2BS71

Crystal structure of f17b-g in complex with chitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWSVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Natural Variation in Bacterial F17G Adhesins on Crystallization Behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
molecule keywords F17BG LECTIN
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 2bs7100
1ZK5A 1O9WA 2BSCA 3FFOA 3F6JA 2BS8A 2BSBA 3F64A 1ZPLA 1O9VA 1O9ZA 1OIOA 2BS71 4K0OA
chains in the Genus database with same CATH superfamily
1FV1A 2OULB 1J0JA 4XMUA 3X13B 1S7RB 2ADIB 32C2B 4DPAX 1WEJL 3S8GB 3WS3A 4FHBD 2W38A 4P9HH 3IS1X 1WUZA 5FYKL 2Y25A 4AKQA 1FORL 3IM1A 1L7IL 2B59A 4J3OC 3QAZB 2XZZA 4Z78A 1WZKA 4HBQA 1CZ8L 1FZKB 1RJCA 1QABA 2XUWA 3CSYA 4GRLA 3BLBA 3TA3C 4AC4A 1PYWA 1AJ7L 3FRPG 3LQAL 1NZRA 3X3FH 5JO5B 1KTLB 1M6UA 3DUUA 4UOW0 4YAQB 3RJQB 3AWGA 1HK6A 3S88H 1C9SA 1NIFA 3MQIA 1N8ZB 2FWOB 3ZUCA 2WVSA 3N41F 4ECNA 1X7SA 5KYUA 3GRWL 3C2SA 3E0GA 3PPEA 5IB4A 3WFCH 4HEME 5BRZB 5KAQF 5I6PA 2X89A 5L2KD 3BPLB 4NO2B 5AL8A 5E9AA 2EEAA 2ZUUA 4ZUSA 1ZXKA 3RDTC 3ZTCC 4YHPA 3I9GL 1R5IA 1X5LA 4XN2A 4F7MA 3QWNA 2WQAA 2AJVH 2JNZA 1N6QL 1KBKA 3NJVA 2D4DA 3KYMA 5LDUA 2P8PA 3P30H 4WNJA 4A6YL 3U4BL 3V9CA 1YEHL 4LOFA 4IKNA 1YYLL 2BDNH 2YD5A 3EZJB 4NT6B 3GIVB 5B1AB 2DH2A 5E6IC 3F6IA 4AW7A 1BMZA 3D09A 3WNKA 2VDKH 2WP3T 3V6OA 3A21A 4RA0C 3DSNB 4NYLA 2PPFA 4KZDL 2E6QA 4FMVA 3GSNA 4B5EA 2IOOA 3HBQA 4FG4A 5FO2A 1DSYA 5L4FA 1G1CA 1I8IB 3I6LD 5D72H 4NNYA 3MRHB 3OKMA 1IAII 3LN4A 1DR9A 2ZOUA 5D1ZI 2JCCE 2AVGA 3PP3H 4B50A 4X6CE 5DD1L 4YDMA 5DI8B 1CFMA 4RVBA 3LIZH 1FYHB 5EBWB 4AX3A 2JCCF 2NSXA 1O5DT 4U4IA 4E9RA 2XQYK 3CHRA 3FU3A 2VR7A 3RFZC 1UD8A 2DI8A 3OR7B 4BH7B 3EOBA 5IM7B 3ATEA 4MZ3A 4GRWH 4HUWB 1JP5A 4XHJC 1ADQH 1N64L 2YEZA 3I9PA 3TONA 4JG9A 1FZJA 1SJHA 2MEJB 1XH3B 5HYSB 4F33B 5A16A 1JK9B 4OF5A 5LAXA 1AE6L 5D7EA 4TTGA 1YUHB 3IU4L 4BBWA 2DQHL 2F5BL 5CIPB 5I26A 3V4PB 4BUQA 2B16A 3ZR6A 2P28B 1E5ZA 4LK4A 1YECH 4X4YB 1EAPB 1PW3A 2B1HH 4NKOB 1L5GB 3ISYA 4KZEH 4I3GA 4C4UA 1MOEA 3L3GA 4UUJB 4WTZG 3EHBD 1BQ5A 1E2ZA 3ARFB 4PTUB 4YVNA 4UI2A 4GRMA 5E8DL 2DDQL 5GHWL 4R2GC 3QIWC 3FTGA 3FUJA 3BPCB 3RG1C 3V0DA 4Z3EA 3LPWA 4FQXB 3KH4A 3HFMH 1JZIA 2VL4A 1Q0YH 2NW3A 1BAGA 2F1EA 2J8UE 4AXWB 3RDTB 4GKOA 1DFXA 2JB5H 3D33A 4B3VA 4ZO7A 1KEGL 3DX0A 2H6PB 4X6DA 2BX5A 3S7GA 1IKOP 2F0CA 2MRYA 4HHWA 1GIGL 3JTSB 2NX5B 3QUYA 1JWSA 5KUMA 1KPRB 2NY5C 1I1FB 4N9GA 4OGAC 2D3NA 3HZVA 4LKCA 1C5DB 4EDXB 4EVNA 4CNIB 3V7MA 3CHPA 3MLRH 5I1JL 3V6FB 1L6PA 4IU3B 1NEZG 1TVBA 4PSPA 4NQDE 3NJIA 1ND0A 2BCMA 2WVTA 3HI5H 4OUOA 4X5WB 3WIAA 5JPNC 5IOPB 4N86A 2VE6B 4HIJA 4RFEB 3IRCA 3OLGA 4MCZA 3WIHH 1MFEL 5AWNL 3S8WA 5BQ7A 4XO3A 1Q1PA 4OZIE 2J6EL 1ZLWH 3OKKB 3NIFF 4QRSA 4Y5YA 3PUUA 5HD8D 4ZUUB 3WE1A 1JN6A 2XVGA 3P77B 4R96B 3ISWA 3WV0A 1UM6L 1RERA 2EDYA 1JRHL 3BWAB 4PJCB 5CM1A 4ICXA 1GKOA 1I7RB 3PWNB 2G0LA 3F58H 4QJ5B 5T3ZH 3WENA 1DVUA 4N2BA 3TBVA 3DJTA 1JTTA 1CGUA 2E9WA 1EAQA 1EANA 5JUEH 1O9WA 1QW8A 4F24A 5KAQG 4FG2A 5AVRB 1MCNA 1NC2A 1CIUA 2O6EA 4YQXL 3VXUE 2IV8A 1SXCA 3ZR5A 5M94B 4QI3A 4DFIA 5F9AC 2FYVA 1A9EA 1EHLH 3IPEA 1FZOA 1KLUA 5TQ2H 5J3HD 2BVTA 4J4PD 4P05A 1OP5H 1OCWH 12E8H 5TQ0H 3DNKA 4ADGA 2CDEB 1B0GA 4MQ7B 3SGKA 3D2UB 4F2MB 5INCA 5E5MA 1IEAA 3H85A 1IC5H 3LIUA 4OLYH 1ZA6A 5AB0A 3CX5K 1RJZA 4A7TA 2JV6A 2OMZB 4LDLB 5FDWA 1E4HA 2YD8A 5KANG 2MCAA 4PG9B 1AO7E 5ENWB 4FD0A 3L3JB 2D3LA 2DLFL 4R5TA 2F19L 5E8PA 4JFFB 5ISZE 2Y5QA 3D1MC 2ZPKL 2G9HB 3ARDB 3OR6A 4FLRA 3REVA 3PY9A 4WTQA 3BEVA 5EEXA 2UY6A 1RUAL 1A6AA 1KCUL 4GLRI 4HVBA 2EILB 4K3JH 4ODVL 3VRJA 3TBWB 2YWZA 1ZLVH 2VRQA 3RUGF 1OO2A 3SQBB 2DQMA 2UWEF 3OMNB 3VRIA 2HKHH 5FCUL 3VFRB 1CGSL 2APTA 1W72A 2MKWA 4IBVA 1C16B 1OSPL 1PZDA 1IVLA 5J11B 3PGCB 2VTFA 3MHZA 4DK5A 2G2PA 1N59B 4H88L 3QYMA 4U3SA 3DHJA 2E74C 4MA1B 3IDMB 3L4UA 4Z8FH 2FTAA 5L88L 1UUSA 3FOMB 4GO9A 5EO0A 4OUUB 3HLAB 3W39A 4MZIA 1PCSA 5KYXB 3IDGA 4BIKA 5M7QA 2OTWA 4YHZL 3RB7A 4ZTOH 4OM1L 4LL1A 3WUWB 2DWXA 5D1QC 2VRAA 4MRCA 1ZWIA 1EMTL 5DU7A 3GSUB 2R0WH 5CN3A 5H37H 5E56A 3J07A 2WNGA 4QO1B 1AD0A 4QY8A 4W6WB 3NA4A 2EABA 3QEHA 1E43A 3B2DC 2O1AA 5D4HA 3LQZB 2ZWSA 1S7QA 3D48R 3B5TA 4ALAC 4B3EA 2Q8AL 2DL9A 2HJFA 3C60A 3DMMC 4QCIB 4RGNB 4OLXH 3KPQA 3VH8A 3WMPA 4QAWA 5PCYA 5LNGA 3IMRA 2VLKA 4HWUA 3ZDZF 2VAJA 1ZSDB 3HPLA 3IJ8A 4ZMZA 4S1QH 4XMLL 3SD2A 5AVQB 4WHYH 5FF6B 4NWTH 3PNWB 2ID5A 2P7TA 4U4BA 1FAIH 1UWGH 3IJHA 1EBPA 4PREB 5DQJB 4IOIA 2FJUB 4ES8A 3AM8C 4UT6L 1RZKC 1SJEB 5JPMA 5KBPA 5L7XH 2IPTH 3K2UH 1HNYA 5GS3A 1IBGH 1DBJL 1BD2D 1FQ9C 1HX0A 5A40E 4KY1L 3VWJC 5DTFB 4APXA 1TR7A 2FH8A 1FH2A 4MJIE 2O26U 4P5MA 3ZYIA 1U33A 2JK5B 2AV1A 4BELD 4WO0A 1XO8A 1JVKA 4OUUA 4RGNE 1IGMH 4ANKA 1IFHH 3SE4A 4P46B 4U7SA 5JW3H 3QFDB 1G7IA 3HC3L 3QXTA 5FV1L 4OFVA 1KPVA 3G5YA 3GK8H 3MV9D 4FLQA 4OFYD 5JW4M 4JFQA 4FFYH 4S1SH 4HETA 3CBKB 5FDWB 3VWKC 1NFIB 2CKBH 2FO8A 5LXGL 3CE1A 3GSVA 1DE4B 5T3XD 1QPXA 2CUAA 4LARH 3LNFA 5DDHB 3ZTJG 3WXVL 3NRQA 4YBQD 1RIHL 3BQUA 5AW6B 1USZA 3NT0A 5JIQA 1XD0A 4N6QA 4W81A 4MQ7A 1FNSH 1OTSC 2UY6B 4KXZH 2DYPA 3O6LH 3NJFA 4MBRA 1QFOA 2W80C 3MRPB 3FO9B 4N87A 3ZHNA 2X3BA 1PCXA 2E4FA 2X4NA 2QR0A 4P23B 1MH5B 2J44A 3HC3H 1PPIA 3LEVH 2COQA 4P2RA 2O30A 4G6KH 2IADB 1BIHA 2PCPA 2P5WE 5KW9H 5E8OA 1E4KA 4JKPH 3UGXA 1G6VK 4L3EB 2VMJA 3W9EB 5I6XC 4OIAA 3ARBA 3K6FA 3G6DL 1RU9H 2GFBB 4EQ2A 2GC4C 1FWXA 4DZ8A 4YBLC 5F6IC 5A2IH 4HAFA 3FL7A 3N40F 3D25A 2R56H 5DJ8B 4CJ1A 2FT8A 3S36L 3VTAA 2D7TL 2L8AA 4ZTPL 5AZEH 1D5BA 3MC0A 1VADB 5KSUB 4CGUB 3MBXL 2IBBA 1FPTH 4UQIM 4HKZA 4WUUB 5DJAB 1TQCC 4GXVL 1LO4L 2VLJA 3WY1A 4WO4D 2H8PB 3HG2A 4J8RB 4M61A 5LNEA 5SWZA 2GABA 4D0BA 2WZ6A 3EJRA 1L0QA 4D9RD 1KYOJ 2YMXL 4JHVA 3SDCC 2CGRH 3OB8A 4I3SL 5DVNA 4GKZB 4JW3A 2PTVA 3EF7A 1DQJB 2RQEA 4PW4A 3RWGB 4HBCH 4JVPA 2N0MA 3K8MA 4HIEA 4AK2A 3QORA 3VCLA 1XCQA 1GC1H 3L4YA 2CAKA 3GTVA 2XQYG 1T21B 2JJTA 1RPUA 3C6EA 1CWVA 2DQIH 4C83A 2Z35A 3MR9A 1MCSA 3MBXH 4TNEA 4ZMVA 3S3CB 4JFOA 4MCZB 1CICB 3MXWH 3BUQA 1CD8A 4IHBA 3X1EA 4YDLC 1JZ7A 3ETSA 4KKLC 5I9QB 4X7EC 3ZZSA 3S34L 2PXYD 3QAZC 1IU1A 3VFOA 3NTCH 1AO7B 4XP1H 5EBLA 3BP7A 4BGLA 1IV8A 3FO2B 5B3JE 1H5BA 2ISDA 2R27A 3P0GB 4PW3A 5FEBA 1TKWA 4L0YA 4G8FA 2IO5A 4NENB 1NGQL 4M02A 2AEIT 1BF8A 1UEMA 1JERA 1FO0L 3TCTA 3IKCA 2LQRA 1B0WA 2OYPA 2YRBA 1P0SE 5FX3A 3AXLA 4Q6YA 4OLVH 2VERN 3QXUA 3Q13A 2E46A 1FG9C 3B2XA 1H15B 2J6EA 4PJFE 1MCEA 3LN5B 35C8L 3ZDXB 1WS8A 1RI8A 3MREA 3FTUA 2AXHA 3QUZB 2F8XC 3VI4B 1JSYA 4H0IA 5GPRA 4F7CB 1JZ3A 3ZKNC 3QZWB 4N1EA 4BH8B 4FYRA 3EOBB 3PGDA 5F8QC 3H42H 4OFQA 3BAKA 2ZNXA 2XG4B 1DQJA 2ZWZA 1OAZL 3L5XL 4OH2A 3OXSB 3PL6D 2QSVA 3UH8A 4HOMA 2A6KB 1TTFA 4NS0A 3L9RA 4O4YL 4JR9H 3Q06A 4U33A 2FQEA 2OP4L 5DRXA 3B7UX 1FFPA 3K8KA 2FX9L 3LB6D 1FLRH 4W9CC 3KYKH 2V33A 4N9OB 5CEZE 3BSZH 2NDFA 2VAAA 4M1GL 3DK2A 5DJAA 1U8JA 3U2JA 3DVNA 4LLYB 3QO1A 2K6ZA 1TF4A 2C9SA 1UTDA 1HS6A 2RALA 3QORD 1GGYA 1YY8A 2VDNL 5EOCL 1JPSL 1V7MH 4HT1H 1KF9B 3PDOA 2AKRA 4U6YA 4AUJA 4U2YA 3RFZA 3D25B 4O58H 5LBVA 3N85L 1I8UA 1RK1B 1U8HB 4J1UA 1ICTA 2XQYA 3U4BH 2IG2L 2P8PB 5DMGD 2ZX9A 1P9MC 4M61B 3LSOA 1WA0X 5SWSD 2ZWYA 4ES9A 2LR4A 2WJ5A 4JM4H 2ADFH 1DVXA 4F7MB 4E0RA 3ELAT 4DTGH 2HUHA 1JHTB 4NZFA 3BDYH 1MG3C 3WIFB 5GRYA 3P0YL 4G83A 2YEVB 3TO4C 3DDFA 4I2XA 2YD0A 8FABA 4DO6A 4DN3L 1FFOA 2VDOH 2R8SH 4OCLC 3JZ7A 2HRPL 3I84A 4L8BB 3UOAB 3EYOA 4P4RA 1MJUL 4TQIA 5IW1B 1NFIA 3GXNA 1UG9A 3LIZL 3BUTA 3CPLA 4MXQD 2BJML 4UF7C 3JV4A 1PG7H 3X11B 2XY1A 1U91A 4WI4A 4B9KC 5B3NA 4DP2X 4AUYA 5KVFE 3BDYL 5ACZA 4IRSA 4KQ4L 43CAA 4B6ZA 1FBIH 1I8AA 4HCFA 1F4XL 4PRBB 1E28B 3BKMH 1PZUB 1CT8B 4CKVX 4GKNB 3PL6C 5F21B 2H32H 1KB5B 2BMKA 5DO8A 4H25A 1KTLA 3DUUB 4JG5A 3B9EA 4NX0A 1RCYA 4DIXA 3EBIA 1SLWA 4L05A 4G80A 4JVUA 2EEFA 4RWHA 5FB8A 3DURB 1E8XA 4HIIB 3C9NA 2LLLA 4KXCA 5ABAA 5FKPB 5CLXA 1PG7L 4ZSOB 4R4NC 5E00A 5GHWH 2NTSP 3EGSB 3RGVA 3APCA 4GSDL 1F11A 1LMKA 3WFBH 4AYBA 4KO6A 1XIWD 1LVEA 3AT8A 3BAXA 3MVSA 1WFJA 3FO0H 4HQQL 5B38A 2W0FA 5HDRA 3DVNB 4LLYA 5BW7C 5J0BA 3MLZH 3BKML 1DZ0A 3FQ2A 1DHKA 4M4RA 1CYGA 1WPCA 1LO2L 1QG3A 2DJ4A 5ADPL 5CEZH 5I16B 1YLBB 1G6RH 4KKRA 3RBSA 4WK2B 2FHCA 4J3OF 4NUMA 1VGKA 4WWKB 5IVZB 1YMHB 5F1NA 4ZFOA 2VUOA 4U6XA 1NEZA 4I48A 5MEOA 4MMXB 5I1JH 5F44A 4Q56A 3UO1L 4JDVB 1T89C 2YBGA 4BCZA 1MDTA 2QDWA 1RZIA 1A02N 3HI5L 2YUZA 4EN3B 3FQNB 2BRQA 4FXKC 3CCHA 5D1ZA 5EU6D 2E5EA 2WSDA 3FOLA 4ZZKA 1SN2A 4W9FC 1INQB 4OIFA 1T1XB 2FBJL 4HS8L 5AG9A 1PG7W 3HMXA 3IU4H 4KOCA 3KNBB 4UOQA 3SGDI 2JI1A 3UBFA 5CEZL 3U7AA 4XPFH 4X8JA 3EO1A 2P46B 3LEYH 3PDDA 4F2EA 1A4BA 1E90A 3BRDA 2XN1A 2BP3A 2WO3B 1OPGL 4XMPH 3RWEA 2DDQH 4MNQE 2VM9A 5HBBA 1XBDA 2APVA 4WI8A 4LSPH 5ITFB 1F4HA 1S2EA 1ROCA 4P5TB 4GRWF 1V27A 5DS8A 5ADOL 5L8JB 3OAYK 3O0RH 2H1LM 1JF6A 1VRSA 4WO4A 5EORL 4MNHA 1XGPA 4KGLA 4D7BA 3P3TA 2CLRA 3SGEI 5TQ2L 2CGYA 4JG0H 3D9AL 5E99L 4XNZB 4JO4L 4JDZB 3V55A 2OMZA 3AU1B 1XEDA 1DSFH 1XWVA 2X9XA 1KENH 1T7WA 5DHMC 4PBVC 4XB3A 1OPOA 1SEBB 5INCB 3DTDA 3GBNL 1DQDL 2P3YA 1TJGL 3ZZ1A 4R4BB 1RZJC 3VFTA 1KBBA 1TCMA 1SOKA 4TMPA 1WGOA 5CGBA 4ZYKA 1WE5A 3BEVB 5INDB 5AD0A 1U4EA 3WEBA 4NIKB 2H4EA 2QPFA 2WUBL 4JPSA 4WFFE 1DP0A 5E94A 2BFGA 2XFXB 4F7PB 4JKLA 2QZ5A 2XBDA 3NCYS 3TV3L 4IK7A 1M53A 4XXCC 5E6ZA 2DWTA 4MJHA 4N3UA 3OJDB 1W16A 1YEDA 3GO1H 3VDAA 3X3GH 3WIHL 4K7PH 5AWNH 3RE0A 4JO4H 5IBUB 3RZWA 4YSUA 3BQVA 1JZ5A 4PJHE 1EDHA 2ICWA 2EIBA 1JD7A 3AS0A 4HA1A 1RUQL 4XX1G 5EUOB 2E9BA 1NUDA 3ENEA 4BK5A 3KLHC 2XG5B 4NJ9L 3TFKD 3NOIA 4EDWH 4N1CA 5JQIB 1UWXH 2VN3A 4C56B 4AIZA 5IEKB 3AG4B 1OAQH 4POZC 1DLHA 4PRPD 2HSIA 5BUAA 2CMRH 3I2CH 1JVOA 1UADC 3U4AA 1JTPA 4AYEC 2XICA 4LEBA 5AKTA 1V55B 1J5HA 3NCBB 1CFTA 4F7PA 2Z8WC 5D1XD 4OZGA 4G8IB 1J8KA 3WHXA 3RWJA 5BS0B 2CJTA 1PZ5B 1WISA 5DF0A 5J13C 2HWZL 1EZUA 4LMQE 4XP5L 2NR6A 4K15A 3DX7A 3WFDL 3HBPA 3QQ4B 5F9DC 4PSRA 4EF3A 2XVKA 4YDZA 3UADA 3IS0X 5DK2A 2XSKA 1I9JH 5IJDC 1V5JA 4QXTB 2DQGH 3RGHA 2DWEA 4G42A 4RMRA 4TRPH 1UGNA 4GAJL 1UJ3B 3KJ4C 1ZKAA 1T1YB 2WB7A 3GC3A 5EEUA 4TTDD 1T1XA 4KK5D 1PS3A 3CZEA 4LPYA 3ILPB 1GHFH 4YZFF 2CO7A 3HC4L 5K1VA 4TUOB 3CSBA 3LMJH 1RIUH 4QWWC 5F7HA 3U0PA 3AB0C 3SOTA 3W38A 4FABL 4PJ5B 4Y5VB 1KCUH 1T0MA 4RSYA 4LBEA 1AQDA 4XPAH 1A22B 3U7YL 3ML9A 2KQMA 3DXAD 1OGAB 4QRPD 4N8VB 1I8MA 1S7UA 5HHPB 1AKPA 3QYCA 3PWPA 4TUUA 4G9DA 2ITFA 5C7XL 2FWLB 1MRDH 3EYSL 3KJ4B 3MRCB 3SPCA 2HG0A 4LVNB 2NXZD 1H6FA 3NABL 1I7UB 3RIFF 3FB7A 3DWTA 4LQFH 4RRPM 5GGVL 1YHPA 1JAEA 4OD2A 4HZAA 4GFTB 4JM2C 4NUJA 4KU1A 25C8L 1MCRA 5EO1B 1MAJA 3UFIA 2X10A 3TC9A 3ZKSD 5KVGH 3KPQB 2AJXH 3ZL2A 2YPLE 4J3WA 1E6JL 2R23A 3QWOA 4K07A 1BXVA 4MMXA 2VDPL 3OWRA 3OZ9L 2YAPA 4Q6IA 2V9RA 1MFNA 4AMKL 4Y4KB 1KN4L 3ZQ9A 1A3ZA 3IPFA 3MA9L 2R0WL 4Y4HC 1G7QA 2YLHA 3P4OB 4UBDD 4TLKA 2CHDA 4D8OA 3IJSA 4A6YH 2ARJQ 1GCFA 1DSWA 3Q9PA 1T0OA 1UM4L 4G8GD 3ULUF 4I0PA 4AQZA 3QDGB 3FUKA 4E5XB 2N59A 3IBOA 3QRGL 3EZ8A 3SDCB 3E6HA 4F1SA 2ED9A 5CJBA 3V7AE 4CVXA 2AJXL 1K8IB 1TPXB 2CM6A 2BW4A 5FV2A 1A3RH 4P2CG 1XGRB 1N5AA 5AYTA 1CDIA 3MFGB 2GUYA 4XVTL 5HDLA 5BZDB 1P2CA 3VFVB 2CR6A 2WSPA 3R18A 4NN7C 2PCPB 1A1OB 3T6VA 1BJ1H 1HCYA 3R06A 4X7TA 2XNAB 1OCOB 5EDSA 4HJUA 1JDDA 1JDCA 1GSMA 3P2TA 4JZJA 2X4NB 2EECA 1UENA 3K72A 1CICC 1MRFL 5AW1B 1CDHA 3TBWA 5CP7A 4Q4IA 2WM0A 3H0TB 2NY1D 1OAYH 5F7LB 4DZBA 1T80A 2C7UB 4PD4J 2Q87A 5IB5B 2AEPL 4EN3D 1S9VB 5FYKE 5F96L 3U1PA 3MUGA 1DANU 3BZ4A 4MYPA 2OW7A 3AZUA 1IFHL 1F58H 4GBXD 5KVDL 3KPSD 4YC2B 4FNTA 2R4SL 2WWNA 2N7BA 3L3DB 3T3MB 3LXCA 3NSDA 4LLDA 2QQKL 4X8GA 2OM5A 5CO1A 3LJ3A 1AGBA 1EJ8A 2ZX6A 3V4VA 1A7RH 4D2NA 4DOHB 1XGYL 4MB3A 4FA6A 4HISA 1E8WA 5ICXB 1U8LA 4KWUA 4G6ML 2CJ3A 1FRGL 2EH8H 2PYEB 1MHCA 4U1JA 3JWNH 3T0AA 1ZA3B 1A3QA 4PJFA 2ZOTA 1S78D 1L6XA 3SPHA 1X5IA 4I3RH 2QPSA 1RLWA 3PP4L 5CN2A 1Z2KA 2NSQA 5T1KA 5IB3A 3AQYA 3WKML 1MUJA 5CEXA 3MXWL 2B77A 2KPNA 4Y4HD 1J1OL 1JGDA 3BWUC 3DA0A 5IW6A 3TEXA 5BPPA 1Q8MA 3AS1A 2R15A 3WNJA 5ICZB 5D7SL 1AIFA 4N3TA 3FAXA 4C4BA 1R0AH 3BE1L 4DUXA 4LZKA 4OF3A 1PFCA 2CDFB 3R0MA 4FP8H 4OCRL 5GRUL 3VE0A 1MSPA 3ETBJ 4G6JH 1GJIA 2FDBP 3GXIA 3IFOA 1XGQB 1GOHA 2H41A 4H8WL 3DBXA 1NBYA 2H3KA 4JO1H 1G7PB 4YGVB 2Y22A 3ESNA 3U9UA 1RV6X 4DOHE 1DQQB 2E7CA 3ECBA 4QRUB 5I5JA 3WHE1 3K6OA 5SX5H 4LASH 5EBMA 1C12A 2IALB 2XXFA 3LZFH 4NKMA 5D96B 1H15A 1HKLL 3MV7D 1F90L 2WBJB 2IF7A 4LSTH 2WHVA 1WBYA 5KWYC 3CFTA 1N0LA 1WFNA 3SKNA 3TNMB 2ENYA 2I60L 4OFPA 4GAYA 5SWSA 2NY3B 3WJJC 5C86A 3WNNA 2EXYC 1RZPA 1J5CA 3K5RA 5T33L 1YC7A 4JL2A 2NZ9C 2DEXX 1AXSB 1YQVH 4R90H 1KJ3H 2B2XH 4L8SC 4EVNB 3QBTB 3KBHE 2R83A 1VFUA 1DZBA 3DARA 3I3BA 2W9EL 2X89D 4G5ZH 2FEEL 2AAVA 3KYNB 4Y16D 3QNXB 4UQ2B 4XNQB 3B2VH 4ANVA 1FNFA 4RMVA 3QHZL 4KX9A 4JFEB 4F9LC 3GUTB 3NJHA 3JVGA 4AL8H 3T0EC 3NSFA 3SDDD 4Y5XC 4HJEA 2MPVA 3QQ9D 1U2YA 3C6SA 4AM0Q 1GGCL 5TH2A 4Q9RH 1CBJA 2XETA 5I8KL 3V9EA 3H7BA 5DUBB 1JPSH 1IC7L 2NLJB 4HT1L 4I0CC 3TBYA 1U3ZA 4FFVD 3EJYD 4C4KT 5K9JH 4NKDB 4DJMA 1AQDB 1M2VB 2V0AA 5E6IB 4F8LA 1M56B 3LHAA 1ZTMA 3HB3D 2YXFA 4TNVK 4EI6B 3P4LA 2Y5EA 1EHNA 4OCYH 1DJXA 2W92A 3ZXAC 4ZW5A 1NJ9B 4NAQA 1S4IA 1WZMA 2PF6A 3QHZH 3S3SA 3SGJC 4QRPE 4JFOB 4PY8I 1G9ML 2E59A 2BRRH 4JZJC 4S1RL 1LO3L 1PIFA 5CJOL 2CM5A 4AIOA 3FT9A 3CFCL 3ZHDA 4CU6A 3WLWC 1W8EA 5I2IB 2DH3A 5J4MA 1ETA1 1ED3B 3BZEA 3A6CH 1EEUA 3RGVD 4QT5A 1KJVA 3HR6A 3LN9A 4K3JL 3MUHL 5T5FH 2ZP0T 4EI5C 3O9WB 2ZSVA 1F8TH 5EA0H 3MLTA 1AY1L 4MWFB 5HDWA 4K94L 1GZQB 4U1KB 3MJ7A 5HPOA 4YDVB 4PR5A 4OFDA 2A5UA 4YFDB 2VDQH 4MASA 1YN7B 1E9PA 4WENB 3IYLW 3V0HA 2WVVB 4YN3A 4Q6KA 5IOKA 4FEMA 2QL1A 3BFQG 1SXSA 3PLYA 4R0LA 3IMSA 5JIMA 2V2TB 2OSWA 3HC0B 4QWWD 4ZQKB 3UBGA 5CCKH 1PZ2A 3U79A 1R24B 1TVDA 4GXUM 1A9BB 4JE0A 5B39B 1VZGA 4JJHA 3VSTA 1CXHA 4DGVH 3KWXA 1PSKL 4MSWA 4XP9H 1MHCB 3PJSB 5CLZA 4PJ5D 4F15B 1X4ZA 4GSRA 3S5LA 1U3HB 4GP8B 3OJMB 4ABVA 1E4JA 2X4PA 2QQQA 3VX1A 3B37A 3TIDB 1JI2A 3HTLX 4IQHA 4IRZA 1IT9L 3QI9B 2K6WA 2G5RA 3FBQA 5JXAL 3F6JA 3GBDA 3VXPA 3LH2H 4F27A 2YPLB 1ZOXA 4HFWA 1ZLSL 5KJ7E 3O3EA 4WWOA 4L4VA 1ZGLP 1BEYL 3LNIA 4WKZB 1SVZA 2IQAB 4BQ9A 3VWJD 3RWIB 4DW2H 1RLBA 3QEGL 4PB9H 3DHUA 3FT2A 3H9ZA 5IJKC 3D0VB 3UACA 4R4BA 1AFVL 1ZTXE 1PSKH 3MMEB 4WO4C 1SOSA 2HLFD 9CGTA 4JE4B 4NHUB 3P11H 4IIZA 2VZSA 4NQTA 2FLBT 4HGWA 4LPCA 1MHEA 5DZNA 1LQSR 1ANUA 2VDML 2B59B 3LH2L 5I19H 1KGYE 3QZLA 3T8XA 3UO1H 2V7NB 5B1CA 2F54A 3B5GA 3KW7A 4RAVA 3TWCH 3IAPA 4O5LH 1BEYH 1Q9KB 3VGFA 4HJSA 3I75B 4W9IC 3CZJA 1SDAB 4QEGA 4DP7X 5E2VH 1AGCA 3ZRSA 5FGBA 2QADD 1A7BA 2XPGB 1UZ6E 3Q5OA 4LAJH 3VQMA 2A9ML 1YEKH 3E1F1 4Y9CA 5E6UB 1MKFA 3JTBA 4L5FH 4ZUVB 1UJ3C 4G1MA 4KGJA 3WTUA 1Z3GL 4L0ZA 2CK0L 5IMLA 1JGLH 1SYVA 2ZXBA 1OCRB 4KXAA 3H8NA 3HPJA 4K7PY 1OPGH 4HIXH 1JNNH 1OL0A 4KVCH 3GMQA 3ULUH 2G0KA 1CLYL 1J1XH 1S7WA 3HN3A 3INUH 4URTB 4F8NA 1FNGB 2NY1B 1KTRL 3EBHA 1WT5C 5ESVB 4AGNA 1T7ZA 2K3TA 3HEIB 5GGSB 5I1KH 4BH7A 4JCWA 3TH3T 1JHKL 3FFOA 4M48L 5LQBH 2DLHA 3RBGA 4NUGH 4X4MA 1KTDB 5C08A 4JKWA 1BM3H 5A7BA 1X5AA 2P48B 4OCMC 5DUMH 3QJZA 4UT7L 4ZW8A 5EZPA 3UZVA 5FB8B 1YEEL 3GLZA 2X4RB 5KW9L 1VAHA 5KN5B 3OKMB 2VXVL 3MPCA 3ARBD 2H32A 4PM1A 3DK0A 2WIMA 3CN2A 2I07B 1L7TL 1BVLB 4O00A 1ZLWK 3U30C 5CLWA 2W0FB 2ALWA 1HE8A 3UJTL 5HDQH 3KMDA 2VR4A 4PMEA 1INEH 2R1XB 3N1MC 4UANA 3W2DL 3ULVL 3E1ZA 1TEYA 3INUL 4PU2A 2FGWH 3HFFA 2QTVA 4P4KA 1LLAA 4EJ1C 1ZS2A 2P5WB 4MXQC 3FUMA 1M3JA 4MQXC 1R3KB 3SHSA 1TMQA 1MG2C 4Z7NE 3FCUB 5TE7L 5IVOA 2FBJH 1GMEA 4HS8H 2IWEA 4AM0B 3RP1A 1N67A 3KXFB 4AQ8C 3R4DA 3IGFA 3V6BR 2OQJA 4BE5A 1YY9C 3BH9A 2HVJA 1J1PL 1MNUL 2CGRL 3OHXB 4L4VB 1MCLA 3DECA 3JWOC 3OM3B 4HAKA 4WFGE 2GSGB 4CC0A 1CBVL 2E76C 4KRPC 3SKJL 1XCTB 2PR4H 3VACA 2XOTA 4QRBA 3II2A 5FOBA 5A6IA 1MJ7L 3C75A 4X98B 1UB5B 2JKWA 3T0BA 1QSZA 3BISA 3EUDA 4K8RL 1GYWA 4QHNA 4WHTA 3Q8BA 1ZANL 1FN4B 2VDMB 3WELA 5ADOH 1OTSD 4QHKI 1J9CT 4WSGA 3SDDA 2BP8A 2IDFA 1FI8C 3EG9B 1D5MA 4KDVA 4XVUC 4PS7A 1SMAA 3QQ3B 2W0LA 4RZCA 2F7RA 2WXQA 4Z7IA 4YHLL 1IRAY 1M1XB 4YZWA 2DWSA 4XP1L 4DEPC 1UATA 1MCDA 4R3SB 1SBSL 4X83A 3ES6A 2ZOLA 3LXAA 1HN1A 1KIPB 1HHIA 1ZT7B 4OF6A 2X9ZA 5ABDE 1JPTL 4UCFA 3FSZA 5T1JA 4XGZA 3PHSA 1XDTT 2YA2A 5LN8A 3X13A 1JN6B 2Y06L 3IU3A 3PL6A 3KLSA 1QASA 5E8NB 1OSPH 1IL1B 1BIIB 1MVUB 4L3CB 3HAEB 4KVPA 2XWCA 4I18C 3T2PA 3FUHA 3BAEL 3C09B 3X3FL 2WVVA 5I15H 1R46A 4NOFA 1XCXA 4MQSB 3HZ3A 2GIMA 4W4OC 3L5WA 2BY1A 4ONHB 1VA9A 5CBEA 4YHLH 1GZHA 4V1DD 3FQUA 4HHAA 5INDA 1FYTB 3PWVB 3UAJA 1LDSA 1M7DA 1AGFB 3DETC 2FJFA 3O9WD 2YMOA 4KTYA 2Z64C 1TQUA 2PTTA 1JWSB 3BYYA 1KY6A 1UH4A 5D7JD 4UV4L 3X1GA 1CL7I 5JMRA 4OZIB 2CSPA 2WBXA 3UZQB 3ZDXF 4BFNA 4NQDD 2ATPA 1UD3A 3CD4A 5EOTB 5I1IH 2YJQA 1A2YB 1M7XA 1HZHL 2CMRL 3I2CL 3V2AR 2FD6H 4ZFZA 2UWEA 3VWKA 2VDNB 5DRXB 3Q5YA 1ND0B 4X5WA 4JFXB 4RLDA 5JHDA 1QFWL 3B6SA 5C2UB 1Z66A 3IKKA 4ODSL 1Q9LB 2GSIA 4JY4A 4ZW3A 1WAAA 3ZPDA 3CHXA 4ERSH 3QG7L 4H8VA 2OX5B 1CLOL 4NZTH 1KPRA 2A6IB 1NCDL 1UOVA 1ZE3C 2EYSA 1S7TA 1FAIL 3JUYA 2BVUA 2WKLA 5DHVB 3T0ED 3GZOA 4GW5A 2D0GA 2VZ3A 5BZZA 4QOKB 4XNYL 4AGOA 2VXQA 2EC9T 2OBGA 4OD1H 4U1NA 1KBGH 4WW2A 4DK3A 5AYQA 3O3DA 3RZCA 4Q74A 1I8KB 1M3IA 1Y6KR 4UB0L 3ZTNL 2VLRE 3T65B 2X5PA 4Y5VC 2D3VA 1QFWH 2OMVB 1KIRB 4O2CA 2FSEB 4HJ0C 4DN3H 3OR7A 5DEFA 4JFFE 2XN9B 5EZJB 3ZGIA 4FABH 2F5BH 4PTUA 4ZS6D 2BSRA 2ODHA 3O6FD 4MDIB 4YHNA 2QVIA 3KWUA 3GSRA 5HDOA 3OXRB 4GAAA 5CBAB 4BZ2L 3ES6B 5HHMB 3WGVB 1QTSA 4X4YA 1BQLH 4LVOC 3UMNA 3BKJL 4PGEA 1TDQA 4U3XA 2QKIB 1VFAA 2NTFA 5C6WH 5E0FA 4JBSA 3MV11 3VSQA 2OXHB 5LO7A 4J23A 4OZHF 3NABH 4HH8A 3WY2A 5I66A 2QDVA 1DJSA 3O2DA 3D5OF 5LHDA 4DP6X 3QXDB 1PDKA 1RSFA 2QVKA 4UM8A 4LOUC 5ISZD 2DV6A 4NOBA 3N42F 3H3PH 2ZCLL 4AJ0A 4UT6A 1OWWA 5FOBB 2PYFA 3TNNA 2JB5L 3B83A 1KEGH 4M1CC 4NZ8A 3NDYE 1TO4A 4QXVA 4DPCX 1AI1H 4L3EA 1GPOL 5LG6A 2IEPA 3NJJA 1ZHNB 4R26L 1HXYB 1H8LA 5CKGA 1ID5I 5E23A 4M6AA 2R2HA 3T0WA 3ALWA 3CSGA 4NDMB 5C70A 2NMSA 5J9PB 2ARJA 3ZUNC 2W88A 4B53A 2CK2A 4IRZH 3VFSA 2AQQA 5D5ME 3IEAA 2QSCL 4ZAKB 4CN6A 4LLUA 3S2CA 2VN6A 5AUMA 1KGIA 1SNRA 4OV5A 5A2CA 3G3LA 3FJTA 5LBSL 1OE1A 4CVXB 2K3HA 4JZNB 1SYSB 5F72S 4DHLA 3H3PL 3GLDA 2ZUQB 5SWSE 3NVQA 4UM8B 4OZFB 4YIQA 1AE6H 5CUSH 5LCVH 3KPMA 1W2KT 3D85A 4LCCB 2WQWA 5D7SH 1KV7A 4BUHA 1OSZB 3L3DA 5DZJA 3Q8CA 4JKNA 5JXEA 3P4OA 2OYLA 4OI9A 2EDLA 1GAFH 2OCCB 4LAQL 3WJMA 4EI0A 2GSGA 4BK4A 2E7LC 2CA4A 2DICA 3QUHA 3JBG7 4TNGA 1BZ7A 2NRDA 3ARZA 2YIHA 3WEXB 4JGMA 2RIKA 5F7AA 4JM2F 4DZBB 3Q5TA 5C07A 3H0TA 3FZUC 5ICYA 5CJ5A 1HE7A 2WTOA 5FM8A 4P4KD 5T3XL 5D6CB 5C0BA 3WN5A 3FQWA 1HKLH 3QEUA 4DWHA 3MLVH 5J6HB 4JZJB 1DN0B 2BNRB 4MA3A 5DMIH 3QB7C 3U7WH 5C0NC 2IPUK 4N0YL 1QSVA 1FZKA 3LQMA 1N4XH 4PBXA 4M8UA 1R3LA 4U1MA 4JCLA 1ERNA 3VD1A 5E2TL 4IEFA 3N9GH 4U7KA 3TZVA 4XPFL 2DQTH 1QACA 4R90L 5CS7A 1TXKA 3HMWH 4WEUD 3VDBA 4DP5X 3FRPA 2P42B 3QXVA 1FL6A 4PGBA 1CTMA 4U1SA 3TL5A 2WTRA 32C2A 1S7RA 2ADIA 1D5IL 1L3WA 2ZQKA 1ZTXL 3G9AB 2NT0A 5K9OB 4YHNB 3C6LD 1LNUB 5T3XH 4U1IA 1NFDF 2W65A 3A6BL 1QRKA 4KJQD 4UBDC 5F7YC 3SE8H 4KKBC 3BVTA 4MMZB 3K80A 4NN6C 1B0RA 3CC5B 1PY0A 1MVYA 4UAHA 3ZMNA 1RUAH 3DO7B 4A6YA 1DQKA 3BD4A 2OMXA 2H1PH 3MJGX 4UQBA 1S8DA 5BV7H 1H6TA 2PTTB 1UT1A 2IC2A 2BHZA 1JRHH 2NX5D 2GEQA 4Y19B 1RKRA 3A3YB 4PUBL 1NIDA 4HZ1A 3D0VA 4U0RB 5DZVA 2W59A 1M05B 1IFRA 5I1DA 1ZHBA 2W8CA 4PRPA 2VC2B 4QAMB 1ZCRA 2X9YA 4FTVE 5SV3A 4Q52A 1U0QA 3P9WB 3HBGA 5IFHL 4ELME 3V8OA 5JORA 1E9QB 2R0LH 1J9TA 3C8HA 1ZV5A 1Q72L 1SRDA 3ZIYA 4ZNEE 5DC2A 4X0NA 1H0DB 2VQ1B 1BJ1J 2XKSA 3VFGH 1XGZA 4ZMQA 1OVZA 1FH5L 2J56A 5BJTB 4HUMB 3WLBB 1A21A 3IFNH 2Z7UA 4RGOH 4HK3J 1HYSD 4IS6B 4LSVL 1TG8A 5EWIL 4GMSH 5CGMA 2NXYC 4PAZA 4YDJA 5LGYA 5DXWA 3SKOA 1HIML 1TNNA 5EUOA 2P5EE 4P9ML 3VXRD 3X17A 1IC1A 3PDGA 1A9BA 4CADA 4HCGA 2WLLA 3MGOA 1AQ8A 2WLYA 2Y5TB 4XVSH 1XHHA 4A63A 4DKEH 5K69A 1NBQA 3BOVA 1BVNP 3U46B 1PLGH 2VQ4A 4PJXE 5E2JA 2XWXA 1B4JL 1TNMA 1E4XL 1OP4A 5D71H 3O4OB 4F3FB 5JHAA 1JZHA 1PEWA 1Z5LB 2APSA 4NZUL 5DHEA 5F3FA 3VXMA 3OBAA 1CFTB 3TPUB 2YPLA 4DO5A 4V2CB 3DV4B 3IDJA 2DY2A 3O9WA 3TN0C 2EKSB 5IJBC 3DXAA 2CDGA 4L4TB 4MB4A 3IBEA 1UXLA 4LO9A 3QJSB 5FUOL 1QBMH 5KBMA 3NCXA 5JXAH 3ZYOA 3FU5A 3HE7D 2BSBA 5IB2B 4YS4A 4QOKD 4AKPA 1UZ6F 3QG6B 2H8PA 4J8RA 5DZOA 5JR1H 4XBEH 4N90D 2YD9A 1GS8A 5GRJL 1F6AA 1OTUC 4KI1A 4KQ4H 1N2RB 1WFTA 2B1AL 4ELMB 4PLJC 3TJEH 1I85C 1S9KC 2E3VA 2ZG2A 7PCYA 3GSQA 1GGIL 3CHSA 1QHOA 5I75B 5KBNC 2G3XA 3DMMD 2QKIC 4S1SL 5IWLC 1PVHA 4KK9D 2DPKA 2GITB 2QT6A 3VFPA 3NIFB 4CA4A 5HHQA 4ODHL 3G9VA 2E27H 4N5UA 1QAWA 1G1OA 3WXVH 2PNDA 3FONB 3MLYH 5E4EC 5B7EA 4GG6B 5IBUG 3NFNA 2FO4A 5EZIH 4P23A 5B1JC 3AU0A 1F1AA 2PW1B 3GMLA 3LTVA 1P5VA 2NYYD 1U8OB 2VDPB 4JFZL 4PY7B 4X5QA 5C07E 3AROA 4QRTB 5E2VL 1SXBA 2WMPB 4LESA 1IX2A 1PQZB 2ICWJ 3OKLA 2F18A 1P84K 1E4WH 2WLJA 2ESVE 3GMQB 5HHOE 4AV4A 3L3OA 1LYQA 4IOSA 1X6NA 1I7ZA 4Y4FD 5CN1A 1G6RL 3JYCA 1ZVSB 1B9ZA 1MCHA 4XMLH 5FW6A 4EBQL 2DMKA 2OMYA 1CGVA 3ZN6A 1G9NL 3IF1A 3IXAA 3RVTD 2CDGB 1XH0A 1BCIA 3DO4A 1GYCA 5KSBF 1SXNA 1MF2H 3FB6A 4FNUA 4NQED 4X4ZA 1B0RB 4CSSA 4NERA 2F53D 4K55A 5DO2C 2Y6SC 2XI9A 2XCMC 5F7EH 4ZTPH 1H0DA 3KZ8A 1QYGL 2HVJB 4K71C 4OAWA 4AVKA 5TGBA 2AV1B 4HIHB 1B0IA 15C8L 4PB9L 1V7NL 1A6VL 2N56A 3BFOA 5D5MA 1F4YH 5FA4A 2ZCHH 3FRPB 4BZ1H 2UXFA 5D7IB 1EEYB 3B9AA 3CFUA 1I1YA 1QEXA 2YMXH 4XZUB 5IQLA 3W37A 5IQ9B 1BQHG 4MTMA 3D39B 2VXVH 4J6IA 4JDVA 3EH2A 4P57A 4KJWC 2PPCA 2ZCKL 4PS4H 3RKDD 4R97C 3HPJB 2H2PC 3S3DB 2DLIA 3WKNA 5AENA 2RBLA 3GS7A 1LO0L 1TU2A 4YXLH 1W72H 3EXJA 3F8UB 2JJSC 4NC1E 4YUEH 5JA8B 4OAWB 4KXDA 2DD8H 4F58L 1L9QA 1OT4A 4KO9A 3A4FA 2WXKA 2AF2A 3P9LA 3K4ZA 3OZLA 4P46D 4KOBA 3GXUB 4Y5XB 4OJFH 4ZO6A 3VMPA 2V5TA 4FQ2H 3OX8B 1S8DB 5F9JA 3GBNH 4MA7H 2BC4B 1IZJA 3FULA 4KO5A 5EUOE 1HSAA 4X9GA 2OR9L 5IW1A 1XTLA 2EZ0C 3NIGF 4M5ZL 2FHFA 3OD3A 3ZZQA 1N5YL 3NACL 4RISL 3UAJD 4JKMA 1T0NA 3IDGB 4IOSD 5EF3A 1LO0H 3Q2CA 2ZJSH 1MJJA 3GXMA 4FHJA 5C0BD 4CVZB 5T1KD 3WIFA 1LO4H 2VMCA 3U2SA 4XMTA 1J1OH 3D4YA 3O3EB 3TJHD 1HDMB 4HFWB 3GMMB 3R19A 3NIDB 3LSOB 2YHGA 4KNTA 5I5IA 4P59L 4AKOA 3FONA 2Z4QB 1NCWH 3QHTC 3QHFL 1DBKL 4ZUSB 1AGBB 3HI1B 3WMQA 2I85A 1QRNB 3TTSA 3KGUA 3FSWA 2R4RH 2DI7A 5HDQL 4BK5C 5C9KA 4J4PC 1WZAA 1XVSA 2MOGA 3TBCA 1R5VB 3BUPA 3FTVA 3O41A 1FSKC 4G7VH 3L3HA 2D2CC 4KI5E 3SSGA 1FLRL 3T2QA 2FYYA 3C6LA 3GM8A 4FZ8L 4N85A 3QIWB 4WI2A 3STZB 3SE9L 3WU1A 3HNTL 3RB5A 4WJKB 5EHFA 4ALAH 4WUUD 4Z0XA 3UJIL 3QQ9C 2V2XB 3BZFA 1NCGA 1M6OA 4BE6A 3AT0A 3F7PC 3H9SB 4HYTB 3H2PA 4W1TA 5CCGE 5J89A 5I9QC 1NOAA 4O02A 1DVFD 4N8VG 1MCJA 4WI0B 4E0RB 2NY3C 3KLAB 1DDHA 2X7LB 4CC4A 3LDBC 2IBZY 4L4TA 1L7IH 3D3VB 4EIBA 4YHML 5IV2B 2DBLH 2WUCL 3F7VB 4UV4H 3NEXA 3EJPA 5HYJD 2OMVA 2RCSL 3QDMA 5L4IA 4HXAH 1P2CB 3SO3B 2CHZA 4CRPA 1RUMH 1R3IH 3BJLA 5ACLA 2FWUA 2JQAA 1IKFH 2LU7A 1HILA 4XNZC 5HSFA 4K8RD 5IHWA 1UWEH 3MV7B 1IEBA 2XA8H 1O7VA 4CMMB 3SE9H 4Z7OB 2ICEB 2X6MA 1LILA 5MI0C 2WK2A 3HRZA 2VWEC 4PJIB 4ERSL 1OTTC 3AC0A 1KG0B 4K9EL 4Z7VA 3ZMRA 2HRPH 2GJ6D 2CCVA 2OX5A 5DC9B 1AO7D 3IMTA 4Q2ZA 4BSVA 4YDJB 3JV0A 3BP4A 4BSJA 4ADIA 5T3XE 5F0PB 1Q9LA 4JPKH 1HOEA 4HXAL 1YYLH 2BDNL 4TUOA 3E9TA 3ZMEA 2BSCA 1T5XA 2AEQL 5EZJA 5HI4D 3GT6A 3QULB 4NP9A 2ICES 5IROD 5F9OH 1G9MH 3OC5A 5EUKB 4A2EA 5F3HA 5TDPA 1WTLA 3WBDA 1AZVA 5ITBH 3OF6A 4UTCA 4ZUTB 1JGVL 2WXGA 2ZUQC 3LX9A 2DKUA 4I2XE 3V6FA 5KSBA 3L5JA 5GRVL 1C7SA 2HB0A 3RX9A 5GGUA 3QCTL 3JYBA 3MLUL 3DMMB 3VXUD 3QNFA 4MMXC 2BW5A 1U3JA 4YC2C 3LS5L 3TYFA 3ESPA 4IKJA 2AEOA 1J11A 3IJYB 1MI5B 3VFWA 3D85D 2X3AA 2JB6B 4ZFZB 3CZLA 3BH4A 3EBAA 3K1DA 4FG0A 3RZCB 2WZ5A 3UG3A 5B4MC 5ITBL 3LZPA 4U1GC 1ORQB 1SXAA 1M7IB 4QRFA 2ERJB 2ATPB 1IBZA 3QJHA 3GI8L 1C12B 4YGAB 4Y4FA 4AQ1C 3IRPX 2A6JA 4NQSB 3RX5A 3WN5C 1VKXA 1UT9A 2WWMD 3QJOA 5EBGA 43C9A 5CD5D 4TLSA 4PWGA 5DK2B 1MWAH 1RJYA 3BVNA 3T4AB 2WQRA 1YEDB 5FS5A 3PWVA 4P2RB 2H3XC 4UIKL 4TSCL 4UDTB 4LHUB 2E7BA 3D30A 4NRZA 5DJ2B 5LAXB 4ZFGL 3LH8A 3CVDA 2EVHA 5DURD 4ZAKC 4O02B 3ZKMD 2QLYA 1D7BA 4N1HB 2WXRA 5FO7A 1K8DB 1NUGA 4Q89A 5E8NA 2GBAA 1O9ZA 1XF2B 1XTMA 2KERA 5EOTA 1U4FA 2OLDA 4WW1A 3ZE1B 1MWOA 4PLKD 3CC1A 1TPXC 4F37F 5KSUA 2C3GA 2CQVA 4U2ZA 1D5BB 2ZP9A 4KVNH 2CBOA 3CVHL 3CVBA 1U93A 1ZJBA 3HNSL 3MLSH 2Y69B 1NMCB 3ULSA 1AHWA 4KITB 4XC1L 5D7IF 5FHAH 2CLRB 2A4ZA 1UA7A 1LWHA 4L8DA 1FCGA 1CK0H 1FRGH 3FYIB 5KTEL 1J7VR 2R9HD 4KJPD 4HWZB 2XLLA 5HYSG 4UIKH 4U1MB 1ZDSA 3BUYA 3Q48A 4HF5L 2DKSA 1NANI 1FCCA 4P5TA 5DS8B 5DVMA 2ZUXA 3H2WA 4JZNA 4OLUL 5B7MA 4Z7VE 2Y1ZA 5DK0B 1F42A 2NY2B 4MJ5B 4I85A 1DCEA 1T04B 2K8MA 4IRJD 2A99A 3N0PB 4KRNA 4CUCA 1CDUA 1IGCL 1FC2D 4OGQC 1G94A 2Z4QA 2K7PA 3LRSA 2LW3A 3MX0A 4FP8L 4NUQA 4OCRH 4Q8BA 1VLXA 4YPJA 3H6AA 3WGUB 4MA1C 5JZ7C 3HMWL 5HHXL 1U95B 3TPKA 2IANA 2E4TA 2KZ1B 3MOBH 5KANI 5D1QD 1JV2A 5HI3D 2O72A 4ZMPA 4PS8A 2VR6A 1KIQA 2Z3FA 4NI6A 1XL6A 4HUXA 4W9LC 3RTQD 3STZA 1BX2B 3HFML 4W93A 5IG7B 5EO1A 4M48H 3B3BA 3NZHH 5I73C 1KGWA 4O02H 3PG2A 5T1DL 3U2IA 2OYMA 2EUXA 1BM3L 3MZGB 1D6VH 2R69H 5BMFH 2WIIA 4TUKL 2CE6A 3PWPB 4BHUI 4BZ1A 5K59F 2CR0A 4XPBH 2P8MB 3UYPB 1ZWIB 1DVQA 1XZWA 2BSRB 4MDIA 3BH8B 2EDKA 2BY0A 4TVPD 4L8SA 1N7MH 1T0MB 3Q44A 3SD5A 4XMWA 1OAXH 5EEVA 3K3QA 3KYOA 4EIUA 3DTXA 4JDEA 4N2DA 1A14H 2X38A 1CN4A 1UWYA 1AGEB 2UZPA 3EFFB 3SQOL 1JL8A 3BT2H 4O02L 1G7MB 4QKTA 5IVXA 2ODIA 1I7UA 1PZCA 4FHKA 2HT4C 2X0VA 5AW0B 4ORZC 5DSCA 5BMFL 1HEHC 2V9QA 1O6TA 1PNDA 4Z7VF 3ILEA 3VTMA 5E4AA 3DIVA 3ELQA 3MRJB 5C09E 5CU9A 1QBLL 2IDQA 3ZL4L 3D06A 1DO5A 3PGFH 2VSMB 3QUXC 4XVOA 2AV7B 4PJ5A 4IRJA 4GAJH 1J0HA 4Y5VA 1X5YA 4Y7MA 5B3SB 3MO1B 4LCWD 3UROR 3CDCA 4ZMYA 1UXWB 4Y4KA 4WY7H 5F6HI 1KULA 2VL5B 1YVLA 4XCYB 2CO7B 4X6FB 3SKUD 3H56A 1FVEA 1LO3H 1KDIA 3B9KC 5EZLB 3FB6B 4YSEA 1DQLL 2KH2B 2V7NA 4APQC 4WV1C 1EXUB 3CLFH 5KVEH 1FNAA 4IBSA 2V37A 4X7CC 1GGTA 3AY2A 5A1AA 1N59A 3FF7A 2O5YL 4FKHA 4LLAA 1OF0A 4PJ9B 4A2DA 3VXOB 3DVGB 1UASA 4PI2A 3ZE2E 8FABB 1P5UB 2NNRA 4G8AC 4WI9A 1FL5A 2OMBA 2VSKB 4XAKE 3DDGA 1CFVL 1KB5A 1ZV9A 1V3JA 4RRPG 5I1HH 2OV0A 2X44D 1JNHA 2N7AA 1UXMA 3CDZA 5EG6C 1P6FA 3MXVL 5MEND 1A7NL 3GIZL 3PS6A 1CC3A 1A3LH 1S9WB 3NCFB 4UQEA 1QSEA 2QGDA 2VLKE 4QXGH 1CQYA 1Q9WB 2F53A 1GZQA 4A66A 4HWZA 2HWZH 2BVQA 1U91B 4N2LA 2F54D 2BFVH 4X99A 5CP3A 1RHHA 4Q14A 5HI5D 4NO0D 1QBBA 2YPKA 5GIRA 5IVXE 4WIQA 1KLFA 1HZLA 4IU2A 3MA7B 2Y36H 1H8NA 1QNZL 4NQCB 1AG0A 1TETL 2H7WA 4KK8D 1PLGL 1XAUA 1S9XA 4TOYL 1GHFL 2AI0H 3V5HB 3DRQB 3RRQA 1SLXA 3P0VH 3VXMB 5J6GB 4YO0B 5I8OH 4FFYA 4HKXA 4JGUA 4JLRB 4TNWF 3G6AB 4LCIL 2P8LA 4OFIA 5DRNB 4MAUL 4MD5A 5F1IB 3OKDB 3A24A 3TFKC 2EKSA 4E36A 4XOCA 3H4FA 2V9TA 1IE4A 1BHGA 2NY6D 2GITA 2BERA 8CGTA 2KLRA 1W6LA 5SWQB 4NQXA 1KJMA 2WLLB 3MGOB 1MF2L 3OQRA 4F8PA 3M7OA 5E9DB 2Z9TA 3EYSH 2H3NA 5BQDA 2P5EB 4H26B 3MBEB 3OGCA 4OGZA 5C8JA 5T1LD 2K9FB 3V9FA 3KL5A 5D8JH 4XBEL 2GK2A 3QARA 4JFPB 2X4QB 1MCFA 4KK6C 4TXVB 1NAMH 2D7NA 5HDBB 1TQTA 3UTTB 1AGDA 2NQCA 1ZLUK 3RZCD 1XIWB 4UTAL 4JM2B 2XTJD 5E7FA 4PRHB 3IKCB 4PJCA 2C4FU 4L9LA 1E6JH 2QGEA 4WFHE 3S4SA 1QZNA 3JZYA 4JG1H 2YOCA 1IEHA 4P5RA 4BINA 3FFCB 1F56A 1P7KA 2PTUA 3MO1A 3BP7B 3RFRA 1QOKA 3FN0H 2XZCH 2WLZA 4YLBA 1JWMB 5KVFH 3G5XA 2E27L 1A7RL 2F7PA 1N0LB 2B4CL 3C5JA 3DVGA 1A1MB 5TH2B 5C1MB 1RZJH 4X9BA 2WAQA 1YJDH 4RNRB 3VSUA 3WIHA 2OCJA 2IWKA 4G43B 1BECA 4LHJB 3EHBC 4M9PA 2XWBA 3EJQA 4U1LB 2YXWA 4BRJA 4PVBA 4DUWA 3WKMH 4F80A 4WGWB 5C0DA 4DQOH 3MRIB 1G43A 5F70A 3F00A 1EV2E 2G3MA 4G6AC 3UTPE 3C6LC 4JDTL 2G5UA 5JW3L 4RBPH 1QEWA 1OT1A 2XIDA 2Z34A 3DSFL 3GRGA 1XSIA 3HOGA 4P2RE 4D9RE 4DAGL 2B0SL 4HIIA 2N7SA 4AK1A 4UM9A 1M1SA 1L7TH 2DAVA 3QC6X 4NZDA 3GNML 4U6XB 5JNYA 3O3BA 3PP3K 2WJ7A 2X1WL 1UC6A 4RISH 2E8YA 1XZ0B 2XXCB 3SKNB 3TNMA 4I1RA 2OTUA 5DUJA 1RK0B 1OTTD 3JV5A 5D7LD 4BFJA 2BY2A 4P2OD 1O7SA 4LSSH 3GI9L 3SE3C 3UIZA 1KCBA 3T5WA 2MJWA 4R7DA 2VABA 4HKJB 5AKSA 1SJHB 4KC3B 1JXKA 1H8OA 2I60H 1XCQB 4LLDB 4M03A 1DBKH 4OV6F 5IM7A 3MV9B 4JKPL 4UOJA 4UIMA 4J12A 2YA0A 1H6EA 2GHZA 5EBWA 1XH3A 3AQXA 3KYAA 4ZAKD 5IMLB 2FR4A 3IDUA 3DUSB 1HWGB 3H9SA 4K8RH 4NO2A 4HPHA 1JF5A 4G7QB 1CQKA 1C1EH 1XIWC 5BOJA 3E8UL 3HS8A 1MUJB 4N2IA 3I02B 1WA1X 4NKMB 3QDJD 4PWKA 2Y1VA 1J5IA 3AXHA 1NIEA 4EOWL 2IDCA 2IAMA 3BXNB 5I8KH 1JFQL 3PUCA 5B8CA 3FFCE 6FABL 3PQYD 1PYWB 2VMDA 5D4JA 1CJYA 4EPSA 1L3NA 1BSIA 5DVLA 1UOLA 4LT7A 1TCRB 4FFWD 3UC2A 1F00I 1IGIH 1RJLB 2HFGL 4MD0A 4FLSA 1OM9A 2GQHA 2ETWA 2PYED 1NAMA 1U8QB 3S3BB 4WJ5B 3GSNB 3S5ZA 3O6MH 4M7KH 5AW4B 2FGZA 2VRKA 4NPYB 4R4FL 2O93L 4PG2C 1J86A 1P5UC 3F7KA 4UOZA 2GY5A 5CZXC 4TSAL 4EUPA 4JHUA 5I5RA 2Q2EB 5F9WC 3E2HB 1GKEA 1N3NB 3U2SB 3BAYA 3MODH 3HUJA 5ID0B 4MA8L 4PBDA 3PABA 4GW4A 2CO1A 2C8NA 4U6VL 4GSUA 1BVOA 3ULUD 2BOBA 3CFCH 3NPZB 3GSOB 1CF1A 3QPQC 1DJYA 3ZRCC 1NCWL 4UZUA 1NMAH 2EADA 4R83A 3BPOB 2QJDA 1HSAB 4UDTA 4FQQB 3QR2A 2Z8RA 5EU7C 4MWFA 2K8QA 2WINB 4WEEA 5BRZE 3K5SA 4ODXB 4XCFH 2R4RL 2XRAL 1O0VA 1MFUA 2OS7A 3B4NA 3BPNB 1L6ZA 2D9CA 3CVIH 4MBOA 5LB1A 3NBNA 2W9EH 3BT0A 3EKCA 3STLA 4UNUA 4OZGE 2AEQH 2A74A 2ZOOA 4R84A 2EH7L 1VZIA 3BUBA 5JO5A 5DZ9A 3ZE1F 2YOAA 4LIQE 3VD4A 4HALA 4YSRA 1WRFA 4NM4H 2DQFB 3TV8A 1BWMA 4IK6A 4ONOA 4AE0A 3A5VA 2D3JA 3UBHA 1CO1A 1R24A 3GRWH 3EJUA 4BQBA 2AFNA 1UM5H 3QW9A 1HH9A 3LV3B 1KY7A 3CWGA 4ZAKA 1T7VA 7PAZA 3GBMH 1BDYA 4RA3A 3SGKC 1E3ZA 3RVUC 1JK8B 4KKAD 4R8WH 1FH5H 2K1MA 3UCRA 5LJYH 2MCMA 3N2JA 3VD2A 5EUOF 4Y1AB 4ZQTA 4PJGF 3NAAH 4EI6A 1G7JB 1ZEAL 3LS5H 4H8WC 3SO3C 2W07B 1C5CH 1OARH 2Z7ZA 4QOKE 4EO5A 2FRGP 3KXFE 3GBLA 5DCCA 1D9KA 2IAMD 4UT9A 2NXZB 3NZSA 5EO0B 3ZDYB 3IGUA 2EDNA 2VLJE 1WS7A 2J5LC 3G5ZA 3PWJB 4FI8A 3F05A 2H9GA 3VA2C 1YMME 5MENA 3C5SB 3L1OH 2YUVA 1PX3A 5ELIA 5GRXG 3FDWA 4S1RH 2HTLD 3UTQA 3VXMD 2GK0B 1F45A 5G4NA 1F4XH 2VAAB 3FB7B 4ATTA 5DR5L 3MRMB 4K9EH 4UV7L 4ANWA 2X6CA 4DPRA 4Y2DA 4HZLB 2NTFB 4BCXA 4TQ8A 5SX4I 5AAWA 4P0DA 3DIFB 4XXWC 4MAYB 2O61B 2V2WB 1T3FA 1TJHH 4ABQA 2NYKA 4FNRA 1G5AA 5IUSA 1SZNA 2JJSA 5BVPH 1Q1JL 2NQ3A 2P5ED 4WNSA 3VXRE 3BLKA 3BPOC 3KPSA 1ZVNA 1B4LA 3DX1A 4QTHA 1M57B 1YNKH 3RKDC 1OW0A 4JFDB 5EO9B 4B7IA 1T83A 5FLVA 4MMYA 5AZ2H 1EFXA 3LB6C 5GS0H 1F1GA 2HFFB 2W0PA 4FQPA 4TVPL 5LXVA 4J2XA 5L6YL 2DWDB 4HUVA 3TVMA 1GGIH 3MBWB 5D1QA 1F13A 4OF7A 3T77A 5I1LB 4JFHE 4TNFA 5ILTL 3HB3C 2YGQA 4JN1H 2BCKA 1R3HA 2IDSA 3QULA 4X6EB 5CKAA 1B0GB 5BOZG 5HHPA 5L4JA 4PEEA 4N8VA 5SWQA 2PW2B 4NQXB 3JTTA 4EZLA 4DVRL 4JQVC 5HDBE 4XTRD 1B2WL 2OZNA 4DH2A 4L4JA 1Q94A 4PYGA 2J12B 3HG4A 3OLDA 1A9EB 5KJ4A 2L3BA 1DDHB 4KO7A 3ZDXE 3MACL 1Z0MA 4MJIA 3K6NA 4HF5H 4GAYB 5SWSB 1I9IH 1SHMA 3D08A 1K3IA 5T3ZD 5K33A 3L3JA 1S3RA 2EP6A 2AJYH 2XTJB 2K9UA 3VH8G 4AIZB 4XE5B 2AXFB 1G6RB 2GJZA 2ZZUT 1EO5A 1DLHB 3O45B 1I3RA 2DJUA 2YD4A 3D4ZA 3TIEA 2F68X 1HJBC 1BQHA 1YMMB 2F74A 2UZYB 4JN1L 1ZT7A 4ZW7A 2WZAA 1FN4A 1R1CA 1R33A 3FFCD 4NP4L 4PJ7B 4NIYE 3T4YA 3Q2NA 4LAQH 4PRNB 4AV5A 4DVRH 2CO6B 4FXKA 4NQEA 4TV3A 4HDIA 5DGRA 2PXYC 3DGCR 3QPKA 2MCG1 2WO4A 4KJYB 1KJ2H 2EINB 4KDTA 1MQ8A 1P1ZA 5AFAA 3P1VA 2GTZA 1GTFA 2PO6B 1YY9D 3HMXL 4FQLH 3VQLA 3OTTA 2XPZA 3QDGE 2ESVB 5HHOB 3Q1SH 5FUZL 4Y2DD 2YQGA 3UBXA 1QFUH 4QMEA 1YEFL 5EORH 4PLJD 3CZUB 1JYXA 4YXKL 3RX7A 2QEJA 5E2UH 2VDLB 4YXHL 2HJLB 2HH0H 3EAKA 4KROC 3QUXA 4QIRA 3QS3A 1JJUA 4U1GB 2QKSA 1IJNA 3RVVD 3MUZ1 4EUPB 2EDJA 1MNUH 2J21A 4YE4L 1ZGLB 1YEIL 3DJRA 2YFNA 3F5WA 3CUPB 4G9FD 3NN8A 2BP5M 1ZK9A 4HSCX 3CLEL 5FHAL 1HSBA 4FXTA 1DE4A 1ACYH 4PLNC 1XGRA 1EXUA 4HJTA 4Y1SA 4ZUWA 5C0CE 1MWAB 1MJ8L 5JUEL 5C0CA 4M6NH 5D7LA 3D7PA 2Q3XA 2JELH 3PFUA 4JFDA 4ENZA 1BBDH 4Y8AA 4Y2LA 2QADB 2XT1B 1NGYA 1UXSB 3Q1EA 1RFDL 4QHNB 1NBZB 2PXYB 5GS2D 2JKLA 2AV7A 3QRFM 1MW1A 5J6SA 1R47A 4WK4B 5I16A 3NCJH 5E5UB 3QDME 3PNWA 4KK8C 3FSOA 3ZY7A 3N6YA 3WEMA 5IHBA 3CV5A 3K71A 2AERT 4L4TE 5IHUH 3IJHB 1U3HC 5F9JB 3UO8B 3BSHA 5IZ7A 2IWFA 3NACH 3PHAA 1EBAA 4XPHH 5GSRA 4EQ3A 3RVWD 1ZSDA 1BYPA 2VSDA 1ECYA 3NFSH 4X9HA 5LVEA 2F53E 1PJ9A 4QCIA 5GRVK 4HPOH 4GUOA 1UEYA 3ATFA 2X9WA 1IQWH 3VH8B 2W91A 1BQUA 2WXLA 1DVSA 4F5CA 1GZPB 1OK0A 5I5MA 5KVEL 1EHXA 1ZLEA 1BFVH 1PZ3A 4NN5B 4XCEB 4X80L 3DV6B 1RPQA 1CFNB 1S7QB 2GAZB 5E6ID 3D0AA 2X1QA 2AAAA 4A2LA 4CBPA 2NOYA 2ENPA 5FCUH 1KBWA 2PR4L 3NGBC 4IOIB 3ARUA 3OPZL 4TL5A 1AMYA 3MROA 3UL4A 1GYUA 5FGCB 4PS3A 1TOXA 5EEWA 3J7HA 5J5EA 3NJMA 2OTWB 1SF5A 4L29A 3NZ8B 1JNLH 2VXSL 5D96C 1BQSA 2PPEA 3HPLB 5GS1C 5IQ7H 1SBBA 1BMWA 3NA9L 5D7KD 5CGYD 4Z5RA 3G04B 5F0JB 2R29H 1YNTA 4QGTA 2QQLL 1IQWL 4HC1H 3V0VA 3DYPA 1U8IA 1P4BH 1FNLA 3MNVB 4YHZH 3ZX1A 4PRHE 3FO1B 4L4VD 1JF1B 4X80H 3M86A 4S0SD 4XPAL 3U7YH 1QRND 4HG4J 3JXAA 4Z7UB 3BDBA 1J0YA 1B6DA 3VM5A 5J1TC 5BZWA 3T2NH 2WXHA 1AD0B 3H4HA 1FSKB 3FT3A 5IB4B 4M43L 1DQTA 2LAAA 3FCSA 3PGFL 3JVGC 3O11B 4KMLB 4N22A 3ILQD 1HQRA 3FT1A 3AAZA 3BPNC 4LGSB 5D55A 1JNLL 2WLKA 2HJLA 2R7EB 5ANME 2OCFD 3FTYA 3N0AA 5CCJA 5KVGL 3VW3H 3M17B 4GUPB 3QI9A 4TLUA 1MCQA 2AABH 1CDYA 4FZEL 3UGUA 1X7QB 1CUOA 3HE6C 1L9MA 2EDMA 2WBJC 5TE4L 3RWCA 3WDJA 2GTZB 3GIVA 3ZTJH 4ZO9A 3VFSB 2JKNA 3V5DA 4G7YH 4R0LB 1YSOA 1O6VA 1U3HA 2QV2A 4AEHL 1IEAB 5EPMB 4LLVA 2AANA 5D7JA 5FA3A 4LGPB 3TO4A 4AEIL 3U6RB 2ATAA 1KJMB 4DUVA 5MENE 4UT6H 1PLCA 2DTMH 4U3HA 1MFMA 1JHLL 1RUPL 1UM4H 3LRHA 1GOFA 4HWNA 2XJLA 4HGMA 5D8JL 3JSSA 4XNXL 3P3SA 1U8KB 1EO8H 1ACZA 2CJSA 2C3WA 4Z8FL 5FO8A 1UA3A 2OR8A 1VPOH 2ZXCA 4X5XB 4XNUL 3DROA 4V1DB 4N26A 2ZONA 1IBDA 1JPEA 1IGML 1EJOL 4FXGB 4UNIA 3GWJA 5JPMC 1NCAL 4H20L 1HXKA 4AY0A 2ZOKA 2BNUB 2ZSVB 3QCTH 5GSVB 4FFYL 3TWYA 1NDGA 4EN2A 3UX9B 4AQOA 3TIDA 3UJJH 4KQ3L 2VO5A 4PRNA 5IBTH 4M00A 3UYRH 2X4TA 7FABH 4U49A 5D2LF 1MIMH 2FUQA 4K3GA 6TAAA 3ZIMA 3F85A 2BWQA 1T5KA 1W6WA 2Z65C 5DHXB 3ZE2B 4R7NA 5CMAB 1I1AA 3QZOA 1QNZH 1RHHB 3Q7JA 3MRGA 5JZ7D 5KSAB 4X99B 3GXPA 4LPWA 3FQRB 4OQTL 1BZEA 1C5BL 2WNXA 4MNQD 5DYFA 5ES4B 3DYOA 2MMXA 3PHOB 4EIZC 5EIQA 1MCIA 3TVMB 4MKMA 3TESA 4NFDA 5DO2D 3F7QA 3BPLC 5L0QC 4FQ1L 5DRZB 3NIDF 2EIJB 3IT8D 4E9VA 4OZHE 3OZ9H 4HUNB 3TH4T 1PU0A 1JNHB 2CJUH 2YAQA 1S3KL 4XPGL 3JT2A 1EERB 3QZWA 1TKWB 3NIDE 2DQDH 3UJJL 3LNGA 1TTGA 1XQ4A 3TYFB 1LEGA 4PJ8C 4HUCA 5IBLC 1Q4NX 1AKJA 5D4IA 3UC0L 1ID2A 2ICCA 2H0EA 2JKIS 4A1RA 3QUZA 1INDL 3QRBA 3PV6B 1EEQA 1W72L 4RRPA 4G43A 1KTCA 4LCCC 4UTAH 1S7SA 1K2DB 2Y9RT 1G87A 1XGUB 4JCMA 2Q3AA 1KPUA 3ECWA 4FQ1H 1NCCL 3W11C 1NJ9A 3BC9A 3V6OC 3CVHB 3ASOB 2JWYA 3GXDA 4HOWA 5HYIA 4N0YH 2A6KA 1AI1L 4PG2A 4YFLF 3IJ9A 3EDDA 3D4CA 4HCRL 3BE1H 3FFCA 2XV2A 4IKIA 4KVNL 2XG4A 1NBVH 3GFUA 5I74B 3B9KA 3MRBA 4WI5A 4H4NA 4G9FA 2XZCL 2DQTL 1M2VA 3FRUB 1QBAA 3JV6A 3L3GB 3RGVC 3GXFA 4J27A 3KS0J 4OTXH 3GJFA 4NRXB 3DXAE 4GRWB 4Z7VB 2YAMA 3IMBA 2QSCH 1MCOL 5DT1L 5IGXL 3NRFA 4IEFB 1U41A 5CBEB 2ZXWB 5CFAA 3EGXA 4C83B 4P5TD 4LASL 5C9JA 1AIFB 3E8UH 3VMOA 2YEZB 3A6BH 1JMXA 2VO8A 3UP1A 1MAMH 1WICA 4AC2A 2KLTA 3VCLB 5ECGA 5ISZB 4LSTL 1DQML 1KFAL 4C47A 1DN0A 2BNRA 4QF1B 4Z0BH 4F33A 5I75C 5FCSH 1T5XB 3BAIA 3DGGB 4JDTH 2PUQT 1T21A 4N4YB 4PTTA 5EU6E 3ORJA 2M83A 3LEVL 4L3CA 4OKDA 2D31B 1TTBA 3VYOA 3SOBL 5JXED 1R6VA 1P84J 4PWFA 5AW7B 1GIGH 5BV7L 1YQ2A 5KSVB 1RU9L 4X8CA 2ZXEB 4JLRA 1KJ3L 2B2XL 4TVPE 4KPHH 5HHXH 2ITCB 3TO2B 5EBLB 4V1DA 1M1XA 4IDJL 2I32A 3IN2A 5ESAB 2DYPB 4IGBD 3O6KH 1RMFL 3JWDH 3MRGB 4HOZA 5A7EA 5KSAA 3ZKMC 5K59E 1ZA3A 2VLJB 3LYRA 5ACZB 3L2NA 2BP8B 3RDTD 5K1JA 4U6VH 4XCNB 3ROLB 4WLCA 4JRWA 4AT6A 4PJ7F 1MFEH 2CO3A 4IBWA 4NQDA 2BINA 3STLB 3FUIA 1KCWA 1E50A 1MCWM 4PJAE 4YX2H 5IMMB 4Y1AE 3ZTDC 2WZPD 2ITEA 5AG8A 2N1TE 3PHQB 4Z18A 1X9RA 1XD1A 4FQQA 1XF5B 1U95A 5C0IA 1A6ZB 2F8OA 3TCXA 1QO3A 3BP5A 3KYMB 1YYML 4LEXH 1QNIA 2CLVA 3VYPA 3EO9L 4J3OD 1PZAA 3AB0B 3BZFB 3QUML 1P1VA 2JH2A 3ARDC 4ZFOL 4H25B 2EAEA 4LLWA 2R7EA 5CP7B 3PXJA 5DZLA 1MY7A 1U8NB 3HUJB 1OGSA 1OOAA 5AW3B 4A2FA 3PWPE 4CVZA 4EOWH 4IYKA 3LEXA 4ELKB 2JTDA 4UMGA 1DDTA 1MCWW 3M07A 2NCEA 4QTIL 4WWNA 3S5LG 2KQNA 5B1JA 4ETQA 4YBHA 1SOQA 1RJLA 4RFOH 3VNZA 1B9KA 3OX8A 4PRDA 2KMWA 2GIXA 1S9YB 3VFNB 5CFHA 1FO0H 1MFCH 1YPZE 2NY4D 4LFHD 4Z78B 1IIKA 2I7SA 4UTAA 2OYKA 4F20A 5HP5A 4NQUA 5B8CB 5I71B 1ZT4B 3KPLB 3LXUX 3QNYB 2I9LB 4FX5A 4DGWC 4JM4L 3VXTA 2VISB 3GSRB 2Y0SA 1HINL 4N8UA 1BM7A 2DLFH 2DYSB 3P0YH 2YK1H 3VGGA 3HZYB 1Q72H 1CMOA 2VDKB 2LTQC 4QLRA 2X41A 1T03L 3DUSA 3L1EA 2XIBA 1HTYA 3VXSB 1GH7A 4UT9H 3MRNB 4YVUA 1JYWA 2NNXA 1XF4B 4MJID 1IAOA 1QR1B 4H44C 3ERXA 4HK0A 2HKHL 5IW3A 4UTBL 1MI5E 4G1MB 1HIMH 4AI7A 4X7SH 1LK3H 1TZHA 4FLOA 4PJAB 1KEML 2EYTA 4M7ZC 2VLKB 2IGTA 5G4OA 1CF8H 3HG1D 1U6AH 5DHYA 2FX9H 4FXLA 4EN3C 5I1GL 1UWXK 3CJJA 1P4IH 4A7GA 5AL0A 5HGDA 4LBEB 5K93A 2BRRL 4J3BA 1M7IA 4MD4A 4PJ8D 4BCYA 1FBIL 2HT2D 2B15A 4R7XA 4PJDE 1AFVH 1F2XK 3U30B 2CR3A 5JTWA 3T1WA 1DJZA 3LKPB 4OM1H 3ZK0A 3P3UA 4XOBA 1Q38A 1XF3B 4V1DE 4BSWA 3WJLA 4NQCE 5JW5A 5ESQB 1CTNA 4Z95L 3UZQA 3NP4A 2VDRH 4OZIA 4X9FA 3CFJA 3LZRA 1G9EA 4PJHF 1I7ZB 1UKSA 1EEYA 1Z9PA 2P5PA 3CFMA 4CU8A 4G8GB 4ILDA 2R2BA 3T3PF 3C5ZD 4M5TA 1U6AL 5I1GH 3TWCL 3C8KA 1P9MA 2LAGB 1I9IL 4XP6L 3AWEA 4HIHA 4RFNB 1SJVA 4KK6D 3SDCD 2Z31B 3T09A 1ZK5A 2YR3A 2QBWA 1E5AA 4AQEB 1MHHB 2Z92B 5L2KA 1HSBB 5TDPB 5D4QA 1KZQA 2E75C 4KX7A 1Z1WA 2X05A 4LB8A 1NCJA 2ZYRA 4JZOB 3QQ4A 2YMTA 3ARQA 4MS8C 3RY5A 3IXAB 1U8PB 2O5ZH 3HLKA 3V4PL 4W70A 3MNDA 3SJVE 5B8CC 3NCCB 1X4XA 5SWZD 3POHA 3O2DH 4DESA 3MV8B 2XVLA 3DJSA 1WUNT 3QK0A 4J3VA 3KPRD 1NIAA 2NXZC 2F1AA 1IAKB 4MNQA 2BZCA 3FOMA 4C57C 2ICWB 3Q2VA 4JPWH 3P9MB 4XO5A 5GS0L 4F93B 1UCBL 3WTVA 1YPZB 3HC0A 1J18A 1Q0YL 2X4QA 3UTTA 1DJWA 2X6BA 3WSQL 4Z7OF 1E65A 5E2UL 3BX7C 4IRSC 5F7KC 2OZ4L 4AVIA 5JIIA 5IB1A 1AHWB 3DHPA 1N18A 5JW4R 3I74A 3GF8A 1OQXA 1HOCA 2WB1A 4G71B 1QLFA 4UT7H 3W81A 2V9UA 1XF1A 4NN5C 2VXQL 3ZZLA 1MW0A 3BESR 4WEBL 1SOXA 2J8UB 2DIAA 2EIKB 3L7EB 3MLTB 1LEIA 3HG3A 3L3IA 2VM4A 2C1PB 1X9QA 3CZFA 5DYOA 5TE6L 3TJHC 1HQ4A 1NWOA 1XR9B 1A6AB 5KS9A 4XGZB 3S96A 2CA3A 5C09B 1IGTA 5TK2A 4WGKA 3ULVH 3FH8A 1CGWA 2H6OA 1CD9B 2V3FA 4YSSA 3WFBL 1S46A 2AK1H 4NRZB 3W5MA 5BUPA 1WP6A 3D69A 3T3MF 5HD8C 4MCNA 3EGDB 3WDIA 2BNRD 4LVEA 5GGSY 3GHBL 1C5DA 1F4AA 5T1DH 4Y16A 2ENSA 3HZVB 5GGRA 5IEKA 4UYPA 9PCYA 1KGCE 2VR9A 3W56A 2HRLA 4XVUD 4LIQL 2BVEA 4DP8X 2BLFA 1D5RA 1H9VA 4TUKH 4Y4FB 3B9KD 1J8SA 6PAZA 4N0FB 1S5HB 4OM0H 4XWOD 3LKQB 4N2EA 4R96A 5JW5B 3K46A 4WSKA 2GJZB 3FH7A 4AXWA 4RFEA 5IOPA 3O8XA 4X6DF 4YSCA 2DOCA 4KVCL 4JO2H 3DVFA 2Q10A 4W9DC 1I82A 1M71A 3CHOA 5E1HB 3WKPA 2OQJB 2D2OA 1XT5A 3WL9B 2EIZA 2WLIB 1JHKH 5LQBL 1KLGA 3UERA 3EFDL 4F58H 2ARWA 2WWOA 3NUKA 4ZXBB 5AD0B 5JYLA 1TVHB 2X09A 3O11A 1M05A 2X12A 3PWNA 1ZHBB 4ZX5A 5I1DB 5DFAA 4XO4A 2DQEH 5DJDB 3U4EA 3KCPB 1A5FL 4F2FA 3LRLA 4NBZB 5DJ0A 4PI0A 4X6DB 1N6UA 2R2BB 4LFHG 4OY9A 2VXUL 3ROOB 2YBRB 2XN9E 4KKZA 3FHEA 3TCLA 4MS6A 5E1QA 3QUYC 4M5ZH 4ZUTA 3ZE1E 3ZL4H 1KB9J 2G30A 2KC0A 4ATWA 2Z31A 2NZ9D 3CMOH 3FO1A 5K9QG 1OV8A 3MNVA 4EUPG 1LP9B 1RZIB 5D2LB 1X5HA 3KDPB 5I6OA 2X4OB 3EADA 3RU8L 4QLWA 2PO6C 4CC1A 3FHAA 3QDJA 4J6RH 2ITDB 2QQNL 3LNDA 2PCFA 2CALA 4KK9C 3VGHA 2OL3B 1HCFX 4NNPL 3KGSA 5DLLA 3HE7A 1YEJL 3HS9A 5D2NE 1S6NA 3BP6B 3NTCL 4P59H 3G5VA 4RIRB 3QWRA 1C7TA 1SQ2N 3MDJA 3SN6N 3QQNA 2VYRE 3M45A 1VCBC 3JTSA 3QUYB 4QHUB 1BD2E 2HFEB 4HU8A 4EUPH 3WS6C 3KJ6H 3VI3B 5FYKD 1MW2A 1MJ7H 2ADYA 4NSKB 4ZD3L 1IM3B 5EFIA 4WI3A 2WBKA 1W80A 2FAUA 3H2QA 4G7VL 3ZU8A 4OT1H 3M46A 1UKTA 1ZIBA 3HC4H 3IDMA 1BX2A 4WHYG 2Q86B 3UYOD 4A7GF 2YD1A 5SX5K 3GMOA 5FUCE 2CO4A 3CG8A 2FO1A 4U1HB 1KCKA 2EEXA 2WTRB 1HAWA 4X4KA 3QO0A 1FFNA 4L1DA 5FFGA 1DVFA 3S37L 4RAVB 3KLAA 1KJ2A 3WJJA 5GGQL 3O8XC 4L4TD 1A4CA 2GBUA 4LPUA 4NC1C 4I4WB 3QIBB 4IGBC 1Q0XH 1TZOA 1YCSA 1U8CA 5DWUL 1L0XA 5DD6A 2UUDK 1BAFH 5EN2A 1AYOA 1RUML 4OZIF 3G6JB 1BAWA 2BIIA 3NQKA 5BXFA 4OD1L 4XTRC 1WIUA 5IVNA 5I15L 2VXTH 3APNA 3LZOA 4MS8D 4JY6B 4S10A 5C08E 2XZQH 1GYAA 4J2QA 4Y9GA 4PJ8A 5IKCB 4JPVL 4OLXL 4O9HL 3V0JA 1IBHA 3CPLB 5EU5A 3H7LA 3O4OC 5J3HC 2BSDA 3P3YA 4ZSOA 1HC1A 1WEJH 3H54A 2PW1A 3GMLB 5I6XB 4NRYA 5DD3H 1I9JL 1DVFB 3MRDB 4A68A 2R2CA 2GTWA 3BO8A 1BEXA 2Q8BL 4DP9X 4F2MA 5ETUA 1X5JA 5HI4C 1ILUA 1E2WA 5LKNA 2YKLL 4XODA 4GKNA 1IBGL 2J1KA 4WW1B 3A67L 3DGGA 3MBEC 2EDOA 3AFLA 1EFXD 1O75A 5JHLL 3EH3B 1RUKL 4ELMF 4YMPA 4YWGH 3SGEH 4QYOB 4HWBL 2GG1A 5C0BE 3EJCA 4MZRA 3QEQA 5DJ2A 3NIGB 4O51A 5DK3A 3QG7H 1XSOA 1NWPA 3JWNG 4WVRA 4J3XA 4WFGD 1G7LB 2MKLC 1SQMA 2F9BT 3RL1B 1N6QH 4MJ2A 1XH2A 3L9RB 2IAMB 3BXNA 3OHMB 5D2NA 3WFEL 1GVIA 2CBQA 4KKBD 4MDRA 4M6OL 5DJYA 1UJTA 2ZICA 1OD7A 2ROYA 2R1WB 1EFQA 1JPGB 3B7TA 3GSNH 3U36B 4E9QA 4GKLA 3X14A 1S7SB 4UB0H 4MGXA 4LRNL 1A9VA 3EDEA 4OLWH 4JFFD 4RFNC 4IMKC 1NGZA 1TEGA 4IBTA 1R3JA 5CUSL 2TSBA 4GRLB 4JN2A 3KVQA 4IGBA 3HNVH 1IGCH 2QFPA 5C9JB 1FGNH 1VFBA 2EQDA 3BD5A 5IQ9A 4G9DB 4I9XA 4LSQL 3BKJH 4X5RA 2OK0L 1LEGB 3KM2A 5F1SA 1YAIA 3AQDA 5JOFA 3MLWL 4QF1A 1X7TA 4JFYB 3B3IB 2R56L 1ETJA 3MUJA 2IOMA 4L3AA 5IHLB 1JGUL 2PETA 5AKRA 5KYYA 4I0PD 3VJ6B 4IS6A 4X4XA 3TA3B 1AMXA 2RMNA 3EGXB 1NLDH 4OZFH 2Y7LA 3ABLB 5GZND 4HUVB 3LS4L 3WS6A 3ATBA 5E08L 4TSBL 2XN0A 5FOJA 1AC6A 4LOEA 3R1GL 1SLUA 3QJVB 3ETBF 4HMCA 1I1AB 1HHKA 1MCPL 1TYRA 1TVBB 5I73B 4FMFA 4UUJA 4N2AA 2XN9D 5EBMB 4I3SH 4CSPA 4LP5A 1ILSA 2X6AA 5FFOA 4Y4KC 2TSAA 1GS7A 4G6JL 4PRIB