;  1UUP A;  3ZJV A;  1I7H A;  4A6Q A;  3TEZ A;  2Q5W D;  2Y3A A;  4MT5 A;  1VRA B;  1I4G A;  2PVG C;  2I2Y A;  2SAK A;  2Y5P A;  3O13 A;  5AUK A;  4ZRQ A;  1K51 A;  3RFZ B;  4A8X C;  1I4X A;  3KQ4 A;  2MJE A;  1YN5 A;  4REZ A;  4D2K A;  1EWY C;  1D6E C;  4J3O D;  2QSD A;  1H7X A;  1C78 A;  5C2T B;  2K22 A;  1NVI D;  2VZK B;  4RGM A;  1SE2 A;  1VZ7 A;  3AM9 A;  2LEK A;  4NJC A;  1MHX A;  3FC4 A;  2N9L A;  3R2I A;  3BYY B;  3FAH A;  2V0G A;  2PVO D;  3BYT B;  5HI1 A;  2QJL A;  3AEF B;  1QKZ A;  4US8 A;  2OED A;  1E6E B;  1L6V A;  1SSN A;  4OW0 A;  2IJ0 A;  2PIA A;  2BBC A;  1TS2 A;  2LHE A;  1E9M A;  1Y56 A;  3W2D A;  1MI0 A;  1OFF A;  5MPO A;  3NRZ A;  4RF0 A;  2WQY B;  1NEK B;  2LJI A;  1SF0 A;  4JWS C;  1UWM A;  2W3R A;  4TMA B;  5D3I B;  3TSS A;  4NZL B;  1ZDX A;  4XE0 A;  1L0X B;  1K52 A;  4ZRP A;  1ENF A;  1OQR A;  1KLG D;  3MFG A;  2V3P A;  1QLB B;  3P42 A;  4YTM B;  1JRP A;  2PTL A;  3U2S C;  1FCC C;  1C9F A;  1F2R C;  2WS3 B;  2BYT A;  1NYR A;  2DYM A;  4HKQ A;  1RFK A;  1N5X A;  4RGO S;  3LB8 C;  2BS4 B;  1UGJ A;  1I4H A;  4PT5 A;  4RNA A;  1BXT A;  1JWB D;  2WDR B;  2JYE A;  2K5P A;  1D5M C;  1B9R A;  1TZO A;  3KWL A;  2ON8 A;  1Q10 A;  2KN4 A;  2ICI A;  3VRA B;  2CU3 A;  3Q8F A;  2JZP A;  2DWQ A;  4L1B A;  3TEY A;  4NAW B;  3H8H A;  3CWI A;  4WH4 A;  2PMV A;  1TYG B;  3URY A;  2G9H D;  4B0E A;  3ETR A;  2RDH A;  4KKI A;  3B2F A;  3EGR A;  3HUI A;  3AEA B;  2W54 A;  1QT9 A;  2IGH A;  3NS1 A;  4IKG A;  1DYQ A;  3TUO A;  4XDD A;  1IBX A;  2MJ3 A;  4WIP A;  1EU4 A;  4N59 A;  3IAS 1;  1NYQ A;  4GLS C;  1AW7 A;  3SR6 A;  3VR8 B;  1SEB D;  3AE5 B;  2HTM E;  4IOI E;  1TS5 A;  1SBB B;  1TKY A;  3AB5 A;  1C79 A;  3NVW A;  2WXK A;  1I4R A;  1V1P A;  4TQ1 A;  3BZD B;  1OQQ A;  3ZYY X;  3IAM 1;  2L83 A;  2IGG A;  2PW9 A;  3HRD D;  3AEB B;  1IUE A;  1XF5 L;  4HEA 1;  1L4Z B;  1QIL A;  4O1N A;  1YQ3 B;  1WWT A;  1CQV A;  4ITK A;  3U52 E;  4YSZ B;  1M4V A;  1UWX A;  2QMT A;  1TKG A;  2ONQ A;  4ZHO A;  1RWS A;  1FFV A;  1DOY A;  2WDV B;  1D5X C;  2I38 A;  3IT6 B;  4KKJ A;  2X38 A;  2R61 A;  3NVY A;  2AQ2 B;  3BVZ A;  1L4D B;  1SJH D;  1N5W A;  3AE2 B;  4DXF A;  1ROE A;  1PFD A;  3MC0 B;  2JSV X;  2YEP F;  1J7A A;  4ZYS A;  2JU6 X;  1HA5 A;  4C7Z A;  1GB1 A;  2GI9 A;  3AE4 B;  3P4R B;  3P63 A;  1V1O A;  2INN E;  1CJE A;  5LNK 1;  4H2A A;  1YN4 A;  2AX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...