2BS71

Crystal structure of f17b-g in complex with chitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWSVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17BG LECTIN
publication title Impact of Natural Variation in Bacterial F17G Adhesins on Crystallization Behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 2bs7100
2BS71 3FFOA 1O9ZA 2BSCA 2BSBA 1ZPLA 1O9VA 2BS8A 3F6JA 1O9WA 3F64A 1OIOA 4K0OA 1ZK5A
chains in the Genus database with same CATH superfamily
2J6EA 4FG4A 4X7TB 1WPCA 5EZLA 4X4YB 3SEPA 3EO1A 3SPCA 2N7BA 4BZ2H 3T2NH 4NRZB 1MVUA 5I5JA 3U7WH 4JFEE 4UOW0 4FI8A 2NY6C 3GKWL 4ELKB 2FO1A 1JV5A 5DJAB 4HX1B 4HETA 4Q9RH 2RQ8A 3X1GA 3GJFB 1ZLSL 3EH3B 2F54A 4AT6A 4XP9L 3RIAF 4WW2B 3TP4A 5I23A 5KYYA 2V7NA 1RY7B 4UI2A 4MNQD 4JZJA 4IOFC 4JQIL 3KPNA 4X7SH 5ECJE 1RMFL 5AAMA 1DTUA 3RA7L 3F7KA 4UV4L 1OF0A 3PJSB 1BAFH 2FLMA 3B4NA 4BV1A 4JKLA 1RPUA 1FYTA 5D72H 4C4UA 5KW9L 2NZ1A 1QLFB 1SUHA 2NT0A 2UYLA 1D5ZA 2XSKA 4U2ZA 2DMCA 4H0IA 3HE7D 1UB6A 2H9GB 3L13A 3ZN6A 1A7BA 1OB1A 2C3HA 3OSVA 4ODUA 1JDAA 4OZHE 3CPLB 5LGJB 5CLZA 4KQ4L 3MRNA 3CSGA 1GSKA 3GSOB 2NW3B 5JLZB 1FNEA 4JO2H 5I0XA 3SZKC 5AAWA 1JK9B 2ILLA 4EJ1C 2I07A 1NC2B 3CHXA 1BZ8A 3NJFA 5FO7A 4ABVA 1YN6A 5TE6L 3RNKB 1OSYA 1IQWH 2FJHB 4NZ8A 3P4MB 1KN4L 2XV2A 1EJOH 2A6JB 3MBWA 1UXMA 4ODVL 2BHZA 4PV1C 4A67A 4F8LA 4X8JA 5FB8A 4TPRL 4KHXL 3NJGA 2ZSWB 1W2KT 5BS0B 1UUNA 3L4CA 1RZPA 2AP2A 3DTUB 5DHVH 4NP4H 4EI5A 4KJWC 1XCWA 3CVHB 1KCKA 1KJ3L 4TSCH 4GKSA 2EDEA 1P7QA 3ABMB 4JFDD 4KFMA 2ADIB 3C87A 1S2EA 4OUUA 3QYNA 2D7OA 4ZMQA 1KJVB 1E5BA 4W4OC 1UZGA 1XGYL 1CGYA 1TITA 4B5ZA 3IKKA 2EC9T 2Z64C 2QQNH 5L0QC 4QCIA 2YXMA 4JFYB 5CZVH 1ET5A 1DLHA 4QRAA 2EDLA 2X0UA 1USQA 4ILDA 1MCKA 2BINA 4NKOB 1V7MH 1CFBA 1UVQB 4V11A 4GIOA 3RPIB 3EIFA 1FVEB 3QJHA 3AAZB 4NZFA 5IKCB 1VFOA 1BF5A 1JPST 1QLRA 5C3LD 2ICES 1MFEH 2FL5B 5INCA 4ELMF 4HF5H 4N24A 2J8UB 2OW7A 3PNRB 1A4CA 3LEVL 2Z34A 4GY4A 2W60A 3ZDZB 4OFQA 1A7PH 4L8DB 1ACXA 1EFXD 5LN4A 3N41F 3V0DA 5E99H 1HINH 2A74B 3EBHA 2PW1B 5L2JB 3S37H 4ZMAT 3QCTH 1S3RA 3AS0A 3QUYC 1KIQA 4N0FA 1AHWC 1BZ7A 4Z7VF 3T6ZA 3VSQA 3ALXA 1GGCH 5IMLA 5ISZB 3D34A 4WWOA 4KKAC 4XBPA 2QDWA 2Y1YA 1KCSL 1TTCA 1XFPA 3QO0B 4I1RA 4L37B 5M95B 4KJPC 1K8IA 1WE5A 3CK0H 4MA8H 4CMMA 2X38A 3ARDC 4FQCH 1IGFH 4TTDD 5ANMA 4JY4B 1M1XB 4J3OH 5DK0A 2VDRH 4JRYA 1AGEA 5FGRA 4HVBA 5GS1B 3ILDA 1NOLA 1AHMA 3ZE2E 3MGOA 3WNOA 4OIFA 4GI8A 3GXTA 3DO3A 3OKOB 4YDLC 4K9EC 2EVGA 4J23A 1DQIA 5C0BE 4HLJA 2H3NB 4O00A 4AGOA 4P2RA 4TQIA 3HW7A 5G4MA 4GAGL 4WWKB 3VXNA 1U41A 3D0LB 5CS7A 3NCFB 4Z3EA 5CIPA 3EO0A 4GW5A 4JZOA 3S96A 4XNYH 5C0AB 3D2UB 3V0WH 4EZMA 2VDKH 4FMVA 2C9AA 2E9WA 2EDMA 3QQ9D 5ILTH 1JZFA 4ONFH 2IPUG 5DMKA 4GEIA 3SKNB 1QZNA 4EIZC 4JM4H 4P48A 4X7DC 1K4CB 4RISL 1TQVA 2F7QA 3QDGE 2O93L 3ARYA 2WZPA 2PWFA 3CXDH 4CC1A 3WUWG 8PAZA 3O41A 4ETYA 3RUGB 3V4PL 3X1NA 4O02H 3A6OA 3F6IA 4UYPA 5C0DB 1K85A 3ETSA 2V17L 2VE6B 1I9JH 1P84K 2VR4A 3BP4B 2HX7A 3H9HA 4MASA 4TQEL 2PYEA 1EUUA 1YG9A 3ELQA 3NZ8A 4OLVH 1JNJA 3ARGB 2XLLA 1KGJA 3WIHH 2WVVA 4G7RB 4EN2A 1IEAB 3FTSA 1G94A 3MNWB 1WWBX 1R5WB 2YAQA 4YFLI 3E2HC 3FFCB 3DJ9A 2W0FA 1WF5A 5K9KB 3MCKA 3H9YA 3HFFA 4QRTB 2H2SD 2X1WL 5BCAA 4G6JL 2NUPB 4AZ8B 2J8OA 4ZO9A 2X4TA 3REWA 4YX2L 4OF8A 2WXLA 2A77L 2BRRL 2X3BA 1NAMA 4JG9A 3KPTA 4K5PA 5JXEA 3MJ7A 1DHKA 2HA1A 2OP4H 3X14A 5CAYB 3QIBA 4UZGA 2X42A 1FG9C 3VGBA 4HWEH 3UPRB 3B7RL 1AGCA 1S4IA 4HGKC 4WWKC 5CJOL 3RWJA 1NEZG 5IB5B 2TRYA 4DETA 5IM7A 4I7ZC 5E6YA 3I6SA 5ID1A 4UQAA 1D2OA 5A3IC 2IPKB 5E4EB 2BHYA 4C56D 1X5JA 4F33B 1FGVH 4KXCA 3C6EA 2WQRA 3T0WA 4K8RC 1QEXA 3UBXG 3WTYA 2V2TA 5FHAL 1GS8A 1N9PA 2ZAIA 4GBXA 4GQQA 4I1NB 1NPUA 1JF5A 1WT5A 4PJEA 4XPBH 1R5VB 2D3LA 2J8UE 2FJGA 1N7MH 3VD9A 4OGAD 1BQKA 3ZDZE 5H2BB 1QNZH 4OJYA 2VRKA 3MJ6A 4QRFA 3AY4A 2CGRL 3E3QC 2HG5B 3FQUA 5D7LA 3GS4A 4R2GD 4UANA 1JGIA 3HG1D 4E9LA 5ISZE 1ORSB 1ILUA 4MAUH 4LEOA 4WUKL 3D33A 4DERA 4F7EB 3H85A 4U6XA 5J11B 4YVUA 1Z0MA 2NT1A 4F3FB 5KSBA 4MHHG 4X6DA 3SPVB 2QVFB 2EXWC 3FUNA 5EN2B 4A7QA 3FHQA 4PHZA 1RUMH 2NX5D 4NUPA 4K9EL 5KZCB 1IBYA 4GKNA 5LQBL 4S0HA 3VDAA 3GBLA 5J3HC 1SLUA 4N2KA 3N06B 4IRJB 5ACMA 1I4FB 3RFZA 1RUPH 4IU3A 1P2CB 4M9OA 3S36H 3RBGA 5EU3A 3BVWA 4N8VG 2AJ3B 4N4YB 2WGNB 1OHZA 3IMRA 2X2YA 4LSRL 4CBZA 2AV1A 1ZPUA 1GGUA 2YPKB 5C0AE 3IGAA 4U4IA 4LLVA 4X4MA 5I1EL 5I0WA 2FH6A 2GC7C 3MV7D 5EIIB 1KGWA 1S9XB 1W0VA 2OMXB 2ZOLB 4ABWA 3ESNA 3RVVD 4LNRB 4C57C 2F2HA 2JJSA 4CVXB 1N18A 4KDTA 1H3XA 4L23A 4JG0H 3WHXB 2VN5A 3RUGE 3OR7B 2HTLC 2C9PA 5CXPA 5BO0D 4LHUB 5IFJA 4RFOH 3F7VA 1AD9B 1Q9WA 3QJTB 2N4IA 4QRUA 3OHXC 5DO2D 3E3QE 4Y4HB 3G6JB 3P4OB 3SGKA 3L7EB 4X6FB 2BCKB 2DI9A 3O3EA 1LNUB 2OSYA 4HUWB 5DK2B 3QWOA 2ZKWA 4NQDD 4ZAKD 5ACZB 1SHXA 2ZXGA 2XBDA 3FFCE 4M7JL 4S1SH 3MRJB 4PRIA 1UJ3B 4BYHA 3GHEL 1EAPA 1NCIA 5BZWB 2AI0H 2QADB 5F7DA 4IMLA 4YQXL 5IJBC 2XZCH 1OSPH 2XHNA 3CZKA 3LY6A 3GS7A 1SBBA 3FSZA 3JYCA 3LKPB 5GGRB 5DD3L 4L1BA 4MA1C 1KV3A 1WBXB 1YNKH 3CXFA 1MW0A 4YUEL 3K8MA 1OVZA 1RP8A 1BLNA 2P24A 1GW6A 3F12B 5FA4B 4XR8C 2DQGH 2XTJB 5TDNA 5ICYA 1PLGL 1TYEB 3ML9A 5DTFA 1CR9H 1PZ5A 3UG3A 4NT6A 2WKOA 1MY5A 3G5VB 2XXMB 1YJDC 4K8RL 4ACTA 5JPMB 5IW3A 4E9TA 3VH8B 4TVSa 3TLRA 4LP5A 5DZOA 5EFIB 4DAGH 4PTUB 4EUPB 3QXVA 1TQWA 2VDLL 2X4RB 4RGND 3EFOA 3ORJA 3AXLA 3NK3A 5LLIC 3EBGA 5FKAB 1PGRB 1MEXL 1IU1A 2YKLH 4YXKH 4CBPA 2HRPH 1MCSA 1OCOB 1KWKA 2VLRA 3DO7A 1HH6B 1IBDA 1LK2B 1ET8A 5CD3A 2YKKA 3CN3A 5C2BL 2ZWZA 1J1PH 4PJFA 1QD0A 4UCFA 5DUPH 2DI8A 3X12A 3RKPA 4MXQC 1ZHLB 5SV4A 5DVOA 2XN1A 1IGIL 1U36A 2WBXA 4Y4HC 5HGAB 4G3YH 2YXFA 1JCKA 4HC1L 4KTDL 4I2XA 2CLZA 2DMBA 1TKWB 4PJCF 4NERA 4AWJC 3RY5A 2IFFH 1Y07A 1P84J 3IPBA 3TFBA 3HTLX 3UJJH 5C3TA 1EK3A 3IM1A 3CDFA 1WTLA 1B4JH 1R47A 2PWGA 1ZPLA 2CRIA 2IBZX 1MN4A 1U95A 4WFHE 4LCWB 1A7RH 2QTEA 1BIIB 3FULA 3PGFH 4KAQH 4JRFA 5AYTA 3IYLW 1JK8A 3TGXA 4FL4C 1UT1A 1PMYA 2FWSA 4KRMB 5EBWB 1IV8A 3E8UL 1BZOA 1L3NA 2DWEA 4QRRB 3GXMA 1CFQA 2J55A 1EAOA 1HS6A 1IJNA 4F7CB 2IVFC 4X9FA 3WXWH 2BIPA 4KZDL 4PP2B 2F53B 1ZSDB 5DLML 4DZ8A 1I3GL 4H1LA 1TQBB 3UMTA 3O3DA 2EDNA 2WCSA 4D0DA 4MMZB 3WS6C 4ZO7A 3NIGB 1QSFD 1F2QA 1HEZA 1L9QA 5DXWA 2X6UA 4TNVF 5JOFA 1EDYA 3WN5B 3INUH 3SDYH 1AY1H 3DUSB 3M1OA 2IMMA 4LPVA 2CBMA 1PTZA 1TYJA 2DMKA 4HA1A 1PKQE 4YHNA 1MCRA 3OF6D 3RWCA 4AYFB 2PWEA 4BE5A 3UTPE 1IBFA 1HZKA 1L9SA 1HE7A 3U9PL 5EG6C 4PRHD 2BO0A 3MBXH 3N04A 4LZKA 5ETUB 3PGCA 1KCLA 2CMRH 2WYHA 2ZNXA 4FQPA 3FSOA 4RDBA 1MF2H 3W1ZA 1NDGB 4LLWA 1NJ9A 1KG0B 2FIKA 2ZKYA 5AW6B 1F1GA 2BIMA 2YARA 2ICEC 1CZ8H 1I9IH 3G6JE 4PHXA 3CZUB 4HCGA 4M62L 1P4BH 3K5RA 2ADGA 1QZ1A 2BSDA 4DGWC 1T1XA 4YS4A 4AV4A 1TXKA 3ESVF 3DRQA 4YR6B 5C6TL 3Q1SH 5CEZD 4JFPA 1PPIA 4JFDA 2Y07H 3U0PA 4ZT1A 5HGBB 1JWMB 4MB4A 3G5ZA 2FZ3B 2KDYA 4MJ6B 2QELA 4KI5F 4MNHB 5DMGD 3STZA 1FFPA 4FLHA 4ZXBD 4XX1E 4NEHB 1IE4A 3T04D 3THML 4YZWA 3UTQA 1TZHB 4DZBA 1ZIAA 4JMNA 1KIUB 3HZMB 1WFNA 3IJSB 3DX8A 3T0ED 4HHAB 4Y88A 3VFVB 2A9MH 3MXVL 3H3KA 3MCG1 4R96A 4WI9A 3LIZA 4OIBA 4WI0B 5EEUA 1NUNB 4RA3A 3L9RA 4ZFOA 3KJ4C 4NBYB 4MMZC 2JB6A 1QOKA 4PPTA 2Y7SA 3L1OL 5H35A 3WELA 3MODH 5GGSA 1RP9A 1JMZA 1KTKE 1EFXA 2J8HA 1MFBL 1KFAL 2DM7A 3D4ZA 4G11A 5HJDA 4EN3C 5KSBF 2XPGA 4X6DF 1IGTB 5LBSH 2EH7H 3GRBA 5LHDA 2LVCA 4QT5B 5DHDA 3P11H 1BM3L 2XPYA 5BO1H 2HUHA 2KS0A 4G5ZL 4MD0B 2X1OA 4CSPA 3FQTB 4GXVH 4B95C 4E9YA 3V10A 4YHYB 1TIUA 5E03A 1ADQA 3GZOA 2GW5A 2UZXB 3MJ8A 4HSCX 4PB0L 4U1JB 1KXQE 4TVPE 3S5ZA 5D7IB 4RX4D 2K7QA 2R1YB 3RWIA 3VFWA 5KTEL 4HFUH 5B8CC 3CBJB 5IW1B 2KQMA 1KXHA 4NCC1 5LGHH 4LCWE 3C6LD 4XAWH 4U6VL 5F9JB 5DUBB 4KQ3H 3U2IA 4TNVK 1NCDH 1IQDB 1PAMA 3MRIA 2VDNL 1BJ1H 3W3BA 4QRRE 2YOAA 1U8PA 1HZHH 1N3NB 4LRNL 1BZEA 5E08L 2HFFA 3VB9A 5FCSH 1O6TA 1UD6A 4X6CB 5B1BB 4Y1AD 4F27A 1FHNA 1HHJB 4HU2A 2C3GA 1S7TB 4JREC 1CF8L 1E4JA 5KAQG 1H6FA 5IT2L 3NCBB 1RL1A 3RJQB 4QNPF 3QCVH 4WWPA 2CD0A 3DIFB 4NKDA 4OZFH 4DW2L 2FR4B 4LASL 1U21A 2MCPL 1E3ZA 4UQIM 3K8LA 4PRPB 4RDQF 1F3DH 1FNFA 1LK3L 2JLPA 4FFWC 3GRWL 3NG5A 5FUOL 3VB8A 4AYMC 2FYYA 4BFKA 5FM8A 4BWWA 4ZUSA 3BH8B 4TLUA 1QFOA 1WHOA 4TVPL 1AGFB 3HS0A 1TQCB 4JHVA 3P77A 3C9NB 1AFVL 5I8KH 4GG6B 5DYOB 3PWUA 4NN7C 5E00A 2EVIA 5H4YA 3MUUA 2DV6A 2NNAB 3PHOB 4R26H 4U1IB 1IAIM 3EOTL 4I3RL 5EIQA 4B9YA 2HT2C 3M7FB 4PJ7B 5G4NA 2WKOF 4JN2B 3FCUB 4P3CL 4R7DA 2FBJH 5AW7B 3MXWL 5GRVK 43CAA 2OLDA 3TYFB 5E9DD 1XF4B 4J8RA 4CL7A 3WEMA 4DEPC 1E9QA 2EDBA 2PO6B 3DROB 4MYWB 3EF7A 4LFHG 2KC0A 1CU4H 2Y1ZA 4ANVA 5DD0L 1DUZA 4ICXA 3G04A 2WZAA 4IDJH 3QJQB 2YPVA 4R7VA 5IG7B 5SWQA 4C56A 1QEWB 2QZQA 2BVPA 2CPCA 3DGCR 1JYNA 2BDNL 1DJSA 1DSWA 3DIVA 3GSXB 4PJFF 3SBPA 3ARBD 3OKDA 4UTCA 4B41A 4GYBA 4N0UA 4HUUA 4R3SB 4ATWA 4AZUA 2BSBA 4U0RB 5EIIG 3FQXB 1H3PH 3CBKB 1NCWL 3MUHL 1OANA 2VSKB 5L7XH 4PV9A 3ILQC 3NEXA 4M5ZL 1W8NA 4OZ4A 4F2FA 1A6PA 2PCPA 2A2QT 4X4ZA 3ZRCC 3DX1A 4YBQD 5I0ZA 3HG1A 1H0DB 2P49B 5I1KL 1G7HA 2DJMA 5HDLA 4PJGB 4PJ5B 4PJ8B 4P5SA 2X5PA 4OM0L 5C0CE 5KBLA 1L9OA 1E8ZA 3BAEH 3ZE1F 3VSUA 1IT9L 1GZHA 1Z9SA 3EJPA 4GIAA 3TVMD 3S97C 5MEND 2OJZH 2XETA 3T2PA 4QRBA 5E8NA 5D7IE 1MZZA 3S3SA 2EKSA 3NH7L 1AO7B 1X7QA 3EAKA 3V52L 4JANA 3U2SB 4YGAB 3FTZA 4P5KA 1MOEA 4MBOA 4W68A 3ABKB 1NKOA 2GUOB 3BN9C 3BQUB 4MA7L 4MJIB 5CZRA 1UA6H 3VNZA 4R90H 4DP6X 1TQSA 4OLXL 4IQHA 4DVBA 5CZKA 4ONOA 4K94H 3BD4A 3KNBB 1MDTA 1BZDA 2FD6L 2EDDA 2XVGA 3V4VH 3L7FA 4U6TA 1WIOA 1RCYA 1P5UA 3KXFB 3BP7A 2CR6A 3MV7A 4X6CE 2CBOA 1KLGB 4EUPG 2Y06L 2Z93B 4L8BB 3DRTA 4XMKL 4U0RC 4OCMC 3C2AL 3CHRA 1GZQA 5BQDA 3B2UC 5EEXA 2UWEB 5CZXD 2ADFH 4NN5B 4AIXA 1QFWL 4L4VB 2PR9A 4QXTA 1QTPA 1MRDL 2CIIB 2E46A 2CM6A 2PPDA 3WDHA 4B6ZA 4PRPE 5JIKA 3V6OA 1EO8L 5K39B 2R1WB 4ZNCD 3GIZL 3A6CL 1E4KA 1PG7X 2BNUB 3OR6B 3T0BA 4NQDA 4TUKL 1HNYA 1ZTXE 4ZAKA 2KERA 4B27A 3AT8A 3N9GL 2BY1A 3VRJB 1QSVA 1JOIA 3BMWA 4M3JA 4GG6E 2OCFD 2ZUVA 4DP2X 1DEEB 4QLRA 1THCA 2WCGA 3QWQB 5T1MA 5F6IC 3EFFA 35C8L 3DOSB 1Q94A 4PJ7E 2WGXA 2O6DA 1KTLA 2EACA 4OLYL 2LTQB 2CSPA 4XMVA 2J7LA 1NBYB 4Y5XA 3RTQC 5HY9B 1QHPA 3BQUC 4JO1H 4WY7L 1KXTB 2CXKA 4GKZB 5D1XD 4P3DB 3FO2B 5KG9A 3IMBA 4XNXL 1DO5A 4QKTA 1IGCL 3RVXD 3HKFA 4RMSA 5EF0A 3S3JA 2FATL 4N90D 3NZSA 4WDIA 5CP7A 1EZLA 3CVDA 1U6AH 4NO3A 4RRPG 2K9FB 3AROA 1HXYB 2E7LA 2P4AB 4ZFGH 4BCXA 4U05A 2G3ZA 5JIDA 5L6YL 4Q4IA 1YEHL 3CMOH 3I9AA 1ZIBA 4N5UA 3KGSA 4L5FH 4N9OB 4UOQA 3FN0H 3P73B 3BKJH 1QMUA 2OXGB 3RILA 3QEGL 4UAHA 2HFGH 1FFRA 1YVLA 5CN3A 3GPSA 1ZTXL 3C5ZD 2NXYB 4HBQA 4LCCB 4ODXA 4RFNC 1R34A 3MRRB 2NLJB 1EHLL 3OZ9L 4L9DA 3GBML 3I9IA 4QF1A 4KJYA 3SZ6A 2CKNA 5D1ZI 4JHBA 4XN1A 1I85A 1L7TL 2LOEA 3CIAA 2AEQH 5DJ0B 4PJGE 4PJ5E 3R19A 1FLRH 3L5WB 5KSAD 1MHPH 2E27H 5EBMA 4DKEH 4X9YA 2HLAB 4I0PD 1T83C 4ZW3A 2N1KA 2LE9A 1GJIA 4QLWA 1NIEA 4WU7A 1B0RB 3U2JA 1OLLA 3K80A 4M4RA 2X70A 4Y4KD 1EXUA 2CZNA 4OBSA 3UH8A 4JFHE 1KTRL 4MXVE 4XZ4A 4X83A 5CU9A 1X4XA 3UZEC 3JWOC 4HZAA 1GRWA 4MJIE 3VJ6A 4HJ0C 2NY1C 1QRND 1RIUL 2WUCH 2UVEA 4FTVA 1PSKL 4KK5D 4NHCL 4NM8L 3N44B 3UYRH 2ALAA 5HHXL 1F45A 4AH2A 4Z7QB 1J1OH 1QSFA 4EOWH 2Z7UA 3TBCA 3B9KD 4TNWF 3UO1L 2GT9B 3KXFE 2GEEA 2L3BA 3ZE0B 5EO9A 3RWGA 2NQ3A 1AZCA 1IM3D 3LXBA 4G43A 1JZ4A 3OF6A 5IMOB 4CN4A 3VFSA 4GW1A 4PRHA 3HMWL 1NIAA 2AEOA 4XNDA 2IQ9H 4WI3A 4UNVA 2OTUB 2DQHH 2UWEE 3TJHD 3U4BL 1M2VA 2OSLB 4NJ9L 4L4VE 4B5EA 2BX5A 2BWIA 1VGKA 3O9WB 4L8SC 1OE2A 1BQSA 4Q6IB 4FFYH 1IEBB 4GFTB 4GO9A 3D1MC 5EZJB 1T1YA 3RKDC 2Q7YA 4G8IA 5CJBA 1VPOH 1XV8A 1ZT1A 2MKWA 4LL9A 4D9QE 4ZD3L 1NGYA 4PJ9D 1YEIL 4X6BA 1KPUB 3SKJL 5EEWA 3II1A 1UURA 4NZUL 3U36A 1E42A 1U8HA 2WSPA 1S7UA 4J5VA 1Q9OB 1G9MC 4FQIH 4U1KB 5I1CH 4L29A 1ET7A 1C1EH 1A22B 2D31A 4JKPH 5JOPD 3QJZA 4KK9C 5JHDA 3N5AA 1MZYA 1XGPB 4OJFL 3NBNA 5ITFA 3T0EA 4DCQB 1EA9C 4AQ8C 1F4XL 2CJUL 4FFZH 3TO4D 2AJVH 3BAKA 5DR5H 5I1DA 1JN6B 5D7SL 1B3JA 4E41D 3IDYB 4LAJH 2XV6B 4G6AC 3CFCH 4XCNA 1JHTA 5LDSA 1SM3H 1DANU 1GHFH 1MCBA 1H3GA 2A0LD 3IJHB 3V0VA 1DCLA 5F1OB 2IV8A 3KHOA 4O2FB 5E6IC 5J6GA 1U92A 2O6FA 5CEXA 4YE4H 3MUJA 3LEXB 4Z7UA 3UC0H 3VWJB 4L1HA 3VVWA 1XHHA 5MEPB 1F8TL 4PJ6A 3MA7A 5AQ0A 3QFJA 4CNIA 1WP6A 3OKEB 1ANUA 5DHYA 3QJFB 5IQNA 3W2DH 3WKPA 1N0XL 5E6ZA 3U0TB 4OFIA 3OAYH 2X6VA 2GSIA 2NXZB 2WSDA 1RJYA 1B2YA 4FP8L 4ZW5A 5F1NB 5C08B 5CUSL 4RX4A 3GGWA 4NJAH 4YDNA 2OULB 4HAFA 3O8XA 3T8XA 5F72S 1SYSB 2VZVA 3IAQA 4G6FB 1J11A 3QUMB 4EAEA 5DD6B 5TE7H 1GYAA 2AGJH 2IH1A 1K72A 2AXJA 3AWEA 4JPQA 2BS9A 3EYQC 3JWOL 5GPRA 1N5YH 2JCCF 4M43H 4AQ1B 4WTQA 3MCLH 5KVDL 1F41A 1HKFA 5FOBB 1DQDL 4K3JH 4TNWK 2J2ZB 2WVTA 4MFHA 5F7EL 5JO5A 1CUOA 4FLQA 5T3XD 1UG9A 1F6LL 1VGEL 4Z78A 4HP5A 4R9HA 2Q8BL 3WJJC 1JGVH 5IP4A 1GYVA 1OEZW 3DURA 1J1XL 3WNMA 1DQJB 2WVSA 4GO6B 3IJ8A 3KPSB 3AM8A 2H1XA 3GUFA 4WRLA 1EHXA 3IDYC 3SGDI 5GRXG 4Z7QE 5KOMC 4P46B 2WQUA 3TEYA 2ZKMX 1WD9A 2XQ0A 3PWLA 3QNZA 3CFQA 4YHKH 3ZE0E 3VD1A 3PPSA 1E27B 4MAYB 2QGCA 1UH4A 2FEDC 5E5MA 1LDPH 4JM2A 3WMPA 2WUBH 4X9GA 3MHZA 3LPPA 2DTML 4LVOB 3CFJB 2YSSA 4OCWL 5EV7A 5HHNA 5DJYA 2KBGA 4ZRGA 3ZYZA 2JKRM 5GS2D 4JDVA 4AIOA 3AWGA 2WAQA 1A8ZA 2VXSH 3FT2B 1OB0A 4G5AA 1XL6A 4QHUB 2ESVA 4NSKA 1XGZA 5IHHA 3MPCA 2JI1A 3M7OA 2A7BA 1SDDA 2VXVH 1MFDH 5J7CC 2BS71 1Y18B 2WLNA 3E6FA 5E9DA 3MMEB 4RETB 1WISA 4M1GH 1KBPA 2CKBB 2X53A 1Z9NA 5JW4M 1IC4H 1OTUC 2EO1A 1G7QA 3EYVB 5B7FA 3BLKA 3U7YL 4OD3L 1R0AH 2WNGA 3H9ZA 5ICZB 1NCUA 3N85L 1ETZB 2H7WA 3Q6FB 2WTRB 4Z18A 1QI3A 3ECWA 4FS0A 2AHIA 3ARBA 4H7VA 3IF1A 4R6UA 1OPGH 4YWGL 4H26B 4OF3A 4KDVA 5D4HA 3IVKB 1BBJA 5FLUA 5BUPA 3EHBD 1SF3A 3ZTNH 4P46C 5D6DC 1KN2L 4GXUN 1ZVHA 2DQJL 1RSFA 2JJVA 1E4WH 1JHLL 4U3SA 1QHQA 1U8QB 1E5CA 3I3DA 1XEUA 4QXGH 2AEPH 2CDFA 3TA3D 1V8HA 2EYRA 2Y7QB 3MUGB 1EO5A 5HPOA 2AQ1A 3QCUH 2E6PA 5AALA 3BPNB 4K3EH 4WNQB 5LJYH 3RDJA 4OF6A 3QQDB 3L1GA 3ZL4L 3U1PA 4ZFQA 3ULSA 3TVMA 3MI6A 1CQYA 4NUJA 5E7BA 4DJMA 5C08E 4DPAX 3BZ4B 3CUPB 5IB1A 2ZE0A 3P3TA 3S5LA 3D08A 5F1IB 4Y5VC 3VFNB 5FYLH 4Y19B 1A6AA 3BSZH 1JS4A 4ZZKA 3KJ6H 1ZHNA 4FNSA 2EVHA 1E8WA 3VXMD 3VXTA 2F8IA 6FABH 2UX7A 2DWSA 2YXWA 4L1DA 4XCYB 3VFRB 3QK0A 2AXGB 3L3OB 4LCYA 4JFQB 4JPKH 2E3VA 3ECBA 5BQ7B 2L7UA 2NSMA 2W0KA 3NA4A 2BIOA 5I1JL 5EORH 4BFIB 4NRYB 3FJTA 4FZEH 3GQFA 3KPSE 1WQVT 1CYWA 4GUPB 1PDKA 2IDQA 1INQB 3TBSA 2GPZA 2CIKA 2VJ8A 1JVKA 2RCSL 2FEJA 3L16A 1A8JH 4JUTA 3VRLF 4P23A 2J1KA 1FNAA 2ADJB 2A5UA 4IIQB 4X9IA 4JR9H 3KS0J 3CHPA 1T2XA 4GS7C 3I2CL 1WZKA 3OZLA 3U48A 5JXAH 3DPDA 4QHMB 1T21A 2DTSA 4P9ML 4ENEC 3FO0H 4DK5A 1DBKH 2VDOB 1FH5L 1LM8V 3VGDA 5F96L 4X5XA 1FZKB 1MWAB 2QPEB 4DVRH 3GMQB 3U9WA 2QL1A 1A4KA 4WTWA 5DS8B 4JFFD 6TAAA 3WNPA 3TM6A 2YD5A 4KNSA 3LN4A 1Q72L 3F7YA 2Z4QA 3QUML 4PLOB 3TU6A 5SX4I 2C8NA 2C9XA 3UTTB 1FH2A 5JW4Q 1REIA 1IAOB 2EO9A 3QZWB 4LKXB 4XXDA 4Z9KB 5HSFA 2DYPD 1KEGH 3BUBA 1AGDA 3ZIYA 2WCPA 3ARPA 4P5MA 2NQCA 1EMTH 2P5WB 3I3BA 3POHA 3VRIA 4EVNB 5TK2A 2C9RA 1SFHA 3O3UN 4Y89A 1MVUB 4HIIA 4HOMA 1E4XL 1MIMH 5F97E 3NA9L 4GSUA 4XN9A 1SJEB 3BEVB 3HPLB 4Z7UF 7PAZA 4M03A 1WAAA 2W07B 1D5BA 3SGDH 5C09D 4F93B 1DN2A 4XOEA 3QUXC 1XIWC 5T1DH 3HN8A 3S34H 4JHAL 2NY4C 4D0CB 3PWPB 4N2FA 2HT4C 4JZJB 3W81A 5TPWH 4XN2A 1A1OA 4RZKA 3QG7L 3MNZA 5I5RA 5HDQL 3QFDA 1BQLH 2JWYA 5EOTB 3DVNB 3D69A 4F7TA 1CMOA 4UM9B 2UYLB 3RVWD 4W6XB 2R23B 1DVUA 4L3ED 3KYOA 4NQUA 5CILH 2ZJSL 5B21A 4ALAC 3DV6A 3MLVH 1TPXC 1OB1B 2A6IA 2DDQL 3AG3B 2F61A 3BCFA 4H20L 3GSVA 1BEXA 4N0YL 3HVDA 3ARTA 4HUKB 3C5XA 2DQCH 2VB5A 5D4IA 4PP1C 1MJ8L 5DHMC 3WIIL 4MMYB 2X4NA 1KT2A 4I0PA 4NWTH 5FAAA 1D6EB 1RAMA 2CLRB 4CDGC 3UBXI 5ALBL 1EEQA 2NNCA 2AQPA 5EZIL 3ZMEA 1YN6B 3VXQA 1FPTL 3TFKD 1AIFA 2G9HA 4LNVA 3GM8A 2ZONA 1F4YH 1T0PB 4Y4KA 2VXQA 4NQVA 1NBVH 1ZGLB 2DEYX 3MBWB 3VFGH 2QEJA 2GABA 4Y19E 5GS0L 1LEGA 4NZTL 5FYJU 1P1ZA 4IRZL 1JE6A 1LYQA 2ZOKA 4AVIA 5IMMB 3LB6C 4PJXA 4XMLL 4ZX4A 4JM2F 4FI6A 5JHBA 5MEQA 1L9PA 4TLSA 4EI5B 2OL3A 5FYKH 5ADPL 4JFZL 1K4DA 3B9KA 3WTUA 3VW3L 4OR1A 1I7ZA 4GKSB 5E0QA 1IM3A 1P7QB 4OUUB 3GZQA 4H4NA 3RWDA 4MHHI 5AAMC 2WMPB 1HVXA 3IMUA 1XB6A 3GDBA 3C5SB 2HRHA 1C12A 1HE8A 3O6FD 4KUCD 5I8CB 2HKAA 3GM0A 2C3VB 2HX9A 3O2WH 1AZBA 3FRPA 4WJ5B 1MCOH 1OK8A 2QKIB 3VI4A 1QVOA 3DJZA 1QLEL 1KELH 3LHPH 3DWTA 4B53A 1CTNA 2OW6A 2ATPB 3GF8A 3ZQ9A 2VZOA 4GSRA 3MSPA 4AVKA 1KGYE 5INCB 4Z1PA 3LRLA 4PJ9A 4D9LH 4YHOL 4H2AA 1EEYB 3FH8A 3ZR5A 1XVSA 4A6YA 3UTTE 4NQTA 5IJDC 2P5EB 5GXBB 4CILA 1WGVA 1TEYA 4W9FC 3FN9A 3H3BC 1PX3A 3IMVA 1FI8C 1KIQB 4JRXE 4U1MB 4N0FB 2VMFA 4JFOA 4QXUL 3ZHFA 4NN6C 5I1GH 3STLB 3MNMA 2P5WE 2AK1H 3EG9A 2PN5A 4JHWH 4U7SA 3T8MA 5I18H 2VDPL 1HZLA 4OFPA 4QMEA 3RDTB 1K8IB 5IEHB 3VDBA 4JDZA 3JV5A 2I85A 4EI5C 5ANMB 4P2QD 3C5JA 4AQEA 4ABQA 2ZYSA 4JRYB 1RK7A 2R83A 3GKWH 2IQAB 4TS6A 4NDMB 1OCCB 4EI0A 2ZQKA 3MGOB 4FXKC 2BSSB 3AU0A 4TSBL 1ZLSH 3VMPA 1N67A 3T9WA 5KJRL 2GJZB 4NNXA 4PJCB 4XP9H 3ARQA 5J13B 3CE1A 4W4NA 2CO7A 3WBDA 1D5RA 4KROB 2VDOL 3IDNA 4JQIH 4P2RB 1SXZA 3VXNB 4ALAL 1KSRA 2BVOB 3SKMA 1RMFH 4FLRA 2E9JA 1XB3A 2R15A 3EO0B 3MGTB 4LPUA 4R4NC 5CIPB 5BZZA 3RA7H 3S96B 1J8HB 2RA1A 4J7RA 1OP3H 4Z3IA 2ZT9C 5LCVA 5KW9H 5EA0L 1YNLH 1WBZA 5SX4H 3ULUD 3UOAB 2VZ1A 2VKWA 3GEWB 3ZY7A 4H2CA 4TRPH 4W9GC 2J6EL 2VN3A 3ELAT 4U7KA 2HFEA 4WNSA 1WFIA 2H0FA 3QIUD 1U4FA 3QORD 4A7SA 4HUVA 3ZO9A 3NZ8B 1DBBL 3EADA 2FECL 4YBLC 3VO0A 3CD4A 5I2IB 4FCHA 3Q06A 4X5WA 1IM9D 2W0FB 1KN4H 1QBLL 2EEAA 4N28A 4ODVH 2VERA 4PJAA 3H7BA 3MLTA 4PJDB 5TK4A 1LO4L 3KH4A 4TPRH 5T5FA 3K2MC 1HHIB 2MEJB 1Q1PA 4J4PD 2PPAA 1SOKA 2DH2A 2X4TB 5D93C 4CJ1A 1Z32X 1IBGL 3FU7A 1V5JA 1KJ3H 3CZNA 1YQVH 3TF4A 3ATDA 1VB9A 2APFA 2KT6A 3QIBB 5HGGS 2Z92B 2BZ7A 1AGCB 4IKKA 2BZDA 3GIVA 3PV6A 2R39A 4KNQA 1CL7H 1U2YA 3C09C 3OKKA 5ID1B 4HBCL 5AL8A 4HUXB 1SXAA 3P02A 2HKFL 1AMYA 3FB6A 2BIHA 2KDGA 2V6HA 3C60D 2Q3AA 3V0IA 2V2TB 5FR3A 3FOLA 4GBXB 4IU2B 2ORBH 2NR6D 2VWEE 3RPBA 4B3VA 1RD6A 2AQSA 3U7AA 5HVHB 4OV5A 2UZPA 2X10A 5HDRA 2DQEL 4LPYA 1WAAF 5D7JD 4HD5A 4ZPVB 1R3KB 1XGQA 5A2KH 2YOCA 2WPGA 2C7UA 5J1AB 1SJVA 5DYFA 2P5EE 4X6EA 3LEVH 3GSRA 1FFQA 2OMZA 1GJWA 1RZ7L 4Z0BH 1SEQL 4OJDH 4P2CG 4MDRA 4ZUTA 1X9QA 2E7HA 4PEEA 4UQBA 3SBRA 1CT8A 3BN3B 2Z35B 3WV0A 1I1YB 2WV3A 4U1HA 5A6LA 4U6XB 4QUOA 1HNGA 3TN0D 3ARZA 2WOBA 4DGIL 5FO8A 2Q2EB 1DZBA 2Q10A 3CZLA 3K1KC 1KCSH 5ANME 4BK5A 3L5XL 1K5NB 2APSA 4GKNB 3F58L 2WTOA 4JRYE 1QFUH 5I8EB 5GSRB 3ASNB 5JXEC 3A47A 3CN0A 3QIBC 5D8JH 1P0SE 2VZTA 4PJCE 1V3JA 3NJXA 4P2RE 1HL5A 4G8GA 1KACB 2WM0A 2EYSA 1NQBA 1RPQA 2AV1B 5EU4A 5AAPA 1J8HE 5AB9A 5FWRA 4LLVB 1OW0A 1Q1JL 4KI5C 1TCRA 5TJWK 1BQUA 3JQOB 5FKPA 5E95B 3QQ4A 4FYRA 4GBXC 5INDA 1W72B 4D9RD 4Y5YC 1WT5C 2PNDA 4PJXF 2NY6D 2X1XR 3HZYA 1T7YA 3F00A 4P9HL 5D4JA 2LHAA 2OMWA 5AKRA 5EN3A 1IBHA 5E4OA 25C8L 3ULVE 3QZWG 1NUDA 4YLBA 3F7VB 4V2BA 4W9JC 3VXMA 1OOWA 4N5ED 3AY4C 1DDHB 1QYGL 4IOFD 5IVXB 3HJ0A 3GLAA 4QRUB 3VFMA 2X40A 3K0WA 2FQFA 2QLVB 2V17H 3OAUL 2MWCA 5EWIH 1J87A 5JHAA 5FM4A 4TQEH 4S11A 4KVNL 1Z1WA 3LJ3A 2D2OA 3B1UA 4HULB 3L3IB 2RMNA 5AB1A 1PKOA 1WA1X 4JN1L 3TBYA 2BP3A 5CLWA 3FB8A 1P4IL 1YDPA 1KV7A 3GJFH 2HVKA 3HJEA 4PJDE 4R4FL 1MAKA 3DMMD 1V10A 3G9VA 4D0BA 5HI4C 4F5CA 5IB2B 2BP8A 1G4RA 3B2MA 2HXAA 3WNLA 3LRKA 4G6JH 4WJG3 3U0WL 3RFZC 3T65B 5TDNB 1RZQA 1UUSA 3IFOA 2OTWB 4RAHA 4YX2H 3OPUA 3OLDA 2A77H 2BRRH 3LVTA 3VFTB 4WHTA 4XWGL 5HHPA 1HK6A 5E8OB 3HR6A 1ZT7B 1AC0A 2B77A 1WG3A 2F18A 3D18B 4FYQA 5IIEA 1N6VA 4JFFA 1H3WM 2XFXA 4YHLL 4YGVA 4P5TA 2VLLA 5CJOH 1IIKA 2YUVA 1KYFA 4IGBB 1NLDH 1DQQA 4KI5E 3EFOB 1X4ZA 4DESA 3ULVL 1E43A 4YPGA 2IF7A 1KGXA 3LVEA 2G0LA 3GS0A 2JJSC 3MBEC 5GRWA 2YGOA 1V54B 2DYPA 4KDTC 2WP3T 4XXWA 4H13C 3VXRD 2HYMA 2PCXA 5AOLA 4KJWD 1G7IA 4YDVB 3QEHA 5FHAH 1OQOA 3DHJA 5HYQA 3W5NA 4PJFB 5IHUL 2WXKA 5I1HL 1DVZA 4IKNA 2CO6A 4BUGA 5ESQB 3Q01A 3ARFD 4UILL 3SGKC 3QYCA 4L2YA 3KGRA 5L8JB 2OV0A 2CLZB 2P9RA 5C09A 4C83A 1ZE3C 3IRPX 2CGRH 1UXWA 1PFOA 3VU2A 3D52A 4Y2DC 4MNQB 3UO8B 1F2XK 1JXFA 1QFPA 1NAML 3CLFL 3CVHH 4HEME 4Q74A 4X6DE 1RU9L 2YXVA 3EYSL 4M5TA 4W9HC 3VXUD 1KGCE 1IGML 3AC0A 4Q97A 4FA6A 3ZDYB 2VDQB 1TTRA 2X7LA 4G59C 1UD2A 2DWEB 1M9SA 5AVWB 1UYWL 3GMOB 1USZA 4POYA 4WEBH 3BEWB 4L3EA 5LQBH 2DQMA 3WY1A 3CH1A 1KNOB 3HE7B 4AGPA 5B7MA 5I0YA 3MOBH 4UIMA 3QUZA 1G7LB 1NM4A 4PRAA 3MV9D 4D7BA 4ZO8A 3QRGL 2G5RA 4D0DB 1IFGA 2J6WA 2JF1A 1J05A 3JTTA 2FX9H 5M94B 1XTLA 1W8OA 3P54A 4LSRH 5IJVA 2WB7A 3UX9B 5GRVL 2K6YA 3R8QA 4KJPD 3O3BA 1Q0XL 2B1AL 3IJ9A 5I1EH 2VITA 3AJ7A 4XVUC 1A9EA 4PJAF 2L04A 1S7WA 4ANKA 1JWUA 1GOFA 4M00A 1U8JA 1I1RA 2JIXD 4W6WB 2BWDA 4OF7A 5J1TC 1RJZB 2NY0C 3K72B 3V4UL 1NJ9B 2FIKB 2ICWA 5IVXE 3QP3A 3FT3B 3LRSA 3P4LA 4M8VA 4UU9A 2J5LC 2ADGB 3SYOA 3APDA 4QNPE 4UAOC 3VD4A 5K69A 1PQZA 1UATA 3DRQB 3TBTA 4A04A 3O4LB 4JFPB 4K0OA 4JFDB 3WKML 1CCZA 3T1FA 1S78D 3P2DA 3WE1A 4A1RA 2GIYA 4M7JH 4BFNA 1D5MA 1E28A 1NCNA 1R3IL 3GHEH 4Y7MA 4WIQA 5EULV 3STZB 1AQHA 3O6FA 4NB7A 4YQXH 4KKCD 2CA4A 4P4KB 1OY3B 2CH8A 1GSMA 3WFHA 4YMPA 3UJIL 2P26A 3KPQA 2YO3A 4BWUA 1EZVY 5C7XL 1HILB 2XWJB 3Q0HA 3Q9PA 3S3CB 2VN4A 3HZ3A 4YUEH 5DCCA 4AJWA 5AKTA 2WBKA 1RKRA 5I17B 1W72L 1PLGH 3UC2A 1HJCA 3EZJB 2GHWB 2NDGA 4JY5H 4M6OL 1M6UA 3MREA 4XPHL 5I6XB 4HWBA 2FSDA 2O5ZL 4K8RH 4EZLA 5GGSB 1XXFC 2B9AA 3QG6B 4MCYA 1O9WA 1UCTA 3RL2B 4AW7A 3QO1B 4H8UA 1FYHB 1YY8B 4KV5E 3HNTL 2XPGB 5JUEL 1D9KD 2HMIC 1MEXH 2WJ5A 4PJFE 4PQXA 1Z5HA 2MQGA 4RAUB 1WS8A 5C2BH 1HNFA 4UBDD 1E2ZA 5C6PB 2GCYB 5JA9A 2B8OT 3BGFB 3U1SL 2FX7L 2G2RB 1BVLA 1YUHA 1HXKA 1LTXA 4A39A 1X5ZA 2YD7A 3TC9A 3RWIB 3VFWB 3LYRA 1CLOL 4KTDH 4HC1H 3VMOA 4AQOA 3LQMA 5A3ID 1D2PA 5CD5D 4DPRA 3CHQA 1TFPA 3OJVC 4N8PA 4MNQE 4J6IA 1OD7A 3LZPA 2PXYA 3V0GA 4BHUI 2BJML 4NFBA 5DI8B 2YEZA 1RURL 5JNYA 3WOVA 4ZK8A 2KKQA 1GKEA 4H25A 2TRHA 1YMMD 3MRIB 5FO2A 5GRYA 5CBAA 1KYOK 1WCQA 1U8PB 5FYKU 2AAAA 3CQFA 1QI5A 4MCZB 4QRQB 3PWJA 5DJZA 2WOYA 3RHWF 5A2IH 5C97A 5DHVA 1IGJA 2JJWA 3GB7B 1G7MB 3FCTB 5I74C 3TT1H 4F7PA 2ZXCA 2APVA 3CFDA 4CUCA 5I1LA 3EGSB 1HH9A 4KZDH 1E6JH 1FBIL 1HQ4B 2LQRA 1HHKB 4GRMB 1KGUA 2OI9C 5DLMH 1GH7A 1I3GH 4NKDB 3L1EA 2P8MA 4YC2B 3I6LD 2H2PD 3S4SB 3PXJA 3QIUA 1ZHKA 3ZPDA 2FSEA 3QORA 2BFVL 3MFFA 5J12C 1A7QH 4F1ZA 2N0MA 2EXWD 2ZOOA 3FTGB 3GMPA 5LB1A 2ENSA 1T0NA 4S2SB 3IU3A 1U3HA 5J3HD 3GSQA 4NI6A 1IAKA 3CFMA 5ICXA 4FQHA 3QQ3B 5AWNH 4J4PA 1JFQH 3GBEA 1CLVA 2VJ0A 2A3TA 4FXLA 4M62H 3GBNL 1ZVYA 1G6RB 4JFDE 3AMKA 3L8QA 3FUEA 3UP1A 1FAIL 2GK0B 4WKZA 5CO1A 4XH2A 4RRPM 2BERA 4CVZA 4ONHB 2PTVA 4XX5A 3FQYA 3NPSB 1CD9B 2G2PA 4AQAB 4P2OD 3G04B 2NY5C 1KCBA 2DQIL 2YHGA 4C56B 5SWQB 3SO3C 2B2XL 1JZJA 3THMH 5T3ZD 3BZFB 4ODBD 4XOBA 3BIKA 4B96A 4O2CA 2I9LA 1LP9B 3O6KL 1JV2B 1QG3A 3CN2A 3S3PA 4N0UB 3MXVH 3K1DA 4HUUB 3CXHK 1QBAA 4AEHH 1J5OL 1HHGA 1GGYA 3MACH 3QVAA 3VXOB 4G8EA 1RJLA 3JWNE 4XMUA 5D7JA 4PSPA 3S35X 5KSUB 4BKLA 2DQ6A 2LU7A 1KEML 4Z76B 1TZ8A 4NPYA 3BP5A 1FNSL 3RGBA 3BRDA 3MO1A 4R2GB 4Q6YA 3VFPA 1HHHA 1GMEA 1ZAGA 3RGVA 4JK0D 3R06A 2J4WL 1MFBH 1UA7A 3HS0C 2YAOA 4W70A 3BZ5A 5DSCB 4DIXA 5K33A 4JDEA 1JUFA 4K3DL 2N7AA 1QFWI 4BEIA 3TN0A 1Z9SB 1T0MA 3NFSL 4AJ0A 5IESL 1L0YA 4G5ZH 3DK0A 3LH2L 4XP4H 4ZS7L 3Q2NA 2NX5B 4RDQG 4OGYL 3NFNA 3AG2B 4O02A 4PB0H 3WFBH 2CAKA 3RHWK 5I73B 2Q76A 4EPSA 4I18B 5HHMD 5KTEH 1EV2E 4LU5L 4CVWA 5G5DB 2G5BA 4ZNEA 1HI6A 3LIZL 2YQ3A 3WIHA 1UENA 2XXCB 5D7KD 2VERN 1AQDB 1BREA 3SKOB 3BPCA 3L7FB 3F3HA 3ZTJG 4MRCA 3OB0K 2P43B 2WBJD 3TIDA 1S7XA 4MXQD 1KJ2B 2JCCB 2Z4TA 2CHWA 4N1HB 4DHLA 2C1PA 5BW7C 2OJ1A 5IUSA 3FFDA 4EUPH 4LRNH 1YN7B 2E47A 1BXUA 1PG7L 5ITBL 4OGAC 5KVGE 1GS6X 3Q3GA 3AS2A 2DL2A 2MMXA 5IT2H 1BD2D 4PY8I 4QO1A 1I8LA 4DW2H 2EXYD 4LASH 2JQZA 4EMZA 2WWKT 4EF3A 2J20A 1NGWB 5D9SA 3KPLB 4ZAKB 1LK3H 3ALPA 2W5PA 4UQ9A 4UTBA 5T33H 5FUOH 1JGEA 2KUTA 3O2VH 5LBGA 5GZNC 3LCYA 4A2FA 4GSDL 3BKML 1GZHC 4BQ9A 1EBPA 4EZJA 4EDXA 1HESA 2AJSL 3DMMA 1AFVH 1SXCA 1LMKA 3B7TA 1HYRC 1I3RB 1M2OA 4BRJA 4K55A 1U91A 2PMZA 3EOTH 4I3RH 4BH7A 3FDWA 3OXRB 4P3CH 1XD0A 4PMEA 3V9EA 1ITCA 5J8OA 3QSKB 2Q5BA 3KYKL 4KFZC 5C9KA 3MV8D 5D1QB 5CCKL 3DHUA 3K71B 3BZDA 1CFSB 3JTSB 5FUCC 5FEBA 3HI5H 4C56E 1XSKA 3A4AA 3U30C 1IEHA 5JQIB 2HX8A 4PGBA 2Q6WA 5CP7B 1P5UC 4BH8A 1F6AA 4TUOA 4RGNB 5KVGL 4AC2A 5B3JE 4MS8D 5HYSA 3IXTB 3JV6A 4N0UE 2F5BL 1MJJB 1N70A 2Y22A 1HOCB 2X2JA 5CLXA 1H15A 5JZ7C 2VLKD 2YLHA 2QMJA 4WHYH 4MJ2A 5KVFH 4OVVA 1N0LA 2JQAA 2NCMA 3S5YA 3ZW3A 5E0FA 3ARFA 1NCWH 2N3JA 2X4UA 5DO2C 1UQSB 2FHBA 4TLKA 1HWWA 4M5ZH 4KJYB 4YJZL 5BRQA 4ZAKC 3IKCB 4AEFA 5FWQA 3ROLA 5ALCH 4AE0A 5H37A 3GJEA 1G43A 1HKLL 2Z65C 1BX2A 2OZ4H 3ERXA 1G6RL 4QHLA 5I1KH 3L95A 4NNYA 1GGIH 4QTFA 3KGTA 5I16A 3MX0A 1EEZA 5DUJA 1J0KA 3VXUA 2HT3C 4KXDA 4OM0H 4PWKA 2NX5E 2DBLL 4YDKL 2IBGA 4PJBA 5DRNA 3RX7A 1IT9H 2E9IA 3CSPA 3ULUF 2ZUQC 3BUIA 3V6ZA 1A6ZA 4Y5XC 2YPVL 5E2TL 5F9OH 1YHPA 1CTOA 3IETA 3NH7H 5D2NA 5K59E 1JNLL 1LWJA 3CVCA 5IK3B 3KLHD 3OB8A 3UYPA 4JFXB 2BLFA 4OT1L 1A7OL 4XC1H 2BSTB 5FYJD 4IRSD 3KYNA 3MV9A 3LEYL 4MA7H 4EN3D 5SX5H 1A02N 2MHAA 2OMYB 1QSFB 2IWEA 3CU1A 4FYTA 3IMSA 4ZMWA 2MSPA 2E7LC 2FD6H 2JCCE 5GHWL 2MNWA 2H4EA 5F7MC 5CLYA 5AW1B 3JWNG 4FQXD 1BXXA 3C8DA 4GW1B 4M02A 4PRHB 6PCYA 2VM3A 3K7UA 1NCCH 1Q9LB 1ACYH 2R56L 2Y06H 2LW3A 2IAND 4G8FB 4XMKH 5CEYA 1LEIA 2VM9A 2GTZA 3C2AH 4JLRA 3VX0A 2MH4A 1ZWIB 1COBA 3KLLA 4P57A 3OX8A 5ELIA 4IJ3C 3V6OE 3ZHKA 3MRFB 1QFWH 3ZZQA 4PBWD 1SEBA 4GMSL 4ZDHA 1I85C 1IAMA 1KJMA 1MRDH 4FN0A 3N55A 4QAWA 4PGEA 3LPFA 1ZHBA 4GP8B 4RA0C 1EO8H 4XOAA 4UDTB 4IKIA 3OTTA 3GIZH 4NQSB 1NGYB 4QGYA 1FL5A 3A6CH 1BQHB 1JFHA 4TUKH 4G1EA 1H9DA 3QHFH 1S7UB 1RIVL 1AXIB 2K7PA 4JY6B 4KPHL 4ZXBB 3SOTA 1BZ9B 3A4EA 4UQ3A 5BRPA 1C16A 5D5MB 1DVSA 1KXVA 1UCBL 1DVXA 4NO0D 4GP5B 2H41A 3DI2B 5T1KD 3MJ9H 1WC7B 5K9QG 5AUMB 3T0AA 2OKMA 2L4OA 3IDIA 3T0EB 5CJ8A 4ANUA 5LBVA 3MLSL 2RH0A 1FAKT 4QHNA 1H8LA 1KIRA 2XZQL 5F88B 2CE6A 4OLYH 1DJXA 4PFEA 1KJ2L 1XD1A 4LEXL 5D1QE 5CSGA 3K81A 2WINB 4WY7H 1NMCB 3V5HB 2DQDH 1VZHA 1IGCH 1P5VB 4RGNE 5EC2A 2ENJA 2R29L 2FATH 1WJ3A 5J6GB 1U92B 3KPPB 1UD8A 3HHMA 3VWKB 2OMVB 1D9KA 2ERJB 2HT2D 1FRGL 3EUUA 2XVLA 1KPVA 2IAMA 3ATEA 3CFNA 3GI9L 4CNIB 5L6YH 1YEHH 1EXHA 5DHYB 3NTCL 3IXAA 4CC4C 2FQEA 1OCWL 1FNHA 3VI3B 1YAIA 1E50A 2Z31D 3I85A 2XQYA 3HOGA 2GSIB 4H8QA 4FFVC 1H8SA 5A16A 1ZTXH 3NJJA 1RJYB 3N43F 3CVIL 2VGLM 2TSBA 4M1DL 1KENH 2WW8A 4HV8A 4X98B 1EHLH 3OZ9H 5JW4N 2OS7A 3GBMH 5MI0C 4XN7A 2F7PA 3WIFB 1L7TH 4OCLC 5C8JB 3AWFA 1JI2A 3FO9A 2XA8L 3WFEL 4G1MA 4WFFE 2BNRD 3C6LB 2XIIA 1IMHC 3F62A 5FDWA 1G84A 2GITB 4Z77A 1ZTMA 1DLFH 1YMMA 4FA7B 4U31A 2EC8A 1FZMB 1I1CA 4KX8A 1CXFA 2EUXA 4M3KB 1E7VA 4NOFA 4XBGA 4S0TD 3ILQD 3F7PC 4FTDA 4Y1AB 2BHFA 4O5LL 1I3UA 4ORGA 5E2JA 2C4XA 4L05A 1WWWX 5ESVB 1RIUH 4EKJA 1QSFE 2XYBA 4HS6B 3VD5A 1UHVA 3SDCD 1MCWW 1PSKH 4NHCH 4NM8H 2BIQA 4ETQB 3Q5TA 3PWLB 2AJYH 4NX0A 3LS4L 3AQYA 3L3GA 3S8GB 2XY1A 3SPGA 4HIJB 1FJ1A 5HGDB 1NTDA 4PRHE 1T7VA 1T1WB 4OTXL 1OM3H 2CJ3A 3WHE1 4XWOC 1ZMYA 3OQ3B 1Z9OA 3HMWH 4WAFA 5CM1A 5D70L 1MHEB 5IBTH 2YQGA 3GMRB 5IV2B 3U4BH 2E9GA 1DQML 4DKFL 3DBXA 4HK0B 4NJ9H 4NM4H 1U8OA 2ODIA 4P2YA 3VRLE 3D25A 2HVJA 1MCCA 3C2SA 3KWWB 3QDJA 3GHPA 2DM2A 3EXJA 2CR3A 2W94A 3IBOA 3O8XC 5CEZE 3HAEA 3BPOB 3BYTA 1DR9A 2KZWA 3SE8L 5EB9A 5C0GA 2R2EB 2KPWA 5L4IA 5F44A 5FW8A 1T1ZA 2OA9A 1G7JA 3L54A 1CDJA 4H88H 5LBSA 3PFUA 1G7QB 3QAZC 3SKJH 5D5ME 6CGTA 4FLOA 3TPUA 4NZUH 2DLEA 2FO4B 3FUJA 4P2OA 1HSBA 4CKQA 3LKOB 4ZOAA 3B2UD 3T0EE 2CO3A 4EEEA 3FO1A 4OAWB 4PGCA 4I13B 3AM8C 1KDIA 3IF1B 4KKPA 1RK1B 1DBAL 3N42F 3APCA 3IAGC 3IFLL 2EZ0D 1F4XH 1QTYT 2F5AL 2ICWJ 1KTCA 2ZX9A 2GY7B 3AB0B 3HA0A 4DKTA 4UB0L 4XNMB 4RNRB 5GRJH 1XGTA 2BC4A 4IK7A 5FO9A 5JIQA 3PYCA 4IKLA 5D7SH 4HYTB 2BSCA 2WNKA 2QFPA 3GI8L 4JM2C 3KHQA 4HPYL 1KB5B 2CDFB 4Z7UE 1X9UA 3FB7B 3BWUF 4PREA 3FC8A 4KKZA 5IR1A 3QUKA 2AV7A 3KPMA 5DURD 1D7BA 1BCIA 2ZAHA 4PJBF 1F1AA 4YL9A 4JJ5B 1A0QL 1F8TH 3VI3E 2A83A 2PETA 4W9ZA 5CEZL 3RTQD 5GJSL 2EE0A 3KW7A 3TVMB 1OE3A 5MENB 1N4XL 1N0XH 4UNTA 4NUJB 4FEMA 4HQQL 2X2IA 3POCA 3CNKA 2B5IB 4KH9A 4OCRL 1XMEB 4J2XA 5IB1B 1PYWA 4OZFA 4IBTA 2PPFA 4FP8H 3OL2A 4UQDA 4B97A 4FG6C 1C5BH 1V27A 4LCIL 5KYUA 5IREA 5CUSH 4U0QB 1SLWA 3P0YL 1HL8A 4XRCA 1ZHNB 1Q90A 4RFEB 1PZUB 5AW0B 1GOGA 4QOKD 3B3IB 4KVCL 1TJXA 2EUWA 2XIBA 1IC7H 1DQDH 2V8MA 1U33A 2WBJA 1PL3A 3ARBC 4NKIL 1TFHA 5I8OL 1XCQB 2J1YA 1PAZA 3BT0A 1F11B 4Y1AE 1VGEH 1WZ1H 3FQRB 4YXHL 4NLHA 4JS7A 3TBSB 2CIKB 4N87A 1J1XH 3WN6A 1E4XI 1BV8A 2JK5A 3D3VD 3H6JA 4LSVL 4M5YL 3VQLA 1SJXA 2CDEA 5BOPA 3G5XA 4JZNA 4G83A 2CA3A 3PWNB 2EE2A 5TFSL 1OP5H 2YBGA 1L7IH 1YEJL 4K07A 5J0BA 1A4KB 5B22A 2KLTA 1S9KC 1GPOH 1D7DA 4DP8X 2FT6A 3EF4A 4HJ0D 4M93B 1H5BB 1MLBA 1DQLL 2WXIA 4KZ0A 3CZFA 4U1SA 4HAKA 1EUTA 2FLRT 1PF3A 1AGDB 3FOMB 3ME0A 3MLZL 4DUVA 4L0YA 3BH4A 2QT6A 4P5MB 4TF4A 3QH3A 3P2BA 2ZWYA 4HXAH 4FXGC 5D1XB 3MV8A 3EJZD 2CO1A 5HVWA 2EUZA 5DVMA 4U6YA 3HG3A 3P2TA 1AOHA 1FG2A 4LSPL 1S9VA 1MCWM 1CG9A 1D5BB 3RY4A 3TCLA 3FQ2A 2BVTA 4UIKL 1T03L 1I9EA 1V3KA 5AVTB 3U7YH 3QXWA 1G5AA 1MFCH 5IFAL 1TSRA 3NFPB 1KLFB 3BPLC 3N85H 3LDBB 5KBKA 2FNBA 3MNZB 4TULL 4P23C 3NACL 4YWGH 3B5GA 5CZXC 3UG4A 2QHRL 5I15L 3UAJC 3D69B 3WXVL 1KTDA 3C5ZB 1KN2H 1M3JA 2DQJH 2X87A 3EJYD 4IOIA 3TCTA 1LO5B 5LNGA 3CX2A 3IB4A 3V4VA 1JGDA 2Q20A 4ZMVA 4KK9D 2O61A 4HJGB 1DL7L 3BVTA 5KSAB 1DN0A 1B0GA 1PS3A 2X4NB 1BVNP 3D7PA 1I7UB 4Y16A 5AZ2L 5MENE 1EERB 1F4WL 5HJBA 3MLWH 3KEHA 3VSTA 1NBQA 1OAQH 1BQHG 1YMHA 3ZL4H 4BSVA 4PJIA 5A2AA 3L08A 4RGMC 5C0JA 4NQVB 1VERA 4G6AD 5H8DA 1YEDA 3ZDXF 1RUQL 1LEGB 3GWJA 3MFGB 3FQWA 3UACA 1WDAA 2ZOKB 1RFDL 2YN3A 4HFWA 1QRNB 5E9NA 3ROOB 4HSAC 5AOKA 3VTMA 5E6ID 4M61B 2YRZA 3RVXC 1CB4A 4IRSA 4EN3A 1KBBA 5C0FA 3JV4A 2XA3A 4WHDA 5CKAA 1I8UA 3KLDA 2B08A 4WSGA 3VG9B 1IM3B 1T5WA 3LDBC 4R7NB 5IMKA 1WAEA 3X13A 1G7PA 4FQXA 4N2BA 2BY0A 1KB5L 4J12A 4DGVL 5IF0B 4XCFH 1C12B 2IANA 3EW3B 4YSDA 3SY0B 1HSAA 3FRPB 4DN3L 3L81A 1H3UA 1XSIA 2GAZB 4YIQB 4ZMTA 2RCSH 3D85B 1NFDA 2ZXAA 1A6WL 3MNVB 2FT8A 2YD4A 3EYQD 4PUBL 1WFJA 2FQGA 1BFTA 1M71B 2KMWA 1B88A 1UACH 4I9WD 4P9MH 2B59B 1NM9A 4PJ9B 3SIKA 4I0PC 5C0NC 3ABLB 5F3FA 3CN1A 4YAQB 8CGTA 1C5CL 4ZOEA 4BK8A 1M6OB 2KYIA 3D4GA 1N8OE 1ULVA 3W11D 2OK0H 1Q72H 1T2JA 3OC5A 4ZW8A 3W9EA 4UTAA 3QUMH 4Y4KC 4NO0A 4OY9A 2XX0A 2J1ZA 4WW1A 2QPFA 2H3KA 3LKSB 1T89A 4M3HA 4OB5L 4CVUA 1NA8A 5I28A 1QWHA 5D1XE 3TO4B 2FEDD 43C9A 5BRZB 1TTGA 1YEEL 5JPNB 3VM7A 5CJQL 4MJHA 1EZSA 4G7VH 4IW4C 1E9PB 1SUJA 5CINH 4MNGB 4E41B 4RGOL 3IN0A 3WKYA 1WAAE 3BVNA 4G8AC 3ECQA 2ARJB 3B9KC 3R4DA 4N90E 4AQEB 3ARUA 1C08A 2FECI 3NA9H 5CSZB 4V33A 1P9MA 2YK1L 3L6FA 3MDJA 1DJYA 1YECL 2HH0H 2QDVA 2ZYRA 5IQOA 2OX5B 5AYUL 3VGAB 1BBDL 4JHAH 1SJHB 3SDDB 2EYTB 3IDNB 3OKLB 3DJTA 3SKMB 2UXVA 3QG7H 5HDQH 1B4LA 1AZVA 2XJKA 3GK8L 1CFMA 5HP5A 1TSHA 2Z31A 3P30L 1BGXL 4R4BB 3IJYA 2IH9A 4BE6A 1OTUD 4NC1C 3WEXB 2PWDA 4I4WB 1WBZB 3F2LA 5CGBA 3VG0L 7CGTA 4MD5B 4R5VA 1NFKA 4LSTL 4H20H 4ZSOA 4LDCA 3DX6A 4AXWB 1PZCA 1CVSC 4ZBJA 1G9NL 1O7VA 4IBZA 2XICA 2OR8A 1MJ8H 3BFWA 2BNRA 4JMXA 1S5HB 2OMTA 3CFBB 4MJ4A 4HUVB 4IBQA 4NC2B 1C7TA 5ALBH 3HPJB 5EZIH 3U6XA 3GFUA 2CKBH 2ZD0A 1G0YR 2HJLA 4ERSL 1FPTH 1YYMH 2LLLA 2SEBB 2H1PH 5I76B 4OGXH 5IGXL 1QRNE 1LQSR 2XCMC 4UM8B 4R83A 1HCYA 4M6AA 5GS0H 1ROCA 4PJXE 4NZTH 4IRZH 5IHLB 3H7BB 1PX8A 2JV6A 3PS6A 4MDJB 3V7AG 1OP4A 3SDCA 1GYWA 3GXIA 4RQQA 4XMLH 5DJ2A 2A0LC 4I77L 3UBFA 4NKMA 4XGZA 1E4HA 4YLQT 1LE9A 1LE5A 2GFBB 2YGQA 4DH2A 1AE6H 5DS2A 4JFZH 1VADB 5ADPH 3VW3H 1X9RA 3CBRA 2OJEB 2B9BA 1TCMA 3WDIA 1RQ5A 1CGTA 2X3AA 3GIVB 1JMXA 2X4OB 4K9JA 2GKIA 2RALA 3MROA 5EF1A 4PS4L 1ZK5A 3OKKB 5HJ3B 2C1OB 1IAIL 3LH8A 4MZ3A 1IB5A 4FFZA 1CFTA 2YC1A 5CLTA 4XMPL 3FB6B 5IOPB 3G5YA 3P69A 3FOLB 3BUQA 1OAZL 4OKDA 4OV5B 2AVGA 3UGUA 3ZGHA 3U4EA 4BDVA 2EXSA 2IDTA 3NZHL 3PCYA 3WLBA 1XGQB 4TXVB 4HWZA 3U46B 3S3DB 5LWYH 1VIWA 3S5LG 3QNYA 4YHOH 4TM9A 4F15C 3GSRB 4FEIA 4IHOA 1FCCA 1MCDA 2OMZB 5JOPE 2HLEB 1K6QH 5CBEB 4OKVA 1G4MA 4ZUTB 2I32A 1DVFD 3RBSA 1S7RB 2OL3L 2NNRA 2D9QB 3QZBA 4KMQA 4Q14A 3KL0A 2KL6A 4YVNA 5BRZE 1J5IA 3QXDB 3QEQD 1UZ8B 1T4KA 3TH3T 4IS6B 2ITCA 4MNGE 4E41E 4RZCB 3RURA 4CADA 3EHBB 1MRCH 4MZIA 2LLGA 3KWXA 3TOPA 3LAFA 5HTSA 5B38A 1ZLVH 3E6HA 3EJTA 5DRXA 3WIAA 3EDEA 4MMXB 3ETBF 4N2LA 4PG9A 3FF7A 4YDJA 3TA3B 4YHZL 5F21B 1VHPA 5DLLA 2Q86A 4PJIF 5KJRH 3ARSA 4U1GB 1J9CT 2B14A 4HDIA 4N85A 2VDOH 3GUTB 2UX6A 1CXEA 4NQED 4ALAH 1TCRB 1JPSL 5F9WC 1MWAH 4N9GA 5H94A 1OPOA 3QQ4B 1Q8MA 1KCVL 4HXBL 4A6YL 4NQCD 5C07D 1R19A 1IL1B 4Z7WA 1UOVA 3HZYB 3QISA 5JORA 3DETC 1A7NH 5LXGH 2AZAA 5MERB 2E7BA 2Z0UA 1R75A 2JKTM 1XIWD 3LS5L 5DRZB 3QPQD 2HB0A 2HT4D 3O3AB 4IEFB 4QOKA 2UY6A 3VFMB 1KY6A 4H8VA 3II2A 4NZDA 5ID0B 1U58B 4HIXL 5HYJD 2GTQA 2PCFA 2I25N 1DBBH 4OZIF 4PWJA 1WEJL 1H6TA 2NRDA 3UAEA 1BVZA 1ORQA 5DUMH 4BZ1L 1NWOA 3IS1X 3SO5A 4BK5C 1QBLH 2V9RA 3WO3B 3EJRA 3D3VA 3KGUA 2LABA 1AZZC 3GINA 3APNA 3KDMA 2ZKHL 1ERNA 2V5TA 1LO4H 3GKZA 5E1AA 1CE1L 4GW4A 3UL4A 5D6CB 4FC3E 5EO1B 3OJ2C 3SDAD 3ES6A 4LK4A 3IFOB 1J9QA 1T22B 4OD1H 4JQXA 4HALA 1IBGH 4WHTB 1FNLA 2DI7A 2VCOA 2MPAH 1T04A 2EINB 5C0RH 2ZCLL 1AVAA 5CF3A 5IIEB 4BQ8A 1OW0C 4JFFB 2XFXB 2XWBB 2OMUA 3FCBA 2FJFB 2JXMA 5IROD 1GC1C 1JPFB 3D9AH 4HBCH 1UASA 3LB6D 2HKFH 1R46A 3GDCA 5K9JL 1J7VR 4RMTA 5GISH 2DYPB 2HN7B 2WIIB 3KYMA 5I9QC 4LQ1A 1P7KA 2VC2B 2VXTL 3ZK0A 5T3XL 5HYQB 3VVVA 3IDMB 3CLWA 2HWZL 3RWFA 1XF2B 5EO0A 2GJ6D 2DQEH 1UC6A 4JO3H 2MCG1 2V4LA 3WL9A 5K1JA 1I53A 4M6ML 4GRWF 3N50A 3FT1A 3CFUA 3C8HA 5E94B 5C09B 2UY7B 1EWHA 4PV8A 3ZKXB 5T5FL 1UXWB 4CGUB 4YZFE 3QAQA 2WZ6A 1SEQH 2FK9A 1WFMA 5EEYA 4RLDA 4HJUA 1UEMA 4XO4A 3QZOA 1NL0H 1EH9A 2AAVA 2YEVB 2XN9B 4Y0GA 2B3IA 1TVHA 2QLYA 2ZOWA 4JPWL 2WZ5A 1WHPA 4A38A 4DGIH 2NY7L 5HHQA 1VKXA 3BSZA 3FTUA 1HAUA 2X7LB 3PIQB 3S7GA 1MHHA 1QBBA 3L5XH 1EGJA 1UD5A 4XPAL 5EU7C 3Q2WA 4M9PA 4KZEL 2B4CH 1XTMA 2ZXBA 3F58H 5BV7C 4L3EB 4FULA 3CH1B 1TZAA 1S7SA 2DF3A 3FRPG 3T4YB 4AEIL 1JZ8A 3GMMB 3VCLB 4UIMB 4JKWA 1UTDA 2X1QA 2JTYA 1KLUA 1MFAL 5DMJB 4PRAB 1MFVA 3W57A 3ZZ1A 4P07A 4P5TC 3DTXA 4HOWA 3SD2A 5IQ9B 4L1LA 5IJVB 5JHLL 1QR1B 2ZKXA 3V6FA 1CYGA 4FNQA 1RZJC 4XXWC 2YAMA 4WO0A 4ZG1A 1DVQA 1RLWA 1U8JB 3VGFA 2EQDA 4PCSA 4X9HA 3TTYA 3AT0A 4AYEC 4RMQA 3REVA 4P9HH 3K2UH 3VXME 4FQJL 1U3YA 5E6IA 3HBPA 4RIRA 25C8H 5HHOB 3LRSB 5E9AA 4RMBA 3W0WA 5A2JH 1AKJB 2ZCKL 5F0LB 2ZOUA 2B20A 1QYGH 4XCEB 3CFEA 3MA9L 1PQZB 1GJUA 4E0RA 4M7LL 4QRPD 5FECA 3ATAA 4QAMB 2NY2B 1BJ1J 2QSCH 4FNPA 1QUNA 4KVNH 4YSAA 4HCFA 5A2BA 2WQXA 3NGBB 3PL6B 1E28B 2WLKA 3LH9A 5EZPA 1P69B 2XFGB 4JN1H 5KYWA 4KY1L 4L0PB 3UERA 1P4IH 4R4FH 4ZO6A 4PVLA 5B4MD 5DD5H 3WE6A 5C1MB 2NW2B 4YHIA 2Y1AA 5EU7E 4HJJH 1A6UL 2IG2L 2Y7NA 5IFHL 1MW1A 1ONQA 1U30A 3QUZC 5CIPH 1GC1L 3FRUA 8FABB 1D5IL 1S3KL 2GIXA 4MJ5B 3QWRA 3U0WH 1ZVSA 1QSEA 3MYJA 4JFFE 5BS0D 4MS6A 5KVMC 2DEWX 3MREB 3V5KA 1ES0A 3K6FA 3DUUB 4UNIA 5JTWA 5EEVA 3CZSA 5F0JB 1V7NH 4TNFA 3TTSA 4B7LA 5F2FA 3MRLA 2VZ3A 4L1SA 2ZP0T 5F9DC 1T5XA 2GK2A 5GIRB 1F3JA 3CHOA 4NO5A 3ULVH 2YPLB 4A68A 3BH9A 2DM4A 1JZGA 2MKLC 1GCYA 5IHWA 2QGEA 3RG1C 2W0LA 3S48A 3MRMA 3UXFA 4OLWL 3QNXB 4NAQA 2E74C 4JPSA 2I9TA 3GSNA 4POZD 4HPHA 2YA0A 4R0LA 3H1ZA 5IHUH 3P0VL 4BXVA 1ACZA 1JHKL 3TV3H 4XVSL 5C09E 1A21A 1A14L 1ZA6A 4FRWA 3NIDB 4P2QB 5F7AA 3T09A 2EH8L 3EGDA 1UWGL 1I31A 5HPMB 4PCTA 5DFVC 1FN4B 1GA2A 4N8CL 4YHMH 4ADGA 1FV1B 5ERWB 4AIZA 2R69L 4AL8C 4B9JA 1SLVA 5EC1B 1A3RH 3RZCA 3QZMA 2XN9E 5EBLA 3O6FC 1I7RA 4J1UB 3CLFH 2WZPD 3WTWA 4R97C 3EYSH 4H5SA 2ZSVB 4Z7WF 2GHZA 3OM3B 1CGWA 3K6DA 5CBAB 5LVEA 1HDMA 3VE0A 1RVFL 5K1VA 3V5DA 4L3EE 5ISZD 4WV1B 1L6XA 3QEUA 4X2UA 5DVNA 1IGJB 4ZMPA 1Q38A 4E5XB 4F7PB 3WTSA 4JG1L 3CFDB 5I1LB 3TNNB 1EDHA 3PHQA 4N2CA 1NSNH 3PAUA 1M4KA 3O4OB 2VC2L 3H4FA 3B7YA 4XBMA 5HD8C 1K8DA 12E8L 1GZPB 2AEWA 2P8MB 3QRGH 4I0CC 4HEPA 3QIUB 4XO8A 3F84A 4ONGH 1TMQA 3QORB 4N25A 2SODB 4B9FA 3LXUX 1B90A 3OMIB 5TQ0L 5DJCA 5JW5A 2Y7OA 2A99A 3GMPB 4HOZA 5HDBF 4AITA 5C0IA 1MQ8A 1TLKA 1SN2A 4HPOL 3TX4A 2CUIA 1IM9B 3BO8A 3QJXA 5ABAA 1A5FL 2R1XA 3QULB 2VRAA 1S46A 5HHOE 3ZOAA 5JXED 1IAKB 4J8QA 3QQXA 3QXAB 4CU7A 3D2UD 2P8PB 5ICXB 5KBDA 3AGWA 1FL3A 5CKGA 4PWHA 3V4UH 4YDIL 1CS6A 1I8KB 5J6HB 1CDUA 3HRZB 4HKZA 3BHBA 3NIFF 1XR9A 3UTZA 5A2CA 2PXYC 5GGRY 3TA4D 4QDGA 4WKZB 1U9KA 3EH1A 4XPTH 5EUOA 3WUWB 3VXPA 4CVZB 2RGSA 4DSYA 1XGUA 4FZ8L 3ETBJ 2N59A 4ZFFA 1OL0A 4R84A 2MIZA 2ZAGA 3O2DH 1WITA 1FZJB 1R3LA 3OAYK 1CXLA 1R3IH 3PU7A 4YO0A 5DQ9B 3S35L 3WO4C 3EOBB 3D0AA 1OOAA 4W1TA 3ARGD 1QHOA 2CLVA 3C60B 2DWXA 4EI6B 3CDZA 3FCSA 3O6LH 1CFNB 4LVHC 4NCC2 3I9GL 4BFEA 4LLUB 2OQJA 5CWSA 5D7LD 4PLNC 5C7XH 3CVBA 5DQJB 3DXAA 4KJQD 4OLUH 1HHGB 4XNBA 5FA3A 1TF4A 1JNNL 1X3DA 1U8KA 4PYGA 3X17A 5EDXA 1JJUA 4ZMNA 2XZZA 1K2DA 5AOZA 4LLQA 1W72H 5JHMA 3F85A 2PW2A 2EDTA 3BAJA 3QIUC 4KUZL 3U25A 5K9OA 3Q8AA 4M6OH 4FMFA 4ANWA 5AKVA 4EIUA 2O5ZH 1MNNA 3D0VB 3MO1B 1R5IA 2QVMA 3T4AB 5HHVL 1O5DT 3R06B 5MHSD 1DVFA 5SWSD 1FCGA 5HI4D 1I1FA 3HI6L 4TUJB 1IGYB 1OHQA 5FS5A 4HUNB 1U3HC 2NY3C 3RFRA 4JDEB 1W0WB 4ZFZA 1JUFB 1NEZB 1B0WA 1XBDA 1WIUA 4WEEA 1RLBA 1EFQA 3LPGA 1I8MB 1BFSA 4KITB 1T0MB 3W39A 4AL8L 3HRPA 3H4HA 2LV4A 4KH2A 3BAYA 3KWUA 4J4PC 1OAYL 3NIDE 4P2QE 5SV3A 2D7NA 3ESMA 5GSVA 3V95A 3PE9A 3UBXB 1I8IB 1ID2A 2XG5B 2YAHA 1XXDC 2FX7H 5AKSA 3VQMA 2V7HB 4D8OA 1JNHA 4LMQE 2XKUA 2DD8H 4MA3B 2IBBA 1ZANL 2Q76B 1AS6A 5GGTA 1OGAB 3VQ1C 1TU2A 1SVCP 3FH5A 2CRMA 2Q7AA 5IW6A 4AK2A 1HI6B 3MBED 1VEMA 1ZLEA 2VRQA 2BVQA 2EILB 4Q9RL 2H8PB 2BJMH 5E2WL 1L9TA 5FDYA 2MCMA 3RVUC 5K9QI 2AZUA 4J28A 3BPCB 1WAPA 3NQKA 4JFEA 1EAQA 3ZTJH 2ATAA 2A6DB 2E59A 3CFKB 3TBVA 1YYLL 4HWBL 1TT6A 5HGHA 1L3WA 5A6IA 3ARVA 3FFDB 1ZV9A 3IJEA 3HBQA 4NQCA 4J3OC 3ULUE 1GTFA 2CO2A 3T8VA 2NY6B 1BFOA 5D7JC 1TDQA 1YEKH 5D72L 4E9VA 4H8WH 3CQQA 1BLIA 3Q3GB 3T71A 1ED3A 1HOEA 3PJNA 4PRID 3T6XA 2VIRB 3IDJA 3WSQH 1INEH 2AKRA 4Y2DD 2R7EA 3SQBA 1NDMA 3RGVC 2FLBT 5DRWB 3D07A 3VFOB 1FNGB 1Q9KA 4A55A 1IARB 2O5NA 1MWOA 1JGEB 2B16A 1LJMA 4OZHA 1DJIA 4GXUM 3TN0C 1E3FA 2BOBB 2X4SA 3NJHA 2IH8A 5FM5O 2Z7YA 3DMMB 2QJDA 2ITDA 1EJOL 1OE1A 1U8MB 3FT9A 5IBLC 4AX3A 3JWDL 3LXAA 5DZJA 4BSWB 3SDAA 1DQKA 3H53A 4F9PC 3GBNH 2VDQH 1SQMA 2WQWA 1RIHL 2WYIA 4GRLA 1DFBL 4L9LC 4GG8A 4GQRA 1FAIH 4XVUD 4GEJA 4BGDA 3OKMA 5B3SB 3ULUL 1S5IL 3V4PB 2X9YA 1TZIB 2Q6WB 2IWFA 3BP6B 5IROA 1F6AB 1PLCA 4RSVA 1OGTB 2NY0D 4Q7DA 2DQIH 4OCSH 1UZ6F 4XBEH 2IADA 4PW9A 1KZQA 4NOBA 3EYFA 3JV6B 2XWRA 3VXRB 2A73A 2QADD 2LU4A 2QQNL 5TGBA 2EIZA 3O6KH 3VFUA 4E36A 3PP3H 1J5OH 1V7ML 4N5EC 4BK4A 5F9AC 3MV11 3ZE2B 2GJ6A 1LEKB 3HE6A 1I8LC 1VRSA 3QARA 4DUXA 3EUDA 5CP3H 5C0BB 3O11B 1KEMH 2XTJD 4MDIA 4P0DA 3HC0A 1FNSH 3NSXA 4HF5L 5CJXA 1KUMA 3NEOA 3S0PA 2G3XA 1SF5A 5L0QB 1JXJA 1IVLA 3HR5A 5L88L 5KS9B 3ROLB 3ASOB 4LL4A 4YHPA 3MLPA 4HS8H 1KZYA 2W9DL 5IQ7L 1DE4B 1R3JB 4HKXA 2R2HA 3QA3A 4NNYB 3LN5B 5E4IA 2XG4A 5E99L 3MX0B 3DMMC 1EEZB 2RFXA 3S37L 3QCTL 5IJKA 4K3DH 1HXMA 4WI4A 1FC2D 1Z5LA 5F3HB 1LXMA 3QDGB 4AI7A 1QO3A 3ENEA 4J6RL 3UAAA 4PRNA 4AE1A 3NFSH 2XVBA 2P46B 1FL6A 1KCRL 4ZS7H 4OGYH 1OGAE 5D2NB 5EU5B 4F57L 4ZNEE 4X4YA 3N1QC 3B2VL 4ODSH 3Q13A 2P42B 3KYNB 3QUYB 4NRZA 3HNVL 3WJMA 2OAAA 4S1DC 1AHWB 2HMID 4DEUA 4WTZG 3S98A 3LIZH 3OWRA 2VDRL 1I7TA 4NXKA 4XMZA 4ELKA 5DJAA 1DCEA 4HX1A 4AJVA 1MIEL 2D0GA 3BGAA 3KLSA 3LKRA 3DX7A 1QSZA 4G9DA 4D9RE 4WW2A 3JWNH 3D48R 5L2KB 3ARDB 2UVFA 3EYOB 2QV4A 3MOAL 3QUHA 2R0ZL 2GTWB 2JIXB 3IWUA 1AG6A 4LCWD 3PJSA 1BJMA 3LSOB 1XGRA 5CEYB 1TUPA 1PG7H 3LD8C 1IZJA 1TNNA 2VLJD 3ARFC 5ITBH 4FXKA 4MXWL 4P57B 4ONFL 1QLFA 3SDXB 4ZDHB 4YDLB 5EUOF 2R2BA 3FXIC 1KJMB 4F8OA 1XO8A 3C75A 4I3SH 2H9GA 3CXDL 3DSNA 4Z5RB 1CGUA 4QRPA 2F53D 3S2CA 3CPLA 5LGJA 1FL5B 3OMZA 4ODWB 3EOAB 2WLLB 3F6LA 3L48A 3BWUC 3GSOA 3AVEA 4X4KA 4I48A 2NW3A 5JLZA 2QMKA 3QR0A 4GMTH 1JK9A 2PTTA 4GSDH 3BKMH 4Z3TA 2QR0A 1JSYA 3L3HA 3OD3A 3UMNA 4AENB 9CGTA 1E8XA 1L0PA 3RNKA 1URLA 2AJSH 2FJHA 2X1PA 1IC5L 1AGBA 5IJCC 5D2NC 4TL4A 4DO4A 1KIRB 1OARH 5F8RC 3U4AA 4LAQH 2FHCA 1BQ5A 3JT2A 5DEFB 1WUNT 4PTTA 1TZOA 2ENYA 5BS0A 4HJSA 4K15A 4K71C 4XVJL 4Z23A 2K6ZA 4E5XG 1ACCA 2R4SL 5CCKH 3E2HB 3CVHA 5E1HB 4FGMA 1W15A 1PY0A 1BG1A 4HH9B 4HWEL 3G3LA 5DWUH 1PNCA 4PR5B 4FHJA 5KVGH 3VXRE 5HI5D 2AQNA 2UXTA 1KJVA 1D9KB 1UJTA 1MCHA 2D3NA 3JVGC 4LGSB 3INOA 1CK0L 4UTBL 3IXAB 4JFYA 1E5UI 3EFDL 4PM1A 3UZQB 1ASQA 4NKOA 1UVQA 3ATFA 2HPOA 3OKYA 4LEEA 4XPBL 1FVEA 3MRCB 2EDJA 3RPIA 1HYSC 1JBJA 1N7ML 1U2CA 3AAZA 5IKCA 3Q8BA 4HV8B 3SD5A 5KS9E 1AZRA 2FL5A 5D96C 3FQNA 3FUMA 2ZUYA 1S78C 4NBXB 1LO3H 2J8UA 3FO9B 3NN8A 4LF3A 1RHFA 3OHMB 1T6WA 5E23A 4OU3A 4N6QA 1RUKH 2KHAA 4G1MB 2ZPKL 4KKCC 4L8DA 1KXVC 1G6RH 3GNML 1VACA 2A74A 2PW1A 1CYXA 2DIAA 2VDLB 5KVEE 1EVTC 2DBLH 4YDKH 1AS8A 5D2NE 3G08B 3NQIA 4ZPTB 5ISZA 1UB5B 4UF7C 1V3MA 3ARWA 3HBGA 3QC5X 2IXQB 3DGGB 3BDYH 4YSSA 5JDSA 3QHZL 1JNLH 5KWYC 4Y2LA 3DYOA 1A7OH 1NGXB 4DOHE 4DO5A 3LEYH 5BPPA 4JY4A 2ZUTA 2IC2A 4FABL 1RUPL 2CO4A 1F97A 2ZWLT 3S36L 2R2CA 5L2KE 2NZ9C 3GXDA 1D9KC 2IAMC 2WXRA 3TESA 2G30A 3B6SA 3GBDA 1G6VK 2H3NA 3OPZL 4GI6A 4YNYB 4WHCA 1KBVA 1BDYA 4XTRC 3D0LA 3J07A 4UBDC 2R56H 3CLEL 4JO5A 5C0AA 2XV0A 3D2UA 4LARH 4WU5A