2BS4B

Glu c180 -> ile variant quinol:fumarate reductase fromwolinella succinogenes
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental Support for the E-Pathway Hypothesis of Coupled Transmembrane Electron and Proton Transfer in Dihemic Quinol:Fumarate Reductase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords QUINOL-FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A
total genus 61
structure length 239
sequence length 239
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2bs4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bs4B01
1L6VA 1PUTA 2QJLA 1JW9D 1L5PA 3AEDB 5H8YE 4US8A 1OQQA 3P4SB 1N63A 1NEKB 4P6VF 5G5HA 1DOXA 5MPOA 1E10A 3VR9B 3SFDB 1FFUA 3AEFB 5G5GA 1VDVA 1ZP0B 2ACZB 5H92C 2WLBA 3ABVB 4YTPB 3P63A 4N6EB 1EWYC 2M56B 1FRRA 1RWSA 3CF4A 1VJKA 1WYGA 1AYFA 1L0VB 1RM6C 3NVWA 1NVID 1ZUD2 1QOBA 1VLBA 2KAJA 2W3SA 3AE3B 4FXCA 2H89B 4YT0B 2PVGC 4ITKA 2BS4B 2QIEB 4YSXB 3LXFA 4JX1C 3NRZA 2MH7A 2CU3A 2L83A 1NENB 1CJEA 3PO0A 1JALA 3ZYYX 1NI3A 1F0ZA 5EE0A 2E3TA 2WS3B 1KRHA 5AUIA 1FO4A 2K5PA 3CIRB 1KFYB 2MJDA 1E6EB 3P4PB 3AE5B 2WP9B 3VRAB 1N62A 1H7WA 2WDVB 4KX6B 1V8CA 2HTME 2WDQB 1RFKA 1FXAA 1GT8A 1E0ZA 1JROA 1FRDA 1IUEA 5C2TB 1J7CA 1DOIA 1FM0D 2K9XA 3ETRA 1QLBB 2N0SB 4N58A 1V97A 3AMZA 5GXGB 1FIQA 3KWLA 1ROEA 1QOGA 3LB8C 2W3RA 2B76B 4A9AA 2WQYB 2BS3B 1JWAD 1TKYA 1WWTA 2AX5A 2JQRB 3NS1A 2DWQA 3P4QB 3AE8B 1QOAA 2OHFA 1SB3C 3DWGC 4USAA 2H88B 1GTHA 1SF0A 1TKGA 2DBYA 1OFFA 2G1EA 4YSYB 2JX5A 3AEBB 4WWMA 1GAQB 3AEGB 2KMMA 2M19A 2WDRB 2CJNA 4ZOHC 1RYJA 2MJEA 4ZHOA 2PKOA 3AM9A 1I7HA 1UWMA 2MJ3A 1XLOA 1N61A 2PVOD 3AB5A 2BS2B 1JQ4A 5EE3A 1FMAD 1L6UA 4HRSA 3CWIA 3W9CB 1DOYA 1E7PB 1XLPA 5C3JB 2BT6A 3AV8A 1N60A 3BIID 3FC4A 4HROA 3AE7B 4N59A 3L4PA 3AE4B 4LTUA 2FBWB 1FFVA 4IDIA 1WXQA 1ZXIA 3DWMA 3W5UB 3AE9B 1E9MA 1N5WA 1SIJA 3HUIA 3P1MA 4US9A 4YTMB 3B2GA 1QT9A 1DGJA 2LEKA 3SR6A 3AE1B 1NYRA 1T3QA 4JWUC 1OQRA 3NVVA 1XLQA 1YJJA 2Q5WD 3WCQA 1XLNA 5EE9A 3AEAB 1QF6A 1ZOYB 1YQ3B 3NVZA 3SFEB 3AN1A 4ZHPA 2CJOA 2EKIA 1AWDA 3FAHA 1J7BA 1B9RA 1CZPA 4YSZB 5AUKA 1JRPA 3EUB2 3B9JA 4WQMA 1YQ4B 1YJIA 3NVYA 1GPXA 1J7AA 1GTEA 1JWBD 4C7YA 1FXIA 3VR8B 2W54A 3W5VB 2L52A 4JWSC 1PDXA 3AH7A 1KF6B 1TKEA 5EE1A 3AE6B 4C7ZA 1PFDA 4YXDB 2W55A 1TYGB 2K22A 3B2FA 2WU2B 3AEEB 1XO3A 3RPFC 1WGKA 1TJEA 3P4RB 2WU5B 2Y5CA 3HRDD 3AE2B 1QOFA 1WRIA 3AECB 4YTNB 3HVZA 1N5XA 1A70A 1R7SA 4C80A 1NYQA 1H7XA 3VRBB 2PIAA
chains in the Genus database with same CATH superfamily
2QJLA 1L5PA 4KV2A 3BVGA 3HK0A 3S2AA 5J18A 2BBCA 4WJPA 1E10A 3VR9B 4K3BA 3AEFB 2R2OA 3H6NA 3RZFA 3E56A 4YTPB 4MM3A 1WE7A 4DHZB 2M4NA 1L0VB 2IPKD 2BYTA 3I5JC 5G55A 3QX1A 3A33B 2CU3A 4FHKA 4II2B 4HK2A 2LUEA 4OW0A 2HJ8A 1NI3A 2N9KA 2K8BA 2NPTB 5CHFA 4TV3A 4DHZE 2ZVNA 2JZZA 1I4GA 3ETRA 2N0SB 1TT5B 2NBVB 2W9NA 4BKSA 5LXHA 2CKHB 4WQMA 3DWGC 2KO3A 4USAA 5BYQA 5CHWA 3L0WB 2BWFA 3AEBB 2KQSA 3U7ZA 3KWVA 2JRIB 2JPHA 4K81A 5FK9C 4MELA 1YX6B 2D10A 1XLPA 3RULA 4HWIB 3UF8A 3K9OB 1SIJA 3RNCC 1XLQA 3ZRFA 2C5LC 2PE9A 3TEXA 4NQKE 3GOEA 1C78A 4HJGE 1KF6B 5EE1A 4HXDA 5GMVA 2N1VA 2L32A 2K25A 3R2TA 2UYZB 4GB9A 1GB4A 2AQ2B 3HM3A 1AW7A 3D32A 4YTNB 4EZJA 4KGTA 2LRWA 3VRBB 4ZRIA 3ZIMA 3V62A 2IO3B 2KZRA 1TIFA 5HG2A 3SFDB 1EU4A 4KKJA 1HZ6A 3URYA 1EWCA 2MBBB 1QQRA 4GXBA 1VLBA 1NI2A 3IBEA 4MJSB 4IKGA 3ZRCA 2QIEB 3LXFA 3RNBC 4I6LB 3NJTA 2QEJC 1KRHA 2GLSA 4NZLB 5E6JA 2MJDA 3DBHI 2N7DA 1RFKA 1GT8A 1IP9A 2DYBA 3DBLI 3ZNGC 3AI5A 3WANA 1WF9A 1QLBB 1PGAA 3VDZA 3PREA 3RNFC 3KWLA 2WXQA 2IYDB 4G11A 1JCKB 2CS4A 2ZNVB 1TS5A 1UBQA 3TL5A 1IBXB 4HPPA 3ZTCA 3W1YA 1GNUA 2VZKD 4M8NA 4NQLB 2A4ZA 2BTEA 3T9LA 2MJ3A 1XLOA 2LXCA 4HRSA 3N9YC 1WXSA 4BZAA 2DAFA 4HEA1 2J7QB 1HTQA 4BOZB 3C0RB 3ZDMC 2D2QA 3AE1B 3NVVA 3Q3MC 2Y5PA 3NOBA 4IM2A 4W9JA 1XD3B 1JWBD 2WGSA 4C7YA 2N1WA 2DNFA 3KYCD 2LMCA 3PLUA 4G0NB 3A9JA 1WZ3A 2L8JA 3KW5B 3N1ZC 1WGKA 2IO2B 4KVGB 1WE6A 2WXGA 2Y5BB 3NS8A 2FCNA 2Y3AA 1WR1A 4FA6A 3AU5A 1Z5SB 3A1QA 3P4SB 2KLGA 4A90A 2K39A 5MPOA 1JWUD 2IO0B 2WWZA 1A5RA 3CF4A 1AYFA 2LGXA 1E8WA 3PZDA 4OZCA 2AQ1B 1WR6E 3HHMA 5JHAA 4MGKE 3ALBA 2PVGC 2QHOA 2KKCA 5AZHA 3PO0A 1SSNA 4GDLB 1KJTA 3R7RA 1KOTA 4DHJD 1LXDA 3IAS1 2N7JA 4YL8A 3RT3B 2B3AA 1IUEA 4WJNA 3GZNI 2AQ3B 3Q8CA 4LLGM 1C77A 1SE2A 2LVPA 4JLCA 4GLSC 3GE8C 4NJ7A 1GAQB 2M19A 4IOIE 3A4RA 2HJ1A 3VH3B 1Q5WB 2GBJA 2KDFB 4C4VA 1L6UA 4ANWA 2JT4B 3BIID 4WAFA 1WYWB 1WGYA 1F2RC 3P1MA 2LEKA 1IGDA 5EE9A 3Q3OC 3SFEB 1JRPA 5LXIB 1FD6A 2INPE 5BMHA 1GTEA 4XYCA 1P7EA 3MHSD 3TSSA 4ZDVA 2YEPF 4HPMB 1KM7A 1PUTA 1FNWA 1GC7A 1VDVA 1I35A 1VJKA 2IDYA 1EU3A 3EA6A 3W1SC 3PRMB 3QJZA 2KANA 2XBBC 5IN7A 4JX1C 1NDDA 1WJ6A 1V80A 4E74A 1JALA 1JWMD 5EE0A 2O2VA 3U2SC 3ZQ4A 4RF1A 4TQ0A 1CK1A 4IC7B 4URKA 2PE6B 1V8CA 3H1UA 1LFDA 5IAAC 2KFKA 3FILA 1WRDB 1FM0D 5E6NA 2PW9A 5GXGB 1ZPSA 1ROEA 3LB8C 3V6CB 3NS1A 2JWUA 5C1ZA 4IW0A 2V1YA 3UQAA 5HFYA 5LLIA 5BYSA 2IY1B 4WWMA 3AEGB 2XN9C 2AL6A 2AEHA 3I9V1 4X57B 3GZNB 3ML9A 2J0JA 4G50A 1N60A 1C3TA 1ZXIA 4PYZA 2MCNB 2UWQA 3HUIA 1R4MI 1TS4A 2KN5A 4M0WB 1YOVB 1ISNA 3MHZA 4ICUA 1QF6A 4ACFA 2GI9A 4K7WA 1C4PA 1XCTL 3EUB2 2WXIA 2FIDA 2INNE 5DPTA 1YN4A 5BYRA 1Z2MA 2KC1A 1TKEA 3NY5A 4J6IA 1MHHE 4KDIC 1WSPA 1WIAA 3RPFC 1XO3A 3Q8BA 2DYOA 4IWQA 3IAM1 3AE2B 2D5GA 3BY4B 2V3SA 2G4SA 2LFIA 4P7IA 2JZ3B 2ACZB 5H92C 3RI7C 3DCGA 4WJQA 2LD9A 2XEWA 4ZYNA 1ZUD2 3TMPB 3B1LX 3LDZE 5KHOA 3MJWA 4HDOA 2KOXA 2L83A 2WHIA 3QC8B 2SAKA 2FUHB 4LCDE 5D94A 1D5ZC 3N1XC 1YD8U 1TZOA 2MWSB 2WP9B 1WI0A 5D6JB 1OEYJ 3PVLA 1HTOA 2D3GA 3VUXA 2WXOA 3DHIC 1OFFA 1UBIA 4GDKB 3OJ3A 3I63C 3AM9A 2SEBD 5EE3A 4WH4A 3FC4A 3MTNB 2V4LA 1VZ8A 1U4AA 2MEKA 1EUVB 1YIWA 5J17A 4US9A 1R4NB 3L10B 2QCZA 3TBLD 1YJJA 3Q3FA 2D3BA 3DHGC 4JE3B 2REXA 1WGRA 1P98A 4KGSA 2N9PC 3DVGX 1GPXA 1YJIA 5HKHA 2K1FA 3VR8B 2V0GA 2N9EB 4PS7A 4BVUC 4HCNB 4A6QA 2KVRA 1WX8A 4B0EA 3HVZA 1N5XA 5CHVC 1NYQA 4NAMA 2LXAA 3A9KA 4BAXA 1OQQA 1ZGUB 4W9KA 2K3UA 4JQWC 2DENB 1M94A 1KLVA 4W9EA 2V9HA 1SXTA 4RH6A 4B6WA 3BINA 1RLFA 5AEKB 3N3KB 1NENB 1CJEA 5TSSA 3AU4A 3CSFA 3WAMA 2JZPA 3DBSA 1FO4A 3A1QB 4EFOA 2WXPA 2OEDA 2WDVB 4OZAA 4AWJA 2EELA 4DXGA 1FRDA 4MEMA 1ZDVA 1J7CA 4MSQB 1ZW7A 3T3OA 3LJ3A 3BVZA 2KJ6A 2JQRB 2NTSA 1WZ0A 3P4QB 1UD7A 3H9DA 2KFKB 1TKGA 2AYOB 4WWNA 2BPSA 2JX5A 3SD5A 4NPNA 4RF0A 3WA0A 1IBXA 4NJ6A 2KDMA 1JQ4A 2NMQA 3WIMA 1FNUA 2V3NA 1WJNA 2L3ZA 2V3PA 1WFYA 3PZ8A 3AE7B 2PJHA 1FFVA 4II3B 2LGIA 1Y56A 4M0WA 2WX0A 5D2MB 4JWUC 4BFRA 5E6OA 2G45B 3RCZA 4MSMB 2KHWB 2JWZA 5AUKA 4A3PA 2LJIA 1HQRD 1HXYD 2BWES 3AH7A 2BGFA 1I4RA 2RDGA 3DDCB 4RCOA 1L0YB 3P4RB 4NY0A 1QOFA 4TSSA 1A70A 1R7SA 1VD2A 4WWOA 1E7UA 2ONQA 2LASA 4NJCA 2BKFA 2V4IB 3RYTA 4HCPB 1V5OA 3X0WA 1WMHA 3M3JA 1I4QA 4ARIA 4P1CC 1EWYC 1FRRA 4JIOU 3PHWB 1ZKHA 2KX0A 4OVVA 2KD0A 1I4XA 4I6PA 3NRZA 1WXMA 3ZXVA 4RMAA 3V05A 3A9KB 2BVCA 5AUIA 1KFYB 3P4PB 4ARCA 1MVKA 4DQOC 1XXGA 3TUOA 2M0XA 1MJDA 1OGWA 4KIKA 3WAPA 2KWDA 2JY6A 2I2YA 2C7HA 1K52A 1LM8B 4RM9A 3FILB 2WQYB 3VUYA 1YNTE 4ZOHC 2O6VA 1YN5A 2KFJA 2DBYA 1VZ7A 3KUZA 3OAWA 5IOIA 3N30A 4ZHOA 3ZO5B 5C23A 4FBJB 2J52A 2ZNVC 3L17A 2I1KA 1R4NI 3DQVA 2WXMA 4LNIA 3WALA 4LTUA 3M63B 2FBWB 2RD0A 3SHQA 3B0AA 1QT9A 4R3DA 2RMMA 4HKZE 3H8HA 3AEAB 2K8CA 2EMTA 1ZOYB 1VR9A 2IY0B 4DDGD 1XQQA 1J7AA 3VTWA 3QIJA 1GB1A 1V1PB 3J9CA 1S3SG 3PS6A 1F9JA 2GB1A 1PDXA 3KQ4A 4GOCA 4M8MA 4CHKA 5JHBA 2FE8A 4DBGA 5EDSA 4FLHA 3AEEB 3Q2AC 1SJHD 1C4AA 3PV1A 2LGDA 2NCNA 4OVUA 3QQ8B 5LNK1 4ANVA 3PHXB 2MP2A 3EHVA 2BYEA 4PT5A 5AZGA 3MC9A 4TUUA 1QKZA 1SGHA 3NUHB 2ZPYA 3RUIB 2NTTA 3VQIA 2KDIA 1MFWA 1TGZB 1P0RA 1KTKA 2LHEA 3CSTA 4XZ4A 1WY8A 3ZVVA 2K0PA 3R2IA 3RNAC 1WGGA 1UF0A 1LGRA 2INDC 2K5PA 2R2QA 3AE5B 1FNVA 1E0ZA 2MP2B 1DOIA 3U4EG 1QOGA 3M62B 1I42A 3TEZA 2OJWA 4MGIE 3E9SA 2OHFA 1XT9B 1WGHA 4EOYA 3KH0A 3NHEB 1P9DU 2VH1A 2CJNA 1L0XB 3T3NA 3V60A 3QA8A 4E71A 3CWIA 3W9CB 2EKEC 4KIKB 1VRAB 3PGEA 1WH3A 3SR6A 2FAZA 2BQQA 3WCQA 5I4DA 2KC2A 3NVZA 2FUG1 4MM3B 1J7BA 2L00B 4ZRKA 2ZCBA 5DPSA 3AULA 2KQ4X 2JYEA 4JPSA 4L2YA 2N9XA 2KVZA 2YLMA 2D3CA 1PGBA 1WGDA 3DWMA 1H7XA 1OQRA 1LO5D 3CF6E 3Q3NC 2O2VB 2YEPB 3HM6X 2VH2A 5FKAC 1ZP0B 4YWGG 4ZRJA 5IKCM 4PK1A 4GSWA 2M56B 1RWSA 3TCAA 1T0RC 1V1PA 4XC2A 1E8YA 3L13A 1NVID 2KAJA 3O65B 1ZXHA 2KQ7A 2BS4B 4K7SA 2BKRB 1QILA 1WM2A 2MH7A 3IT4B 4ASWC 3LYYA 2DAJA 1V9JA 1ET9A 1R4MB 2KACA 4GMVA 5J2RA 4P1BC 2HD5B 5HI1A 1JWSD 2K8HA 3TJPA 3JSVB 2WXLA 3FKYA 1UZXB 2H88B 1CMXB 4W9FA 4YSYB 3QWZB 1TS3A 2LZ6A 2PKOA 3HIZA 3QARA 1N61A 3ZNHB 2GBRA 2BB6A 4QAYA 2ZVOA 1F77A 2UU7A 2LUMA 3M95A 1D5XC 3HVDA 3MFGA 1Q0WB 4ZHPA 2DYMA 2I1JA 3NVYA 2KLCA 2KDEB 2L05A 2L1AA 1OEYA 3H7SA 4HPLB 4KSLC 1BUIC 1TYGB 4EEWA 1SIFA 3SU8X 3UINB 1D5MC 2PIAA 4F8CB 3KLSX 2HE7A 1ESFA 2KMCA 4LNNA 2WXNA 4K1RB 1FFUA 1XCQL 4A8XC 3ZTDA 4OZBA 2MBQA 3RN9C 1RM6C 1UH6A 4OHJA 4GN1A 4ZRQA 1C9FA 4XE0A 1V6EA 2LHDA 4O1NA 4GU2A 1XF5L 3V6EB 3R3MA 4B0MA 5FR3A 4PS8A 1DYQA 3N32A 1SE4A 2WXKA 3BK1A 4FHJA 1T0YA 3APCA 4KX6B 3APFA 1V49A 1D4BA 1ENFA 4RGTA 4N58A 3EFUA 2FCQA 2B76B 4KDLB 1TKYA 1QOAA 4BBNF 4ZYSA 3Q3JA 2KDBA 2VZKB 3BYYB 2JSVX 4GDLA 2PVOD 4E3CA 2L0TA 1DOYA 2J53A 1TZ1A 1TS2A 4WIPA 1I4PA 2KWVB 1E9MA 1N5WA 1WX9A 1HA5A 4RNAA 1TY2A 2N9LA 1XLNA 1GJZA 3JW0X 2HDEA 1CZPA 1B1ZA 3W5VB 2D07B 3KUCB 3GB1A 5CTRC 3RMKC 3NZUA 2BF8B 2W55A 1PQSA 1TJEA 2NBWB 1IGCA 3V3XA 5FR6A 3AECB 2RGFA 3BVMA 1X1MA 3C8YA 3I57A 4US8A 2Z8LA 1WX7A 2J0KA 2G9HD 3NZ3A 1OTRB 4ANXA 3DHHC 2BYFA 1OQYA 1Q1OA 1CQVA 4N6EB 4MJSA 2C60A 1FEHA 3QK0A 3QHTA 2L0FA 1EM7A 2W3SA 4ZRPA 4FXCA 1P7FA 2M8SA 4HLEA 2LVOA 4RGNA 2BB5A 1F2RI 4BKGA 2CU1A 3ZYYX 2I38A 5AZFA 2LI5A 4EE2A 4DHJB 1JROA 2KX3A 5C2TB 1ET6A 2K9XA 2M1MA 2WXHA 4EZKA 1SBBB 3NZSA 4BOSC 3Q8FA 1FIQA 3L16A 4K7UA 4C56C 4W9LA 2M17A 2JU6X 1JWAD 4D2KA 2DWQA 3AE8B 1SB3C 1WJUA 1GTHA 2KT7A 1SE9A 2G1EA 5IO9A 2OOBB 1I7HA 4MT5A 1UWMA 4DDID 2IBIB 2C7MB 2DX5B 4H2AA 3KYDD 1EF1A 3K9PB 4RGOS 5C3JB 4HROA 3N20C 2MX2A 3EGRA 2ZEQA 1VCBA 2NPTA 2J0MA 4EZLA 3AE9B 2Z59B 2KTRA 1YMHE 1PGXA 2WXJA 1DGJA 1KLGD 2LGSA 4LNFA 1TY0A 3KUDB 5G2NA 2CHZA 2WXFA 1UWXA 2XK5B 2AL3A 3W2DA 4JWSC 4J3OD 4C7ZA 4XDCA 1PFDA 3H7PA 1F1HA 4AJYB 2OJRA 3VXWA 1WRIA 2L76A 3Q6BA 2E6XA 5TR5A 4PS3A 2GRIA 3DBRI 3NG0A 2JRHA 1MI0A 1WXAA 2FNJB 3ZGZA 3ZLZA 2MBEA 2WLBA 3P63A 1RAXA 3VTUA 2FCMA 4CYEA 2INCC 3N1YC 2GOWA 4B95A 2J4XA 2IGGA 4MACA 4EUTA 2K6DB 3AE3B 4ITKA 2ZPNA 1C4CA 4KZ0A 4IM0A 1MG4A 4P16A 4OVZA 2E3TA 5D3DA 4IM3A 3RD2A 2JYTA 3Q8AA 5CX3A 4XDDA 1N62A 1H7WA 1TTNA 4NNJB 4FN2A 1BMLC 4A9AA 3OG5A 1WWTA 2GMIC 4REZA 1ZE3D 2LWPA 5DCNA 2LRUA 4A3OA 4EKUA 4MDKE 4F1SA 2CR5A 4C00A 3AB5A 2KK8A 1FMAD 4A55A 2RDHA 2BT6A 1K50A 4AOFA 3PLVA 1UGJA 3P42A 4N59A 3AE4B 2DZJA 3ZUNA 3Q69A 3Q8EA 4XX5A 1NYRA 4AS1A 1S1QB 2Q5WD 4M02A 1C76A 4M01A 5D3IB 4WWPA 2CJOA 2IJ0A 4WURA 2ZJDA 2D3AA 1EO6A 3ZKJC 2NBUA 1HEZE 4A20A 2K22A 1I4HA 1IPGA 1RFAA 3ML8A 2JUOA 4LDTB 1NBFC 1UUPA 4MGYE 2MLBA 2JXTA 1GUAB 3ZXRA 3AEDB 4LK0M 5H8YE 1J8CA 3H7PB 3QCAA 1NEKB 1AARA 1J19A 1L4ZB 1YN3A 4KKIA 2YVCA 3DOWA 3ABVB 4I6NB 2ICIA 1E90A 2BW2A 1BT0A 3AXCA 3ZNZB 3APDA 2WYQA 4W9HA 2BYVE 3PTFC 1JMLA 4LJOB 4XWTA 1HE8A 1C1YB 3IG3A 4KSKC 2M0AA 4PYUA 2DZKA 4FJZA 3DBRB 4W9CA 5DPRA 1JRUA 4IWPA 1FXTB 3VRAB 4IWOA 2KTRB 4FADA 1RRBA 1V97A 2KN4A 3IHPC 5HHDG 2O6VB 2R61A 1MHXA 2IO1B 5BMGA 1SF0A 4G3XB 2FIFA 2KMMA 2ON8A 4LNOA 1RYJA 4N9F4 1FCLA 4HKQA 1LQBA 3VFKA 1J0GA 1YJ1A 2KWUB 2QSDA 2VRRB 1E7PB 5DPWA 1FCCC 1Y8RC 4L1BA 4IDIA 4LDTD 3W5UB 4AP4C 2ZW0A 5E6PA 3RNEC 3ZDTA 2ZW1A 1V1OA 3DVNV 2Z0EB 3DBHB 1YQ3B 3O13A 2EKIA 2MQJA 1MPEA 3ENEA 2MBOA 2LJ5A 2MHJA 1STEA 3V61A 1E8ZA 1FXIA 3ONSA 2G3QB 4W9GA 2L52A 3ECIA 2TSSA 1C79A 4BKTA 1FPYA 2CHWA 3B2FA 2RSUA 2W82A 4DXAB 4S0RA 2IGDA 5BO4B 2IZVB 4MGZE 3BK2A 3EECA 1YX5B 1L6VA 2QC8A 2JF5A 3L54A 4FJYA 2G4DB 3TEYA 5L83A 2KNBA 4S17A 3IT6B 2FCSA 4CQNA 2O6VD 2MSED 3QAQA 2RPQA 1QOBA 1PYWD 3DVNU 3VUWA 4YT0B 3B08A 2EMSA 1GC6A 1F0ZA 4B9KA 3CIRB 3PRPB 4C4VB 1E6EB 4WAAA 5G5HA 3CMMB 1DOXA 2KXJA 1FXAA 2GBNA 4LNKA 1GG3A 3KVFB 4FJVB 3MC8A 3TEWA 1H4RA 4AUQC 4TQ1A 2AX5A 5JXVA 1IYFA 2DLBA 5IA7A 3C19A 1L7YA 3IXSA 3SEBA 3GS2A 2C9WB 2KTFA 2IGHA 2NS5A 3ZW3A 3U7DA 1MG8A 1D3ZA 4K3CA 4RFBA 1YQBA 3B2GA 3PPAA 1T3QA 1KH0A 3VHTC 4KZCA 3ZJTA 3W1SA 3EFCA 3DPDA 3FAHA 3OWEB 4LJPB 2AWTA 4AQ7A 3ZJUA 4Q2JA 3B9JA 2K6QA 2QMTA 3DVGY 1P1AA 5BMIA 1WM3A 3AE6B 4YXDB 2DZIA 3HRDD 4WJOA 4DK5A 4HDQA 4GGQA 4BBNC 4C80A 2X8XX 2Z0DB 3A9JB 1N63A 4P6VF 2QILA 3GE3C 3UQBA 1UELA 4GIVA 1V81A 3VTVA 5JH5C 1E5WA 1SE3A 1GOZA 1T0QC 4W9IA 2CHXA 3MJ5A 4IUMB 3EC8A 2C7NB 3R7QA 4KGRA 1E8XA 3UIOB 1V2YA 2WS3B 3I3TB 4XGAB 2X38A 1XEEA 3A4SC 2N4FA 2HTHA 1WXVA 4HVBA 5L95C 3UGBB 4GDKA 1WJ4A 2ZCCA 2W3RA 3RNGC 3RFZB 3BYTB 4JGHB 2BS3B 4IG7B 1M4VA 3JSVA 1SEBD 4F7ZA 5T8IA 4XWWA 3SDLC 2WDRB 2MJEA 4NAWA 2LGYA 4M00A 2NR2A 2BS2B 4WQOB 3U30A 1HZ5A 3VVWB 3L4PA 1N6ZA 1T5XD 4ANUA 3L08A 2KMAA 3Q14C 1F52A 2WNMA 2RR9A 3PT2B 1V5TA 3PZ7A 1AWDA 1K51A 2D11A 1B9RA 4YSZB 1WMHB 3IFWB 1D6EC 1G6JA 3MP9A 5KHQA 1VZ6A 2PEAA 2QDFA 2A5UA 2MW5A 1V86A 2WXRA 2MBHA 2MRPA 4TKNA 1ZDXA 1JW9D 2XNAC 1BXTA 4RGMA 2WX1A 2ASQA 1H8CA 1EF5A 5G5GA 3U52E 3PSEB 1WYGA 2PLPA 2PPHA 5D7GA 4TMAB 4HJKA 2RPVA 1ACCA 1TBEA 3NVWA 1QZEA 2H89B 4YSXB 3JVZX 2J42A 4FULA 4MH8A 2RDBC 1L4DB 2PTLA 3P2BA 3U8ZA 2PMVA 2JXXA 2HTME 1E7VA 2WDQB 3PRZA 3VH4B 3RZWC 3UIPB 4BKSD 4RM8A 5IP4D 1K8RB 3AMZA 3MC0B 5JZEB 1P3QU 3IVFA 3T8MA 2KJHB 4DXFA 4NAWB 2KWCA 1UGMA 4DWFA 2DZMA 2XK5A 3UI3A 4ICVA 2NVUI 3BWUD 2ZZPB 4AJWA 3JYUA 3OJ4B 3AV8A 2LVQA 3ZNID 1Q10A 1SJED 4CO7A 1WXQA 2GBKA 1UNSA 3R8BA 4YTMB 2WDTB 3ZJVA 1KLUD 2KJRA 3AN1A 3WAOA 1L2NA 2DHZA 3R66C 2L7RA 2N7EA 1YQ4B 4W9DA 3X23A 2W54A 4MH0E 3TIXA 1AN8A 2KYWA 3GP7A 2GBMA 1T0SC 4UDUC 3VAWA 2WU2B 1K53A 3BZDB 3DBLB 4JL9A 2WU5B 2Y5CA 2JVCA 3OLMD 4L23A 1T6BX 2MA9B
chains in the Genus database with same CATH topology
1LO5D 2QJLA 1L5PA 3AEDB 4LK0M 5H8YE 3BVGA 2BBCA 2LFIA 1NEKB 2YEPB 1YN3A 1L4ZB 1E10A 4KKIA 3VR9B 3AEFB 5FKAC 1ZP0B 2ACZB 3E56A 4YWGG 5H92C 3ABVB 4YTPB 2ICIA 2M56B 1RWSA 2BW2A 1V1PA 1L0VB 2IPKD 2BYTA 1NVID 1ZUD2 2KAJA 1JMLA 4XWTA 1ZXHA 2BS4B 1QILA 2MH7A 2CU3A 2L83A 2M0AA 2SAKA 4OW0A 1NI3A 2N9KA 3IT4B 1D5ZC 3LYYA 1TZOA 2WP9B 3VRAB 1ET9A 2KACA 1I4GA 3ETRA 2N0SB 1V97A 2KN4A 5HI1A 5HHDG 1JWSD 2WXLA 2R61A 1MHXA 4WQMA 5BMGA 3DWGC 2WXOA 4USAA 2H88B 1SF0A 5BYQA 1OFFA 4YSYB 3AEBB 4GDKB 1TS3A 2KMMA 2ON8A 3KWVA 3U7ZA 1RYJA 1FCLA 4HKQA 2PKOA 3AM9A 5FK9C 2SEBD 1N61A 5EE3A 2QSDA 4WH4A 1E7PB 1XLPA 1FCCC 3FC4A 2BB6A 1VZ8A 4L1BA 2MEKA 4IDIA 1F77A 3W5UB 1SIJA 2LUMA 4US9A 2ZW0A 1D5XC 3HVDA 2ZW1A 3MFGA 1XLQA 1V1OA 1YJJA 4JE3B 1YQ3B 3O13A 4ZHPA 2EKIA 1MPEA 2DYMA 3TEXA 4KGSA 1C78A 1YJIA 3NVYA 1GPXA 1STEA 1FXIA 3VR8B 2L1AA 2V0GA 2L52A 4HJGE 1KF6B 5EE1A 2TSSA 1BUIC 1C79A 1TYGB 3B2FA 2W82A 1D5MC 2L32A 4A6QA 3R2TA 1GB4A 2AQ2B 4B0EA 2IGDA 1AW7A 4YTNB 3HVZA 1N5XA 4KGTA 1NYQA 4NAMA 3VRBB 2PIAA 3BK2A 1L6VA 3KLSX 1OQQA 1ESFA 5HG2A 2WXNA 2K3UA 3TEYA 3SFDB 1FFUA 1XCQL 1EU4A 4KKJA 1HZ6A 3URYA 3IT6B 4A8XC 1EWCA 4OZBA 1QQRA 4CQNA 1RM6C 4OHJA 1SXTA 4RH6A 1QOBA 1VLBA 4ZRQA 1C9FA 4XE0A 1PYWD 2LHDA 4O1NA 4YT0B 4IKGA 1XF5L 2QIEB 3LXFA 1NENB 1CJEA 4B0MA 5FR3A 5TSSA 1DYQA 2JZPA 1F0ZA 2QEJC 1KRHA 1SE4A 1FO4A 2WXKA 3BK1A 3CIRB 4NZLB 5E6JA 2MJDA 2WXPA 1E6EB 2OEDA 5G5HA 1DOXA 2WDVB 4KX6B 4OZAA 2EELA 1RFKA 4DXGA 1FXAA 1GT8A 1FRDA 1ZDVA 1J7CA 1D4BA 1ENFA 1QLBB 1PGAA 4RGTA 4N58A 3T3OA 3TEWA 3KWLA 2WXQA 3BVZA 2B76B 4TQ1A 2JQRB 1TKYA 2AX5A 2NTSA 5JXVA 1JCKB 3P4QB 1QOAA 2DLBA 1TS5A 1TKGA 1IBXB 4ZYSA 2JX5A 2VZKD 3IXSA 4RF0A 1IBXA 2VZKB 3SEBA 3BYYB 2JSVX 2BTEA 3GS2A 2MJ3A 1XLOA 2KDMA 2PVOD 2IGHA 1JQ4A 2NMQA 1DOYA 1FNUA 4HRSA 2V3NA 2J53A 3N9YC 2V3PA 1TS2A 3PZ8A 4WIPA 3AE7B 4HEA1 1FFVA 1I4PA 2LGIA 1Y56A 4M0WA 1E9MA 1N5WA 4RFBA 3B2GA 3AE1B 1HA5A 1T3QA 4JWUC 3NVVA 4RNAA 1TY2A 2N9LA 1KH0A 1XLNA 2Y5PA 2HDEA 3ZJTA 3W1SA 3FAHA 3OWEB 1CZPA 4AQ7A 5AUKA 3ZJUA 2LJIA 4Q2JA 1HQRD 1HXYD 1B1ZA 3B9JA 1JWBD 4C7YA 3W5VB 2QMTA 3AH7A 5BMIA 2LMCA 3GB1A 3AE6B 1I4RA 2RDGA 4YXDB 2W55A 4RCOA 1L0YB 1WGKA 1TJEA 3P4RB 3HRDD 1IGCA 2WXGA 3V3XA 1QOFA 4TSSA 3AECB 1A70A 2Y3AA 1R7SA 3BVMA 3C8YA 4C80A 3I57A 2ONQA 4US8A 4NJCA 3P4SB 1N63A 2Z8LA 4P6VF 2QILA 4A90A 2G9HD 2V4IB 3NZ3A 5MPOA 1JWUD 1CQVA 4N6EB 1I4QA 4ARIA 1EWYC 1FRRA 3CF4A 1FEHA 1SE3A 1AYFA 1GOZA 4OZCA 1I4XA 2AQ1B 1EM7A 3MJ5A 2W3SA 4ZRPA 4FXCA 1P7FA 2PVGC 4KGRA 2BB5A 3NRZA 1F2RI 4RGNA 3PO0A 1SSNA 3ZYYX 4GDLB 3V05A 2I38A 2WS3B 5AUIA 2X38A 1KFYB 1XEEA 3P4PB 4ARCA 1MVKA 4DQOC 4EE2A 1XXGA 3TUOA 3IAS1 2N7JA 1JROA 2KWDA 1IUEA 5C2TB 1ET6A 2K9XA 2WXHA 2I2YA 1SBBB 1K52A 3Q8FA 1FIQA 4C56C 2W3RA 3FILB 3RFZB 3BYTB 2JU6X 2WQYB 2BS3B 1JWAD 2AQ3B 3Q8CA 1M4VA 4LLGM 1YNTE 2DWQA 1C77A 3AE8B 4ZOHC 4D2KA 1SB3C 1SE2A 1YN5A 1GTHA 2DBYA 1VZ7A 2G1EA 1SEBD 4GLSC 5T8IA 1GAQB 4XWWA 2M19A 2WDRB 4IOIE 2MJEA 4ZHOA 1I7HA 4MT5A 2J52A 1UWMA 2BS2B 4H2AA 1L6UA 2WXMA 3BIID 4RGOS 5C3JB 4WAFA 1HZ5A 4HROA 3L4PA 3EGRA 4LTUA 2FBWB 1T5XD 1F2RC 3AE9B 3P1MA 1YMHE 1PGXA 2WXJA 1QT9A 1DGJA 2LEKA 4R3DA 1KLGD 2RMMA 4HKZE 1IGDA 2WNMA 3H8HA 5EE9A 3AEAB 1TY0A 1ZOYB 3SFEB 1VR9A 3PZ7A 1AWDA 1K51A 1B9RA 4YSZB 1JRPA 2WXFA 1D6EC 1FD6A 2INPE 1UWXA 3MP9A 1J7AA 1GTEA 5BMHA 1GB1A 1V1PB 1VZ6A 3J9CA 3W2DA 2GB1A 4JWSC 1PDXA 1P7EA 3KQ4A 4J3OD 4C7ZA 4XDCA 3TSSA 1PFDA 2FE8A 2WXRA 3AEEB 2YEPF 1SJHD 1WRIA 1C4AA 2E6XA 1PUTA 1ZDXA 2GRIA 1JW9D 5LNK1 2XNAC 1BXTA 1FNWA 4RGMA 1MI0A 4PT5A 5G5GA 1VDVA 3ZGZA 2WLBA 3P63A 1QKZA 3U52E 1VJKA 3NUHB 1WYGA 2PLPA 5D7GA 2IDYA 4TMAB 2J4XA 1ACCA 1EU3A 2IGGA 2RPVA 3NVWA 3EA6A 4MACA 2NTTA 3VQIA 3AE3B 2H89B 1KTKA 2LHEA 4ITKA 4YSXB 4JX1C 1C4CA 2K0PA 2J42A 4MH8A 4P16A 3R2IA 1JALA 4OVZA 1JWMD 1L4DB 5EE0A 2PTLA 2E3TA 3U2SC 3ZQ4A 5D3DA 4RF1A 2K5PA 4TQ0A 1CK1A 2JYTA 3Q8AA 4XDDA 3AE5B 2PMVA 1FNVA 1N62A 1H7WA 1V8CA 2HTME 2WDQB 3FILA 1E0ZA 1FM0D 1DOIA 3AMZA 3MC0B 3U4EG 2PW9A 5GXGB 1ZPSA 1ROEA 1QOGA 3LB8C 3TEZA 4DXFA 1BMLC 4A9AA 4NAWB 3NS1A 1WWTA 3E9SA 2JWUA 2OHFA 4REZA 5HFYA 1ZE3D 5BYSA 4WWMA 3UI3A 3AEGB 2CJNA 2XN9C 1L0XB 3BWUD 3T3NA 3I9V1 3AB5A 1FMAD 4A55A 3CWIA 3W9CB 3AV8A 2RDHA 2BT6A 1K50A 1N60A 1UGJA 1Q10A 1VRAB 3AE4B 1SJED 3P42A 4N59A 1WXQA 1ZXIA 3DWMA 1UNSA 3Q69A 3Q8EA 3HUIA 3R8BA 4YTMB 3SR6A 1TS4A 1NYRA 4AS1A 3ZJVA 2Q5WD 3WCQA 5I4DA 1C76A 3MHZA 1QF6A 3NVZA 5D3IB 1KLUD 3AN1A 2CJOA 2FUG1 2GI9A 4MM3B 1J7BA 2IJ0A 1C4PA 1XCTL 3EUB2 4WURA 1YQ4B 2WXIA 2INNE 2W54A 1AN8A 1YN4A 3GP7A 2KQ4X 1HEZE 5BYRA 1TKEA 2JYEA 1MHHE 4JPSA 4L2YA 4UDUC 2K22A 2WU2B 1K53A 1I4HA 1WSPA 3BZDB 1XO3A 3RPFC 2WU5B 2DYOA 2Y5CA 3IAM1 3AE2B 3Q8BA 1PGBA 1UUPA 4L23A 1T6BX 2D5GA 1H7XA 1OQRA 2JXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6V A;  1PUT A;  2QJL A;  1JW9 D;  1L5P A;  3AED B;  5H8Y E;  4US8 A;  1OQQ A;  3P4S B;  1N63 A;  1NEK B;  4P6V F;  5G5H A;  1DOX A;  5MPO A;  1E10 A;  3VR9 B;  3SFD B;  1FFU A;  3AEF B;  5G5G A;  1VDV A;  1ZP0 B;  2ACZ B;  5H92 C;  2WLB A;  3ABV B;  4YTP B;  3P63 A;  4N6E B;  1EWY C;  2M56 B;  1FRR A;  1RWS A;  3CF4 A;  1VJK A;  1WYG A;  1AYF A;  1L0V B;  1RM6 C;  3NVW A;  1NVI D;  1ZUD 2;  1QOB A;  1VLB A;  2KAJ A;  2W3S A;  3AE3 B;  4FXC A;  2H89 B;  4YT0 B;  2PVG C;  4ITK A;  2BS4 B;  2QIE B;  4YSX B;  3LXF A;  4JX1 C;  3NRZ A;  2MH7 A;  2CU3 A;  2L83 A;  1NEN B;  1CJE A;  3PO0 A;  1JAL A;  3ZYY X;  1NI3 A;  1F0Z A;  5EE0 A;  2E3T A;  2WS3 B;  1KRH A;  5AUI A;  1FO4 A;  2K5P A;  3CIR B;  1KFY B;  2MJD A;  1E6E B;  3P4P B;  3AE5 B;  2WP9 B;  3VRA B;  1N62 A;  1H7W A;  2WDV B;  4KX6 B;  1V8C A;  2HTM E;  2WDQ B;  1RFK A;  1FXA A;  1GT8 A;  1E0Z A;  1JRO A;  1FRD A;  1IUE A;  5C2T B;  1J7C A;  1DOI A;  1FM0 D;  2K9X A;  3ETR A;  1QLB B;  2N0S B;  4N58 A;  1V97 A;  3AMZ A;  5GXG B;  1FIQ A;  3KWL A;  1ROE A;  1QOG A;  3LB8 C;  2W3R A;  2B76 B;  4A9A A;  2WQY B;  2BS3 B;  1JWA D;  1TKY A;  1WWT A;  2AX5 A;  2JQR B;  3NS1 A;  2DWQ A;  3P4Q B;  3AE8 B;  1QOA A;  2OHF A;  1SB3 C;  3DWG C;  4USA A;  2H88 B;  1GTH A;  1SF0 A;  1TKG A;  2DBY A;  1OFF A;  2G1E A;  4YSY B;  2JX5 A;  3AEB B;  4WWM A;  1GAQ B;  3AEG B;  2KMM A;  2M19 A;  2WDR B;  2CJN A;  4ZOH C;  1RYJ A;  2MJE A;  4ZHO A;  2PKO A;  3AM9 A;  1I7H A;  1UWM A;  2MJ3 A;  1XLO A;  1N61 A;  2PVO D;  3AB5 A;  2BS2 B;  1JQ4 A;  5EE3 A;  1FMA D;  1L6U A;  4HRS A;  3CWI A;  3W9C B;  1DOY A;  1E7P B;  1XLP A;  5C3J B;  2BT6 A;  3AV8 A;  1N60 A;  3BII D;  3FC4 A;  4HRO A;  3AE7 B;  4N59 A;  3L4P A;  3AE4 B;  4LTU A;  2FBW B;  1FFV A;  4IDI A;  1WXQ A;  1ZXI A;  3DWM A;  3W5U B;  3AE9 B;  1E9M A;  1N5W A;  1SIJ A;  3HUI A;  3P1M A;  4US9 A;  4YTM B;  3B2G A;  1QT9 A;  1DGJ A;  2LEK A;  3SR6 A;  3AE1 B;  1NYR A;  1T3Q A;  4JWU C;  1OQR A;  3NVV A;  1XLQ A;  1YJJ A;  2Q5W D;  3WCQ A;  1XLN A;  5EE9 A;  3AEA B;  1QF6 A;  1ZOY B;  1YQ3 B;  3NVZ A;  3SFE B;  3AN1 A;  4ZHP A;  2CJO A;  2EKI A;  1AWD A;  3FAH A;  1J7B A;  1B9R A;  1CZP A;  4YSZ B;  5AUK A;  1JRP A;  3EUB 2;  3B9J A;  4WQM A;  1YQ4 B;  1YJI A;  3NVY A;  1GPX A;  1J7A A;  1GTE A;  1JWB D;  4C7Y A;  1FXI A;  3VR8 B;  2W54 A;  3W5V B;  2L52 A;  4JWS C;  1PDX A;  3AH7 A;  1KF6 B;  1TKE A;  5EE1 A;  3AE6 B;  4C7Z A;  1PFD A;  4YXD B;  2W55 A;  1TYG B;  2K22 A;  3B2F A;  2WU2 B;  3AEE B;  1XO3 A;  3RPF C;  1WGK A;  1TJE A;  3P4R B;  2WU5 B;  2Y5C A;  3HRD D;  3AE2 B;  1QOF A;  1WRI A;  3AEC B;  4YTN B;  3HVZ A;  1N5X A;  1A70 A;  1R7S A;  4C80 A;  1NYQ A;  1H7X A;  3VRB B;  2PIA A; 
#chains in the Genus database with same CATH topology
 2QJL A;  1L5P A;  4KV2 A;  3BVG A;  3HK0 A;  3S2A A;  5J18 A;  2BBC A;  4WJP A;  1E10 A;  3VR9 B;  4K3B A;  3AEF B;  2R2O A;  3H6N A;  3RZF A;  3E56 A;  4YTP B;  4MM3 A;  1WE7 A;  4DHZ B;  2M4N A;  1L0V B;  2IPK D;  2BYT A;  3I5J C;  5G55 A;  3QX1 A;  3A33 B;  2CU3 A;  4FHK A;  4II2 B;  4HK2 A;  2LUE A;  4OW0 A;  2HJ8 A;  1NI3 A;  2N9K A;  2K8B A;  2NPT B;  5CHF A;  4TV3 A;  4DHZ E;  2ZVN A;  2JZZ A;  1I4G A;  3ETR A;  2N0S B;  1TT5 B;  2NBV B;  2W9N A;  4BKS A;  5LXH A;  2CKH B;  4WQM A;  3DWG C;  2KO3 A;  4USA A;  5BYQ A;  5CHW A;  3L0W B;  2BWF A;  3AEB B;  2KQS A;  3U7Z A;  3KWV A;  2JRI B;  2JPH A;  4K81 A;  5FK9 C;  4MEL A;  1YX6 B;  2D10 A;  1XLP A;  3RUL A;  4HWI B;  3UF8 A;  3K9O B;  1SIJ A;  3RNC C;  1XLQ A;  3ZRF A;  2C5L C;  2PE9 A;  3TEX A;  4NQK E;  3GOE A;  1C78 A;  4HJG E;  1KF6 B;  5EE1 A;  4HXD A;  5GMV A;  2N1V A;  2L32 A;  2K25 A;  3R2T A;  2UYZ B;  4GB9 A;  1GB4 A;  2AQ2 B;  3HM3 A;  1AW7 A;  3D32 A;  4YTN B;  4EZJ A;  4KGT A;  2LRW A;  3VRB B;  4ZRI A;  3ZIM A;  3V62 A;  2IO3 B;  2KZR A;  1TIF A;  5HG2 A;  3SFD B;  1EU4 A;  4KKJ A;  1HZ6 A;  3URY A;  1EWC A;  2MBB B;  1QQR A;  4GXB A;  1VLB A;  1NI2 A;  3IBE A;  4MJS B;  4IKG A;  3ZRC A;  2QIE B;  3LXF A;  3RNB C;  4I6L B;  3NJT A;  2QEJ C;  1KRH A;  2GLS A;  4NZL B;  5E6J A;  2MJD A;  3DBH I;  2N7D A;  1RFK A;  1GT8 A;  1IP9 A;  2DYB A;  3DBL I;  3ZNG C;  3AI5 A;  3WAN A;  1WF9 A;  1QLB B;  1PGA A;  3VDZ A;  3PRE A;  3RNF C;  3KWL A;  2WXQ A;  2IYD B;  4G11 A;  1JCK B;  2CS4 A;  2ZNV B;  1TS5 A;  1UBQ A;  3TL5 A;  1IBX B;  4HPP A;  3ZTC A;  3W1Y A;  1GNU A;  2VZK D;  4M8N A;  4NQL B;  2A4Z A;  2BTE A;  3T9L A;  2MJ3 A;  1XLO A;  2LXC A;  4HRS A;  3N9Y C;  1WXS A;  4BZA A;  2DAF A;  4HEA 1;  2J7Q B;  1HTQ A;  4BOZ B;  3C0R B;  3ZDM C;  2D2Q A;  3AE1 B;  3NVV A;  3Q3M C;  2Y5P A;  3NOB A;  4IM2 A;  4W9J A;  1XD3 B;  1JWB D;  2WGS A;  4C7Y A;  2N1W A;  2DNF A;  3KYC D;  2LMC A;  3PLU A;  4G0N B;  3A9J A;  1WZ3 A;  2L8J A;  3KW5 B;  3N1Z C;  1WGK A;  2IO2 B;  4KVG B;  1WE6 A;  2WXG A;  2Y5B B;  3NS8 A;  2FCN A;  2Y3A A;  1WR1 A;  4FA6 A;  3AU5 A;  1Z5S B;  3A1Q A;  3P4S B;  2KLG A;  4A90 A;  2K39 A;  5MPO A;  1JWU D;  2IO0 B;  2WWZ A;  1A5R A;  3CF4 A;  1AYF A;  2LGX A;  1E8W A;  3PZD A;  4OZC A;  2AQ1 B;  1WR6 E;  3HHM A;  5JHA A;  4MGK E;  3ALB A;  2PVG C;  2QHO A;  2KKC A;  5AZH A;  3PO0 A;  1SSN A;  4GDL B;  1KJT A;  3R7R A;  1KOT A;  4DHJ D;  1LXD A;  3IAS 1;  2N7J A;  4YL8 A;  3RT3 B;  2B3A A;  1IUE A;  4WJN A;  3GZN I;  2AQ3 B;  3Q8C A;  4LLG M;  1C77 A;  1SE2 A;  2LVP A;  4JLC A;  4GLS C;  3GE8 C;  4NJ7 A;  1GAQ B;  2M19 A;  4IOI E;  3A4R A;  2HJ1 A;  3VH3 B;  1Q5W B;  2GBJ A;  2KDF B;  4C4V A;  1L6U A;  4ANW A;  2JT4 B;  3BII D;  4WAF A;  1WYW B;  1WGY A;  1F2R C;  3P1M A;  2LEK A;  1IGD A;  5EE9 A;  3Q3O C;  3SFE B;  1JRP A;  5LXI B;  1FD6 A;  2INP E;  5BMH A;  1GTE A;  4XYC A;  1P7E A;  3MHS D;  3TSS A;  4ZDV A;  2YEP F;  4HPM B;  1KM7 A;  1PUT A;  1FNW A;  1GC7 A;  1VDV A;  1I35 A;  1VJK A;  2IDY A;  1EU3 A;  3EA6 A;  3W1S C;  3PRM B;  3QJZ A;  2KAN A;  2XBB C;  5IN7 A;  4JX1 C;  1NDD A;  1WJ6 A;  1V80 A;  4E74 A;  1JAL A;  1JWM D;  5EE0 A;  2O2V A;  3U2S C;  3ZQ4 A;  4RF1 A;  4TQ0 A;  1CK1 A;  4IC7 B;  4URK A;  2PE6 B;  1V8C A;  3H1U A;  1LFD A;  5IAA C;  2KFK A;  3FIL A;  1WRD B;  1FM0 D;  5E6N A;  2PW9 A;  5GXG B;  1ZPS A;  1ROE A;  3LB8 C;  3V6C B;  3NS1 A;  2JWU A;  5C1Z A;  4IW0 A;  2V1Y A;  3UQA A;  5HFY A;  5LLI A;  5BYS A;  2IY1 B;  4WWM A;  3AEG B;  2XN9 C;  2AL6 A;  2AEH A;  3I9V 1;  4X57 B;  3GZN B;  3ML9 A;  2J0J A;  4G50 A;  1N60 A;  1C3T A;  1ZXI A;  4PYZ A;  2MCN B;  2UWQ A;  3HUI A;  1R4M I;  1TS4 A;  2KN5 A;  4M0W B;  1YOV B;  1ISN A;  3MHZ A;  4ICU A;  1QF6 A;  4ACF A;  2GI9 A;  4K7W A;  1C4P A;  1XCT L;  3EUB 2;  2WXI A;  2FID A;  2INN E;  5DPT A;  1YN4 A;  5BYR A;  1Z2M A;  2KC1 A;  1TKE A;  3NY5 A;  4J6I A;  1MHH E;  4KDI C;  1WSP A;  1WIA A;  3RPF C;  1XO3 A;  3Q8B A;  2DYO A;  4IWQ A;  3IAM 1;  3AE2 B;  2D5G A;  3BY4 B;  2V3S A;  2G4S A;  2LFI A;  4P7I A;  2JZ3 B;  2ACZ B;  5H92 C;  3RI7 C;  3DCG A;  4WJQ A;  2LD9 A;  2XEW A;  4ZYN A;  1ZUD 2;  3TMP B;  3B1L X;  3LDZ E;  5KHO A;  3MJW A;  4HDO A;  2KOX A;  2L83 A;  2WHI A;  3QC8 B;  2SAK A;  2FUH B;  4LCD E;  5D94 A;  1D5Z C;  3N1X C;  1YD8 U;  1TZO A;  2MWS B;  2WP9 B;  1WI0 A;  5D6J B;  1OEY J;  3PVL A;  1HTO A;  2D3G A;  3VUX A;  2WXO A;  3DHI C;  1OFF A;  1UBI A;  4GDK B;  3OJ3 A;  3I63 C;  3AM9 A;  2SEB D;  5EE3 A;  4WH4 A;  3FC4 A;  3MTN B;  2V4L A;  1VZ8 A;  1U4A A;  2MEK A;  1EUV B;  1YIW A;  5J17 A;  4US9 A;  1R4N B;  3L10 B;  2QCZ A;  3TBL D;  1YJJ A;  3Q3F A;  2D3B A;  3DHG C;  4JE3 B;  2REX A;  1WGR A;  1P98 A;  4KGS A;  2N9P C;  3DVG X;  1GPX A;  1YJI A;  5HKH A;  2K1F A;  3VR8 B;  2V0G A;  2N9E B;  4PS7 A;  4BVU C;  4HCN B;  4A6Q A;  2KVR A;  1WX8 A;  4B0E A;  3HVZ A;  1N5X A;  5CHV C;  1NYQ A;  4NAM A;  2LXA A;  3A9K A;  4BAX A;  1OQQ A;  1ZGU B;  4W9K A;  2K3U A;  4JQW C;  2DEN B;  1M94 A;  1KLV A;  4W9E A;  2V9H A;  1SXT A;  4RH6 A;  4B6W A;  3BIN A;  1RLF A;  5AEK B;  3N3K B;  1NEN B;  1CJE A;  5TSS A;  3AU4 A;  3CSF A;  3WAM A;  2JZP A;  3DBS A;  1FO4 A;  3A1Q B;  4EFO A;  2WXP A;  2OED A;  2WDV B;  4OZA A;  4AWJ A;  2EEL A;  4DXG A;  1FRD A;  4MEM A;  1ZDV A;  1J7C A;  4MSQ B;  1ZW7 A;  3T3O A;  3LJ3 A;  3BVZ A;  2KJ6 A;  2JQR B;  2NTS A;  1WZ0 A;  3P4Q B;  1UD7 A;  3H9D A;  2KFK B;  1TKG A;  2AYO B;  4WWN A;  2BPS A;  2JX5 A;  3SD5 A;  4NPN A;  4RF0 A;  3WA0 A;  1IBX A;  4NJ6 A;  2KDM A;  1JQ4 A;  2NMQ A;  3WIM A;  1FNU A;  2V3N A;  1WJN A;  2L3Z A;  2V3P A;  1WFY A;  3PZ8 A;  3AE7 B;  2PJH A;  1FFV A;  4II3 B;  2LGI A;  1Y56 A;  4M0W A;  2WX0 A;  5D2M B;  4JWU C;  4BFR A;  5E6O A;  2G45 B;  3RCZ A;  4MSM B;  2KHW B;  2JWZ A;  5AUK A;  4A3P A;  2LJI A;  1HQR D;  1HXY D;  2BWE S;  3AH7 A;  2BGF A;  1I4R A;  2RDG A;  3DDC B;  4RCO A;  1L0Y B;  3P4R B;  4NY0 A;  1QOF A;  4TSS A;  1A70 A;  1R7S A;  1VD2 A;  4WWO A;  1E7U A;  2ONQ A;  2LAS A;  4NJC A;  2BKF A;  2V4I B;  3RYT A;  4HCP B;  1V5O A;  3X0W A;  1WMH A;  3M3J A;  1I4Q A;  4ARI A;  4P1C C;  1EWY C;  1FRR A;  4JIO U;  3PHW B;  1ZKH A;  2KX0 A;  4OVV A;  2KD0 A;  1I4X A;  4I6P A;  3NRZ A;  1WXM A;  3ZXV A;  4RMA A;  3V05 A;  3A9K B;  2BVC A;  5AUI A;  1KFY B;  3P4P B;  4ARC A;  1MVK A;  4DQO C;  1XXG A;  3TUO A;  2M0X A;  1MJD A;  1OGW A;  4KIK A;  3WAP A;  2KWD A;  2JY6 A;  2I2Y A;  2C7H A;  1K52 A;  1LM8 B;  4RM9 A;  3FIL B;  2WQY B;  3VUY A;  1YNT E;  4ZOH C;  2O6V A;  1YN5 A;  2KFJ A;  2DBY A;  1VZ7 A;  3KUZ A;  3OAW A;  5IOI A;  3N30 A;  4ZHO A;  3ZO5 B;  5C23 A;  4FBJ B;  2J52 A;  2ZNV C;  3L17 A;  2I1K A;  1R4N I;  3DQV A;  2WXM A;  4LNI A;  3WAL A;  4LTU A;  3M63 B;  2FBW B;  2RD0 A;  3SHQ A;  3B0A A;  1QT9 A;  4R3D A;  2RMM A;  4HKZ E;  3H8H A;  3AEA B;  2K8C A;  2EMT A;  1ZOY B;  1VR9 A;  2IY0 B;  4DDG D;  1XQQ A;  1J7A A;  3VTW A;  3QIJ A;  1GB1 A;  1V1P B;  3J9C A;  1S3S G;  3PS6 A;  1F9J A;  2GB1 A;  1PDX A;  3KQ4 A;  4GOC A;  4M8M A;  4CHK A;  5JHB A;  2FE8 A;  4DBG A;  5EDS A;  4FLH A;  3AEE B;  3Q2A C;  1SJH D;  1C4A A;  3PV1 A;  2LGD A;  2NCN A;  4OVU A;  3QQ8 B;  5LNK 1;  4ANV A;  3PHX B;  2MP2 A;  3EHV A;  2BYE A;  4PT5 A;  5AZG A;  3MC9 A;  4TUU A;  1QKZ A;  1SGH A;  3NUH B;  2ZPY A;  3RUI B;  2NTT A;  3VQI A;  2KDI A;  1MFW A;  1TGZ B;  1P0R A;  1KTK A;  2LHE A;  3CST A;  4XZ4 A;  1WY8 A;  3ZVV A;  2K0P A;  3R2I A;  3RNA C;  1WGG A;  1UF0 A;  1LGR A;  2IND C;  2K5P A;  2R2Q A;  3AE5 B;  1FNV A;  1E0Z A;  2MP2 B;  1DOI A;  3U4E G;  1QOG A;  3M62 B;  1I42 A;  3TEZ A;  2OJW A;  4MGI E;  3E9S A;  2OHF A;  1XT9 B;  1WGH A;  4EOY A;  3KH0 A;  3NHE B;  1P9D U;  2VH1 A;  2CJN A;  1L0X B;  3T3N A;  3V60 A;  3QA8 A;  4E71 A;  3CWI A;  3W9C B;  2EKE C;  4KIK B;  1VRA B;  3PGE A;  1WH3 A;  3SR6 A;  2FAZ A;  2BQQ A;  3WCQ A;  5I4D A;  2KC2 A;  3NVZ A;  2FUG 1;  4MM3 B;  1J7B A;  2L00 B;  4ZRK A;  2ZCB A;  5DPS A;  3AUL A;  2KQ4 X;  2JYE A;  4JPS A;  4L2Y A;  2N9X A;  2KVZ A;  2YLM A;  2D3C A;  1PGB A;  1WGD A;  3DWM A;  1H7X A;  1OQR A;  1LO5 D;  3CF6 E;  3Q3N C;  2O2V B;  2YEP B;  3HM6 X;  2VH2 A;  5FKA C;  1ZP0 B;  4YWG G;  4ZRJ A;  5IKC M;  4PK1 A;  4GSW A;  2M56 B;  1RWS A;  3TCA A;  1T0R C;  1V1P A;  4XC2 A;  1E8Y A;  3L13 A;  1NVI D;  2KAJ A;  3O65 B;  1ZXH A;  2KQ7 A;  2BS4 B;  4K7S A;  2BKR B;  1QIL A;  1WM2 A;  2MH7 A;  3IT4 B;  4ASW C;  3LYY A;  2DAJ A;  1V9J A;  1ET9 A;  1R4M B;  2KAC A;  4GMV A;  5J2R A;  4P1B C;  2HD5 B;  5HI1 A;  1JWS D;  2K8H A;  3TJP A;  3JSV B;  2WXL A;  3FKY A;  1UZX B;  2H88 B;  1CMX B;  4W9F A;  4YSY B;  3QWZ B;  1TS3 A;  2LZ6 A;  2PKO A;  3HIZ A;  3QAR A;  1N61 A;  3ZNH B;  2GBR A;  2BB6 A;  4QAY A;  2ZVO A;  1F77 A;  2UU7 A;  2LUM A;  3M95 A;  1D5X C;  3HVD A;  3MFG A;  1Q0W B;  4ZHP A;  2DYM A;  2I1J A;  3NVY A;  2KLC A;  2KDE B;  2L05 A;  2L1A A;  1OEY A;  3H7S A;  4HPL B;  4KSL C;  1BUI C;  1TYG B;  4EEW A;  1SIF A;  3SU8 X;  3UIN B;  1D5M C;  2PIA A;  4F8C B;  3KLS X;  2HE7 A;  1ESF A;  2KMC A;  4LNN A;  2WXN A;  4K1R B;  1FFU A;  1XCQ L;  4A8X C;  3ZTD A;  4OZB A;  2MBQ A;  3RN9 C;  1RM6 C;  1UH6 A;  4OHJ A;  4GN1 A;  4ZRQ A;  1C9F A;  4XE0 A;  1V6E A;  2LHD A;  4O1N A;  4GU2 A;  1XF5 L;  3V6E B;  3R3M A;  4B0M A;  5FR3 A;  4PS8 A;  1DYQ A;  3N32 A;  1SE4 A;  2WXK A;  3BK1 A;  4FHJ A;  1T0Y A;  3APC A;  4KX6 B;  3APF A;  1V49 A;  1D4B A;  1ENF A;  4RGT A;  4N58 A;  3EFU A;  2FCQ A;  2B76 B;  4KDL B;  1TKY A;  1QOA A;  4BBN F;  4ZYS A;  3Q3J A;  2KDB A;  2VZK B;  3BYY B;  2JSV X;  4GDL A;  2PVO D;  4E3C A;  2L0T A;  1DOY A;  2J53 A;  1TZ1 A;  1TS2 A;  4WIP A;  1I4P A;  2KWV B;  1E9M A;  1N5W A;  1WX9 A;  1HA5 A;  4RNA A;  1TY2 A;  2N9L A;  1XLN A;  1GJZ A;  3JW0 X;  2HDE A;  1CZP A;  1B1Z A;  3W5V B;  2D07 B;  3KUC B;  3GB1 A;  5CTR C;  3RMK C;  3NZU A;  2BF8 B;  2W55 A;  1PQS A;  1TJE A;  2NBW B;  1IGC A;  3V3X A;  5FR6 A;  3AEC B;  2RGF A;  3BVM A;  1X1M A;  3C8Y A;  3I57 A;  4US8 A;  2Z8L A;  1WX7 A;  2J0K A;  2G9H D;  3NZ3 A;  1OTR B;  4ANX A;  3DHH C;  2BYF A;  1OQY A;  1Q1O A;  1CQV A;  4N6E B;  4MJS A;  2C60 A;  1FEH A;  3QK0 A;  3QHT A;  2L0F A;  1EM7 A;  2W3S A;  4ZRP A;  4FXC A;  1P7F A;  2M8S A;  4HLE A;  2LVO A;  4RGN A;  2BB5 A;  1F2R I;  4BKG A;  2CU1 A;  3ZYY X;  2I38 A;  5AZF A;  2LI5 A;  4EE2 A;  4DHJ B;  1JRO A;  2KX3 A;  5C2T B;  1ET6 A;  2K9X A;  2M1M A;  2WXH A;  4EZK A;  1SBB B;  3NZS A;  4BOS C;  3Q8F A;  1FIQ A;  3L16 A;  4K7U A;  4C56 C;  4W9L A;  2M17 A;  2JU6 X;  1JWA D;  4D2K A;  2DWQ A;  3AE8 B;  1SB3 C;  1WJU A;  1GTH A;  2KT7 A;  1SE9 A;  2G1E A;  5IO9 A;  2OOB B;  1I7H A;  4MT5 A;  1UWM A;  4DDI D;  2IBI B;  2C7M B;  2DX5 B;  4H2A A;  3KYD D;  1EF1 A;  3K9P B;  4RGO S;  5C3J B;  4HRO A;  3N20 C;  2MX2 A;  3EGR A;  2ZEQ A;  1VCB A;  2NPT A;  2J0M A;  4EZL A;  3AE9 B;  2Z59 B;  2KTR A;  1YMH E;  1PGX A;  2WXJ A;  1DGJ A;  1KLG D;  2LGS A;  4LNF A;  1TY0 A;  3KUD B;  5G2N A;  2CHZ A;  2WXF A;  1UWX A;  2XK5 B;  2AL3 A;  3W2D A;  4JWS C;  4J3O D;  4C7Z A;  4XDC A;  1PFD A;  3H7P A;  1F1H A;  4AJY B;  2OJR A;  3VXW A;  1WRI A;  2L76 A;  3Q6B A;  2E6X A;  5TR5 A;  4PS3 A;  2GRI A;  3DBR I;  3NG0 A;  2JRH A;  1MI0 A;  1WXA A;  2FNJ B;  3ZGZ A;  3ZLZ A;  2MBE A;  2WLB A;  3P63 A;  1RAX A;  3VTU A;  2FCM A;  4CYE A;  2INC C;  3N1Y C;  2GOW A;  4B95 A;  2J4X A;  2IGG A;  4MAC A;  4EUT A;  2K6D B;  3AE3 B;  4ITK A;  2ZPN A;  1C4C A;  4KZ0 A;  4IM0 A;  1MG4 A;  4P16 A;  4OVZ A;  2E3T A;  5D3D A;  4IM3 A;  3RD2 A;  2JYT A;  3Q8A A;  5CX3 A;  4XDD A;  1N62 A;  1H7W A;  1TTN A;  4NNJ B;  4FN2 A;  1BML C;  4A9A A;  3OG5 A;  1WWT A;  2GMI C;  4REZ A;  1ZE3 D;  2LWP A;  5DCN A;  2LRU A;  4A3O A;  4EKU A;  4MDK E;  4F1S A;  2CR5 A;  4C00 A;  3AB5 A;  2KK8 A;  1FMA D;  4A55 A;  2RDH A;  2BT6 A;  1K50 A;  4AOF A;  3PLV A;  1UGJ A;  3P42 A;  4N59 A;  3AE4 B;  2DZJ A;  3ZUN A;  3Q69 A;  3Q8E A;  4XX5 A;  1NYR A;  4AS1 A;  1S1Q B;  2Q5W D;  4M02 A;  1C76 A;  4M01 A;  5D3I B;  4WWP A;  2CJO A;  2IJ0 A;  4WUR A;  2ZJD A;  2D3A A;  1EO6 A;  3ZKJ C;  2NBU A;  1HEZ E;  4A20 A;  2K22 A;  1I4H A;  1IPG A;  1RFA A;  3ML8 A;  2JUO A;  4LDT B;  1NBF C;  1UUP A;  4MGY E;  2MLB A;  2JXT A;  1GUA B;  3ZXR A;  3AED B;  4LK0 M;  5H8Y E;  1J8C A;  3H7P B;  3QCA A;  1NEK B;  1AAR A;  1J19 A;  1L4Z B;  1YN3 A;  4KKI A;  2YVC A;  3DOW A;  3ABV B;  4I6N B;  2ICI A;  1E90 A;  2BW2 A;  1BT0 A;  3AXC A;  3ZNZ B;  3APD A;  2WYQ A;  4W9H A;  2BYV E;  3PTF C;  1JML A;  4LJO B;  4XWT A;  1HE8 A;  1C1Y B;  3IG3 A;  4KSK C;  2M0A A;  4PYU A;  2DZK A;  4FJZ A;  3DBR B;  4W9C A;  5DPR A;  1JRU A;  4IWP A;  1FXT B;  3VRA B;  4IWO A;  2KTR B;  4FAD A;  1RRB A;  1V97 A;  2KN4 A;  3IHP C;  5HHD G;  2O6V B;  2R61 A;  1MHX A;  2IO1 B;  5BMG A;  1SF0 A;  4G3X B;  2FIF A;  2KMM A;  2ON8 A;  4LNO A;  1RYJ A;  4N9F 4;  1FCL A;  4HKQ A;  1LQB A;  3VFK A;  1J0G A;  1YJ1 A;  2KWU B;  2QSD A;  2VRR B;  1E7P B;  5DPW A;  1FCC C;  1Y8R C;  4L1B A;  4IDI A;  4LDT D;  3W5U B;  4AP4 C;  2ZW0 A;  5E6P A;  3RNE C;  3ZDT A;  2ZW1 A;  1V1O A;  3DVN V;  2Z0E B;  3DBH B;  1YQ3 B;  3O13 A;  2EKI A;  2MQJ A;  1MPE A;  3ENE A;  2MBO A;  2LJ5 A;  2MHJ A;  1STE A;  3V61 A;  1E8Z A;  1FXI A;  3ONS A;  2G3Q B;  4W9G A;  2L52 A;  3ECI A;  2TSS A;  1C79 A;  4BKT A;  1FPY A;  2CHW A;  3B2F A;  2RSU A;  2W82 A;  4DXA B;  4S0R A;  2IGD A;  5BO4 B;  2IZV B;  4MGZ E;  3BK2 A;  3EEC A;  1YX5 B;  1L6V A;  2QC8 A;  2JF5 A;  3L54 A;  4FJY A;  2G4D B;  3TEY A;  5L83 A;  2KNB A;  4S17 A;  3IT6 B;  2FCS A;  4CQN A;  2O6V D;  2MSE D;  3QAQ A;  2RPQ A;  1QOB A;  1PYW D;  3DVN U;  3VUW A;  4YT0 B;  3B08 A;  2EMS A;  1GC6 A;  1F0Z A;  4B9K A;  3CIR B;  3PRP B;  4C4V B;  1E6E B;  4WAA A;  5G5H A;  3CMM B;  1DOX A;  2KXJ A;  1FXA A;  2GBN A;  4LNK A;  1GG3 A;  3KVF B;  4FJV B;  3MC8 A;  3TEW A;  1H4R A;  4AUQ C;  4TQ1 A;  2AX5 A;  5JXV A;  1IYF A;  2DLB A;  5IA7 A;  3C19 A;  1L7Y A;  3IXS A;  3SEB A;  3GS2 A;  2C9W B;  2KTF A;  2IGH A;  2NS5 A;  3ZW3 A;  3U7D A;  1MG8 A;  1D3Z A;  4K3C A;  4RFB A;  1YQB A;  3B2G A;  3PPA A;  1T3Q A;  1KH0 A;  3VHT C;  4KZC A;  3ZJT A;  3W1S A;  3EFC A;  3DPD A;  3FAH A;  3OWE B;  4LJP B;  2AWT A;  4AQ7 A;  3ZJU A;  4Q2J A;  3B9J A;  2K6Q A;  2QMT A;  3DVG Y;  1P1A A;  5BMI A;  1WM3 A;  3AE6 B;  4YXD B;  2DZI A;  3HRD D;  4WJO A;  4DK5 A;  4HDQ A;  4GGQ A;  4BBN C;  4C80 A;  2X8X X;  2Z0D B;  3A9J B;  1N63 A;  4P6V F;  2QIL A;  3GE3 C;  3UQB A;  1UEL A;  4GIV A;  1V81 A;  3VTV A;  5JH5 C;  1E5W A;  1SE3 A;  1GOZ A;  1T0Q C;  4W9I A;  2CHX A;  3MJ5 A;  4IUM B;  3EC8 A;  2C7N B;  3R7Q A;  4KGR A;  1E8X A;  3UIO B;  1V2Y A;  2WS3 B;  3I3T B;  4XGA B;  2X38 A;  1XEE A;  3A4S C;  2N4F A;  2HTH A;  1WXV A;  4HVB A;  5L95 C;  3UGB B;  4GDK A;  1WJ4 A;  2ZCC A;  2W3R A;  3RNG C;  3RFZ B;  3BYT B;  4JGH B;  2BS3 B;  4IG7 B;  1M4V A;  3JSV A;  1SEB D;  4F7Z A;  5T8I A;  4XWW A;  3SDL C;  2WDR B;  2MJE A;  4NAW A;  2LGY A;  4M00 A;  2NR2 A;  2BS2 B;  4WQO B;  3U30 A;  1HZ5 A;  3VVW B;  3L4P A;  1N6Z A;  1T5X D;  4ANU A;  3L08 A;  2KMA A;  3Q14 C;  1F52 A;  2WNM A;  2RR9 A;  3PT2 B;  1V5T A;  3PZ7 A;  1AWD A;  1K51 A;  2D11 A;  1B9R A;  4YSZ B;  1WMH B;  3IFW B;  1D6E C;  1G6J A;  3MP9 A;  5KHQ A;  1VZ6 A;  2PEA A;  2QDF A;  2A5U A;  2MW5 A;  1V86 A;  2WXR A;  2MBH A;  2MRP A;  4TKN A;  1ZDX A;  1JW9 D;  2XNA C;  1BXT A;  4RGM A;  2WX1 A;  2ASQ A;  1H8C A;  1EF5 A;  5G5G A;  3U52 E;  3PSE B;  1WYG A;  2PLP A;  2PPH A;  5D7G A;  4TMA B;  4HJK A;  2RPV A;  1ACC A;  1TBE A;  3NVW A;  1QZE A;  2H89 B;  4YSX B;  3JVZ X;  2J42 A;  4FUL A;  4MH8 A;  2RDB C;  1L4D B;  2PTL A;  3P2B A;  3U8Z A;  2PMV A;  2JXX A;  2HTM E;  1E7V A;  2WDQ B;  3PRZ A;  3VH4 B;  3RZW C;  3UIP B;  4BKS D;  4RM8 A;  5IP4 D;  1K8R B;  3AMZ A;  3MC0 B;  5JZE B;  1P3Q U;  3IVF A;  3T8M A;  2KJH B;  4DXF A;  4NAW B;  2KWC A;  1UGM A;  4DWF A;  2DZM A;  2XK5 A;  3UI3 A;  4ICV A;  2NVU I;  3BWU D;  2ZZP B;  4AJW A;  3JYU A;  3OJ4 B;  3AV8 A;  2LVQ A;  3ZNI D;  1Q10 A;  1SJE D;  4CO7 A;  1WXQ A;  2GBK A;  1UNS A;  3R8B A;  4YTM B;  2WDT B;  3ZJV A;  1KLU D;  2KJR A;  3AN1 A;  3WAO A;  1L2N A;  2DHZ A;  3R66 C;  2L7R A;  2N7E A;  1YQ4 B;  4W9D A;  3X23 A;  2W54 A;  4MH0 E;  3TIX A;  1AN8 A;  2KYW A;  3GP7 A;  2GBM A;  1T0S C;  4UDU C;  3VAW A;  2WU2 B;  1K53 A;  3BZD B;  3DBL B;  4JL9 A;  2WU5 B;  2Y5C A;  2JVC A;  3OLM D;  4L23 A;  1T6B X;  2MA9 B; 
#chains in the Genus database with same CATH homology
 1LO5 D;  2QJL A;  1L5P A;  3AED B;  4LK0 M;  5H8Y E;  3BVG A;  2BBC A;  2LFI A;  1NEK B;  2YEP B;  1YN3 A;  1L4Z B;  1E10 A;  4KKI A;  3VR9 B;  3AEF B;  5FKA C;  1ZP0 B;  2ACZ B;  3E56 A;  4YWG G;  5H92 C;  3ABV B;  4YTP B;  2ICI A;  2M56 B;  1RWS A;  2BW2 A;  1V1P A;  1L0V B;  2IPK D;  2BYT A;  1NVI D;  1ZUD 2;  2KAJ A;  1JML A;  4XWT A;  1ZXH A;  2BS4 B;  1QIL A;  2MH7 A;  2CU3 A;  2L83 A;  2M0A A;  2SAK A;  4OW0 A;  1NI3 A;  2N9K A;  3IT4 B;  1D5Z C;  3LYY A;  1TZO A;  2WP9 B;  3VRA B;  1ET9 A;  2KAC A;  1I4G A;  3ETR A;  2N0S B;  1V97 A;  2KN4 A;  5HI1 A;  5HHD G;  1JWS D;  2WXL A;  2R61 A;  1MHX A;  4WQM A;  5BMG A;  3DWG C;  2WXO A;  4USA A;  2H88 B;  1SF0 A;  5BYQ A;  1OFF A;  4YSY B;  3AEB B;  4GDK B;  1TS3 A;  2KMM A;  2ON8 A;  3KWV A;  3U7Z A;  1RYJ A;  1FCL A;  4HKQ A;  2PKO A;  3AM9 A;  5FK9 C;  2SEB D;  1N61 A;  5EE3 A;  2QSD A;  4WH4 A;  1E7P B;  1XLP A;  1FCC C;  3FC4 A;  2BB6 A;  1VZ8 A;  4L1B A;  2MEK A;  4IDI A;  1F77 A;  3W5U B;  1SIJ A;  2LUM A;  4US9 A;  2ZW0 A;  1D5X C;  3HVD A;  2ZW1 A;  3MFG A;  1XLQ A;  1V1O A;  1YJJ A;  4JE3 B;  1YQ3 B;  3O13 A;  4ZHP A;  2EKI A;  1MPE A;  2DYM A;  3TEX A;  4KGS A;  1C78 A;  1YJI A;  3NVY A;  1GPX A;  1STE A;  1FXI A;  3VR8 B;  2L1A A;  2V0G A;  2L52 A;  4HJG E;  1KF6 B;  5EE1 A;  2TSS A;  1BUI C;  1C79 A;  1TYG B;  3B2F A;  2W82 A;  1D5M C;  2L32 A;  4A6Q A;  3R2T A;  1GB4 A;  2AQ2 B;  4B0E A;  2IGD A;  1AW7 A;  4YTN B;  3HVZ A;  1N5X A;  4KGT A;  1NYQ A;  4NAM A;  3VRB B;  2PIA A;  3BK2 A;  1L6V A;  3KLS X;  1OQQ A;  1ESF A;  5HG2 A;  2WXN A;  2K3U A;  3TEY A;  3SFD B;  1FFU A;  1XCQ L;  1EU4 A;  4KKJ A;  1HZ6 A;  3URY A;  3IT6 B;  4A8X C;  1EWC A;  4OZB A;  1QQR A;  4CQN A;  1RM6 C;  4OHJ A;  1SXT A;  4RH6 A;  1QOB A;  1VLB A;  4ZRQ A;  1C9F A;  4XE0 A;  1PYW D;  2LHD A;  4O1N A;  4YT0 B;  4IKG A;  1XF5 L;  2QIE B;  3LXF A;  1NEN B;  1CJE A;  4B0M A;  5FR3 A;  5TSS A;  1DYQ A;  2JZP A;  1F0Z A;  2QEJ C;  1KRH A;  1SE4 A;  1FO4 A;  2WXK A;  3BK1 A;  3CIR B;  4NZL B;  5E6J A;  2MJD A;  2WXP A;  1E6E B;  2OED A;  5G5H A;  1DOX A;  2WDV B;  4KX6 B;  4OZA A;  2EEL A;  1RFK A;  4DXG A;  1FXA A;  1GT8 A;  1FRD A;  1ZDV A;  1J7C A;  1D4B A;  1ENF A;  1QLB B;  1PGA A;  4RGT A;  4N58 A;  3T3O A;  3TEW A;  3KWL A;  2WXQ A;  3BVZ A;  2B76 B;  4TQ1 A;  2JQR B;  1TKY A;  2AX5 A;  2NTS A;  5JXV A;  1JCK B;  3P4Q B;  1QOA A;  2DLB A;  1TS5 A;  1TKG A;  1IBX B;  4ZYS A;  2JX5 A;  2VZK D;  3IXS A;  4RF0 A;  1IBX A;  2VZK B;  3SEB A;  3BYY B;  2JSV X;  2BTE A;  3GS2 A;  2MJ3 A;  1XLO A;  2KDM A;  2PVO D;  2IGH A;  1JQ4 A;  2NMQ A;  1DOY A;  1FNU A;  4HRS A;  2V3N A;  2J53 A;  3N9Y C;  2V3P A;  1TS2 A;  3PZ8 A;  4WIP A;  3AE7 B;  4HEA 1;  1FFV A;  1I4P A;  2LGI A;  1Y56 A;  4M0W A;  1E9M A;  1N5W A;  4RFB A;  3B2G A;  3AE1 B;  1HA5 A;  1T3Q A;  4JWU C;  3NVV A;  4RNA A;  1TY2 A;  2N9L A;  1KH0 A;  1XLN A;  2Y5P A;  2HDE A;  3ZJT A;  3W1S A;  3FAH A;  3OWE B;  1CZP A;  4AQ7 A;  5AUK A;  3ZJU A;  2LJI A;  4Q2J A;  1HQR D;  1HXY D;  1B1Z A;  3B9J A;  1JWB D;  4C7Y A;  3W5V B;  2QMT A;  3AH7 A;  5BMI A;  2LMC A;  3GB1 A;  3AE6 B;  1I4R A;  2RDG A;  4YXD B;  2W55 A;  4RCO A;  1L0Y B;  1WGK A;  1TJE A;  3P4R B;  3HRD D;  1IGC A;  2WXG A;  3V3X A;  1QOF A;  4TSS A;  3AEC B;  1A70 A;  2Y3A A;  1R7S A;  3BVM A;  3C8Y A;  4C80 A;  3I57 A;  2ONQ A;  4US8 A;  4NJC A;  3P4S B;  1N63 A;  2Z8L A;  4P6V F;  2QIL A;  4A90 A;  2G9H D;  2V4I B;  3NZ3 A;  5MPO A;  1JWU D;  1CQV A;  4N6E B;  1I4Q A;  4ARI A;  1EWY C;  1FRR A;  3CF4 A;  1FEH A;  1SE3 A;  1AYF A;  1GOZ A;  4OZC A;  1I4X A;  2AQ1 B;  1EM7 A;  3MJ5 A;  2W3S A;  4ZRP A;  4FXC A;  1P7F A;  2PVG C;  4KGR A;  2BB5 A;  3NRZ A;  1F2R I;  4RGN A;  3PO0 A;  1SSN A;  3ZYY X;  4GDL B;  3V05 A;  2I38 A;  2WS3 B;  5AUI A;  2X38 A;  1KFY B;  1XEE A;  3P4P B;  4ARC A;  1MVK A;  4DQO C;  4EE2 A;  1XXG A;  3TUO A;  3IAS 1;  2N7J A;  1JRO A;  2KWD A;  1IUE A;  5C2T B;  1ET6 A;  2K9X A;  2WXH A;  2I2Y A;  1SBB B;  1K52 A;  3Q8F A;  1FIQ A;  4C56 C;  2W3R A;  3FIL B;  3RFZ B;  3BYT B;  2JU6 X;  2WQY B;  2BS3 B;  1JWA D;  2AQ3 B;  3Q8C A;  1M4V A;  4LLG M;  1YNT E;  2DWQ A;  1C77 A;  3AE8 B;  4ZOH C;  4D2K A;  1SB3 C;  1SE2 A;  1YN5 A;  1GTH A;  2DBY A;  1VZ7 A;  2G1E A;  1SEB D;  4GLS C;  5T8I A;  1GAQ B;  4XWW A;  2M19 A;  2WDR B;  4IOI E;  2MJE A;  4ZHO A;  1I7H A;  4MT5 A;  2J52 A;  1UWM A;  2BS2 B;  4H2A A;  1L6U A;  2WXM A;  3BII D;  4RGO S;  5C3J B;  4WAF A;  1HZ5 A;  4HRO A;  3L4P A;  3EGR A;  4LTU A;  2FBW B;  1T5X D;  1F2R C;  3AE9 B;  3P1M A;  1YMH E;  1PGX A;  2WXJ A;  1QT9 A;  1DGJ A;  2LEK A;  4R3D A;  1KLG D;  2RMM A;  4HKZ E;  1IGD A;  2WNM A;  3H8H A;  5EE9 A;  3AEA B;  1TY0 A;  1ZOY B;  3SFE B;  1VR9 A;  3PZ7 A;  1AWD A;  1K51 A;  1B9R A;  4YSZ B;  1JRP A;  2WXF A;  1D6E C;  1FD6 A;  2INP E;  1UWX A;  3MP9 A;  1J7A A;  1GTE A;  5BMH A;  1GB1 A;  1V1P B;  1VZ6 A;  3J9C A;  3W2D A;  2GB1 A;  4JWS C;  1PDX A;  1P7E A;  3KQ4 A;  4J3O D;  4C7Z A;  4XDC A;  3TSS A;  1PFD A;  2FE8 A;  2WXR A;  3AEE B;  2YEP F;  1SJH D;  1WRI A;  1C4A A;  2E6X A;  1PUT A;  1ZDX A;  2GRI A;  1JW9 D;  5LNK 1;  2XNA C;  1BXT A;  1FNW A;  4RGM A;  1MI0 A;  4PT5 A;  5G5G A;  1VDV A;  3ZGZ A;  2WLB A;  3P63 A;  1QKZ A;  3U52 E;  1VJK A;  3NUH B;  1WYG A;  2PLP A;  5D7G A;  2IDY A;  4TMA B;  2J4X A;  1ACC A;  1EU3 A;  2IGG A;  2RPV A;  3NVW A;  3EA6 A;  4MAC A;  2NTT A;  3VQI A;  3AE3 B;  2H89 B;  1KTK A;  2LHE A;  4ITK A;  4YSX B;  4JX1 C;  1C4C A;  2K0P A;  2J42 A;  4MH8 A;  4P16 A;  3R2I A;  1JAL A;  4OVZ A;  1JWM D;  1L4D B;  5EE0 A;  2PTL A;  2E3T A;  3U2S C;  3ZQ4 A;  5D3D A;  4RF1 A;  2K5P A;  4TQ0 A;  1CK1 A;  2JYT A;  3Q8A A;  4XDD A;  3AE5 B;  2PMV A;  1FNV A;  1N62 A;  1H7W A;  1V8C A;  2HTM E;  2WDQ B;  3FIL A;  1E0Z A;  1FM0 D;  1DOI A;  3AMZ A;  3MC0 B;  3U4E G;  2PW9 A;  5GXG B;  1ZPS A;  1ROE A;  1QOG A;  3LB8 C;  3TEZ A;  4DXF A;  1BML C;  4A9A A;  4NAW B;  3NS1 A;  1WWT A;  3E9S A;  2JWU A;  2OHF A;  4REZ A;  5HFY A;  1ZE3 D;  5BYS A;  4WWM A;  3UI3 A;  3AEG B;  2CJN A;  2XN9 C;  1L0X B;  3BWU D;  3T3N A;  3I9V 1;  3AB5 A;  1FMA D;  4A55 A;  3CWI A;  3W9C B;  3AV8 A;  2RDH A;  2BT6 A;  1K50 A;  1N60 A;  1UGJ A;  1Q10 A;  1VRA B;  3AE4 B;  1SJE D;  3P42 A;  4N59 A;  1WXQ A;  1ZXI A;  3DWM A;  1UNS A;  3Q69 A;  3Q8E A;  3HUI A;  3R8B A;  4YTM B;  3SR6 A;  1TS4 A;  1NYR A;  4AS1 A;  3ZJV A;  2Q5W D;  3WCQ A;  5I4D A;  1C76 A;  3MHZ A;  1QF6 A;  3NVZ A;  5D3I B;  1KLU D;  3AN1 A;  2CJO A;  2FUG 1;  2GI9 A;  4MM3 B;  1J7B A;  2IJ0 A;  1C4P A;  1XCT L;  3EUB 2;  4WUR A;  1YQ4 B;  2WXI A;  2INN E;  2W54 A;  1AN8 A;  1YN4 A;  3GP7 A;  2KQ4 X;  1HEZ E;  5BYR A;  1TKE A;  2JYE A;  1MHH E;  4JPS A;  4L2Y A;  4UDU C;  2K22 A;  2WU2 B;  1K53 A;  1I4H A;  1WSP A;  3BZD B;  1XO3 A;  3RPF C;  2WU5 B;  2DYO A;  2Y5C A;  3IAM 1;  3AE2 B;  3Q8B A;  1PGB A;  1UUP A;  4L23 A;  1T6B X;  2D5G A;  1H7X A;  1OQR A;  2JXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...