2BS71

Crystal structure of f17b-g in complex with chitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
b'VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWSVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17BG LECTIN
publication title Impact of Natural Variation in Bacterial F17G Adhesins on Crystallization Behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 2bs7100
3F64A 1O9VA 1O9WA 2BS8A 1ZK5A 1OIOA 4K0OA 2BSCA 2BS71 2BSBA 1ZPLA 3F6JA 3FFOA 1O9ZA
chains in the Genus database with same CATH superfamily
3MRLA 5T3ZL 1FFNB 1YDPB 3UAJA 4G6ML 4PJAB 1CFTA 4MRCA 2QKIA 2OYLA 3KLHC 4JQVA 5DZNA 2DQHH 5FIEA 3K6SB 4JFZH 1YECL 1IQDB 2A83A 2A73A 2AP2A 3G04B 4NQVB 4Y19A 4D3CL 1F02I 4H8WL 2QGCA 5BQ7B 3K2IA 1BVLB 1I3RA 4PJ9C 4UV7H 4JPQA 3B9KA 4HUWA 4K15A 5EHFA 2IGFH 1FVCA 5BJTA 1HNGA 2GBTA 2R29H 4G8FB 5IGXH 1HINL 4BZ2H 4XNZB 1RPUA 1B0GA 3TH4T 1S46A 3C60B 2ITDB 3BEVB 4AYDC 4X7SH 2FWOB 4GIAA 2ENJA 3P4NA 5I1LA 4K7FB 4X6CE 1YNTF 4KKBD 3KPLA 3ZDYF 2G9KA 1U8LA 1WBXB 3QCVH 2Q6WA 5ALBL 1VDGA 1AO7B 2HVBA 3KPSB 1BA9A 4HJEA 3HNVH 2QLVB 3QDGD 5I6XC 1TZHB 2JH2A 4HEMA 3RWJB 1DVUA 2H1LM 2R29A 3GMQB 4Q56A 4BZ2A 1UD4A 2AXGA 2Y6SD 4AOFA 3S37L 2IAMD 2RALA 3BCDA 3BIKB 4BFIA 4L2YA 3QZOA 4LCIH 3CSGA 3VI4B 2D3LA 4DQAA 4HXBL 2JKRM 1PAZA 1PTZA 1WZAA 4FJ6A 4CU6A 2XSKA 1W8OA 3U4BH 3T3ME 5A2AA 1FE8H 3MR9A 3GSNL 5GS0L 4OZGE 3SSGA 1OCOB 3KXFA 3V6FB 1RK0B 1RULH 5L2JA 4LBEA 3MXVH 2KHAA 5EU6D 4F37F 3MJ8A 4AW7A 2XJLA 5MI0C 2YGPA 3SBWC 2FJSA 4K5LA 4G80A 3EOAB 3BUPA 2W91A 4LHUB 1ZTXE 3MRDB 4AYGA 3H55A 1VPOH 3WN5B 1GZHC 1ZLVH 1N64H 5DJ6B 5EPMA 3BP4B 4GP5B 1V5JA 3VFNB 4RFOL 2LFGA 4D0CA 2HWZL 3IETB 3NJFA 4ODTH 3C5ZD 4OJYA 4Y16A 3RPIB 2Q8BL 3IVKB 2I9LB 4AGOA 2LAAA 5EOTA 4OF5A 3VMNA 2XV2A 2ZOKA 1Q9LB 4GJTB 1A6AB 2A77H 1LNUA 1RJYA 3E0GA 4GB9A 4AV4A 2ZQKA 2ADIA 1DFXA 2C26A 2HMIC 4OFKA 4NFDA 4PS4H 2X70A 5CHNA 3TCTA 1MRFH 1OSZB 1ZLDA 4LDEB 4ZPTA 3TA3D 1DVTA 3GSUB 5BRZD 4J6RH 3RVWC 3E8UH 1K85A 2AXFB 1AZZC 2YA2A 5I6NA 2AEWA 3MV01 3KBHE 2CUMA 2NTSP 3DA0A 3HPLB 3QWRA 4P9ML 5E8PB 4ATTA 1BJ8A 4DN3L 5LG1A 2EDLA 2FSEB 5DUBB 4ZUVB 4M6AA 2Q8AL 3ZHKA 1AQMA 1U8QA 1FL5A 2ARJA 1LWHA 2W5PA 3AZUA 1P4IH 1NGZA 3T8XB 1FGNL 1NGYB 5EUKB 1EHLL 4LCUA 2HFFA 2ZPKL 4NRZA 1J7VR 1RHFA 4S2SB 3HLAB 3SDDD 1MY7A 3L13A 3CPLB 5AW1B 1DVQA 3LEYL 1R24B 3QUKB 4S1SL 3UG5A 5IMLA 1OARH 2HTLC 4YC2B 2N7SA 3BH9A 1PNDA 3N0AA 5FUCC 2WWMD 4OZIB 4FTVA 1KY6A 4OJEH 4HHAB 3OHXB 4WHDA 3L9RA 4XNQA 4XP6H 4PJFA 5CKAA 2GSIB 2XFXA 2IV9A 1SYVB 3K8KA 3DOHA 4KROB 2CXKA 2BCMA 3KPQA 1ODUA 5F6IC 5L7XH 1ZOXA 1NBVL 5JQ6L 4JE4B 3EJTA 1KYDA 1Q9KB 2VLKB 1Q9OB 5I0VA 5IVXE 3O8XB 4HLZH 2JJUA 1E5ZA 3DMMD 3P30H 3MROA 4CL7A 4OGAC 5KBDA 1UM6L 2OL3L 5HBBA 1DR9A 1RMFH 1YEJL 1MI5A 4J1UB 1DQJB 1J9RA 2DM7A 5E1GA 1CDYA 3T3PB 2G5RA 5BV7B 2AJVL 3TWCH 3QAQA 3JWNH 4JRXB 1SJHB 5DUPL 5FYLL 1U3YA 4TSCH 5LBGA 1BFVL 2UXGA 1PD0A 1NCAH 4YEEA 2MKLC 1HXKA 5F3BB 5H35B 5ITFA 3CSFA 2F0CA 1P2CA 2VM9A 3ETSA 3TVMA 3IPBA 2YKLL 3ARTA 5D1ZB 3D3VA 2J6EH 5C0AB 4DK6A 1RIVH 3H3PL 1FN4A 1BMZA 5JNYB 3TBCA 4RAHA 2P5WB 2EJ1A 3UZVB 5ID1B 1JXFA 4Q58C 1QABA 4H1LG 2ALWA 2W9DL 3DHPA 4WGKA 3ZU8A 1FCGA 2W0PA 1XQ4A 1E67A 4JREB 4P4RA 5F0PB 4JDEB 4ZW6A 1JWMB 4Q14A 4PTTB 4NFCA 3L6FA 1OGTB 3UC2A 1VRSA 1CZ8L 4PFEA 3UTPE 4B95C 1LD9B 3FQ4A 1A7QH 2JB5L 4FRWA 2J6EA 3K4DA 2J5LB 1E4KA 3RAJL 4CC4A 2DLHA 4IU3A 4S1QL 3QDME 4Y0GA 1HAUA 3SKNA 4ZMOA 2OV0A 4JFFD 5C2BH 1IU1A 3PQYB 4UIMA 1WA2X 3BD3A 4WUUD 5GJSL 4RIRA 4PJIA 4FFTA 4IS6A 2Q3AA 2AI0H 4ZZFA 3MTXA 3TBYA 2OBGA 4DEWA 1EEYB 3SDXF 2CZNA 1A6PA 2QQNH 3FT1A 5EIVA 4JPSA 2X12A 4HCGA 3OLEA 4JKMA 4ZO8A 3AQZA 2ADGA 2ZUVA 3ILQD 3O4LA 1IBDA 2BP0B 2YPVH 2R56H 4OIAA 2D4DA 1RXLA 2PCFA 1M71A 1NMCB 5AOIA 4HC1H 1PJ9A 3U30B 3MRRB 2VSMB 3RVTC 1RJZB 5IROD 2QPDB 3RA7L 4MA7H 4I9WD 5AW2B 2OP4L 3O6ML 4FDWA 1SXNA 3KLAB 4LF3A 4CU8A 5G2NA 1NGQL 4PJ8C 1ZVYA 4HKZB 4R7NA 5JW5B 2H6OA 1B0RA 4MB3A 4MMXC 2RHEA 3HI5L 3ZTNH 4IMLA 5E56A 2VZ3A 5DS8B 4PJGE 1OT2A 4OZFG 1LYQA 4J3OD 2V3FA 1ZTMA 1Q1PA 2YPVA 4Y5YB 5DHYB 3I84A 3VXNB 2B14A 4JFEB 1YEHL 1YCSA 4HC1A 1FL6B 3P0VL 5EV7A 4XN5A 5KYNA 4M7JH 3PDGA 2BY3A 2P26A 4UU9B 4BKLA 5LGJA 5IQNA 3EG9A 2EP6A 3LB6C 4MHHG 3F58L 1VGEH 3W9DB 5MHSD 4IBVA 3CC5A 4ZFFB 1GC1C 4IRZH 5L4IA 1TZAA 3O11B 4ZQTA 3VXQA 3QUXB 4HH9B 5BUPA 1MEXH 3NJNA 2WLHA 1X7TA 5DD5L 3UP1A 2YD6A 5E6IB 2NUTB 5D55A 1GZQB 4AV5A 3LIUA 3C6EA 4L9LC 4B7LA 5IMMA 4IBQA 5F7YC 2W59A 1I7UB 3OJDB 3MOBH 4O2EA 4HW6A 1OL0A 1TQTA 3L3OC 1QRNB 1RD6A 4MJ5B 4OGQC 1N2RA 5DS2A 2EDBA 4IRZA 4BDVA 4ODVL 2WQWA 3QI9C 4OBSA 5I74C 4J3WA 2BFGA 3IAQA 4YX2L 3IFLH 1WK0A 5DWUL 1ASOA 1QVOA 1OCWH 4E41A 1JZ6A 3QO1B 1TEFA 3CMOL 3G5YA 2X9YA 4U1IB 2JCCA 4AJVA 1Z0MA 3MCKB 2ZYHA 4LHUD 4LQFL 4UT6H 3MRGB 5E1AB 2F1AA 1NUGA 4QHUA 1XL4A 4L4TE 2DMGA 1FZKA 5TFSH 4BQ9A 4ZUUA 5CJQL 1E5YA 3M45A 4WFGE 5T1KD 3ZYOA 2ZXWB 4EO5A 4K5PA 4EN3B 5I1EH 1E3ZA 2RJMA 3CZGA 5DJZB 1F6AB 2HT3D 3LZLA 3O2WH 1JF6A 1XEUA 2B1OA 3B6SB 4ONFL 3EYQC 4K7PL 3KXFE 3OF6D 5E6YA 3ETBJ 2YQ2A 4PJBE 5D7JA 2IXQB 3MLVL 35C8L 4UT6A 2YPKB 5TE6H 4Q6IC 4ZK8A 2L04A 2OKMA 1LO0L 1WCBB 3NCWA 4KDTA 4MB1A 1WS7A 4MSWA 4U6XA 2EEAA 5JIQA 3C08L 2D7PA 5FCUL 3EFOA 3ZT7A 2MMXA 2ITCA 1TG8A 4M7ZB 1T1WA 4WF7A 1HWHB 1J1PH 3V5KA 2CO7B 2OSWA 4XMLL 1YUHA 4ILDA 3CXDH 4P5TD 4DGIL 1JL8A 1TUPA 1JCKA 2PETA 3VW3H 4Y5VB 3HNSH 1T3FB 3TWYA 5ICXA 5LAXB 2EUVA 1R3HB 2ATPB 2L4OA 4GQRA 2ICEC 4XNBA 5L4JA 4DK3A 3RKDD 1HU8A 5EN2A 3B9AA 4R0LA 4GUCA 4GG8B 1MRCH 5AD0A 2V33A 3V4PL 3FQNA 2CJUH 2J7LA 4KJQC 3DX9B 3QZMA 4XBGA 3BJLA 4NQSB 3HC2A 1Z7JA 2UWEF 3QRBA 2A9AA 4PRAA 2C3VA 2CO2A 2J2ZA 3A6CL 2QJDA 3L1EA 2BZDA 5C08D 5E9NA 5I75B 4JM2C 3I75B 3QHZL 4LU5H 5B38A 3MLYL 4ZYKA 4NHUB 2ZG2A 4YHZH 3ZYIA 3RDTB 2RR3A 5HPMB 5J6SA 1BQKA 3LKNB 2Y5TA 1LMIA 3A47A 1C1EL 1T21B 3AXLA 3QEHA 4N2LA 2FEEI 2BOCB 1FLRL 2WCSA 4X9BA 1L9QA 3FH7A 1AD0B 5DC4B 3U2JA 5IOPB 2Z64C 1P5VB 3FSAA 3NN8A 2COQA 5D71H 3FFOA 4FTVE 4JRXD 4EJ1C 2NUPA 3H1ZA 3EAKA 4FFWD 3MMEB 3W3BA 4PJFE 3FAXA 2VXQH 1A1OB 4I77H 2AEPH 3IS0X 2KL6A 1NEZG 2R2EA 2JKLA 3SBRA 3LJ3A 3GKWH 4MTMA 1Q0XL 5LGHL 2ED9A 2Q7YA 1ZA6A 3L7EB 5D1ZD 4D0BB 3O6FD 4LVNC 1LGVA 1WFMA 2PYFA 3LH9A 4AT6B 5D2NA 3ULSB 4WW2A 1T2QL 5D1QB 1BPVA 3V6ZA 5FYKE 2DBLH 1IGCL 1Q72H 4TRPL 4U1MA 2ADJB 2VXQA 1JF5A 2CMRL 4MMYA 1O7DC 3SPIA 4G42A 1VGKA 1YEKL 2NNRA 1K6QL 3GHBH 5HGGS 3W39B 5FHAL 3LCYA 3BZDA 1PGRB 4YBLC 2F08A 5FUOH 4LSDA 3HC4H 3ZKMD 3KVQA 3RP1A 3SE3C 2OX5B 2CLVA 2R9HC 3DTDA 2HX9A 3TN0D 4JZOA 1FZOB 1ZLSL 5DRNB 5CWSA 3D4YA 3FT2A 5MEPA 2OI9B 2K9UA 5DZAA 1A1NA 4HEPG 1J0JA 3TZVA 5E7BA 3DROB 3IRZA 5GS3A 2AEIT 3CVCA 5CCGE 5GS1A 1IGYA 1AGDA 4M5SA 4EDWL 3F7PC 4OD1L 4KXDA 1F00I 4JDVB 4OGXL 5E99H 3MNZA 4HA1A 4Z3EA 7CGTA 4K3HA 2VDKH 1F4XL 1T66C 1TJHL 1TNMA 3Q6GH 1Y18A 5B7FA 3HI6L 4AMWA 3A5VA 3IU3A 3DX1A 3ARGB 4GRWH 1NFIA 4H7VA 2VTFA 4PV8B 2ITEA 4HJIA 4LRNH 1NFDA 2B20A 4YHMH 3X3GL 3QNXB 4YE4H 2DH3A 2LW3A 2BWQA 2QLYA 4FF9A 4PJIE 1F13A 5IJKA 2B15A 1KB5B 5F21B 9PCYA 2WVVA 3MLZH 2OAAA 4LSQH 5HDRA 2X1QA 2F5BH 1DANU 2WYTA 3MV11 1PDKB 4QTIL 3QO0B 3BSGA 4QRAA 3Q3GB 2HVKA 4G7QB 1A25A 2BM3A 1MHEB 2D31A 5E51A 4HCRL 1ZXKA 4FLOA 3FTVA 2QBWA 3VE0B 3HPJA 3P4LA 1XSKA 5TK4A 3GBML 4GSRA 4JDZA 4I3GA 5C0ND 4FG0A 5JW4R 4APXB 4M8QB 4BSJA 4E9RA 1I8KB 4WKZA 3OV6A 1QATA 3FFCA 1OAXH 4K71C 2H5UA 2XU9A 4X6FB 5EFIB 3TJHC 4M02A 3V4VL 4J3OG 1CICC 4LB8A 4PJDA 4YHKL 3GSRA 3WJJA 4O51B 1MCFA 5EU3A 3QUXD 3MSPA 3AB0C 5JOEA 3G6JB 1K8DB 4GG6A 2JELH 4FLHA 5HY9B 4TUOA 1ORSA 1RAMA 3WSQH 1UXWB 2HJKA 1SN2A 3AAZB 1IKNA 3P3UA 2EXYD 3GRWL 4JHUA 5I0DA 1BYOA 3MLXL 2I32A 2J8UF 4J12A 1YPZE 2YBRA 4Y2DA 3VSQA 2Q2LA 2QQKH 3B5GA 4ZS7L 3NABL 1ITBB 2QGBA 5CS7A 1A7BA 3ARPA 5KJRL 4LVHB 1U21A 3VXRB 5DT1L 3U0WL 3UDWA 4R4FL 3LRGA 3VFWA 2ICCA 1JI1A 4TUUA 5CEYB 3LD8C 4RCAA 3MRKB 5M95B 4UOW1 1M1XA 4M1CD 3OKMA 3BP7A 4HOWA 3U46A 5CM1A 3B1TA 4ODUA 1DBML 4UMGA 1NAKL 4FNPA 3AG3B 3FB7A 7PAZA 1NWPA 3DGGB 3HIZA 3OKLB 4A7QA 3OAWA 4PLJC 3WFCL 2WY3B 4Q9RH 1EMTH 4XAKD 1NLBL 3BLBA 3MCLL 4L4VB 1OANA 4N1EA 4EN3D 1AD9A 2L8AA 4LAQH 5L6YL 4HAFA 3K1DA 3EJPA 5TQ2L 1QSFE 3IF1B 5IESL 3S88L 1U8KB 2MNJB 3GLDA 3WE6B 4TM9A 4WHYH 5GGRY 1IB5A 3P3SA 2B4CC 2JJTA 4TQPA 2V7NB 2IALB 1HXMB 1QLRB 4R4ND 4NKDB 1TETL 1WHOA 3QJHA 1JGUL 3DECA 4NEHB 3RI5F 5E5RB 3BPCA 1YEGH 4O5LL 2PF6A 2JCCE 1F4AA 4Q9QH 4L2LA 1MFVA 3UEZA 3U6RA 4M4PA 1DN0B 2PCPB 5K9KB 2BVPA 4PVBA 1GGIL 4KC3B 1U8NB 4KRLB 1I9JL 2W88A 5EEWA 5CCKH 5GGUA 1C7SA 5E9DD 4IDLA 3DX3A 4LHJB 1D7FA 3BYTA 4DCQA 4DK5A 3HE6D 3IDXL 3U2SB 3J07A 4MAYB 4YWGL 5J6HA 3UO1L 1ASQA 1RIUL 1HEHC 4YGVA 2CU9A 4PVMA 3PWPA 3CFMA 3QUYC 3T0EB 1CFMA 4UDTB 3UFIA 4RDQF 3HZYB 5J56B 3ZE1E 3VX1A 3VXSB 1PLGL 5KVFH 1J0YA 3QYNA 4KGJA 4LDCA 4WWID 1TPXB 1NCGA 1LVEA 3QUZB 4B27A 4Y5XC 3HBPA 3GTVA 1FFOB 3VO0A 2C1OB 1EPFA 1E5UI 3WKMH 3QIUD 1A4AA 3HR5B 4WI4A 2C8NA 2F54B 4WV1A 3DV6A 2G4GA 3VUAA 2X53A 1TYRA 1J9SA 1KGWA 4BXVA 1F42A 2EICA 2NW2A 5AOKA 1ZWIA 4JGUA 2DLEA 4JFOA 2FD6L 3BEWB 4U1KB 5BVJB 3EOBB 4LSPL 2HJFB 1PCSA 3SDAD 4F7EA 4FQPA 5KYXA 5HVFB 2RQ8A 3DHMA 4GI9A 1SBBA 1X5MA 1QFUL 3DX6B 3L3DB 4LCYB 2H9GA 3GRBA 1XIWA 4Y4KC 5DSCB 2IDCA 4PMEA 2VLLA 5AZEL 1KYFA 2A7BA 1I9RL 1N7MH 5AKRA 4Y4HA 3MV9A 2WIIA 5HPOA 5F7BA 1CVSC 4JY5H 3LKSB 1EZUA 2RCSH 4NQEA 2F7RA 4GW4A 4KUCF 1JFHA 1GS8A 4NRYB 3RIAK 1O6VA 3TEZA 3TIDA 5JZ7D 2ERJB 2ZT9C 1A6TB 1R3JA 4PN6A 4W9JC 5AAPA 5AYTA 1G7IA 2AAAA 2DQUL 5KVGE 5KVEL 2QEJA 5D7IF 5E5MB 4AQ8C 3LEVH 4PG2C 3WKNA 4AEIL 4ENZA 4QDGA 4APQA 3QRGH 4K8RL 4P4KC 4CVZA 2IPTH 2VXSH 2QSCL 4U1GB 4MMZC 4RMTA 1DVZA 4NN6B 4RGMC 3WO3B 2VZSA 3HFMH 5EO1B 1T04B 5KBPA 2Z6FA 2V3DA 4HWZB 1ZEAH 3PPEA 1R0AH 4XMVA 1LEIA 4MZIA 1KLGA 4JQXA 4JG0H 4NNYB 1CLYL 3V8OA 3VRLF 1VB9A 1U91B 1KLUA 3IE9A 3N1MC 5F88A 2N56A 3T77B 1TFPA 2X09A 2QQQA 1G5AA 3LEXA 5J0BA 2Z91A 3DO3A 1QBAA 5HYSB 1BM3H 4K3EL 2ZKXA 1HOEA 1EHXA 2W60B 3VYPA 1MJJB 3P3RA 3CZFB 1C16A 1PSKL 4MA1B 4FNLL 1RV6X 2BP8A 3KBEA 2WNKA 4QT5A 1EGJH 4BH8B 4DAGH 2E76C 3RFZA 1UM4L 2Z8WC 5FYJU 5DR5H 3T6VA 4EUPB 4NQDA 2Z7WA 2HKAA 2MTAA 3H4HA 3L4YA 4KKZA 3S4SG 3WUWB 4AQEA 4ZOBA 3VQ1C 2XQ0A 1ZS2A 2ZSVB 2B59A 3L2NA 4S1RH 2ZCLH 3VDBA 1MIML 4PGBB 4N8VG 3GPSA 1U3HB 3FU8A 4IIQC 2WQSA 3QXDB 5DO2C 2ZOUA 4NM8L 2BSDA 3T1FB 3WY3A 4GMTH 1M7DA 1U8MA 5FUZL 3K5RA 3PIQB 2BY2A 1EGJA 4K4KA 5GRJH 3G6AA 1SJVA 5L4MA 4XHJC 1F56A 3N1FC 5DRZB 1Z9SA 1DVFB 3QG7L 5FO8A 2R8SH 4U1SA 2OMBA 1HEZB 1CBVH 3KDMB 3NIDB 4HCFA 3CSYA 1Z3GH 1ZLEA 4XPGH 1IM3A 5J5EA 3RZCC 1UT1A 1U8PA 3ARFD 3O4OC 1TJXA 1XGPA 4DVRL 3IJHB 1KFAL 1MREH 2BNUA 4QHKJ 1J8HA 1TTCA 5KSBA 2YRPA 3E6FB 5E5LA 2OMTB 3CFUA 5FW8A 3VTTA 4IRJD 2EYSB 3U4EB 5CN3A 3US0A 1D9KB 4J3UA 2NY4B 4AK1A 1FVDA 3UGUA 1NOFA 1FDLH 3ZQ9A 2EXTA 4F37K 4I5BA 4FI7A 4RMSA 4KDWA 4MS8C 3TCLB 3VXRD 3RNQA 4KNSA 3DTXA 4OLZL 3UJJH 4BCZA 5HDBE 4ONHA 3FFCE 4HIQA 4NP4L 4PRHB 1JZ8A 1A7RH 2E47A 3FQUA 2JTDA 2C9SA 1JBJA 2YFOA 2DQJL 4WEBH 5ILTL 1U41A 3C6LD 3K81A 4R83A 4S11A 2XG5A 2FO4A 5BS0E 4XGZB 4ADIA 1T6VN 4DGUA 3QQ3B 3IGAB 5HI3D 2HRPH 2KZKA 2BFVH 3CHOA 3VQMA 5CEXA 4PRID 4KZEL 2X05A 3IMBA 1J5HA 3NFPB 3KGRA 3QNYB 3V0HA 1CVRA 2YWYA 2FQFA 2LR4A 3H53A 5DZLA 4JLRA 4BK5C 2D7TL 1YMMB 2WZPD 1M05A 2VB5A 1XH3A 1CLOH 3PUUA 4HS8L 1YNTA 5SWQB 3AT8A 1WLHA 2Q3ZA 5C0RL 2FX7L 2GKIA 3QC5X 4HUMB 3ZZ1A 1VEMA 1HI6A 3W11D 5JYMA 1UZ6F 4G70B 3MGTB 3B8SA 3TGXA 2AQRA 3P9LB 4KQ0A 2GJJA 4M7LT 5D70L 3V7AE 1TQCC 2IVFC 2Z4QA 3OZ9H 5SX4H 4FXKC 2CKBL 1D5IH 3C5JB 3R4DA 5FGRA 3RILA 3EBHA 3WJMB 5D2LB 3WMQA 4IMKC 2PYED 5CEZH 3PDOA 2J8OA 4AGNA 1S9YB 4RGNB 5GGRA 3VD2A 4OGZA 1QLEB 2H6PA 2RIKA 5K9QI 2X4PB 4C59B 1FZJB 2WK2A 3O6KH 1D5XB 2DLIA 3VWKA 3QG6B 1A6WL 1TTBA 1KIQB 4HBCH 1DLHA 2X5PA 4U1JA 4XX1G 1ETJA 4N1CA 5CD3B 5IHUL 2R27A 2ZTBA 3E2HB 3IK2A 3BVUA 2APVA 3VD1A 4E9WA 1HHKB 1DQML 8FABB 2FHCA 4JY6B 4ZMNA 5K69A 4WJKB 3VXSD 1TQSA 1DYZA 2WQ8A 2CLZB 2X4UA 1MJUL 3MUUA 5FFLA 5ICZB 1HDMB 3D5OF 4XO4A 1EDQA 2K8QA 5MENA 2QDWA 1QBML 3H8NA 2VISB 3JYBA 3B2UD 2PNDA 1J5DA 5AAWA 3ATEA 7FABH 5AUMA 3W82A 1JYWA 2F54D 2VO8A 1IT9L 3IAGC 4ERSL 5I1DB 1OKEA 3L4VA 1JHTA 3VFVA 3EGDB 3VRJA 2BWIA 2K4WA 2QKIC 3MLTB 2JI2A 3QIWB 4K94H 4LASH 4JQVC 5MEQB 5JXAL 2HLEB 5GGVH 1LQBC 1U2YA 5C0GA 4LL1A 1XF4A 1L7TL 3EGSA 2ESVA 4UF7C 3LKRB 2HLAB 4OAWB 5B3JE 5E00A 1TZOA 1KULA 2DM4A 4UINL 1OW0C 5H94B 2G4EA 4XI5C 3P4OA 3SJVB 5HHMD 5IB3B 1QBBA 1ETZA 5IQOA 5DJ0A 4PI2A 4QJ4B 3ILDA 5DJCA 4FKHA 3SQBB 1T7XA 2C4XA 3UAJD 1NDTA 4HQQL 4EKJA 3QORC 4ZTOL 3H9HA 2HB0A 3T0VA 2YEZB 3RVVC 3N85H 2YD8A 3QQ4B 1RVFH 1NIAA 3NSDA 4X5LA 1X5YA 1OP4A 1BF5A 4IOFD 3ES6B 3O3DA 2D0FA 5E2TL 1EXUA 5KVFE 3VX0A 2XN9D 1BD2E 4GT0A 3HZMA 3KZ8A 1CIDA 2VABB 1SZNA 3S5LG 1SQ2N 5I66B 3CXFA 3K2KA 2L7UA 1P9MA 1DEEA 2XKNB 4LEOA 1X5XA 4GUPA 3ETBF 3GM0A 3HRPA 4BK4A 4D94A 4H8VA 43C9B 1SY6A 1BJ1H 4OT1H 1JPTL 2EE2A 2FZ3A 1TZGH 2P8PA 3ARBB 4UM9A 2X2UA 4ODBD 3BGMB 2UYLB 5FLVA 5DRXA 4NQEE 5EB9A 4DVBA 3KS0H 5JORA 3N1GC 4IEFA 2N1KA 5CCHE 3S98A 4G2AA 3QDJB 4OIIL 3JQOB 2XTJD 2BW4A 3HEIB 1ZJAA 1JHKH 4XVSL 2G2PA 4XPHH 1MG2C 2NY7L 4X0KA 4N0CC 1SF5A 4BQCA 3FRUB 4PREB 3LOWA 4PJ9B 4O58H 3BD4A 4TXVB 4UB0L 3TT1L 3L1GA 4YR6A 4I18A 2HSIA 1QNZH 2VMJA 4ONGL 3NACL 2D03H 1J5OH 5EZIH 5IB5A 4OSUL 4URKA 4WFEE 5T1JA 4ZMQA 2Z31A 3KWWA 1FRGH 4Z7WB 4Y16C 3SPVB 1QX1A 3F83A 1CFQA 1HH9B 3UJIL 2XWZA 4DNLA 1YJDL 2DS4A 1U3HD 4WJ5B 5C0CB 5JXEA 1QA9A 2Y36L 1S3RA 2VDPL 2PXYC 4F7MB 5I6XB 4LDLB 2OXGB 2EDOA 1FO0L 2GT9A 3ZDXF 2QVTA 1J5IA 3B3BA 5JUEH 4RNRA 2YC1A 2C9RA 2OK0H 4PRDA 3ATFA 1ZHKA 4RH4A 1F1AA 4IM8A 3N41B 2AJUL 5G4MA 1AY1L 3TO2B 4N0YL 4DP1X 5KTEH 4LEXH 1SEBB 4NQDE 2Z35B 3HUJF 1J0IA 4KMTL 6CGTA 2EDYA 1L0XA 1NC4A 5FGCE 1N4XH 5SWZA 3NH7H 4G43B 2BINA 3I02A 1ZK9A 4ALAL 12E8L 5LXGL 2A9DA 4CVWA 3WY1A 4NZUL 5HGHA 2C7UA 1TVHA 1H6UA 5F9JA 3O9WA 4HS3B 2OCJA 4NNXB 1JPFA 3HN8A 4X4ZA 3SGJA 3SDXA 1FZMB 3UAEA 2QPUA 5MI0B 2GJZB 1BWWA 1D9KD 2IFFH 3U4AA 1FYTB 2NY4D 2ZWLT 2AGJH 1E9PA 3GMLA 1J12A 4HYTB 4QXTB 4D9RD 5A2KH 1MW2A 4EI5A 4NZ8A 1FNGB 4UTBL 2KZBA 3HN3A 1KG0B 3M86A 1MLBB 1YEFH 2CGRH 2YRZA 3SYCA 3SZ6A 1N5YH 3AY2A 1QP1A 1M3JA 4ZUSB 5TF0A 4XP9L 1ZANH 2KUTA 3OGCB 1HWGB 4PRHD 4URTB 1VFMA 4G8EA 5DFTA 3KR3L 3OGOE 1AOHA 3N44F 4TF4A 3H6AA 4EZMA 3QULB 5ESQB 5KSBE 2X1OA 1IL1A 4AGPA 5I1GH 2JKXA 3UIYA 5C07B 3LNIA 3L5WB 2NMSA 1NH6A 5FYJL 4PPTA 3TM6A 1L5GB 5JOFA 1YMMD 1NUNB 2V5TA 3CIAA 3L3IA 3QZPA 1GGBL 3P3YA 5FM4A 3BUYA 3BAIA 4FJZA 3D18B 5F72S 2ARWA 2JXMB 3BQUA 4I88A 4NCDA 3HZ3A 2UUDK 1NLDL 3LNFA 2AXHA 3EJRA 5E4EC 3P54A 3NCJL 1RZ7L 3PPSA 4KH2A 4ZS6C 3GSXA 3M1BA 5DEFA 1ROCA 3FTYA 1K5NB 4YHIB 2IH3A 4YSRA 5D4IA 5GHWL 1URLA 4JFUA 5IQ7L 2LU7A 2KLTA 2E6PA 1B90A 1PKQA 1NEZB 2VXUH 2UV3A 2WTOA 1JGLH 4N2OA 5CILH 4K9EL 1DUZA 1KWGA 2EH7H 5CSGA 1RZFH 5IEKA 3SGKA 4KZDH 3TVMD 5E4AA 1MLCB 1E4XI 3RGHA 4IU2A 3REVA 4PJEF 1E4KC 2EYRB 2ZWNA 5T1MB 4CC4C 3OMAB 1ZV9A 4GSDH 3GMMB 3X12B 2CUHA 3NBNA 5F6IB 2VDRB 2Y07H 1EK3A 1KTLA 4GEJA 2D0GA 1KYOJ 2NYKA 4QCIB 2CAKA 3ARYA 1XGRB 4I87A 5F7AA 2KQMA 4NN7C 4OJDH 3BSZA 2DQFB 1THCA 1SBSL 4BSWB 2VXTH 1D6VH 5EZJB 2QSQA 5BVPH 3CLEH 4NYLA 2UUDH 4J3TA 3QJZA 4F3FB 1OK0A 4R5VA 4TQHA 3NK3A 3UTTB 1VFOA 5AOMA 3B9DA 1N10A 1NICA 5T1LA 3ZTDC 4P5MB 1DJSA 3QIWD 2AJSL 3OX8A 3P3TA 2VIRA 4LESA 5FPIA 5DMYA 4XNDA 4FERA 1JNLL 2WLYA 3WL9A 1L9MA 4BFGA 1QBLH 5C09A 3BN3B 4I1PA 1R1CA 1ES0B 4HJJH 5CMAA 2XZQH 4AI7A 4LHQB 3SJVD 4UQCA 3PGFH 1TITA 3O4LD 2OR9L 4OTXL 5F1NB 5IR1A 4JM0A 4QD2E 4PH8A 1F58L 3FH8A 4M3HA 1JDDA 4JBSA 3FQ1A 4X5XA 1F6FB 3S0PA 5FLUA 2NNCA 3PGCB 4P46A 3MV8A 5E8DL 2MCMA 4HT1H 4KAQH 3GLAA 4MKMA 4PB9H 3MU3A 2E0PA 5IJDC 2D4FA 2CWRA 1HVXA 2XWTA 5I8OH 4AQZA 2NYYD 2F58L 1GGCL 1T7WA 2VE6B 3LS4H 3QJRB 1LE5B 4OLWH 4CVUA 1WP6A 2AJXL 2ESVE 3HZVB 1JZJA 3L9YA 3O45A 5FB8B 3VJ6A 2FBRA 1S7VB 2AITA 2DWYA 2YFNA 2UWEA 2M1KA 2E7BA 3HB3D 4WDIA 1KBKA 2F5AL 3CN0A 4L37B 2P42B 5F3HB 1RZJL 4H8WH 2OZNA 5DI8B 3VFUB 4YXKH 5KVDH 3WEMA 4LLMB 5I1JH 1OGAA 4N24A 2DV6A 2OZ4H 1AQKL 1ZVSA 4Z7NF 1OP9A 4WNQA 1R4XA 5JHDB 3P2TA 2MH4A 3RWIB 4CN4A 2V17H 4DO5A 3N43B 4R3SA 2KQNA 1A7PH 5HP5A 3HAEH 4A37A 1YN7B 4ZXBD 2HKHL 1RP9A 2WJ7A 3GF8A 3S5YA 3UMNA 2ATAA 1HYSD 3CLFH 2ZCZA 1JZ2A 1VESA 1JVOA 3P77A 4Y1AD 3P2BA 4PJ8B 2A5UA 4D0DB 4I13B 3QFJB 1PZSA 3WDIA 4CU7A 5C86A 5A16B 4MMXB 2BMKA 4LSSH 1OM3H 2HT2C 4L3CA 3S3JA 2YLHA 3SBPA 1A2YA 3KEHA 1JHLL 1C5CL 2VMCA 3I9PA 3ZGHA 2J4WL 1KTRL 3K2MC 1KENH 2BWDA 3HAEA 3HE7A 2W9LA 3SCMD 4GNKB 3FQRB 2PWEA 5FKAA 4N4YB 2UZIL 2ZXEB 4C55A 1I1RA 3ARXA 1KLFA 4HXBH 1S7WA 4OJAA 4BELD 2CJ3A 3JWDH 5D7JC 3VGHA 1IV8A 1AAJA 4YHPA 5C0CD 2E5EA 1UWXH 1ZXQA 5EBWB 4C56A 4MNQD 1X5FA 1RK1B 5KSVA 2XRAL 2NY5C 1KPUB 4G8IB 4PJ7F 1NMBH 4QRUA 4GS7C 3VI3A 3O3EA 4YPJA 5JMRA 4AYSA 5HYJE 1QSEB 2F8VA 3WGVB 3I2CL 5FECA 3HS0C 3VFGH 5LCVL 2Z0BA 1AIZA 4L9LB 3IKCA 1ONQA 3FT3A 4WK0B 1L9SA 1SMOA 4IW4C 5C0FA 4L3EA 3L4TA 4B9ZA 5JW3L 4UZUA 3L3OB 1R3KA 2QV4A 3L4WA 4KQ4L 2ZOOA 4GEIA 2F53E 3QI9B 5I74B 3HG1E 4R0LC 1RSYA 4HX1B 2JB6B 4F8OA 1EEZA 4F7KA 4ZNEE 4PLOB 2EO1A 2IDQA 3RVXC 1BQLL 5JIKA 4BKTC 2LABA 3UEQA 4X83A 5GJTL 3TEUA 4WHCA 1I9IL 3SZKC 4GW1B 4PTUA 5E08H 5I17A 2EXWD 4TVPE 2LFEA 2BCKA 3ZHLA 2AK1L 1KJ2B 4QAMB 3ULUH 1OAKL 1IEAB 1S5HA 4F2FA 2AKRA 2OMUB 4P9MH 2NDFA 2BOBB 2YZ8A 2ZCHL 3GJEB 5HGBB 3WIHH 5I1AB 3N55A 3O2DH 5DJXB 4H88H 4ZDHA 3MRIB 1FGNH 1E5AA 3NSJA 1A6ZB 1ZIAA 2BXYA 2W8CA 1S7TA 3KLDA 3QPQC 3PAUA 1E28A 4PGCA 4Q6IB 2DTMH 2NXZC 2VC2B 4YDLC 1HCZA 1UWEH 3S3DB 3DURA 3QEQA 3KHQA 3MJ9L 3LEYH 4O2CB 3MLWH 3Q05A 4OZHF 4KTYA 5IVOA 4PG9A 3O3AA 3RI5K 1KT2B 2QQLH 3AWGA 2FQDA 4FI8A 3MBXL 1K2DB 3WIHA 1TZIA 1ILUA 1ZGLB 3LH8A 3MOAL 5FW7A 1GSKA 5J1TC 3F7VA 3F7LA 3PABB 3VRIB 4WW2C 4A2DA 4KI5D 2GTZB 2A0LC 4P2RD 4YSOA 5E8OB 1QTPA 4JKWA 2ICEB 1MFAL 4DPRA 4WWNA 2VN3A 4KO5A 1CTOA 3WHE1 3OMZA 3RVUC 4KHTL 1H0DB 4EIUA 2OSXA 2AEQH 1SJMA 4PM1A 3CBKB 3OB0K 3OKDB 1RIHL 2BDNL 1IAOB 3NJKA 4NC1E 1VHPA 1NJ9B 1MQKH 2QADC 4MXQD 4TUKL 2I07A 3VXMA 3CU7A 3KPRE 2O5YH 4F7PB 1L9OA 4JM2B 3EBAA 1QSZA 1UB6B 3DI3B 4I2XE 4UOQA 4PS3A 3RWDA 3VXUE 1SUHA 5K9OA 4RQQA 4AIZB 3D69A 4N2GA 4WWKA 3TZVC 5GS1C 2YKLH 4POYA 2J1KA 2OL3A 3HG3A 4HLZG 1S7QA 4JDTL 1KZYA 1I3GH 4FC3E 2I26N 3E6HA 1QYGL 4AMXA 4JNXA 1D5RA 3MV7B 1CU4L 2JK5A 1I1AA 2DLGA 3IFPB 3D39D 3PJSA 4HJGB 5EOCJ 3HI1B 3G5ZB 5IQ9B 2VDQH 3W0WE 2W9DH 3F12B 1BVZA 3JWNG 4M9PA 2AK4D 5DMGC 4DTGH 5MEOB 2DLFH 4EI0A 4A55A 2G60H 5I9QC 1Q1JL 3PWUB 3HG0A 1S7SB 3BWUF 4P5KA 5E0QA 4HAGA 1CZ8H 4XNXL 2FYYA 2VITB 1EFQA 1Q0YH 1G7HB 3GDBA 3OB0H 2D9QB 4LVNB 4E9QA 5IJKC 1XF5A 1YNKH 4LSVH 5FV2A 1NPJA 5SX4I 2D7OA 4AC2A 4YBQC 2K45A 3NJIA 2FUQA 2O6FA 1R46A 3IEAA 4MQ7B 3QJSB 3S2AA 2E7CA 1P84J 1WWCA 3RJDA 4Z7OB 5KSUB 3CWGA 4ANWA 4I3SH 2VDOL 3NFNB 2A4CA 3WTVA 5AW3B 1AIFB 2YS4A 3KWVA 5ALCL 4X7TB 4N0UB 5CNHA 3L1OH 4YHNA 5LB1A 4RFNC 4X99B 3ZE0F 5C8JB 1ETA1 1TJGL 1ZT7A 4YZWA 4YBLB 1U58B 4JFYB 4HKJA 1PPIA 4BZYA 1HSBA 4DF9A 4NSKA 2G2RB 3WHXB 1DJXA 5CKGA 4NOBA 3LH2L 5DVKA 1C8PA 3WJJC 3MUHL 1P5UA 1DVSA 2VLRB 2DQCL 2DIEA 4Z7QF 1E9QA 5EDXA 4AENB 3BVNB 2FGWL 5CLYA 2WKGA 4DGVH 1WBYB 2B16A 4L9DA 3BZFA 1LP9F 4AITA 3QNZB 2X4QB 1IKNC 4QY8A 1B9KA 4PJCB 3ARUA 1OCZB 4B41A 4RFEA 2PP8A 1NM4A 4Y2DC 5LQBL 1W6WA 3NJXA 5DQ9A 1XZ0A 5E6SB 3BVDB 3MV8E 1CXFA 3QRFM 1EAOA 4EDXB 3VD9A 4KKCD 2A38A 5HJ3A 5KANG 1QFWI 3UDWC 3PHOB 3P0VH 1BYPA 4PIRF 2FB4H 4Z9KB 1KC5L 3QUHA 5BZDA 1IIKA 3L5JA 5DURB 2EE0A 4RRPA 4WTQA 5FDWB 1H15B 1DUYA 2OTUB 2RD0A 5GGQH 1QO3A 2UWEE 5AVWB 1IGIL 4YSUA 1MZZA 1W9XA 1TLMA 3LS5L 4JRYB 2VDOB 2YPLB 4YMPA 4KPHH 1OGAE 5HHPB 5GXBB 1RP8A 1OF2A 1GH7A 3FO0L 3BMVA 5DMKA 5ERWA 1PD1A 1WV7T 3FMGH 1T4KA 4P57B 4QNPF 5T3ZE 1JDAA 4P49A 4PJHB 3ZKXC 2Q86B 3OZLA 1UD2A 4PS8A 3BZ4B 3PWVB 1L4IA 5I6OA 2IPUK 4K71B 3LX9A 1DSYA 2PTUA 4KK8C 5FKPB 4F8TA 5IEHB 2FUTA 2F7PA 5MERA 1M2VB 3GM8A 4FS0A 2DQTH 1CICB 5D7IA 4A2MA 4N5UA 3IU4L 5KG9A 4DGYL 3VH8A 3AB0B 4EF3A 2UXVA 2A9ML 3GNMH 4KVCL 4XZUA 2WXLA 1HH6A 1WZ1H 5FK9A 1FPTH 1OAYH 3NZ8B 3U7YH 4ZX3A 1CWVA 3X13B 3FUKA 2K7PA 5K9QG 3NDZE 3DIVA 3B5HA 1EHNA 1EJ8A 4KRMB 1PFOA 2QSTA 1H3VA 2R0ZH 1HYRC 1IX2A 3QH3A 1UTDA 2X0UA 2WTRB 4MLIA 4C56E 3LD8B 4WFHD 4I0PA 4POZD 2PR9A 4NQCB 4ONFH 5GS2D 4GKNB 5GIRB 4R90L 3MHZA 4XWGH 4AEEA 4GAGH 1MG3C 1DJHA 4A7SA 1NCHA 4CSZA 3A3YB 2LLLA 2GSGA 1EQWA 3D9AH 4ZX4A 1SOKA 4IJ3C 3F65A 1IC4L 3OKKA 4OD2A 1UADC 4W9GC 4Z18A 4XXWA 5FCUH 1NAML 4MD0A 3BHBA 1BEYH 2GIYA 5I76B 4WV1C 2HXAA 3RWCA 2O6EA 1GR7A 5DK0A 4J3OF 3H3BC 4WO4A 4WNJA 2OCCB 3AREA 2E27L 3ABZA 4G7SB 5CXPA 3MJ6A 1CYGA 1JMXA 2XWJB 4XMUA 5HGAA 3CXHK 2MNUA 1ET5A 3IN0A 1K4CA 5BW7C 3QJFA 4YO0A 4AZ8B 4IBTA 4U7MA 5CP3H 5DJAB 1EWHA 1AZVA 4IGBD 1XH0A 4WY7L 2YGQA 4UQ2A 5E8NB 4LL4A 1RFDH 3SYPA 4E42A 4Y4HC 1CDJA 3A6CH 4QKTA 1TSRA 3JV4B 2YD5A 5FM5O 1ZLUH 4PGEA 3T0WA 4B9JA 4CKVX 1CD1B 5EOCL 2J21A 4XCYA 3BZEA 2XZCL 4HUXB 3VD5A 1QEWA 2R7EA 3OPUA 5FDYA 3S36X 1UFGA 1HL8A 2MPVA 1BLNB 5B38G 4KQ3H 5CP3A 3RX7A 2WLLA 1CGTA 2FR4A 2ZF8A 3QUYB 2VZ1A 3ME0B 5FCSH 2WAQA 3K6DA 4OLUL 3IJ7A 1FLRH 1CFNB 2YXMA 3BKML 4N68A 3C9NB 4UUJB 1RPQA 2XQYK 3LKQB 4APQC 1X5HA 2WZ0A 3OAUL 4UNTA 2ZKWA 5CZKA 4Z7IA 2GK0B 4IKKA 3HC3L 1IAIL 4DZ8A 4Y5XB 4AQOA 4QOKA 2PUQT 4X6CB 2R59A 1SUJA 4JQXC 3FQXA 1Q0XH 4AG4H 5IJCC 3S5LB 4CC0A 2H26B 4P2OD 1HZHL 4KJYB 2EIMB 4NDMB 5EC2A 4WZ9A 1BVNP 3KJ6L 1P7HL 3MV7D 1THAA 2ORBL 4KX8A 3VGFA 3TJPA 3OR7A 4JEGB 4QRPA 3SOBH 3U1SL 5E2JA 5CP7A 3ZDZF 4D9QD 1QR1A 2J8UE 4MB4A 4PY7B 3IB4A 3GUTA 1DFBL 3WEBA 3VXME 3D0LA 3WKQA 2CMRH 2AABH 4U3SA 4OY9A 1A0QL 1JNHB 4Y4KB 3RFZC 1DO6A 3UO8B 4ZFOL 2VDLL 3ZO9A 4HF5H 1D6EA 4XO9A 1TKWB 4CJ1A 5DRWA 3T3MB 2JF1A 3EDDA 3K3QA 4OZGB 3T6ZA 1EJOH 2PO6C 5F7EL 4I48A 4HUVA 2XPYA 4W9CC 1JK8A 1Z1WA 5IB2A 5AW6B 3NIFF 2CK2A 2GJ6A 3AVEA 1UC6A 2V7HA 2SEBB 4W9EC 2KPWA 3UCRA 3WNLA 1M1SA 2NSXA 4LEBA 1NKRA 3TYFA 5FYLE 2YZ1A 5K39A 2VR5A 3D2UB 4OD1H 3I3EA 3HC0B 4P4KB 4DZBB 4M5TA 4QI3A 4P0DA 3TYGH 2OM5A 5CZVL 4RGMB 2R9HD 2MCG1 1HNFA 3KLQA 4RISH 5ESVA 5F8QC 3JTSB 4P2QA 3X3GH 3QT2A 2ICWI 1XXDC 2CM5A 2GPZA 4AGMA 4HOZA 3EBGA 4IK7A 4ABWA 4PD4K 1KIUA 3ZOAA 2XPGB 3JT0A 4ATWA 3G5VA 2XI9A 3ILPA 4NPYB 4WIQA 4F91B 1JWSA 3RYMA 5FA4B 4AYFA 3SGDH 4PHXA 2FX9L 3N42B 2WINB 3E80A 1JV5B 1HXYA 1NIBA 4FQLL 1QWHA 5EIQA 1G9HA 1E30A 2C9PA 2DWDB 4AH2B 1BYNA 2CBTA 4BRVA 4MJJA 1J8HD 1KCVL 3DUUB 3PGDA 3O2VH 1IKFL 4FZEL 3DYPA 3B43A 3NJLA 3OXRB 5IJVB 1WZLA 3TH3T 2BXZA 2JIXD 3T2OA 3EJYC 3POHA 2ROXA 1XF3B 4BE6A 4LLQB 3V4VH 4JL1A 2E4FA 2YIHA 1XX9C 4P59L 4IIQB 4JRYD 2ZKHL 4BQBA 3FB5A 4HWEL 5D1XD 2BNRA 2CK0L 1N0LA 4H26B 2R23A 3LRSB 3RWHA 1C08A 4JO4H 2BC4A 2OR8A 3MA7B 1I1YB 3QXUA 3GJFB 3TO4A 2AV1B 2P49B 2F19L 3TONA 4FG4A 2CHZA 1SN5A 4P3DB 3MRBA 1E5CA 2NW3B 2QTEA 4U7SA 1I8IA 3V4VA 4FQJH 4LK4A 4QXUL 2OPCA 3T4AC 4W4OA 1KV7A 4QRRD 3BXNA 3FO2B 4R8WL 1EAPA 4PRPD 3RZCB 5IVXB 2K70A 3O4OB 5HYQA 1R3IL 2O26U 3FF7A 5PCYA 3CFEB 3PL6A 3L9BA 1TLKA 3JV6A 3K8LA 3DX7B 1T22A 1UT9A 1HHGA 3Q8BA 3NP4A 2XFGB 1WBZA 4XC3L 3ZZLA 2H0EA 4R5TA 4MCNA 5FC9A 1YLBB 4N0FB 1SVBA 5I8CA 1EJ6A 2ZXBA 4HK3J 4NZRL 4TUJB 1NBZB 1CDGA 4ZUTA 4NQCD 1JV2A 4Y9CA 2VDMH 4WU5A 4PHZA 2XX0A 2H2PD 4GKSB 1T5WB 2A1WH 1TETH 1QHQA 1JGUH 2DWEA 1SMDA 4M1GL 1A9BB 4W9ZA 2V5SA 3QQXA 3VWKD 1T89A 3EKCA 2G0KA 4OB5L 1KJMB 2VCOA 4UV4L 2DQDH 5AAWC 4X4YB 5CJOH 1ZVHA 5KN5B 1XFPA 3BKYH 5JIHA 3D1MC 1FC2D 1RZIB 1JWUA 3DVNA 2WXGA 5CCJA 3L16A 4G1MA 5EA0H 1NC2B 4WHYG 5FA3A 2R69H 5D7KD 3WFDH 1WZKA 1AKJB 4ZO9A 4I4WB 1TQCB 4OIFA 5F7WC 2A2QT 2W9EL 1JYXA 4FXKB 2IBZX 4HIJA 4HKBA 3L95B 4ABVA 3OD3A 4JB9L 4N9GA 4PR5A 4NAQA 2OMYB 3FU5A 5LWYH 4NO2B 2Z8RA 4HIXH 4YDIL 4JG1H 1MCLA 1ULVA 2FT7A 2G0LA 4YN3A 1AGBA 4LOEA 3VWJA 1ZHNA 3FPXA 3OR6A 3NFSL 3B7SA 2UZPA 4ZMYA 5G4OA 4HIIA 3GIZH 3CVHB 3HUJA 3MBWB 4H5SB 3BZ5A 2BRRL 5F7KC 4IOSD 3K6OA 4M48H 4NHCH 1K72A 3S3PA 4H40A 1RZGA 2JFCA 3VD7A 2WW8A 3TXAA 4NCC2 2DQHL 5EIIA 3H9SD 5C0IA 4OV5B 4NO0A 3DRTB 3ZY7A 1WUNT 4CSPA 1S2EA 3NJGA 1OSEA 1XR8B 1JS4A 4FQQB 4PLKD 4UV7L 3WXVH 1DSWA 1BIIA 3GSVA 5E6RB 2IGFL 4RZCB 5I15L 4P04A 1P9MC 2R29L 4MDJB 3QFDA 5IGXL 4BZ2L 4PJGB 3TPUB 3RRQA 1BZ9A 4X7SL 4XVTH 1CFSB 2NSQA 1Y0LA 3GFUA 4PP2A 1FHNA 4JHBA 1I3UA 3CDFA 3PU7A 1TQUA 5IBUG 3GS0A 2V2XA 1CFTB 2YSSB 3MO1A 4X6EA 1NCDH 2QKIB 3CH8A 3CH1A 3QIBA 1OT4A 5FWQA 1A6VH 5IBTH 4JQIH 2A73B 1VZGA 2A83B 4UZGA 5SWSA 3DPBA 4TLUA 1WWBX 1YEWA 2W80C 2DYPB 1I3RB 1V7ML 4G9FD 4U1LA 4E9VA 4LCIL 4LCVA 4YGAB 4GYBA 2CDEA 3QZWA 1M7XA 4NO5A 3K0WA 5GSRA 5KJ4A 3VFMB 1WO2A 1B0GB 1PZ5A 1DBAH 3U4BL 4DN4H 5JDSA 4QOKE 1USQA 3JWOH 3EOTH 3OKNB 3P4NB 1FE8L 2Z31C 4Y2OA 3IBOA 3ZL1A 1WICA 3QORB 1N0XH 3KM2A 1S78D 3KPLB 2QSCH 4YDZA 2DF3A 4JQIA 1RULL 1AZBA 1U8LB 1EO5A 3NESA 3I6KA 3SE9H 2YUVA 3MXVL 5I6MA 3F2LA 1BVKA 5EC1A 4N85A 4G7YH 4EXKA 5C71A 1U8HB 3ESVF 1MIEL 4QRPE 2HJLA 3FF8A 4FYSA 2EDFA 3APFA 4YIQB 1WWWX 1SXZA 1XAUA 2AXGB 5DLMH 4WEMB 4ZNCD 4BFIB 4LFHD 4P4KD 4L4TB 4RX4A 1N64L 1UA6H 4Z78A 2XN0A 3GQFA 3DDFA 1UZ6E 4FNLH 2N0MA 3F64A 4ODTL 1FP5A 4XAWL 4KV5F 3MZTA 3PV7A 3ESPA 1TFHA 2D9CA 4HDIA 1AH1A 2VXVH 2A77L 2EDWA 5E1IA 3KXFB 1MXGA 4PJBB 5L2JB 5F7UA 1H3WM 2E8ZA 4PS4L 2GJ6E 2PABA 3MJ8B 1HHHA 1MRFL 3MJ7A 3RQ3A 1UOWA 3SE6A 4J6RL 3KL5A 2EILB 3E8UL 2CALA 1R5WA 3ZMRA 1V54B 1XWVA 2X87A 4EI5C 5KW9H 4IK6A 1I7ZB 4MCYA 3BWAB 5SWZD 4WSGA 2EVHA 3PAYA 2B1AH 2XXCB 3PWNB 1P4IL 1U93A 1J18A 2Y6TE 4D0CB 4XE5B 4Y16B 3UPRA 1VKXA 4F27A 2YD9A 4OH2A 2ZOKB 4AGQA 1LNUB 3JV0A 2QHRH 1OARL 2ADIB 2H2SC 2NNAA 1NOAA 2PXYB 2X70B 4OQTH 3MOQA 4MJIA 4XP6L 4NC1C 3K6IA 3MBED 3DSNB 1ZPUA 1DQKA 3LNEA 4AL8C 5KZCB 5ANME 5ELIA 3W37A 3KPMB 3TBBA 5L7XL 1BQHA 3I6GA 1SFHA 1XGUA 1KJVA 5FXCH 1M2OA 1U8QB 4ENEC 3EO1B 1AR1D 1CXLA 2XC8A 4LCUB 2HFFB 4F58H 2YQ3A 4NRZB 1RMFL 1OCRB 2CO6A 4KK5C 1PD6A 4HMEA 2WLZA 3C09C 3LNDA 4ZAKA 1BQUA 1NBCA 3EDEA 3TWCL 4ZW3A 4AVKA 5IMLB 4GPVA 2YD3A 3BH9B 5HHVH 2E4TA 3KYMA 2ILLA 4PWHA 4TSCL 1CIUA 4FTVB 4NCC1 5AVQB 4D7PA 5A6MA 5IFJB 1AS7A 3Q5OA 1BAGA 1FFPA 2JWYA 1XD0A 2DIAA 3L9RB 4PJFB 1IC5H 3BVTA 4X8JB 4XNQB 4KZEH 4NRXB 1YO4A 1E50A 3VXOA 2ZWSA 4KRPC 3KMDA 2DWTA 1KCRH 4BFEA 5JIIA 3AXIA 2YN3A 2FECL 2J6EL 2NNXA 3TA4D 1QHPA 4RVBA 1RIVL 4WCYH 3T2NH 4TV3A 1NA8A 5D5MF 3FPYA 3DETC 4NIYE 2Y1VA 1R17A 3MROB 4HHWA 2MCAA 5IKCA 1RUMH 1W72L 1ZV2A 2G9HA 5CLZA 3ZKNC 1T7YA 3U83A 1OB1A 3V2AR 2V9TA 4U31A 2XVBA 4D8PB 2YUXA 4B53A 4Z76A 2JJSA 4U05A 5I16A 1HSAA 2N7BA 3FQTB 2OW6A 4QGYA 5DZJA 4GH7B 4GKLA 3ZX1A 4B9FA 3I50H 2Y06H 3ZMNA 4F2EA 2VJ8A 5C2BL 1R9FA 3FCTA 4ZUWA 1Q94A 3QDMD 2WP3O 3PRZA 1P2CB 3U48A 4PQXA 3UTOA 5E4EB 2AI0L 4YSAA 3L81A 1YA5A 2UY6A 3NCYP 4JUTA 1FN4B 2QQNL 2V4LA 5TDPA 1XGTA 3U7AA 2HT4C 4MA3B 2NX5A 5EULV 4FD0A 1FL3A 4YH6A 4AYMC 4A6YB 1E4HA 3IJEA 3GMRB 4W9KC 2XWRA 2FT6A 2R56L 2YPVL 4HH8A 4IRSD 4WQOA 4K5NA 5HD8C 5DFAA 5E2WH 1YAIA 3FU9A 2ZXDA 4HC1L 5C09D 2ZX7A 1G7QA 3IJSA 4MA7L 3ZHFA 4XX5A 1HKFA 3ELQA 3SKNB 5K59E 4I7ZC 1JD9A 4UIMB 2CGYA 2ZCKH 4OZFA 4PJIB 4IS6B 4OUUB 3ZDXE 5JQIB 3C2AH 4NN7B 4ZSOA 5TF1H 2V2WA 1EXHA 4XBPA 4YL4A 4WNSA 4DHLA 5KUMA 2O72A 4P46D 3I3DA 3UBXG 1DQLH 4FZ8H 1KF9B 5IB1A 5KVMC 1JZIA 3HUJE 4M7JL 1QFPA 4ZW5A 5FW6A 1WT5C 3H0TA 5JR1H 5TH2A 4PU2A 4G8GA 4D7BA 4JY4A 1VGEL 3GS4A 1VIWA 4OI8A 4XXDA 2BVTA 4IRZL 2XA3A 4LF3B 3W2DL 4H8WC 3X1EA 1JGEA 1B0RB 3MX0A 2DYPD 2O5ZH 2WXPA 4IMLB 3D07A 5BQDA 1GTNA 4NBZB 4OZHA 5DJ8B 4UT9H 1DJGA 1ZY9A 2WBJC 1UWGH 2G5BB 3B2PA 3QDGA 3MGOA 2AEOA 3NMEA 9CGTA 3HE7C 3MOBL 4N20A 5J4MA 2ZOTA 1YPZB 2ED8A 1PY9A 3GMPA 3Q01A 3HRZA 3QORD 4M7KH 4MYPA 3MODH 2IAMA 2OLDA 5DWPA 2N7AA 1JPTH 1HKLH 4CMHC 3T65A 1H3GA 1T83A 3IFLL 2J1WA 1OCWL 2LQRA 2VNCA 5AAMA 1QPKA 3QR1A 2VAAB 3FQWB 2VLJE 2WUCL 4UT9A 4AE0A 4UT6L 4AYEC 1C5DA 4JZJC 5F0JB 4JPWL 4DP6X 3FN3A 1PCXA 4HMDA 3FU3A 5TFSL 5EEZA 3NEEA 1WAAF 3F7RA 5EU6A 2YWZA 1J0ZA 3ZDWA 5JQHC 4WFGD 1DSFH 2Z92A 4RZKA 5I1EL 3JWDC 5IMMB 3TT1H 2ZX5A 1QWNA 3QYCA 1QSFB 1MCWM 3O2WL 3VSUA 2NLJA 3SO3C 2GBUA 5GS0C 3NZSA 1N2RB 3OG4B 4KK6C 5FX3A 4X6BA 4BDVB 2J57A 1NBYA 2LLGA 4V2BA 3ULAB 3IFOA 4KITB 5TE6L 3O41A 3HTLX 2YK1H 4PBWD 3DX4A 5KVEE 4KTDH 1QVOB 3DRQA 5GRVL 1S7UA 5B7EA 4G59C 1YJDH 2BIHA 1UZ8A 4B9GA 3CDYA 3G5YB 1LO5A 1NEPA 3C5ZA 2JCCB 1J0KA 4CA4A 1XCQA 1J1PL 4QHUB 2X28A 4QHNB 2VQUA 1FZKB 4XXCA 3CXDL 4HZLA 1MWOA 1SHXA 4ZUUB 3TX4A 4LLAA 4PJEE 4RWHA 3GTTA 3SGEH 3VW3L 4XN7A 1ILSA 3HNSL 2EKSA 1U8CB 3TA3A 4NI6A 2WWOA 2OJEB 5BRZA 4N0YH 4P23C 2E3VA 2ZP8A 2RH0A 5EO9A 3AABA 4DERA 2E7LC 1EVTC 1TJMA 4KMTH 3MRJA 3W9EA 3PHQA 3RWEA 5D7JB 2R0WH 4ANUA 1MRCL 4QPEA 1KPRA 2CJUL 4KU1A 3K74B 3EADA 2RB8A 5BOJA 1FO0A 3D50A 1I31A 3ZE1B 1MCOL 3LRLA 4GS7B 4U6XB 2VSKB 5HYFA 1G1YA 3EFOB 2EABA 3SB3A 2ITCB 5C9KA 1JF1A 3N6YA 4GXUN 3SDDA 4F15C 1NIEA 4LU5L 5T33H 3FO9A 4I1NB 1SLWA 3HS0B 4QTFA 3UACA 4PLNC 3T1WA 4YHZL 1J0HA 2CBOA 3GINA 2OFQA 3UPCA 3FTWA 1RH8A 3HKFA 2IV8A 1F11A 4CN1A 3WTWA 3MGAA 3C8KA 4XP9H 4PV1C 4PMFA 4HWBL 4JFDE 1CGWA 3DC0A 3QEQD 4RSYA 4ELMF 1LP9A 5D71L 1ZJBA 4R0LB 4NPKA 5AD0B 4F24A 4AXWA 3FQNB 3ULUD 2P8MA 3ZUCA 5F8RC 4LKXB 4NKIL 3GLZA 4MJIE 2GCYA 3TV3H 3BYYA 5BXFA 2VXQL 3DMMA 4I77L 4PRAB 2J2ZB 1W8NA 2AEPL 2GTQA 2WQRA 3GKWL 3P02A 4EE2A 1CTNA 4NUJA 5JA8B 4KKLC 1RPKA 3SO5A 4AJWA 4PGJA 5DVPA 1IBGH 1LJMA 5GRWA 3RBSA 1GGBH 5D9SA 5I8KH 2Y5TB 3EYOA 4R96A 4WWKC 3W56A 4DESA 1ORQB 3TT3H 3AXLB 5BZZA 1DQDH 3JUZA 2E8YA 3EFDH 5HYIA 4RETB 3WEXB 3SN6N 1XSOA 1FVEA 1Q72L 2WBXA 4RMVA 2MSPA 4CKQA 1I1AC 2ENYA 2NZIA 3NN8B 5DK2A 4FQ1H 2NXZB 4YDLB 1YQ2A 5CGYD 3BOVA 2NUPB 4Z7NE 3V0JA 4TTDC 1CN4A 2X42A 3DX8A 5FUOL 3HC4L 3MUGB 2RBLA 1CFVH 5E03A 3VAEA 4KK9D 2R2EB 3GHEL 1RCYA 3DDGA 4M5ZH 3WS6A 2Q7YB 1B4LA 1ZA6B 3FN0H 3MYJA 2PYFB 2YA1A 4ZMVA 1TVBA 2FAUA 4WW2B 3UTSD 3ZTCC 3V6ZB 4MVBD 1B4RA 3PP3H 5E99L 1CG9B 4YSDA 2XIIA 5DGRA 4JFFA 2QR0B 2VDKL 2XWBB 1PZDA 3DXAE 4U1MB 5I24A 2P5ED 1VCBC 3A67H 3WBDA 4G42B 4WUUA 1ZPLA 3Q6GL 2P3YA 3D34A 5A2BA 3FOLA 1VGKB 3LKPB 3H3KA 4EN2A 2QADB 4IJTA 4Y88A 4LRNL 1XH1A 5IVNA 4YHML 2CLVB 2Y3AA 4Q89A 4YE4L 5B1JA 1FNFA 1XF2A 4NKOA 4JZOB 3BDBA 2WQAA 4GBXC 3EIFA 5CWSB 1P5UC 2A6DA 2ENSA 3MLZL 1BZEA 1VADA 3LPPA 4LSQL 1A1NB 1CI3M 2XXGA 4PJ7E 1FFNA 2AQTA 2WQVA 3JTBA 2F5BL 1SXAA 4X4XA 3TZVB 4OCWH 4PJAA 5GS1B 1IGYB 5IROA 5J9PA 1ZT1B 3MREA 1IQDA 3MNZB 3C8DA 1BW8A 3D4CA 5BZWB 4JKLA 3T0BA 5BQ7A 1Y18B 4NQXA 4B9PA 3AS2A 3IU3B 4C47A 1C7TA 4U2ZA 3UP6A 1NFIB 5I9QB 5IBLD 4JW3A 1OAXL 2BVQA 3A4DA 1LE9A 1F1GA 4OI7A 2ITDA 3BEVA 4N0RA 1T5KA 3Q9PA 4CMMB 5DHEA 1UACH 1JYVA 1XGYL 3V79C 1NEUA 1TEYA 1PYWB 2JELL 1O9VA 5HHNA 1WBXA 2WZ6A 2EEFA 4ZSOE 3F84A 4H0GA 1CURA 4RMQA 4QAWA 5DFWH 1HK6A 2Y0SA 4R6UA 2N4IA 2FRGP 2D7QA 3RWJA 3VB8A 2V5RA 3GMQA 3ESNA 3Q1SH 2CHNA 1HILB 2ZAGA 3HPJB 1YUKB 4G72B 1TR7A 4Q2ZA 3LQAH 4RFNB 5DQJA 1J1OH 2FO8A 4JN2A 4LZKA 3VI4A 3APCA 1KIPB 2O4EA 4PVNA 3M88A 1P0SE 4WKZB 5HDBB 3FFCB 2CD0A 1RLBA 4XB7A 2PWFA 3CZJA 3ARDD 1KB3A 1Q4NX 1U9KA 4YSTA 4PJDB 1BSIA 3GSRB 5EU3B 3UXFA 2HKHH 2HLFC 2A6JA 2VMFA 4TUOB 1R5IA 1ORSB 1QI5A 1RK0A 4Z3GA 4Q9RL 1EMTL 2CG9X 5KYYB 3K4ZA 3Q5YA 1X9RA 3CU1A 4LAQL 4W6YB 4MAUH 3II2A 4ES9A 5DQDH 1FAKT 4Q4EA 2YBRB 4Y2DB 4AIOA 3P9MA 1TIUA 1QSFD 4LHUA 3WS3B 1GS6X 1JCVA 4OF8A 4MD4A 1RZKH 3DBXA 3KE0A 5EU5A 1P7KB 1HE7A 4PWIA 3VFWB 5T1KA 3W81A 4FXLA 3HVDA 3HAEG 1VEPA 4ETYA 2FVNA 5L9DH 3KW7A 1OY3B 1YEGL 1M1XB 2DJMA 4YL9A 2BZ7A 3OKMB 5IMKB 2VMEA 3T4YB 3BP7B 3U9PH 1YC7A 2O93L 4XP5H 3IVKA 3U46B 3RPIA 2O6PA 4FG6C 2I9LA 5DA4A 3FHEA 3FB8B 3OF6A 3QFGA 1G7LA 1Q9LA 3EH4B 1A6AA 4GRLC 1X7QB 5EU6E 4RAUA 5CCKL 4XXWC 3WTYA 4OFVA 1MCDA 3FDWA 2AS5M 5DFVC 4F7CB 1AD9B 4FFVC 1KGIA 4CRPA 1FNAA 1MNNA 3TF7C 4WO4C 2DBJA 3MLSH 1VENA 3AREC 4B3EA 4NOFA 2H45A 4Z7VF 4Z95H 3HPLA 5E8PA 3ZKXB 3S35X 2GEQA 3G5XB 4RBPK 4P5TA 1KYOK 3TEWA 3QJHB 1T80A 2Q5BA 3DGDA 2DOCA 1J05A 5ENWA 1G6RB 1QI3A 5DMJB 3U6RB 2QDVA 3KH4A 2OXHB 1PZ2A 4S2SA 3HLAA 1BQLH 3CPLA 1R34A 3WKML 1R24A 2X0VA 3AMKA 3LIZL 5GGUB 3WTUA 2GC7C 1Z9OA 1PZ3A 1FG9C 1VACA 4JFXA 4HSAC 2QV2A 5C08A 5HHOE 2GSIA 2JV6A 4DCQB 4RMWA 2NY3C 1G87A 5BV7H 3ZIYA 3OL2A 4LVOC 3FU7A 3P40A 2EYTA 1YY8A 3OHMB 3PWPB 3OKOB 1FG2B 3E9UA 4FULA 3QC6X 2AQQA 3V4LA 2VLKA 1BDYA 3K8MA 1Q9OA 3ZE2F 4H2AA 1ZSDB 4NUGH 1W91A 4JN1H 4GAFB 4KHXH 4U6YA 3G9AB 1N7ML 4J1UA 2OTWA 4V2CB 4IJ3B 15C8H 2E9BA 1ED3A 1IFRA 1NINA 2IWEA 4JY5L 2R0LH 4K3JH 1IAMA 4ZPVA 2ATKA 2E7HA 2CNZA 4JRXA 1SJHA 1JK9B 3VG9C 4WV1B 3EGXA 4AKPA 2C1PA 2D3JA 4XCCH 1G94A 1WIOA 2NW2B 2FK9A 4IDJL 4Z7QE 1ZWIB 5GZNC 3TNMA 3MOAH 5H35A 3BRDA 1WVZA 2C9VA 1LP9E 2V9RA 2ZWZA 4JJHA 5LUMA 1BD2B 3LEVL 5CIPB 2B77A 2GFBB 4F7EB 5D1ZA 3OAYK 3O6FA 1Z9MA 1U8IA 3QPQD 5KYXB 5C0AA 5LO7A 2NXZD 1P53A 3QRGL 4E9YA 1C5BH 2XV0A 3MJ9A 4JO3H 4LPUA 4R7XA 5JNYA 3FT4A 2VXSL 1ID5I 2X89D 4P2YA 5AALA 3S36H 4HWUA 3HFML 2G75B 3EF4A 4FA6A 4MAZA 3HCVA 3GIVA 4Y4HB 1R0AL 1ZEAL 2WIIB 1DBJH 2B9BA 1XF1A 1JWMA 4GFTB 1MCNA 4JG0L 4NQEB 4GW4B 1T0NA 4RGOH 3AADB 1MFMA 3OWRA 3TIDB 1LD9A 2A0LD 3QZBA 3VSVA 1BM3L 1G7IB 2A74C 3UZEA 2PMZA 2ZX6A 2HH0H 4LIQL 3TN0A 5AOLA 3P0GB 1CE6A 5FYJE 3PF2A 3MNVB 2X9WA 5CLWA 1QYGH 4TL5A 2QADD 4APQB 1EGJL 1DO5A 4RMUA 5DR5L 4CVZB 5ESAB 3FK3A 4QNPE 2PN5A 2WGNB 2A9BA 2JLPA 4LPWA 3OAYH 1LEIB 4S1RL 4JMNA 2ZCLL 1KNOA 4AGLA 3MZGB 1KLGB 4KXZI 3AGVA 1KLUB 5F88B 5C3IA 4G7RB 1BQSA 4GMTL 2NY6C 3C8HA 2NY0C 2Z91B 4JFFE 2C3WA 1FAIH 5GRJL 1MCSA 4WUUE 1UOLA 1UQSA 1FNSH 3NTCH 4Z23A 2WJ5A 3OAZH 2CIKB 3VGAC 2KLSA 1MCEA 3V0VB 2BP8B 2R8SL 1CBVL 5DS8A 3RFZB 5A7EA 4UNUA 2VUYA 4NQDB 4QRSA 5DHYA 3VXNA 5FR3A 2EZ0D 1RLWA 5FGCB 1FL6A 1A4CA 2DY2A 3HHSB 1CE1H 4AQEB 5GPRA 3NRPA 1LO2H 4L8CA 1CF1A 4ETQB 1A3ZA 3MFGB 2PO6B 1YZZA 3CFKA 4I9WE 2Y2TA 2Z9TA 3GMOA 3UYPA 4CNIB 4ZFFA 1M7DB 1U8MB 1D3CA 4RDQG 2XX1A 4O02H 2YAMA 4KI5F 1CR9H 3QUXA 2P24A 1XB6A 1PBYA 4HJ0D 4WO0A 1Z9SB 2NUTA 4Q9BA 3TO4C 2CBQA 5FO8B 3CLWA 3DTUB 3OKYA 1A7RL 5LG6A 1YYMH 1IM3B 1MCBA 4MHHI 4N6RA 3PLYA 1BJMA 4WEBL 3BI9X 2WAHA 4MJ5A 1U8PB 1XGPB 2EC9U 2J6WA 5ACZA 4O02A 5BS0D 2HRPL 2FGZA 2BFVL 2QZQA 3VTMA 2B3IA 3PL6C 5KSBB 5MHSE 3GSWA 3EO0B 3AQDA 1KCWA 4JO2L 4JGNA 5CBEA 2J56A 4RRPG 1CLOL 1GJIA 4U1IA 3LS5H 1P6FA 3MCKA 5IQMA 3KYNA 3RURA 3TIEB 3OG6B 4NX0A 1BFTA 5JPMC 5HDOA 4G6AC 4JO1H 1NANH 3DTXB 3OZ9L 4ONHB 4NC2B 4N8UA 2O6CA 1NCWH 4EN3A 1D5IL 5D7HA 3QXTA 4XMTA 3FQUB 4G3YH 1EHAA 1T1XA 5CEZL 1E3XA 4A7GF 2NCEA 4U0QB 4X8CA 1SPDA 2RACA 3MRFA 3O81A 2XG5B 1OSPH 2FO4B 1TU2B 1GAFH 1T89C 5CEXB 2ADFL 2YPKA 1FC1A 4Y9BA 4ODXA 1UJ3A 3N50A 4L3AA 3B2VL 4UTAH 3VH8G 4JLRB 3FUMA 3CVDA 4AQAB 1M05B 4Q0XH 2LU5A 1MNUH 4GKZA 1YNTB 4M8UA 4PBVC 4MCZB 5HI5C 3ZDYB 3UTQB 5AVUB 3ILEA 1A9VA 3CQFA 2CO7A 3K2UL 3Q1EA 3VFRB 2DKSA 5HHXH 3UAAA 2Z4QB 3D8MA 2NY2C 1NFDF 4KK8D 3AM8C 1TO5A 3Q7JA 5E9DA 4GQ9H 4ODWA 3T4AB 1JZFA 3CFQA 3B8YA 5DCCA 4OLVH 3VFPB 3OLIA 3HE6A 4JFTA 5LAXA 3ZDZE 1E7UA 4UTAA 3PDOB 2ATPA 2EE9A 3HBQA 3VWJC 3KLSA 1S7XA 4EIBA 5GGRB 1NGPH 2R1XA 1PKOA 1F4YH 1H6TA 4M43H 4L48A 7FABL 3LQMA 3QEUB 4HS6A 3NSFA 4CUCA 3LXBA 4PRBA 4GRWF 5INCB 1H3TA 5C9JB 4PCTA 3F00A 4NLAA 5EWIH 4LASL 2HX7A 1DLHB 2VZOA 3Q5TA 4K94L 4U1JB 3I75A 5GGVL 2HX8A 1OHZA 3HS9A 2KMWA 4QHKI 1IGFH 1V8HA 3UL4A 2C9UA 1PY4A 3NIFE 4Y7MA 1EX0A 4P99A 1CQKA 3W57A 1WDAA 3GBEA 1U4FA 1T21A 2VRAA 3TBWA 2BOCA 4GG6F 4KJWC 1REIA 1NMAH 2X4UB 4ZMXA 1CGSH 5AG9A 2WBKA 3SDAA 2I60H 3G6DL 4G71B 4M8RA 3N85L 5B21A 5AUMB 1RVFL 1VFUA 5F89A 3MMEA 2F61A 5C08E 1XCWA 3ASWA 4F33A 3GLEA 3V0AC 1JHTB 3VFVB 3VRJB 3LRKA 1H19A 3QIBC 1BOGA 1OQXA 4PEEA 2FH6A 3T9WA 3D85D 3L7EA 1G1CA 1XF4B 4D0BA 3LXAA 3EGSB 2ESVB 1XCXA 4JPIA 4L5FH 4ODSH 3ULSA 3QARA 2X4NA 3BUTA 1JPST 5T5FH 1F86A 1ETZB 4MLSA 3A6OA 5AL8A 5DJ0B 3V10A 2P8LA 4OT1L 4DKDC 4E5XA 1TZGL 2DJ4A 5DJCB 5ECJE 1BF8A 1A4JA 2ADJA 2FT8A 4F8LA 3ZL4H 3L17A 3KPTA 3UADA 3U79A 3CN3A 2AW2A 2EAEA 3SD5A 1E2WA 4HFUL 4LCCA 2GC4C 2F7QA 1JHKL 4S0SD 3TTSA 3QZLA 4XPHL 4P07A 1EXUB 1HN1A 4ISVA 5T5FA 3HZMB 1FZOA 5DRNA 5K9JH 3ALPA 4O58L 4FYQA 2ARJQ 4K8RC 1NCCL 1OZUA 3TASA 5J6GB 1QNZL 4LEOB 2D03L 1J5OL 5EZIL 1MXDA 1MHPH 1CO1A 4OCRH 4LEEA 1KB5H 2FZ3B 4UM9B 2P8PB 3GK8H 5AOZA 3BRGC 4NT6A 2VL4A 2Z7UA 3CUPA 5DRXB 3MNDA 3C6SA 5C0BE 4DVBB 5JORB 2Y3NA 4Y9GA 5D5MA 1GZPB 3BVWA 3OSVA 2VDNH 3TCXA 3J27A 2D7NA 5D6DC 5D93C 4Z5RA 5JUEL 2H8PB 1MCHA 4UQBA 3U9UB 2OK0L 1P7QD 1OO2A 2A9NH 4Y4FC 3RPBA 1KB5A 4BFBD 4LCWD 5HYJB 1UOVA 5KTEL 3CDGA 3N1QC 4LEXL 4YR6B 1F18A 1KB9J 2F18A 4BWUA 5IWLA 1EFXD 3H4FA 4U2YA 1N4XL 3NH7L 4LRIC 1BXVA 1YYCA 2Z31B 1T2JA 3KWWB 3WIIL 4UNVA 3SDCC 2XBDA 4N90D 3DJ9A 3VE0A 1CFQB 3KWUA 5DC2A 4PVLA 2F53B 1F3DH 2PO6D 3IMUA 4NNPH 4QR7A 2HTKC 4OJFL 4APXA 5C3LD 4M8QA 1E6JH 1N59A 1O75A 3HG1B 4XMKH 1QA9B 3L3KB 3V0IA 2IFFL 2AGJL 4NJAH 4RNRB 2YC1B 2ALAA 2PWDA 3ARFA 1K8DA 3G6JA 4HBQA 3SKJH 5HY9A 5TE4L 1ZGLM 2DEYX 2CGRL 4LNRA 1UXWA 4WI8A 4LO9A 1P1ZB 4IRJA 2KYIA 4J7RA 1NC4B 2FX9H 2UY7A 3EZ8A 1EVUA 3RIFF 5C6TH 4JPVH 5CD5D 4R9HA 3AUVA 2HA1A 5HGHB 1BWMA 2DZEA 1TVHB 4PB0L 3VXRA 5F9JB 5E0FA 5I1GL 1NCTA 1JPFB 3HJEA 5CEYA 2YRBA 3SDXB 1B0WA 3MRKA 4BQ8A 3X1NA 4KO7A 4HUUA 3MUY1 5D96C 2OMVA 1E9PB 3GMLB 4P59H 5E95B 3V4UH 3VYOA 3C6LA 4EI5B 5A2JH 2CK0H 3AG4B 3DGGA 4BGDA 3ZZSA 4TTGA 3A23A 1AYRA 4PRIA 3TBVA 2XJKA 1C8QA 4MQTB 1KXVA 2WOBA 1KPVA 1WQVT 2WZPA 4ZMZA 2FX8H 3CHQA 3IF1A 4W81A 3ATDA 3FNKA 3WE6A 3QPXH 5I28A 3EJYD 4YOKA 1ZKAA 4XNAA 3II1A 5E1HB 1IL1B 2V7NA 1DBBH 1JGLL 2CHDA 1QLRA 3L5IA 1NDMA 5CILL 5INDB 3NCEB 2A9CA 3WCYA 3AY4C 1E9OA 1R3IH 3LPGA 2EH7L 3HOGA 1ROWA 1RZFL 2EXSA 2Q76B 4KZDL 2JMRA 1T0MB 5KBMA 2PYEA 4KZ0A 4AEHH 2HZHA 1DN0A 3EJUA 3KPRB 3MNWA 4GW5B 1KDJA 3DJRA 2RAMA 1RL1A 4XAKE 4Y1SA 2NTFB 2Y07L 4I2XB 1OPGL 3VXUB 5E2UH 3BPLC 1MN4A 5TDNA 5EEYA 1I8AA 3GSXB 3IWUA 3M1BB 4FFYH 4OR1A 5DEFB 4FMFA 4J3XA 5DJYA 2IH3B 1GYVA 5JW4N 2VXTL 1D6VL 1S9VB 3GMNA 4P06A 3TH2T 2XVGA 3C09B 5BVPL 3CLEL 1B2WH 1MWAL 1SJEB 4UDTA 3ZBMA 3DARA 5EN3A 1I7TA 5FWRA 1P1VA 3LN5A 3VXSA 5IEKB 1UXLA 3W0WB 2P5PA 1MHHB 1YEEH 3EH5B 3REVB 2ICES 5A43C 4KRPB 5I71C 1SGKA 4QRFA 4F2ME 4FFYA 4HHGA 1QBLL 2PW2A 1INQB 5AB2A 3K1KC 3KHOA 1KTLB 5E9DE 4HJJL 5EBLB 2FJHB 1VA9A 2BERA 2F54A 2XZQL 3Q43A 3FO1B 1D5ZA 2YQBA 3O6LH 3U0PA 3SYQA 3PGFL 1L3WA 2BNQD 4HPOL 4B50A 3RL1A 2H41A 3RGVD 3I9AA 5BVJA 4U1KA 2HJFA 5CFHA 4NYLB 2NT1A 3FSZA 5HVWA 3KYOB 1Q0EA 4HT1L 4KAQL 2DQIH 1TEGA 1WJ3A 4FL4C 5I23A 3NFSH 4KV5E 4XPAH 4JL2A 1MF2H 5I8OL 2YO3A 4HJTA 2ICWB 2E9JA 2CIIB 2VIRB 4OLWL 2B08A 2GUOA 2N0KA 5CLTA 5I19H 2NNFA 3WL9B 3LKSA 2XY2A 2XOTA 3GEWB 1U8OB 1VFBA 4FQXD 1ND0B 2WWKO 4NO3B 1KGCE 5I8EA 4Z8FH 1PZUB 5CMAB 1MJ8H 3J8F7 5EIIG 5AB9A 1A6TA 3LN4A 4YXKL 5KVDL 1VEOA 3IN2A 5G5DA 5I1JL 5IR1B 1WWAX 2OZ4L 2XN9A 3KL0A 1KEGH 2LT9A 3IWVA 5E5MA 5I15H 2H3NB 4G8GD 1JPGA 2ZUWA 3BDXA 3PG2A 4QYAA 4X5XB 3X2QB 1OAUH 4FKKA 1UCBH 2Y6SC 2V17L 1ZS8B 3MV8B 1A7PL 4R97C 2EVFA 1OM9A 1E8YA 1T83C 1U6AH 4HGMA 3CLFL 2XWTB 1HFUA 3BFWA 2QMJA 2ZNXA 3P9WB 5AAMC 1FHGA 5H8DA 4ELMA 4NZTH 3ML8A 4PY8I 1ZLVK 3FS9A 4OGYL 1COBA 2ZX9A 4EUPH 2F6AA 4LSSL 4NNYA 1M7IA 1OM3L 3VJ6B 2UWEB 1O5PA 4JMXA 4LBAA 4F57L 1KENL 5HYSA 1V7MH 1OGAB 2PPAA 2ZXQA 1E27A 1ZVSB 4MX7A 2W60A 1L7IH 1JTPA 3JWDL 3QZWG 3VACA 3V5HB 1EANA 4R3SB 5L8KB 1ZGLP 1IKOP 1HWWA 3L4ZA 3S8FB 4L5FE 4XVUD 3QA3A 3TNNA 1QTYT 2OQJB 1NMBL 25C8H 4QRQA 3LRMA 3P77B 3WUWA 4ORGA 3C5ZC 2ZSVA 1XGZA 2HAZA 2W0FB 3ATBA 4KUZH 4N2KA 2WLIA 3NJVA 5KYWB 1UA3A 1OEZW 1MIEH 1U3HA 2WZ5A 4XXCC 3VFGL 3OWEA 2QSVA 2V6HA 2WBJB 3EXLA 1MUJB 4FYTA 5IM7B 4XNYH 3BWUC 3HAEB 3HE7B 3TA3C 5HHQA 5KS9F 3MKGA 2FIKA 4N3UA 1OP3H 2X0WA 3Q6FB 2LE9A 1S7WB 4N8PA 3NPZB 1R19A 5D5ME 1YJDC 5GRUH 4CMHB 2ZUUA 2F53D 1E8XA 3NCFB 1NQBA 1HEZA 2EACA 3LSOA 4XAWH 3ZLQC 4ZFGH 5I18L 3HG1D 4YHPB 4C56B 5ACMA 5DS1A 3FRPA 5ID0A 2YN5A 5DGQA 3PY9A 4U4BA 1U42A 4QRUB 3T8VA 3O3EB 4JZJB 4K23L 2KC0A 1AE6H 3IJHA 5E08L 3BO8A 4X6DF 3SDDC 1MAKA 1I4FB 2MKWA 1ZT4A 2Z7ZA 2EDEA 3CN2A 3E6FA 3MQIA 4O9HH 5K1JA 5FECB 5L2KD 1MCPH 1QACA 3CK0H 3FTGA 3U4EA 1XEDA 4TVPD 2WWMC 3ULUL 1I85A 1D9KA 1ONQB 5CJ8A 2NXYD 5C0FB 5IK3A 1UH2A 4POUB 3AROA 3QS2A 1FF5A 4ALAC 3SO3B 3GSNB 3WIHL 4ADGA 2XBZA 1LTXA 1MW3A 1S4IA 3O2DL 1WC7B 4H88L 3ZR5A 4MD5A 4L1HA 3NSXA 1CDHA 2DTML 5KSAC 5I2IA 1GGTA 3EDKA 4KI1A 1EEZB 4PRHA 5AL0A 1UWEL 5B39B 1RUQH 3G5WA 4HETA 3MLWL 4KVPA 2IANE 4YDVB 3DMMC 4Z3FA 2ZONA 1CD8A 2OSYA 3D4ZA 1F4WH 3OPZH 4YDMA 2QQLL 1E2ZA 2UVFA 4ZO7A 3FCUB 3KL3A 1G7JB 5J3HC 3PE9A 1DQQB 1YMMA 1S5HB 4IOIB 2AKRB 4P23B 3C5SB 3AWFA 2CKNA 1QLEH 4ACPA 5DUMH 1FA4A 1N26A 4XBEH 1BQHG 3IXAA 3MGTA 4JVWA 2AEQL 3P9LA 3FKUS 5B8CA 1EA9C 1S7TB 1E28B 1JXKA 2H1PH 1MQKL 4PGCB 4PYHA 1HHJA 3BUQA 5GRXG 1WH0A 3DURB 1EDYA 5IMOA 4A04A 2O5YL 2I27N 3KPRD 4PG9B 5ISZE 4F15B 1BGXH 3O3AB 5D7SH 5F9OH 4PRIE 3ASNB 4F5CE 3WS6C 2EE3A 3BPNC 5DF0A 5LN4A 3VXUD 2X4PA 1HC1A 4K73A 3F7VB 4ZZKA 3QG6A 3B7YA 4BWWA 3FH5A 5AW9B 4WENB 2FO1A 5CD3A 1I3GL 5DVMA 1IAIM 1AI1H 4R2GD 4KK5D 5F93C 4Z7UF 2UZXB 2AJ3A 2QVMA 2VZTA 1BECA 2K9FB 4PAZA 4K9EC 4PJ5E 2VDQL 4JY6A 2XWEA 1W72H 4I89A 1HHIA 1LO3H 2X7LB 4PV9A 2J8UB 4DTGL 2DLFL 2E59A 2G60L 3W0WD 3VXMB 1FQ9C 4V1DE 3BN9D 3CZLA 1SEQH 1PVHA 1X4ZA 4KRPD 3RG1C 4EMZA 4Y9EA 1Q0YL 4EVNA 1HCFX 1LM8V 1XXFC 3QW9A 3ILQC 1YNKL 2OMZA 3IDJA