2BS71

Crystal structure of f17b-g in complex with chitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWSVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17BG LECTIN
publication title Impact of Natural Variation in Bacterial F17G Adhesins on Crystallization Behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 2bs7100
2BS8A 3FFOA 1O9WA 1O9ZA 1O9VA 3F6JA 4K0OA 1OIOA 2BS71 1ZK5A 1ZPLA 2BSCA 3F64A 2BSBA
chains in the Genus database with same CATH superfamily
3IETB 3WFDH 2VQ1B 4W9ZA 4P06A 5DD6B 3ABMB 2Y2WA 4IQHA 4X99B 2YKKA 2ZCKL 3JUZA 5EUOF 4UQDA 3K0WA 1U41A 3B37A 5CD5D 4M5YH 2XN9D 4UBDC 4AIZA 4A04A 1JHKL 1WDAA 4U6HA 4ZPTB 4ZTPH 1QSFE 3QDMB 3ZL4H 2J1XA 5L2JB 4NNXB 4XP9L 4MD0B 3PL6D 5DZNA 3GXDA 3ULVF 2W9EH 2ADIA 2OL3L 4Y16D 4QTHB 4DF9A 4QWWC 5D55A 2D7OA 4PJDB 3UOAB 3ZKND 1XT5A 3AFLA 1A9EA 2Y7MA 4J1UB 1E2WA 2EDRA 4IGBD 2GAZA 1HZHH 1OHZA 3OXSB 5DHYA 4UT6H 3WDHA 5TQ2H 4I18C 3T2PA 25C8L 3MRKA 1FFQA 2HTKD 3KJ6H 1R3IL 1Z2KA 1V10A 1EJ8A 5K39B 1C5BH 1RZFH 3L3JA 2AI0L 4XP1H 3IDJA 4Y4KA 3FCSB 4NPYB 4U2YA 4JGUA 3FT3B 4M6NL 3TGXA 4XZ4A 5HHPA 1KGCE 1I1YB 1DVXA 2GTZA 1MCWW 3DPBB 3NMEA 4X6CF 5IESL 2NUPB 5JXEC 4HX1A 3MRRA 1WE5A 3HVDA 5F8QC 3TWYA 4IRJD 4KHXH 3SN6N 2BVQB 2YFNA 2EIDA 5IVZB 3DYMA 3MRPB 1JK8B 3R7RA 1TLKA 4QGTA 4LNRA 1AXSB 4KXCA 3QQ4B 4YXLH 5F0LB 2YK1L 5CN3A 5IEHA 1FO0A 1S78D 2AJYL 1ANUA 1S7TB 2F7RA 1QZ1A 4WAFA 5E08L 3S8FB 2QQLH 4K3EH 2QSTA 2WJ7A 2WCPA 2IANE 3QEUB 4GT7A 4QRUA 5E1AB 5A43C 3UYOD 1WA0X 1UM6L 3DA0A 3QNXB 4OF7A 1C08B 4WDIA 4JY6B 3ZKXB 2WMPA 3U9UB 1UKTA 4J8RA 4BKTC 5TPWL 4JANB 3ZKSD 2P8PA 3TT1L 1MLBB 4NJ9L 2WXNA 4AQAB 4J3OG 3MV01 5H2BA 3CNKA 1A7OH 2FBJL 2K6YA 2RFXA 3ZKMC 3ABLB 2R0WL 2ZX8A 3QCUL 4OD1L 4C56A 4X4YB 1ED3B 4WJ5A 3BWZA 3TN0B 3LV3B 2VLJD 1AR1D 5EU7E 4I9WE 1CD9B 4OCRL 1N6QH 4ZG1A 1G6RL 3W9DA 5IBUB 2WVTA 4OGAC 3SDDD 3E9UA 3VFGL 4BFEA 1KLUB 5F0MB 4WWOA 1PVHA 3CFCH 1L5GA 1L0PA 5CCKL 5JOPE 2RQEA 2H32B 4HIQA 3V5KB 4I48A 3CK0L 4ZO7A 3MV7E 1W0WA 4F7EB 2XJLA 3JWDH 3ESOA 2CR6A 5DEGB 4MNGB 4P46B 4JQIL 5CLYA 1JS4A 4PJGF 5EU5A 3LH2L 4NB7A 3WTTA 3OWEA 1E6JH 4CADB 1LD9A 2NR6A 3UTOA 3EZJB 1N0LA 5KN5B 3EJYC 3W11D 3WKPA 1SLVA 1P5UA 3R8BB 2BSRB 3MRFB 3VI3E 3SE4C 3E80A 2X2JA 1XL4A 3VXRA 1J1OH 4KV5E 5ID0A 5IW6A 3FMGH 3TNMB 4XRCA 4BUHA 2JFCA 5ESVA 4PW4A 4XN8A 2AXHA 2VDNB 5IROD 3DV4B 4HMCA 5HYJB 5DO8A 3ZYJA 1F6LL 5E9DA 4DTGL 5J3HD 1BJ1H 1M71A 4FQIL 3H9HB 4HWBA 4XPAL 4PRBA 1FN4A 5FECA 2EEDA 3WY2A 4JO8A 1I8LC 4NZJA 4LMQE 1A47A 2MRYA 5B1JA 1BQ5A 4NUQA 4Z7UB 1QFHA 1PKOA 3JWOH 4RH4A 1IAIL 5FKAA 3GSNA 1X4ZA 3ZKQD 4GG8A 4XWGH 1TCRA 4AEIL 4LSSL 3ZTJG 1JZ4A 4RZCA 4WNSA 2VQ4A 3B3IA 4P9HL 1X3DA 3SOBL 1WIUA 2Y06L 2ENJA 2AJSL 2P52A 4O58L 4HP5A 3D4ZA 4BQBA 5JXAL 5ABAA 1AP2B 4PUBH 3MV8A 3ULUE 4AM0Q 4CRPA 2WXQA 3BPNB 3EDJA 1HL4A 4KI5F 5GJSL 4JN2A 3ZXAC 5B7FA 3GI9H 3GBEA 1LEGA 2X09A 5F7FA 3HZMB 4NHCL 4W93A 1H3UA 2L8AA 5ICYB 4IRZH 4KH2A 4WY7L 5C0JB 4W9IC 1K8DA 3MV7B 4OCYH 3X11A 4DW2H 1MVUA 4PJEA 3VGEA 4WF7A 4OZIA 1KPRB 1SYSB 3D1MC 4FG2A 4KJWC 1T83C 4LLWB 4LLDA 4JFZH 4H13C 4UT7H 2MCAA 5I2IA 4PS4H 4RGOL 4DPAX 5IWLA 2WGXA 2E74C 3BWUC 4N1HB 3FU0A 3GMOA 3RDTA 4TNWF 2CDGB 1FV1A 2OMZA 2YSTA 4NRYA 4DKFL 1KEGH 4W9CC 4AVIA 5JYLA 1UACL 3HR5B 4Z8FH 3FAWA 3B2UD 4X7SH 4IMKC 3VH8A 2XN9B 2HFTA 2AJZA 3CSYA 4GKZB 3NRQA 5D1QA 4JM2B 2WWOA 3BT0A 2NX5D 2GIMA 1TTFA 2OL3B 3KCWA 4O51B 5H94B 5KS9E 1CD8A 4GI6A 4Y5YB 3TV8A 4PY8I 2ENPA 2CNZA 2AGJL 3DGCR 1KIPB 4L1HA 2YRLA 4F91B 5BO1H 5F1OB 4JR9L 4LOFA 3PL6B 1KXVC 3QULB 3HRZC 4JL1A 1CXLA 5I75C 1N5YL 3ESPA 5SWQB 3DO3A 2CIIA 3SKMA 2PNDA 3QXAA 1DUZB 5ESQB 5IEKA 2GHZA 1FFNA 3WS6A 2YD2A 4JG5A 5I5IA 5KVGL 3OKOB 4IGBB 2JLLA 5DRZA 2Z0UA 4FZEH 4HJ0C 3RIFF 6PCYA 5J6HA 1JHTB 2VC2L 2F53A 2YD3A 4HKJB 2YAQA 1BDYA 5DK2A 1AHWA 2YUVA 3BIKB 2ARJB 4PB0H 3QSKB 4WI3A 3NZHL 5F7MC 3CDZB 1J87A 4KNSA 1L3NA 4PJ9C 4PCKA 4N0FA 4YWGH 3CFJB 4OGYH 1GXEA 2MH4A 4HUWB 3HC4H 5CSZB 4ZPVA 3U7AA 1R0AL 3JWNE 1KXTB 5F9JB 4FRWA 4GT0A 4AWJC 3M8OL 3GSWA 2FL5B 5FLVA 4P0DA 1F4XL 4YZFE 5ISZA 4BE6A 1CR9H 1RUPL 4IRJB 1IGJA 3G5XA 4MZIA 1FNSH 2F54D 2W1NA 4FKKA 4NWUH 4YSUA 1T4KB 3O2DH 3WMQA 4M6ML 5DEFA 4NO2A 1AYOA 3FUIA 2YIHA 5K69A 5IQLA 3AUWB 5BPPA 3KPLA 1EZUA 5AD0B 3L3IA 2LT9A 1P6WA 5FC9A 3C5XA 3NCXA 3GXPA 2OTPA 5DDHB 2CIKB 3Q0HA 3FO1A 4I4WA 5DQJA 1HEHC 3MCKA 4OM1L 2DWDA 5TTRA 1J0KA 2IO5A 3FN0H 1QBAA 4A55A 3C2SA 3U6XS 3L5XL 4NQDD 5L4JA 1O75A 5L0QC 3QEGL 1D5BA 2CMRL 1VDGA 2EZ0D 1KJ3L 3BQUD 4XC3L 3EFDL 1R24B 1G6RB 3TA4D 4ZMQA 4FNSA 4K9EL 3QZOA 5KS9B 1YNTA 3CPLB 3VDAA 1M7UA 2CA3A 2VXVH 3H6AA 4OW6A 2Q8BH 4Y5XC 2C9XA 2JJTA 2UY6B 2AABL 4HJSA 4I0KA 5IBLD 4LSVL 4BDVA 2NXYD 4TRPH 3WIHH 1Z5HA 4V1DE 1FFOB 3UPRA 5E4EC 5SWZE 4AMWA 4D9QD 4RMWA 3SDDB 3VGGA 1RK7A 4NFDA 1EEYA 3QJOA 3N40F 4G7VH 3ES6A 5DQDH 4L4VB 4U7KA 4RMUA 3L81A 1OCCB 3KGTA 4UM9D 3BQVA 2EDDA 4N2FA 1CICA 1MFUA 4N6RB 5ICXA 5A2CA 1KENL 3EOAA 1UOKA 1C16B 3PV6A 3QUYD 5KEZA 4PTUA 4OZFH 3BUPA 1BCIA 3LSOB 1C5DA 4BSWA 3TH2T 1X9UA 3OAWA 2CGYA 1RD6A 4F7CA 3TBCA 2GK2A 5IJDC 4L4TB 1T80A 2RCSH 1WBXA 3G9AB 3SYCA 4B97A 3BLBA 3SDXA 3X3GH 1CS6A 3EBGA 3ASNB 3GLAA 4JFFD 1HH9B 4UWQB 5M7QA 1H9DA 3DJRA 5KSBB 4JFWA 3A6BL 1J05A 4OLWH 1XCQB 2XQ0A 1S3KH 3BPLB 1E7UA 1CGXA 1I8AA 3U7YL 4PJAA 4DKEH 1GH7A 5B4MC 3AAZA 1NGYA 3LKNB 1OTUD 1PZCA 1RJYA 3KPTA 1IE4A 1WZ1H 2ADFL 2APWA 4APXA 3MROB 3RB5A 3AXHA 2Q5BA 5T8IA 4HS3B 3TASA 3HZKA 2ZOLA 5A2BA 3UX9B 2NQCA 3BVDB 1GS8A 4BWWA 1QYGL 1OLZA 4JPWL 1MXGA 5K9QI 1PFCA 5AB9A 2F8VA 5DZLA 3RWFB 2BS8A 2CALA 5EWIH 4EN3A 4LQ1A 1NMCB 4ISVA 3S96A 1GC1H 4F57H 2MHAB 2FJHB 3S5LB 2IBBA 4WI6A 4HC1A 3U30B 5ADPH 1CFTB 1S9VB 1SJVA 3GEFA 4XWOD 4P05A 3PRZA 2L7QA 4YDMA 5IR1B 3TBTA 3N50A 4PJFF 5BRZD 1JV5B 1GKOA 1AKJD 3GK8H 1TJHH 4I1PA 2WBXA 2YAEA 2F8IA 4Y9CA 5DHEA 4K8RH 4GSQA 4KDTA 3O6FB 5IMOB 2OTUB 3N2JA 4CVZA 3ARRA 3PAVA 3PDDA 2O1AA 1M7DA 2DD8H 2ED6A 4GRMA 1BFVL 1F18A 3T6VA 1G9NH 4DGYH 4FADA 3RTQA 3ZKXC 4CC0A 2FO1A 3I9IA 1PQZA 1X6LA 4KZ0A 3TBYA 4HCRL 3O3DA 4LPXA 3TXAA 5J12B 3OHMB 5TQ0H 3I9GL 1SY6H 3ARSA 1MJUL 3IPEA 2ZWKA 5CHNA 3J8F7 5I1EH 3KAAA 4MXWL 5EORL 1ZTXL 4C55A 2VYRE 1LK3H 2X4PA 1HHGA 1YLBB 3TN0C 4XVUC 4PHXA 3HUJB 4P5TD 2NX5B 1ETZA 3DV6B 3P4OB 4Y1AE 1T5XB 4LDEB 5DWUH 2OW7A 5L2KE 2H5UA 1MCIA 1U8LB 4F1ZA 1NCNA 4EUPB 5I0WA 2R1XA 1JYWA 4RWYL 4DAGL 2FT8A 5HPMA 2Q3AA 4P99A 2NMSA 1QKZH 4X4ZA 1FRGH 5EFIB 3T4AA 2R69L 1XEUA 3BEVA 4X9GA 3FL7A 3HZYB 4U1KA 5IMKA 2JKIS 5F6HI 1GJUA 3GINA 4RAUB 4R6UA 4M03A 3UYRL 4O5LH 3KLHC 2ZKMX 5D2NB 5IHZB 4P46C 1CFSA 3ZLQC 1HDMA 1U3HA 3POCA 2FIRT 2Z4QB 5EF0A 1H6UA 2D0FA 3H9SE 4LXFA 5LNGA 2BZCA 2EDOA 2Y3AA 4IKNA 4PJIF 2Q9OA 4LEXH 1NUGA 4EQ3A 3JSSA 3KDMA 2ZXWB 3NA9L 1YSOA 2ITDB 2V5SA 4UZUA 5TH2A 3RVVC 3BKML 1JGUH 2VMEA 4QRPA 2A9NH 3ZTCC 1DFXA 4YEEA 4BXSV 1BVZA 1YMMD 1OAYH 2G3MA 3V6OE 1M53A 4IOSA 2KMWA 5INDB 2GJRA 2HMID 1IKOP 2EEBA 1M1XB 4XBPB 3KPOA 4MGXA 3PNWB 1NIDA 1ULVA 2WCGA 4MLIA 4BGLA 3VCLA 4HPHA 2PXYD 2VDPL 3G6JB 4RGMB 1BAGA 3QQDA 3TP4A 5C08E 4CL7A 4MSWB 2DEXX 4FFTA 4RMBA 4H8PA 4PS8A 4B50A 2O6FA 5EZIH 1EHKB 1U8CB 1XGQA 2IDFA 4PP1C 4KRPB 4D3CH 3F5WA 2BRQA 3VA2C 5HGAB 5CLZA 4L2YA 4WLCA 3SO5A 3MCLH 5KJ7E 5EOTA 1TEGA 2AERT 2MTPA 2XXGA 2A6IB 4AK2A 1EPFA 1F1GA 3U0TA 2YHGA 4L5FH 1KIUA 4NRXA 5TE6L 1MPAL 3M88A 2R23A 2CHZA 4AIOA 3KYAA 1E6OH 1MIML 1RIVH 5HD8D 4KJYB 2HRHA 1KZYA 3LXBA 4LLQA 3IXAB 1IJ9A 5AZ2L 4XI5C 3KJ4B 4LLUA 5JZ7C 2ODHA 1A9BB 3BPNC 2NXYB 4Z76B 2J6EH 1Z5YD 1G7IB 4H25A 3FU6A 3E8UL 4YXKL 2DPKA 4DPBX 1NCIA 2ZX6A 4GO8A 3M1CA 4K7PL 3NJNA 5IVXF 1I9EA 2O4EA 4XMZA 4EZJA 1X5AA 5FYJH 5FR3A 1P9MA 4Z5RB 3HPJB 3VXSD 1HZKA 4LOUC 1CMOA 3QUYB 3B9KD 4JY5H 3TIDB 3LEYL 2C3XA 1WEJH 4CC1A 3GZQA 4XNXH 1FIGL 3H9SB 3CHXA 5CILL 2FD6H 1DE4B 1YDPA 3QWOA 5BVPL 1OQXA 4G9FA 2N7AA 5D1XA 1YN7A 4RNRB 5JHBA 3MLWL 5DZAA 5CD5C 4JFFB 4X6BB 1FVEA 1DJGA 1PEZA 1IC4H 5DVLA 3ZX1A 1BFOA 4JM2C 1DQJB 3K2UL 5K1VA 1F8TL 5GGQH 2YUZA 2V2WB 2B77A 4F9PC 3KLAB 3QDGA 5G2NA 3TOPA 4AJWA 4XPHH 2VIRA 3UAJD 3PL6C 4O2CA 4JM0A 1S7QB 1R5WA 1S7XB 3SGKC 4RMSA 1IB5A 1QACA 5T3ZE 1U8QA 4OLYL 1O6SB 3AM8A 3Q2VA 3RFZB 5JOEA 3ZKNC 1KV3A 5I1GH 5GRWA 3EYQD 4IGBC 4QEGA 3RJQB 3FU9A 3UEZA 1YYCA 1PGRB 4ZAKD 1PY9A 3MUUA 1EAJA 2QQNL 5AL0A 2HTKC 1KELL 3PXJA 4MJHA 3OJVC 1G7QA 3LKRB 3QI9A 5EIIB 3MRMB 3PPEA 3MV9E 4HV8A 1QMUA 1QUPA 1S7SA 4W1TA 4S1DD 4XNMA 2VW4A 2X4TB 4JRYD 3R06A 3F2LA 2BPBA 4G5ZH 4XCCH 5C09B 5F71A 1AANA 3QCTH 4CC4C 3KL5A 5FXCH 3WY1A 3GS4A 4F8OA 5GJTH 4W9EC 1YPZA 3DBXA 4YFLI 4JFHE 1TJGL 2B5IB 5JNYB 1NGZA 3QEQA 4NLAA 4IRJC 2PTTB 1AKJB 4FMVA 4PJ8A 1KB9J 1CDGA 1SXNA 1YEKL 2LFEA 1NDGB 5LKNA 4JRXA 5DVKA 2M83A 3B2VL 4XBGB 3V0IA 2CK0H 1KB5B 2ADGB 5E9AA 2DYSB 4L9LA 4M8QA 2F8XC 4AIEA 1M7IB 4EIGB 1LDPL 2I07B 3P3YA 3TJEL 5IB2A 5TE7L 2WZ0A 3WNOA 2HWZH 5MEQB 4YHZH 1UYWH 1ZT1A 1AY1L 3U6RA 1B4LA 2PWFA 2LE9A 4CILA 4Y5VA 3QFDB 1KSRA 4YDLB 4PRPA 5BQDA 2HVJA 1OLLA 4MS8D 2CHNA 4YFLF 5C0BA 2WLLB 5KYXA 3OHXA 4NCC1 4MD4A 3QS3A 2PTVA 3MRJB 1BYNA 2IG2H 3NCCB 2WB1A 4JPKH 1R3KA 2P24B 5FYLD 4P5TB 3NJLA 1DUYA 3SBRA 3BP7B 3TC9A 5CAYB 3SDDC 1DANU 2EVGA 3L9RB 3BH9B 1G1KA 4PG9B 1J9SA 2IDSA 3IDXH 2ZXDA 1GGTA 2QPUA 5FYLL 5BMFL 2B3RA 2AEIT 2ZOWA 2CJUH 4FHBD 4PGZA 3SYAA 3S48A 1NIFA 5IP4A 3CBJB 4RDQG 3C60A 1F4HA 2Y36L 3GRWL 1NPNA 2JCCE 4HEMA 4PRIA 4AL8C 4LVOB 4JZJB 4FQJL 3FUMA 4JO2L 4ZBJA 3VM7A 3LRLA 1LO2L 4BYHA 4ZNEE 5K9OB 5DTFB 5F6IB 5JPMA 3GGWA 1KCKA 4FMKA 3WFBL 1A6AB 3B83A 4HIHB 4Y2DD 1T03H 4WHCA 1UJ3A 3RUGA 5E6SB 5FO9B 1JP5A 3WKYA 2G4EA 2ZUXA 5TDOB 3BPLC 1T1WB 5JW4M 3QZNA 3W82A 3D12B 4KQ4L 4Y0GA 4XCYA 2UX6A 1DVZA 1I9JH 5IROC 4JE4B 1DQVA 2AJ3A 3LNEA 4MQXD 2XQBL 4GG6B 2CHWA 2PXYB 3MLYL 1KNOB 2Y69B 4H8WL 3MRCA 3OKNB 5HHOD 3SJVA 3PJSA 3CWGA 5KJ4A 2FRGP 1NEZG 1QWHA 4HUMB 1SDDB 4IU2A 5EZJA 1LWRA 4KZDL 3N85H 1AXTH 3I02B 1JWMB 1C1EH 1PZ3A 1QATA 3BVNA 2WXGA 4P9HC 4MA1B 5IJVA 3ARDA 3PXLA 1ZY9A 5LG1A 3M1BB 5B1BB 1S9XB 3NTCH 3QEHB 3RWEA 4G80B 3UTZA 1OO2A 3U30C 4D0CA 3ORJA 4H0GA 5I1HL 5FDYA 5BXFB 1B0RA 4KGLA 5I0DA 2HG5A 1IL1B 4APQB 1W80A 2P5EB 1UA6H 1XZ0B 1H6FA 4PEEA 1B3IA 2FJUB 3N0AA 5HYSB 1NDTA 5IQ9A 4IBLT 2OJEA 1RZKL 3LNHA 4GQRA 3V79C 5J1TC 3QJXA 3WMPA 1OT2A 5TDNA 3O6FC 4MDIA 2DOCA 1CK0L 4UDTA 3K4DA 2WWMD 2R15A 4I3SL 3DECA 1YUKB 4BFRA 1KTBA 2RIKA 5DRXA 4Q97A 5JUEH 2XPZA 5BCAA 3RBGA 2V2TA 2JCCB 5D7LD 2CD0A 1D7FA 5ITFB 3VXSB 4JJ5B 1GPOL 3OG4B 4ELKA 3K6FA 5J12C 3VGHA 3K81A 4DVBB 3WAJA 3VD3A 2UY7B 3OC5A 2XWEA 5JMRA 3GI8L 4D0DA 3B2UC 1L9RA 2Y2YA 5D7IE 5DZVA 3TEXA 1KBBA 3APDA 4Z7VB 1QPPA 1FCCA 1HSAB 4BZ2A 1UJTA 3ETBJ 4D0BA 1FNGA 1FAKT 1K4DA 2B39A 5E5MB 1PU0A 3RAJL 3QIBB 4CMMB 4EIBA 2YD9A 2I32A 2YC1A 4M48L 4ICWA 2VDOL 5DJCB 4J23A 1QSEA 2QVIA 4Y19E 1J5CA 4XXWC 1HHIB 2JJSA 4HXBH 15C8L 2F7IA 4WI0A 5HDWA 4B5EA 2DI8A 5CUSH 1SMDA 3MNMA 4XMXA 2HLAA 4MAZA 3EOTL 2GT9A 3O4OB 5D2NC 3S6CA 3L4XA 1JZDC 4N0CD 5AAWC 2AXFB 2YGNA 5KBLA 4WU5B 3OXRA 1T2XA 2HT3C 4FJYA 5HGDB 3W39B 2R0ZL 1CTMA 5AENA 2R39A 1BXAA 2WIIA 3UDWA 5DZOA 1ND0A 4KY1H 2EXSA 2XG5A 3BP5B 3SGJA 1Y0LA 2YBGA 5I66A 1A6UL 3MLUL 4I88A 4ALAL 1I1RA 3LTVA 4JCWA 1ZA3A 2ZPKL 4H8QA 3OTTA 3D9AH 1A1MA 3V52L 3IDIB 5CZRA 2QHRH 4HBCL 3JBG7 2R2EB 4JDTL 5E51A 5MEOB 1MKFA 1XCXA 3QNFA 5I5JA 5T1KB 5HVHB 1DQDL 5LBSH 1A7RH 1JZJA 2HJFB 4RGMC 1AC0A 5C3TA 3TZVA 4A1RA 1JERA 1V7NH 4PGBA 2GSGA 4WO4D 1LTXA 1LWJA 1L9MA 4FEIA 1THAA 2PYEE 1GIGH 2JIXA 3LZPA 3FB5A 4KRPC 3G6AA 4MB1A 5AQ0A 4ZXBA 4M1GL 1MELA 3IU3B 3D06A 4IBTA 1JJUA 2JKTM 3ECWA 2DB8A 4E68A 3UTPE 1DQML 1BD2A 3UZQA 3D0LB 1VCBC 1DR9A 5KYUA 1OARL 2JI1A 5DHDA 4ABWA 1DN2A 4G8FB 3V0VB 4WJG3 3IDNA 5I6KA 5D7EA 2UZYA 1VFBA 1E4KA 2Z7WA 3DTUB 4U0RB 1BYOA 4JVPA 2UZXB 2Y23A 4ZFGH 1FORH 3TNNA 2NXYC 3MOAL 5DJDB 4YQXL 1IC7L 1WJ3A 1NGQH 3DJTA 4PJDF 4Y4FD 3WNMA 4G6KL 3X1FA 2ZKXA 4NIYE 5K9JL 2KQNA 3O6ML 3BDBA 3OKEA 3VFWA 1VGEL 1H3GA 1OTTC 2OW6A 1P53A 4QNPE 2MKWA 4JM4H 4DP4X 4OCXH 4ETYA 2X42A 1R3HA 2D0GA 4G8GD 2GJ6E 3MV11 3QUYC 4G43A 5D1ZB 3QDJB 5JO5A 2ENYA 3DC0A 2EKSB 4XX1G 2OMYB 2RR3A 1NJ9A 5AKSA 1ORSA 4XN7A 2DLGA 5G55A 3UEQA 5CWSB 1I8IB 1FZOA 1SBSH 4F7TB 1F5WA 4NZUL 3ZRFC 2H32H 5EOQL 2DV6A 1EJ6A 4EBQH 4WNQB 4U1LA 1N6VA 4KITB 4L29B 4LRIA 4QXTB 4UM8B 1F45A 4YZWA 3P0GB 3ZHLA 3MOBL 4XH2A 1PAZA 5EPMA 3RFZC 5TE4L 4Q58C 5IMMA 3B9AA 3H2PA 3ZDYB 4HULB 1AQ8A 3WJJA 5HHOB 4BUQA 5C07D 4P3CL 3Q8CA 1YEIL 2F19L 4GMSH 4DUXA 1FZMB 5JW3H 3QZMA 3D2TA 2WWNA 4L8BA 4PJBB 2VABA 1EEZB 5E2JA 1E4XI 4DWHA 1I4FB 3T8XB 3UERA 1TVHB 4P4RA 1QBBA 3EYUL 4YSAA 2BOLA 5AWNL 4DGUA 2C1OA 1QVOB 1QPKA 1ROWA 3K2IA 7FABL 1T66D 4H8VA 4L23A 2VDNH 4K5PA 1U92B 1HOCA 4XWOC 2X7LA 4OZGE 3L3GA 5DT1L 2B7DT 1S2EA 3EJPA 1SVZA 2B5IC 4WKZA 1VEMA 1ZV9A 5B3JE 1M7XA 3JZ7A 3IE9A 2NQDA 1A1NB 4ZMNA 3DO7A 1TETL 2YQ3A 3EG9B 5F88B 3P3TA 3RKDD 3T3ME 1OZTG 3HBPA 5D8JH 4H26B 2UYLB 3MOQA 5F3BA 1TZAA 4U4IA 1S5HA 2CBPA 3CHPA 4U6XA 4S2SA 2HPTA 5KZCD 2VGLM 2HJLA 3A6CH 4CVWA 3LPFA 3LNDA 1QABA 4Y2OB 1IEAB 3STZA 5E6ID 2H6PB 1Q38A 2X89D 4A2HA 4MWFA 3L1FA 2EDQA 2QGBA 2L4OA 4YDIL 3PWNB 1ZHLA 1AG6A 2NY3B 5C0GA 3X14A 4F8TA 1FH2A 1OOWA 3GXTA 5FKPA 3UADA 3GMLB 4OTXL 4W6YB 5GZND 4YDLC 1WA1X 2YAHA 4XODA 1VFOA 3E6HA 1G0XA 1U8JB 2RTTA 3LEVL 1LE9B 1SXSA 4G1EA 1Q8MA 4TSCH 4V2BA 1HN1A 2WBKA 3FH7A 2VDOB 4HFWB 1FG2A 2FWUA 3EJRA 5A2AA 4P5TC 4EDXB 5KUMA 2BIPA 3WIFB 3UJTL 4LCWE 1J0JA 5AFAA 3BUYB 4Z3GA 4JFOB 2HZHA 3H54A 3BPOB 4XC1H 4F7MA 1T6WA 5I1IL 1G7HA 1J5HA 1G84A 4P3DB 2BVUA 3FO9A 3FPXA 5HI3D 3IDMA 1KLFA 2JB6A 2R27A 3C2AL 4KK5D 4X7EC 1LHZA 3REWA 2KC0A 4IMLA 1EXGA 4X7DC 1VFUA 4JFEE 4G7YH 1ZVNA 1RUKH 4JZJC 1NEPA 1NBYA 3GO1L 4DN4L 2HX7A 2A99A 2OL3H 3VQMA 3VRIB 5F6IC 1G7JB 3D69B 3VTMA 1J48A 1QQDB 2PP7A 3D33A 4U3HA 2OR9H 4Z95H 3DARA 5MENE 5A7BA 4WHTA 25C8H 4ZS7L 3SE3C 2VW7A 1PX3A 1FGNH 3A5VA 1JNJA 3ZY7A 4ELME 1CDHA 4F2MA 5IHWA 4MS6A 4FXLA 2XSKA 5CN2A 1BQRA 3QIWD 2JTYA 1M9WA 1PAMA 1IGMH 2K45A 3JYBA 4LMQI 5GZOA 2PXYC 1N19A 4M6NH 2Q7YB 5LN8A 3ARGD 3TA3A 2BSEA 4X8GA 4H88L 5IESH 4IS6B 4L3EE 2KZBA 3LPGA 5EOCL 4BRJA 3N40P 3N55A 3SPIA 5CEZE 1UXWB 4RMTA 1XFPA 3AMLA 3OQRA 4F92B 1FBIL 2IH1B 3B5GA 1MAKA 3P30L 1ODAA 4GRLB 4BH8A 2J2ZA 4MA1C 5FAAA 2I9TB 1KJVB 3BKYL 4P4KD 2XWTA 5DVMA 4POYA 3HHSA 2YK1H 2AJYH 2YPKB 2MCPL 4JKPH 1TCMA 4KV5F 3JTTB 1KLGB 4APQC 4OZHA 4JM2F 1UM6H 4EI6B 5C08A 4HS6A 4FXKB 3I6LD 2Q6WA 3Q6FA 4C4BA 4YEFA 1A4AA 1MSPA 4WFGD 5IBUG 3JVGA 1N26A 2M1KA 1G7MB 4PJHA 4KPHL 1UQSA 2HFGL 4NJ9H 4W9GC 2ZUTA 3MLXL 2P80D 4JFXA 1EJOH 3U83A 4JG1L 3C6SB 1SBBA 3IFPB 3L6FA 1SJHA 1AFVL 4PWJA 1C7TA 1PG7W 3QCUH 1RIHH 4OBRA 4CMHB 1ZTMA 2BCMA 4OFQA 1U0QA 2APFA 4WU7A 4B5ZA 1KEML 3LRSB 1D5MB 2DQCL 2XWBA 3GUFA 1BVKB 4G8GB 2GFBB 3PP4H 2Q8AL 4ORGA 3VXNB 3BZEA 2WYZA 1D5IH 3KPNB 1DSYA 3VFGH 3NPZB 1DBML 1NQBA 3GF8A 3DDFA 4R4BA 5EBLA 4G6FB 4IKKA 5CCKH 5KSAB 2BC4B 2HVKA 2G9HB 2W60A 5F7DA 4TLKA 4MYWB 1VKXB 3OQ3B 3MA7B 1R33A 4JPIA 3ULUF 3BIBX 3LX9A 2X10A 4JDZB 1OAUH 1AO7E 2IBGA 4K7FB 4WW2F 5DJ6B 5TGBA 3IK2A 4BA0A 4LSUL 3KLKA 1OT1A 4JQIH 3FF8A 4E0RA 3QIBC 4HGMA 1OM3L 4UTBH 1SN2A 3MA9L 5E8EA 1QLRA 2XKNA 3QUZD 4NQEA 2ZXAA 2KERA 4FQCL 4AL8H 5TD4A 3DWTA 1IM9B 3V4UH 1HC1A 1S9YB 4QHUA 3CFEA 2R4SL 5D5MB 3FTWA 4IU3A 1PDKB 3ROOA 1P7BA 4XOCA 4TSBH 5C07B 3EYQC 3O2DA 3Q3GA 3O4OC 4I1NB 4LSDA 4ZAKC 3VXUA 4N5ED 3V0GA 1ZHKB 4YLBA 1CFNA 4CW1B 4QRSA 1BXUA 4F8PA 3ZQWA 2P47B 4XN4A 4XPAH 4M43L 3CFQA 3UAAA 4UZGA 2AEPL 2YZ8A 5KS9F 1ZHBA 5D2LE 1P7QD 4LZKA 4XHQA 1XR9A 1VA9A 4WK2B 5EUKB 1MG3C 3AXLA 3DNKA 2V3EA 4I8DA 4MMZA 2DWSA 1ML0A 4R96A 3MJ7A 2EVIA 5DMIL 1AACA 4LO9A 4LSSH 1WZAA 5AALA 4GH7B 4DIXA 2ZSVA 5JPNB 4P9HH 5HVHC 5E4OA 5HGHA 1MAJA 4PGDB 3SOBH 2IPUG 3SODB 2Y06H 3W56A 1SM3L 3VFMA 4MX7A 5KZCB 2BM3A 3WIHA 5I24A 1X9LA 2XY1A 4AXWA 4U6YA 4XO3A 1KACB 5DI8B 3EJSA 5E6IB 2W07B 4XNQA 4CDGC 1SLUA 2C1PA 3CC5A 4AENB 4YHYB 3CVCA 4FQQA 3KVDD 4OGQC 5HTSA 3PGFH 4WY7H 4R90H 1JE6A 4OZFA 4YZFF 2FNBA 1URZA 4IBQA 3TBVB 2BNRD 1J1XL 1DDHA 4DZBB 1MHCB 2WGNB 4JO4L 2PCFA 4MS8C 1AO7B 4OKVA 5FK9A 3PFQA 5I26A 4HJIA 4U0RC 1CLOL 4OF3A 4RGOH 3APMA 1RZGA 1T5KA 2CLZB 2ITCA 3V0HA 1F00I 5AYTA 3Q05A 1U8PA 1QUNB 1P5VB 4EXKA 4X8JA 5K59F 3JV4B 5FCUH 4Z9KB 4HJJL 4M56A 4LASH 2YD7A 3MAWA 4NKOB 4RAVA 1BVNP 2E86A 2EDMA 4MQ7A 3HCVB 2GIXA 3QO0A 3M17B 4JHVA 3S3CB 1V3KA 3FTUA 3ZO0A 1OGAD 3MRNA 4AG4H 2BIIA 1JOIA 1OPOA 4G6AD 4P2RB 4R5VA 3D2UA 4E36A 1YEDB 1Y18A 3OJDA 3LVEA 3BISA 2WQRA 5FFOA 1FZJB 2C4FU 2VLMD 4HUXA 3DURA 3TIEB 4X9YA 2XTJD 3EYSL 1MY7A 5F7HA 5I6NA 1Z66A 3N1QC 1V5JA 1Q72H 3GSRB 2CPUA 3APNA 3F7LA 4I77H 4UIMB 1TIUA 3KHQA 4ENED 3S3PA 4EUPH 2ID5A 1LO0L 5KVGH 1B3JA 5E8OA 1BP3B 2FYYB 35C8H 4R7NB 3IJHA 3VXPA 4PFEA 2CR0A 4X5RA 1IBGH 3GSXB 1LILA 4R26L 3IN2A 4LKCA 2A83A 2KL6A 2W59A 1OAXL 1DJHA 3NZHH 2BO0A 3NJHA 4QMEA 3T0ED 3ECBB 1MEXL 3QIWB 1Z9MA 5FFGA 5BZWA 1R0AH 2P8MB 2EYTA 3O11A 4DO4A 2F7PA 3AREB 3M8OH 3AG1B 4J3WA 3ARGB 1LP9E 4JUTA 1F4XH 1F3DJ 3EDKA 5B1AB 2YOCA 5I1KL 3TYFA 4L1LA 4LK4A 2DBLL 3DRTB 1HCVA 3AB0B 4QDGA 2EXWD 4FHJA 3B34A 3F01A 2R2HB 4ZFFA 3DTDA 4P4KB 4M6MH 4ODVH 5KJRL 2YA1A 5IFHL 1EWHA 3HN3A 4JFPB 4NRZA 1OCWL 3APCA 1ZGLP 1S8DA 3MXWL 3BUIA 2ZCHL 1JPEA 2BW4A 3QIUA 4YGVB 1RZKC 3FF7A 2LU3A 3COOA 4GBXD 4PWHA 3FSOA 2V8MA 1PKQB 4X6DA 3T1FA 4OJFH 3TJPA 2YXWA 5JW5B 4PGEA 1NFDE 4QLRA 1OANA 1DDTA 1FNAA 2FT7A 4J7RA 5SX4I 3QEGH 2CMRH 2FEJA 5D1QD 1KJ3H 4XC3H 1I9IL 2DM2A 2OX5B 3ZO9A 5CBAB 4N2CA 4EKXA 2YUWA 1L7TL 3B6SB 1MWOA 4JKNA 3MRGA 4HZ1A 3W5MA 2AABH 2Q76B 4C83B 1MAML 5IK3A 1SOSA 2NY3C 1P7KA 4NQVA 4MCZB 1J8RA 4ODBD 1J8HD 1DQIA 2HB0A 3MBXL 2F53D 4NQQA 3P9MB 3QFJD 3LQAH 2J5LB 3P4NA 1J1PH 3HG1A 4Y2LA 3RIAF 1KENH 2BNQD 5MEPA 5T33L 3PJLA 4IHOB 1ZIAA 1GRWA 3KVQA 1EO8L 3EJZD 2UVFA 3E8VA 2A38A 2NW2A 3MI6A 4ODTL 1Z0NA 4Z7WE 4DQAA 1JBJA 1BGXL 2LV4A 3WHE0 1KGYE 1N3NB 5HHVL 1BX2A 1T0MB 3BPOC 3FU3A 3WKMH 5GGSB 4TVSa 5I0VA 3OMZA 3F7YB 3BJ91 4FQLL 3LOWA 1TYRA 1RJLA 1Y6KR 2C3GA 3DTXA 4ZSOA 2ZKHH 3MLZL 4I18A 4IW4C 3U7YH 2YAPA 5DJ8B 2UV3A 4QYOB 1E4WH 4N0CC 4OD3L 1KULA 4X5WA 2AEQL 3LQZB 3K6SB 5E8PB 1H3WM 1KPVB 4ALAC 1R19A 5FGCB 1CN4A 3ARFB 1EHNA 4KVCH 4GI8A 1ZLDA 2R9HD 3JTSB 4G42A 4NNYA 1E9OB 1P7QB 4JPWH 4AQ8C 5IV2A 3WU1A 4UNVA 1MWAH 2UWEA 3LXUX 4NDMA 2ARJQ 3AWGA 2VE6A 4P8QA 3GMPB 5CO1A 1CG9A 5KYYA 4F8NA 5K93A 2W9DL 2LR4A 3HNSL 3V5DA 1YY9D 2Z7UA 3UG3A 3K4ZA 3OLGA 3X1EA 4A68A 5EN2B 1HHKB 1NEZA 3QXUA 1A7BA 1MHEB 1I3UA 2VDLL 3Q8EA 1A3RH 3PHOA 1IGTA 1QRKA 1LQBC 3I9PA 2ATAA 3TWCH 3L95B 4DP7X 2EH7L 2VZ1A 4OLUL 1NBQA 1NCWL 2C7UA 3SDCD 1T0NA 1F97A 2J8UB 5FX3A 4TUJA 2COQA 3L5WA 4FNLL 2NDGA 3DK2A 4PREB 4S10A 3BWAA 3Q5OA 3KS0H 4ATTA 4UTAL 2BNRB 3W1ZA 4U1IB 2PLTA 5CJ5A 4FXKC 3L3KB 1XGYH 2DRUA 4NKIH 6PAZA 4O4YH 4PN6A 4NN5B 2RGSA 2VOTA 1KB5H 2ESVA 4OAWB 1NCGA 2EXTA 1AJ7H 1UZ6E 1D5XB 4HCRH 1UXSB 4KXZH 5SWSA 4OLZH 1MJUH 4Y4FC 1URIA 3TVMD 4WI9A 4KJQD 2KLTA 2X53A 4OH2A 2DH3A 5ITBL 5EC2A 1ZTXH 4CMHC 1YYML 4KXZI 5TDPB 4LCYA 4PR5A 3ZJAA 1IAKB 2WZAA 3PP3H 2V5TA 5J9PA 2HRPL 2XOTA 3RZCB 1OGAB 4FTVA 4JCMA 5CF3A 3MACL 2CUAA 3FSZA 5HVWA 1ONQA 4RWYH 1ZDSA 1OIOA 2WN3A 3KW8A 4WGVB 4JRLA 1VPOL 5KSAC 1FL3B 1JXJA 4LP8A 3AITA 2C9UA 3WXWH 5J56B 3SE4A 1I1FA 3RX8A 5B1CA 3WE6B 1UFUA 4JRWA 4UIKL 2AQ3A 2DMHA 3FFCA 4ONOA 5EV7A 4G7RB 3C8DA 1F86A 1HIML 3G5ZA 5FW6A 1B9ZA 1TVBB 4I2XB 2EDFA 1TZIA 2FX8H 2R51A 3T0EB 1JZ7A 1QBLL 1RURL 2YARA 5CZKA 1UA3A 4BE5A 1FFTB 3WTWA 1I8LA 2DJMA 4FFVD 4JLRB 4ZS6D 4ZMXA 4J6IA 2EH8H 5E99L 1BM7A 1U91A 1E5AA 2NY1D 3NESA 3ABGA 1IGYB 4UNTA 1GCFA 1NDMB 4HIEA 1IAOA 1RZJL 3NDZE 4LRNL 5ID1A 5F9AC 3VVWA 5JQ6H 5DD5L 2MNUA 5KVEE 3NSXA 3OKDB 2A6DB 4RGNE 4MNQE 5GGTL 1MHHA 3UC0H 4HF5H 3P0VL 4X4XB 5KVDL 1T66C 2HG0A 4FQ2L 2VLKD 4QRRB 2ICWB 4WEMB 1WV7T 1OALA 3EGXA 3MMEB 4CDHA 2GITA 1QFWH 4PHZA 1CE1L 4J6RL 4YHKL 1A22B 2IPKB 3F7VA 5JLZB 5JPNC 1NLDL 43C9A 2MSPA 4GQ9H 5DF0A 5TE6H 4BCYA 4ONGH 4L8DA 2D3LA 3GLDA 4NHUA 2EDYA 1EXUB 1QFWI 1MIMH 2P28B 3LRKA 3GUTA 4XNYL 3DYPA 2J88H 3OBAA 5F96L 5E6IC 3J27A 4XP6L 2AJXH 4Z18A 3KYOA 2Z65C 4POZC 3A4DA 3B7YA 4YXKH 4YHYC 3E8UH 1SJEA 5C7XL 1YUHB 3T77B 5I0ZA 2ILLA 1J8HB 1Y6MR 2A6KA 4IMKA 5D9SA 2JE8A 5A2KH 5J1SC 5EBMA 1FCGA 4HJGA 4B9ZA 2VL5B 1BREA 1E0OB 1ROCA 1MI5A 2CLRB 2EXYD 2IH3B 2BNQB 3BX7C 4H2AA 3VFOB 5IVNA 3FRPB 1NGWB 2LU7A 3WEMA 5JHDA 2JNZA 2YD5A 4PGCB 3EGSA 4QHMA 4GG6F 1FIGH 2JCWA 5FPIA 1KXVA 5CCHE 3QXWA 1F56A 3HRZA 4QRPD 3FONA 4PRHD 1XBRA 1UZ8B 5DR5H 1MW1A 3IB4A 2R2CA 4LCUB 4P07A 2NYYD 2AV7B 3NUKA 2CKNA 3LKPB 3FQYA 3K2UH 1AS7A 2PCPB 5HI3C 3ZYZA 1SEBA 4HWZB 4LIQL 5DSCB 1QASA 1UWEL 2J20A 3N9GL 4KK5C 3RA7L 3VG0H 4ZW5A 5AW8B 1Z9PA 2BS71 5EIIG 4PJ9A 4WRLA 5BJTB 1MFCL 4MHHI 1NCCL 1NIBA 1TFPA 4L3CA 3P0YL 1T7ZA 1RXLA 2ZKWA 3GMRA 5DJ2B 3V9CA 3NFSL 3EW3B 3RIFK 2QQNH 3IGAA 1CZ8L 4AC4A 1BF8A 4Q6YA 1KELH 3S37L 2ZOKA 4QRBA 2VMFA 4PLOB 5FM4A 3ECQA 1ZHNA 2G3ZA 3WFCH 3HMWL 2E3VA 2NNAA 2Z35A 2ZJSH 3AMKA 3RWHA 3QIWC 4AEEA 3OPZL 4OFIA 1IO4C 4GNKB 2FR4A 3AREC 3WUZA 3ARGC 3BFWA 3EBIA 3ZE1B 5J4MA 3IPFA 4FD0A 2JCCF 4HISA 5FYKD 1JRHL 1XGZA 3FCGA 1IBZA 1AG0A 2CO2A 3AB0C 3SQBB 3TURA 5CMAA 2F58H 4CN6A 3K7UA 3WFZA 4P4KC 3BSZH 2AZUA 4EOWH 2FX9L 3A47A 1D6EB 4WTXA 3SDCB 3WTUA 3FUJA 5FYKL 1Z9SA 4A7TA 1FL5A 1XL6A 2O6EA 1T21B 3WD5L 1YQVL 3RNKB 2Z91A 5FGBC 3VD5A 3RP1A 3VFVB 3VAEA 1JL8A 3WHE1 1LDPH 4Y5XA 3WEOA 3B9VA 1XGUA 4A6YB 5EIQA 3PWLA 3LHPL 2NOYA 2SEBA 1GVIA 2E9IA 1CC3A 3NABL 1EV2E 5JR1H 1I7ZB 1U42A 1A7QH 2VDQL 2CO6B 3D7PA 4QT5A 2XYCA 3TVMB 5HJ3B 4JG0L 1A6WH 4GI9A 1AGBA 1DLHB 1SGKA 3IF1B 3CZSA 4W9FC 3OAYH 4XP4L 4QCIB 1XF5B 3VWKD 3O9WB 3T77A 3CZLA 1KIRA 5KSUB 3CXDH 3IETA 2VQ1A 5DD6A 1CDJA 3BYYA 3OKYA 2G5UA 2DN7A 3C12A 2C26A 4LL9A 1EGJA 3FN3A 3I75B 4HK3N 5L4FA 5DO2D 4Q9RL 3JQOB 1C5CH 3CFUA 4RX4D 2J5LC 3V0WL 4HWEL 3CC1A 3QDMA 4UB0L 4W9KC 5I1JH 1NGPH 2MQ3A 3O2VL 2WIMA 2Y36H 3GRWH 4LSPL 1NUFA 2FTAA 3NIDE 5D96B 5I6PA 1F90L 1BSIA 1ZK5A 3U1QA 12E8L 3C8KA 4LGRB 4FQJH 4RQQB 2BSDA 5EO0B 1LO2H 1OGTB 4QTHA 4NFBA 3QUZC 1K8IB 4PJDA 3ABKB 2HVBA 4M02A 3FT9A 4XPBH 4J1UA 1AYRA 3MUGA 4M9OA 1ZWIB 1HWWA 3OXSA 4LEBA 2AK4A 1JDDA 4DP8X 4ZOEA 5D1ZI 1TXKA 5FM5O 1K4CB 4FXTA 4TVPE 3FXIC 3FUEA 5K39A 3IE4A 2VAAB 4N5EC 1MOEA 1HXMB 4ZUVA 2P48B 5JIKA 5JHLL 3AADB 3PQYD 3FCSA 1H3XA 3M46A 2IGFL 3KYNB 3L9EA 4XN9A 4NPYA 3MUY1 1QI5A 3PWUB 3C9NB 3UJIL 3RNQB 3MLYH 3FT3A 5D7IF 4B0MM 3ARFC 1I1YA 3DPBA 4J39A 1IEBB 4KZDH 4BZ1H 3WJLC 2QELA 2UZPA 1OQOA 5HYSG 3P9LB 1P1VA 5A3IC 2HFEB 1BA9A 2IIJA 4MBOA 4N25A 2BVQA 5DMGD 5IVZA 1BJ1J 3MRPA 1JK8A 3V9EA 1AXSA 5B39B 2N59A 4RMQA 2Z1KA 1CF8L 1WICA 1HYRC 1S7TA 3Q5YA 2Q3XA 3V0DA 1H8NA 3QEUA 5E1AA 3V8CA 4KKCD 4QXWA 5CM1A 1WAAE 2WV3A 2YKLL 3QNXA 1EUTA 1C08A 3Q1EA 4JHWL 1P2CB 4JY6A 3U9UA 1PD1A 2WZ6A 4JANA 4EXPX 4GQQA 4FYTA 1MLBA 3RL2A 5CR1A 2VO5A 3T6ZA 3MRQA 4AYGA 5I5MA 4AQAA 5LGKA 1HEJC 1CGSH 2FEDD 3CD4A 1CK0H 3TV3H 1M6OA 3E38A 2YGOA 3C60D 4PRID 2XPGB 1QR1B 5A7EA 1XR8B 4X4YA 1ED3A 4ICXA 4UT9L 3L08A 2VCOA 3TN0A 1AS6A 2CRMA 2XKSA 3NIDB 3X13B 4NN5C 4L1DA 4JKWA 1YNKL 1LJMA 4N90E 4LCIH 4ZD3L 4CVXB 2E9JA 1KLUA 4CBPA 3FTYA 1OWWA 4BFGA 4NO5A 3ZDYF 3AT0A 1B0WA 1E90A 2H32A 1A8ZA 2XBDA 4PRHB 5DJZB 3V5KA 3QUML 1SDYA 4YHLL 5CN1A 1EAPB 2FX7H 1YMME 3FT4B 1KOAA 5DEGA 1XF1A 4MNGA 1LDSA 1U8IB 4P46A 4NUGH 3RZCC 3IBOA 4M1DL 1M3JA 3NJJA 3CSGA 1XSKA 4NQUA 3RAJH 1TJIH 4JO1L 3U2IA 3K72B 4G6AC 2IPTH 4M48H 3TTYA 3LJ3A 5KVFE 4QOKD 1X5LA 5KN5A 4DKDC 15C8H 4LEEA 3GJFB 2NUTB 5DA0B 4C4KT 5BZDB 4LHUB 3MRFA 4ENEC 1JV2B 3CSFA 3VWJD 5D93B 1I7TB 3U2SB 2VM3A 2YXFA 3EOTH 1EZSA 2QSCH 4YDNA 1Q9KB 1HQRB 3VD0A 3TNMA 2X2IA 2X0WA 2F74B 4LKXA 1JGEB 5C0CD 2B15A 3DV4A 5HYJA 2IADB 2BHUA 3NYKA 3T0EC 4L0YA 1KTDB 4QNPF 2XWJB 3KLQA 1E3FA 1HE8A 3R4DA 2R0ZH 1Q9OB 4E41E 4OF0A 3I6GB 5FGRA 2QKSA 1BJ8A 1A6UH 2F18A 4Z7UA 1RJZB 2JWYA 3BVUA 3MLUH 2A1WH 1NMAL 5CJBA 4ALAH 3F6LA 4MAUL 5FUOH 1KGWA 4ECNA 1GOHA 1B4TA 4YGAB 3ABZA 2EXWC 2C9PA 3V4PL 3V52H 1CGWA 2E0PA 5I8OL 2WP3T 4N2AA 4HBCH 3RVXC 1SPDA 4X98B 5D7SL 3TCLB 2DAVA 2ZD0A 4PCYA 2Y7NA 2PWEA 1J10A 3JUYA 4EO5A 3HG3A 3BAJA 4ILDA 5GHWL 1J5IA 2ICCA 4OCSL 1EHLL 1OAJA 2LVEA 1KCRH 3VFTB 1AP2A 4TXVB 2VDQB 1G87A 4KFZC 3KMDA 1DQMH 4JKLA 1XD1A 3VFNB 2P5WD 5GS1B 1OARH 5LQBL 3RPKA 5ICYA 5C0JA 2F1AA 2K3HA 2XWDA 5C0AB 3N06B 3FT0A 4FP8H 4ODHL 4YSPA 3QXDB 1KBKA 3GXNA 5DUPH 1SYSA 4LLWA 5CSGA 3O3EB 4ZUTB 4LLVB 3SDAD 1WT5C 5CINL 1TZGL 4LPUA 3QPKA 4L3AA 3RWDB 3BD4A 3MOAH 3VWKB 1ID2A 2NQ3A 1IC7H 1OTSD 2CDGA 5I82A 4TULH 3ECUA 3HR5A 4OZGF 5GISL 5GRVL 5KBKA 5K9JH 4ES9A 3O6MH 4W6WB 3E6FA 1VGEH 3HVNA 1PZSA 1OSYA 2XN9A 5B3JF 1H6EA 4GKZA 2B9BA 1G7LA 3SPCA 4HK3J 4JM2A 5H94A 4FQXD 2OL3A 5HY9B 3T3MF 1CB4A 4P2YA 4F9PA 3H56A 1HK6A 3CVIL 4OIIL 1KIPA 1L9QA 2C4FT 3IPBA 3RWCA 4MBRA 3PL6A 1XH3B 5I8EB 3QULA 3U7WL 3KBPA 2AITA 3SGKA 3SGDI 1IFGA 3MJ9H 4NO3B 3S35L 3V0AC 2R1WB 5SWQA 5T3XH 1DUZA 2E27H 5ESQA 1N4XH 3FQUB 1QFOA 3FTGB 1CQKA 3OKOA 4IGBA 3L3OB 1T1ZB 2E7MA 1JHTA 4HKJA 3ULVD 1JVKA 3VGFA 3L5JA 3BIKA 1U8KA 1RHHB 2ARJA 4YVNA 3CDZA 1Z0MA 5J13B 1DLFL 1OB1B 1XVSA 1SVBA 2IFFL 1Q94A 2JIXD 3CFJA 3PQYB 3V7AE 4HUWA 5CSZA 5EZPA 3ULVL 1KXTA 2ZWYA 4FLQA 5F9JA 4CC4A 3BH8A 1GYVA 2FL5A 2Y1YA 5D71L 5ACLA 4HU8A 1FZKB 1YEIH 2F19H 2R0KL 5DGRA 3D0AA 4PJ7E 5ABDE 1FLRL 1G43A 2XNAB 2D2CC 4GLRH 4IRJA 2JKWA 3KR3H 1T4KA 4QJ4B 2ALWA 2OMVA 2XV3A 4DPCX 4L37B 4U1MA 2AZAA 1JVLA 5AD0A 5DD1H 1YY9C 1I7RB 7FABH 1QHQA 1HEZB 1SRDA 5T5NG 3IAGC 1XCTB 4YDJB 4XAKD 4DJMA 1YECL 1K3ZA 1WQVT 4HIPA 5DDHA 1ZD6A 2CIKA 5A6LA 1AE6L 5FYLE 1P4LB 3WFDL 4G8AC 4LFHD 4Y9BA 1D6VH 3VXME 1UFGA 3NP4A 3U2JA 2VWEC 2NNCA 3QBTB 2QVKA 5IUCA 3EDDA 3SDCC 3CFDB 4PJXE 1S3RA 1VEPA 5MHSD 4MQTB 4Q2ZA 1G6RA 3MLTB 4ELMF 3SBQA 2YD6A 2YAFA 3CPLA 4UV7H 4WUKH 4HGWB 2XRAL 5AYQA 2UY6A 2H2SD 2VLJA 2YBRB 3IWVA 4Z77B 4KKBD 3FTSA 4NPJA 2B16A 1FFOA 1W16A 1P4UA 1JG9A 2E5EA 3QUMB 4YDIH 3DRQB 3SDDA 2AXGB 3QW9A 4ZFZB 2EIKB 4PG2C 4OFDA 4L4VA 4OTXH 4UT6L 5DK0B 3TVMC 1U58A 4P2CG 4FI7A 1RU9L 1WISA 4KJQC 4JQIA 1N5AB 1D2PA 2XVBA 4HJ1A 2XICA 4N1CA 4N6RA 3TBWB 4BQ9A 3LEVH 1I82A 1RZFL 1C16A 4GRWE 4XP1L 4YBQC 1RV6X 4KAQL 4CJ1A 3LSOA 4DP2X 1JZGA 1X5JA 2LHAA 3O9WC 4CKQA 3UJTH 1LYQA 1OD9A 4L4TA 4LLMB 5F7EH 2X3CA 2Y9RT 4OSUL 5E4AA 43CAB 5I1IH 1KDJA 3QJHB 4XPTL 1HH9A 5KSBA 4C4UA 4KHXL 1YO4A 3MO1B 1ASQA 3SE6A 1XCQA 3CSTA 3VWJB 3C2AH 5C2BH 3KPQA 2FUQA 4YXLL 5J11B 3BZ4B 1T2QL 3FULA 5D96C 3B2XA 4JL2A 5D72H 3GO1H 2QQLL 2YR3A 3D0VB 2WM0A 5IROA 3PDOB 3MROA 2OMTB 2X9ZA 5DS1A 4KNQA 1FL6B 1H5BB 1AGEB 4HS3A 4NQCE 2IFGA 4P5KA 1HNFA 4B9FA 3HE6D 4FFVC 4ZS6C 1P69B 3V4PB 1BQHB 4BK5C 3VRLE 4GW1A 3RWFA 4XVTL 1W72B 4WSJA 1OAQH 1CDUA 5DHVH 2MHAA 1A7OL 4PYGA 1QLEH 2BSTB 2FJHA 3OGCB 5A2JH 3M1OA 4MCNA 2YEVB 4IBZA 1H8OA 1CFTA 3WN6A 1S9VA 4OM0L 5I16B 3EOYG 5I1AA 1O6TA 3QUGA 1V3JA 4H88H 4AZ8A 2VH5H 2FWSA 3IAQA 2BY1A 3W0WE 1AXIB 1OCRB 2DQTH 1DJZA 5IW3A 1JXFA 2VO8A 2X1XR 3Q48A 1FBIH 1JV5A 2NSMA 2WJ5A 3P30H 4PLJD 1Q0XH 4PP2B 1ZVYA 2E7LC 3MGTB 4AYBA 3CFCL 1V8HA 4CNIB 2EABA 1HCYA 4OT1H 2OCCB 2YAMA 3O6FA 5IMOA 2IVFC 2OTUA 1DQLH 2P5WB 4Y4HD 1AC6A 1RL1A 1YEJH 3FBKA 4KKLD 4U31A 2APXA 2WSDA 2VR9A 4D9RD 4IIZA 2VZVA 4KI5D 2ZE0A 1ILUA 3SDAB 3KW7A 1H0DB 4LCCB 1E6JL 3D25B 3WDIA 2JKRM 2Y7QB 4NZ8A 5JOFB 2HFGH 3BKJH 1JIBA 2A0LD 3MLXH 4X50A 4BSVB 4P2AA 4FG6D 3IS1X 2WQXA 1UOLA 3K6NA 2K70A 1EDQA 3N44B 4JPQA 4P59L 1AFVH 1MLCB 3FMGL 2K78A 4QF1B 5FW8A 3HUJA 2DQCH 2NX5A 4JPSA 2Q8AH 3DV6A 3P4OA 1T5XA 4UV4H 5AB1A 1U8LA 3EAKA 1MW2A 2OP4H 4R2GD 5IHBA 5EUOB 3I6KB 3NJMA 4XXWA 1RZ7H 4R9HA 2EICA 3PF2A 3JWOL 3HZYA 4IBUA 5F89B 4PJ5E 5H37H 2NYYC 3BW9B 3IS0X 4RAUA 5GRYA 3S7GA 2IMNA 3N41B 2EADA 2MPAL 5D2NA 1MXDA 4LSUH 3K1DA 5AAWA 4GW5B 2ZONA 3INUH 1OM3H 2AAAA 3MRBB 1SHXA 5D4HA 1DEEB 2HRLA 2Z4QA 4GUQA 3BDYH 4FQCH 2C34A 2XY2A 3FSAA 4YDVB 2E9GA 3GBLA 5D4QA 3T6XA 2ITDA 1E9QB 2QZ5A 1BXXA 1ACYL 1X7QB 3KL3A 5D93C 4ZMWA 1VJSA 2K3TA 1IBDA 2FAUA 3HIZA 3ILEA 3GI9L 5INDA 3AW5A 1X7SA 1IE5A 4MRCA 1BJMA 2GYSA 1M1XA 4XBPA 3PNWA 2F54A 4IRZL 4NGHH 3G5YB 4NXSA 5C92A 1IZKA 4JFDB 2OMWB 3HZVB 4DW2L 3MFGB 3IJ8A 4KQ0A 2CGZA 4M43H 3G6JA 1EO5A 4X6CB 2AEPH 3HMXH 1QTYT 3SPGA 4A37A 2HLFD 1UCBH 4JFZL 3EJQA 4MSWA 4UT7L 3GMQB 4YJZL 1VZHA 4Z7OE 1U8CA 3TONA 1WG3A 2QJDA 4GINA 4HIXH 3NEXA 3L3HB 2ZUYA 8FABB 5HGAA 3MR9B 4NP4L 3NFNB 1ZLWH 4WTWA 4AV0A 1T89C 1ZV2A 3CJJA 3MX0B 4NQDA 4LEOB 3G08B 4X7SL 1N68A 3ZHKA 2A6IA 2CO1A 1A9VA 4FNQA 4X80L 4OV5B 2D7MA 4I7ZC 5F21B 3UGEA 2NY6D 4XE5B 1DJIA 3EH2A 1U95A 3HG0A 4KJYA 5E8NB 3IGLA 3WIAA 1R34A 1T5WB 3IXAA 1X5FA 2I5YH 1M2OA 2RMNA 2DEWX 3D39E 1IC0A 4Z76A 2B1HL 2D7PA 5EH1A 1G7IA 4G71B 4BD4A 4HK0B 7TAAA 1JPFB 5GS1C 1JZEA 2X6MA 1LP9F 1WUZA 3TO4D 3PFUA 5EU3B 2E6QA 4FZEL 5GSVB 3U0WH 2FO4A 1LEIB 2ZKYA 4AK1A 4PJ5B 1W8EA 4QHNB 3F04A 3ZE2E 2JELH 4Z5RA 3HPJA 1YEHH 5BUGA 1H9VA 1CLOH 3QUYA 2CCVA 4YWGL 2V3DA 3TIDA 1NKGA 3VWKC 3HC4L 3NIFE 5JA9A 1DE4A 2JK5A 3HS9A 4DOHB 2ATPB 5CLWA 2OZ4H 4HJJH 1U93A 3U4KA 2NCEA 4RNRA 5HGBB 2DZEA 3FPYA 4FHKA 2UXFA 2Z6FA 2FVNA 4JFFA 1CR9L 2DIEA 5DO2C 1NFDF 4I9XA 4XMUA 5DK3A 2R29H 2VRAA 2Z9TA 3O2DL 4PJGB 2DLHA 2V2WA 3KLAA 4W9HC 2AANA 4JAMB 5DD3H 1S7QA 4ZQKA 4Q7DA 2F1BA 3KPRD 3EYSH 3LN5A 1O6SA 1RUML 4P2QB 3RFZA 1UD6A 2OSYA 5CEYB 1INEH 2ZXQA 3FN0L 1BG1A 3MRDA 3L3OC 3DKHA 2PW1B 2VLRB 1OSEA 4P57B 3TF7C 3FCTB 3D3VD 3LKOB 4L1TA 3ULSB 1OCOB 4R26H 5EBWA 2OSLB 1MCJA 1U3ZA 3LKRA 1C9SA 5LNDA 5EIIA 2XX1A 3MRMA 4OU3A 3NDYE 1IBYA 2X4TA 1MEXH 4XGZB 4HMEA 4BFOA 5C09A 4BKLB 4ZW3A 4B27A 4MCYB 4DVRH 2JV6A 4ZMOA 2VXVL 4J3TA 5BRPA 5E24E 2Q8BL 4JDEA 4CSSA 1K6QL 3PUCA 3IFNL 4TRPL 5JNYA 5DZJA 2K1MA 2G3XA 5BRZA 4Z7WF 2DBLH 3B5HA 3DMMB 3SQOL 2W0FB 3D39B 5L6YL 1WITA 2PTTA 3VD4A 1AKJA 1U8NB 1WWAX 2XV6B 4G7VL 2EJ1A 3VDCA 5KJRH 3STBA 5IFHH 1NDGA 3AY4A 5EO1B 1G9EA 4KWUA 4UYPA 3P4LA 1OCWH 4XBGA 2ZCHH 1FYHB 2FNWA 4Y4HB 5E9NA 3HE7D 4KKCC 3AWFA 2ADGA 4HCRA 1ET5A 4CJ0A 4U6TA 1A5FH 5ELIA 1M7IA 1P6FA 3EJCA 2I07A 2RCSL 1KIQB 3DX1A 3G3LA 1AQDB 4RA0C 2HYMA 5MEQA 3X3GL 5BQ7B 3DUUB 1E2VA 5HJBA 3TU6A 3A24A 4HEPG 2D4FA 5H37G 4BFNA 3QGVA 2RBLA 4LSQH 4OLWL 4ZFOL 1I9IH 2JF1A 1S3KL 2FEDC 3QFDA 4YDKH 1IBHA 3T9WA 2WLLA 1L7TH 3D2UD 4G3YL 5I8CA 3C5SB 4GSXA 3MRJA 1KPUB 3KGRA 1WZ1L 4P5TA 5FO7B 3P73B 3GMMB 1MAMH 3BP7A 1S46A 1A21A 4UDUB 1FH5H 3L9RA 1X5IA 1MRFH 4WFFE 3T3PE 1OAZL 2C4XA 4R2GB 4TLTA 1RIUH 1XXDC 2GTWB 3VX0A 4AV4A 2WYIA 4RRPA 5EWIL 5T33H 3J2PA 1ZA6A 2QMJA 4X42A 3F84A 4EIUA 3CN4A 5IB4B 5ADPL 2PPDA 3F58L 1LWHA 1RUAL 4RLDA 4JZJA 1BGXH 4URKA 5K9OA 5HHVH 2WOBA 4Q14A 3KPSD 1FNEB 2PPAA 1O9VA 4K8RD 4OUUB 4OV6F 1U2YA 1G7PA 4HIHA 1U21A 3GK8L 5BRQA 4HLZH 4M3KB 5TDOA 4LDLB 1JPTL 1T1WA 3SE3A 3VWJC 4F5CA 4P23D 3ZTEA 4K8RL 5GGVH 1QOKA 2IMMA 3NT0A 4OD3H 3RTLA 1FVCB 2KLSA 1RZQA 2AEQH 1T2JA 5F72S 1CLCA 1MJ7H 2XZZA 5CJXC 4GG6A 3G04B 2PXYA 1DTUA 2DD8L 1KNOA 2N7SA 3CSPA 3OKNA 5KVEH 4QHKJ 1WA2X 2BZDA 1SDDA 4MZRA 1UADC 2LGNA 2JKNA 3GPEA 4OJYA 3WJMB 1JWMA 1OP9A 5TQ0L 1SY6L 4BHUA 5M95B 4HJTA 1WFMA 4X5LA 4XN5A 5GRZA 3M1BA 2W9DH 1S9XA 4UQ3B 3QEHA 1OM9A 4R7VA 1KT2A 3HNSH 3OR7B 3UZVB 1XSOA 5I1EL 4LDCA 2IPUK 3PYCA 4DNLA 2JQAA 5BXFA 2O30A 1LK3L 5GGVY 2A4ZA 3WGUB 1LO3H 4B60A 1MG2C 1IL1A 1S7WB 2NY6B 2VJXA 3PG2A 1MUJB 4GSUA 1TUPA 2P5EA 4XMKL 5DWUL 3DJZA 1XZ0A 5HYSA 3TPUB 4E9QA 1HI6B 4X9BA 3CQPA 3V9FA 2EH7H 4MLSA 4DFIA 4HALA 4OLUH 4B9KC 3C08H 1QKZL 1FRGL 1GMIA 1PIFA 5C97A 5HJGA 4EI5B 4GAYB 2K7PA 4G6ML 4ONFH 3ARUA 1UD2A 1V3MA 3GBNH 4UTAH 3IEAA 5IB1A 3ARXA 4GIOA 4IDJL 3DX6B 2G75B 2OS7A 3VXOB 3SDAC 2Y7SA 4QWWD 3VXSA 4LCCC 4JJ5A 1NUDA 4PRDB 5ITFA 2ZG2A 3T2LA 3BGMB 4LEXL 4DVBA 3H53A 1OTSC 2UY7A 2CDFB 4RWHA 4A6YH 3VNZA 4XTRD 5ANMB 3L48A 1OAYL 1QO3B 1BOYA 1KWGA 4EE2A 2EDBA 1E65A 5DUBB 4BXVA 4Z7VA 3MBED 4IJTA 1M56B 5BOPA 2EUZA 4MB3A 4FQXC 2C3WA 4WJKB 2TAAA 5E5MA 4HUVB 4EAEA 1BIIA 3QIBA 3MACH 2NY0B 3L4VA 4WUUD 3RX7A 3CSBA 5JXED 5DJCA 5IFJB 1NC4D 4KRLB 2CBTA 2LLGA 2BOBB 1HHIA 5EZIL 3NK3A 2ZWZA 1MFAH 3KPRB 4LPYA 3G7TA 4D3CL 5I5RA 5CNHA 4IEFA 3DLQR 1TZOA 3MCLL 4UIKH 3BUDA 1DJYA 4KROB 3OB8A 4ZAKA 2YLHA 3D3VB 3V10A 2JI2A 3ULVC 5FFLA 2AXFA 4YHNB 4M4RA 4C56E 1HHJA 3QG7H 4A7SA 3GT6A 3OD3A 4WU5A 3TF4A 1WBZB 2VITB 4JRYA 5HGDA 3W39A 1SLWA 1PSKH 2FQDA 3VFRA 3J7HA 4OZ4B 1CL7I 3ZMRA 1FYTD 3QHTC 4I1RA 3BP5A 4OFYA 4R4NC 5E99H 2VXTL 3ZR6A 3PIQB 1A9EB 2J6EL 2QQQA 2P43B 4IHBA 5DHYB 2P5PA 2Z0BA 3ZKMD 4AKOA 2ERJB 3IDIA 5E6RB 3RWIA 2W0PA 2NCMA 5DD5H 2R2EA 3GPSA 5MEOA 3PY9A 3P4MB 5GRJL 2HJFA 1LM8V 3I3DA 3KXFB 1UM5H 1NIEA 5KVDH 1E28B 2ESVD 3PWPD 3TT3L 2DQIH 3BI9X 4JY5L 4TUOB 1Q9LB 3MQIA 3VGAB 3FHAA 3IU3A 1T22B 3NIGE 2FD6L 3LS4H 4ZFOB 1JF6A 1JTTA 4BFBD 3UH8A 4TNVK 4J6RH 3VXRE 2EIMB 1QLFB 2B1AH 5BS0D 3D0LA 1NLDH 2F61A 1BF2A 5A16A 1UUSA 3L5IA 4G8FA 3V0VA 1F2QA 4N8UA 4R5XA 2VERA 1JYXA 4L0ZA 1FO0B 2FBRA 3I2CH 5GGQL 2H1PH 5E9DE 1JPGA 3QUHA 2OMBA 4AKPA 1EDHA 3R1GH 4XPHL 4YAQB 4KGJA 3UAFA 5F96H 2X1QA 2UZXA 3VTTA 3FRPG 4QI3A 4KKBC 4FN0A 3EJYD 5DJDA 5J6SA 2XTJE 1IU1A 2GW5A 4HLZG 1F13A 4MNHB 4J8RB 3LZFL 4UU9B 1PS3A 1GYCA 3GRWA 4FG4A 1I8MA 2YPLD 1WFIA 3NZSA 5H2BB 4NAJA 3W37A 1OOAA 3UTSD 3L4ZA 1SF3A 3FAXA 1KN2L 2WTRB 3QDJA 1OZUA 2EKSA 4XCCL 4FNRA 2D73A 5DS2A 5CKAA 1Y7VA 2OMYA 4YLCA 3KPSB 3MV8E 4H7VA 4NZDA 1FP5A 3PS6A 3VB9A 3WV0A 2DLEA 1ZT7B 3GSOA 2PN5A 1CCZA 4UQAA 3UO1L 1I8IA 5HSFA 4F7TA 3NRFA 1U4EA 4LIQH 3P40A 1UWEH 3DSFL 3N9GH 3RA7H 4OZIE 3T0WA 4PJEE 1JZ2A 1XCWA 4TVPH 2DKMA 4FCHA 4L29A 2CK0L 4PJIB 4QXTA 3LAFA 4BZ1A 1BM3L 4BEIA 2W92A 1IFHH 4UQ2B 5EU5B 5HHOA 4XMPH 1PNDA 1LD9B 1FZMA 4YHIB 3P9WB 4M3JA 3MFFB 2WXMA 2HWZL 1OGSA 2LVCA 4YHZL 1M9SA 1S7RB 1EHXA 4G9DB 5JIDA 4PJBA 3S37H 4AQOA 4HA1A 4BH7A 1EEZA 4PLKC 1I4FA 4L2LA 5ANHA 3VXRB 3T8XA 1TVHA 5D1QE 4AQEA 2WN2A 4EN2A 1VFMA 1QVOA 2ZX5A 4HIIB 2WXJA 1YJDH 1U92A 3N43F 4HJUA 5E9DB 1MIEL 1M71B 3VI4A 3NIDF 5FLUA 2YXVA 3DMMC 5H4YA 1A1NA 4H0IA 5AW2B 1UT1A 4PLJC 3O4LD 2XZQL 3EG9A 4N5UA 5F88A 4F37F 3IDXL 2P9RA 2Q2EB 2UYLA 1ZXQA 2FX9H 2F53E 2CJUL 1TCRB 3PWVA 4KHTL 4Y4HC 2AS5M 2DI7A 1YQVH 3WD5H 4RZCB 4MB4A 4Y2OA 1IEAA 3B3IB 2OFQA 4KKLC 3KPPB 2XIBA 3LRHA 1UH2A 2H6PA 3UFIA 4KI5C 4M7ZC 1XF4B 3WKNA 5D7LA 4J2XA 1YRKA 4S1RH 3LHPH 3UIZA 2RH0A 2OPCA 3S34H 1QRND 4K3JL 5ISZE 1T03L 2A0LC 3MV8B 4FF9A 4HW6A 5IVXB 4HJ0D 2VDQH 3GMLA 1LE5B 2DIBA 3FZUD 2ZOTA 3QAZB 4JN2B 1KBPA 2PMZA 4JG0H 1U8JA 3PREA 1KGUA 4GAJH 2DQHL 4JFYB 2NTFA 2G9KA 4KTDH 4XVOA 1LE9A 2N1KA 4PJ9D 4I0PD 4MASA 2AXJA 4Q4IA 4A7GA 2CSPA 3MBEB 3QH3B 1MVUB 4HFWA 2QSVA 4XP4H 4EDXA 4YFEA 4OZIB 1ZS8B 2VNCA 4KVPA 2X6BA 4GQPH 5TF1H 3QZWB 1KCUH 4X9IA 3JWOC 4C57C 4JFOA 4WUUB 3UG5A 4R2GC 3EYFB 4OKDA 1NC4B 1WAAF 3N85L 3RDTB 4H1LB 1NAKH 1FV1B 2W9LA 4Q9RH 1C1EL 4P3DA 3QXVA 3V0WH 2X40A 1NM9A 1QI4A 4ZMYA 4UB0H 3RIAK 4MB5A 2EC8A 3ZQ9A 4LAJH 2X6AA 3NTCL 1FJ1B 4LSPH 3CMGA 3VH8B 1KWKA 1CTNA 4YSOA 4MVBC 1R46A 3X1GA 2I27N 3I50L 3AROA 1WH0A 5EZOH 1QQDA 1UA6L 2H47C 2FGZA 4OIAA 4N1EA 1FYTB 2B1OA 2CBOA 3A4EA 4TMPA 3HJEA 4Z0BH 1E50A 3JT2A 1K85A 4DEWA 5DRZB 5HDBE 4Z7IA 5B39G 1G5GA 1KTCA 2IGFH 5J6HB 4LP5A 3SKUD 1CXHA 4MAYD 3RGVD 2IQAB 3CZUB 5JUEL 2Q7YA 4L8SA 4V11A 2H0PA 2L7UA 4KO5A 4JN1H 5C8JA 4IS6A 4N0FB 1U8MB 3JV5A 3PHQA 5HHME 2HLFC 5AW9B 5JIQA 2DS4A 4GO9A 3QZPA 4EZKA 1X5MA 5EU6D 2IH1A 3SDXE 1I8KB 5AKRA 4LL4A 4K9JA 2I9TA 1KJVA 4FC3E 1D7DA 3U9WA 1RP9A 2PO6D 4PJAE 1IGJB 2YPKA 1B90A 1UGNA 3QUKB 4MXQC 1MRDL 4ABVA 1K5NB 4QRAA 3TEUA 4ANXA 5BS0B 3C5JB 5FUCC 2HXAA 2OR7A 2DQUH 1KLGA 2IAAC 2NY6C 1MCPH 4EI6A 1TO4A 3FB6B 3L3IB 4FXKA 2K6ZA 1T1YB 2NLJB 4JHWH 2CXKA 1E5YA 1Q1JL 2X9WA 1W2KT 3JV6B 4H0LC 4O02L 4PY7A 1G7MA 1WHPA 3ZYIA 5JA8B 5D7KE 4HXBL 2XG4B 5G4OA 4Y4FA 1XB8A 2VN5A 4ABQA 4M6OH 3C6SA 3TO4C 1DP0A 3IFPA 4E9VA 3KBEA 4KNUA 4M61B 2Z7YA 5I71B 1D5BB 3RHWF 1IUZA 3UP6A 1BVKA 4G8GA 3HC0A 3LDBB 3BSGA 3UTSB 3VXNA 3T1WA 1YNTB 3KPNA 3GHBL 1AIFA 4RSYA 4ZD3H 3B2DC 2R4RH 4KMQA 4TV3A 1AMYA 4BDVB 1K5WA 4ONHA 2E6PA 3UPRB 5IQOA 4XMWA 2BC4A 2JQZA 3QUMH 4FDWA 4YHLH 1H3PH 4FJZA 2XETA 5CBEB 1VKXA 3N1FC 4JDZA 3D9AL 4WHDA 5DJ6A 3SB3A 2AEOA 5ICXB 3WS3B 1C7SA 3PV6B 5LBSL 2NY0C 1A7RL 3SKNA 4PTUB 1XSIA 4JJOA 5KYWB 3IRPX 5KBMA 3S2CA 4WHYH 3UBXI 2EO7A 4AGLA 1KCWA 1IM9A 5HHMB 1WD9A 3ETTA 3ARBD 1WBXB 5D5MA 3P2TA 4XXDB 1PDKA 5C07A 1IKFL 3DXAD 1YVLA 2Q7AA 4ODXA 3ZL2A 1SUHA 4NCDA 3T04D 3CZJA 3AS0A 2Y24A 4XZUA 1J05B 3CX5K 3Q9QA 1SXAA 3GHEL 3VTAA 4CW1A 2W8CA 1LK2A 1XGTA 2HN7B 1I3VA 1IM3B 3GJEB 1KXQA 3ZQXA 3WNKA 3S97C 4PB9L 4YC2B 4UZSA 4N0UB 4L05A 5DQ9B 2BRRH 2CG9X 2R0LL 4HVBA 3N42B 3HPLB 4N0YL 3HZKB 1NGQL 1N7MH 6CGTA 1DN0B 1LMIA 2RA1A 2D03H 4XB7A 3V4PH 1P4BL 3TFKC 5I8OH 2ERJC 1CVSC 3O4LB 9CGTA 1I7UB 1TG8A 1UM4L 2YUXA 1HESA 5JPNA 1W72H 1RY7B 3PP3K 4JM4L 1O9ZA 4OCXL 4X8CA 4PGDA 4XVUD 2DWTA 3HE7C 4Y7OC 1GJWA 5GHWH 3QYCA 4EVNB 1GR7A 3VGAC 2ADYA 1A66A 2L04A 5E6IA 3SKJL 2X89A 2FEEI 4WFHE 4QRPE 4AENA 1XMWA 3GSVB 4F58L 1Q0YH 1UWGH 5LQBH 1CF1A 2X4NB 2I69A 3BRDA 4PJ7F 1SBSL 5DYFA 3CVHB 3TBVA 4DZBA 5FOBB 1MHCA 1R3LB 4YO0B 4EBQL 5CINH 3ISWA 3K80A 3K8KA 2BP3A 1KGCD 2CLZA 4GRMB 4NYLB 4GRWH 2GK0B 4HU2A 5HYIA 1QUNA 1P5VA 3JV4A 2NY5L 1E4XL 1HILB 4O2FB 4PIBA 4XBEH 5FCSH 5GISH 3ZDZE 4WO0A 4M7JL 4G11A 5F7WC 3TBYB 1GSMA 4NKOA 2DM3A 4X5XB 3HCVA 4AVKA 3M17A 5CJOH 3K1KC 4P49A 5A1AA 2R83A 4UTCA 3O8XB 5IG7B 1F3JA 3RL1A 2X0UA 2WXRA 2IAND 2VR5A 4PJXF 4P2RA 3SBWC 2D0HA 4DGIH 3U7WH 1ETZB 1TQUA 3TIEA 1FZJA 5DURB 2I85A 4PP1D 2VLLA 1NAMH 1IAIM 4UIMA 2R1XB 3BN3B 1QA9B 4AE0A 4JE0A 2IQ9L 4HSCX 4R7NA 5T5FH 3H9YA 4FNUA 1W6LA 2Y1AA 3GSXA 4GIAA 3WLBB 1WYJA 4MJIB 1OPGH 4KK6D 5JHAA 4RBPH 5F7AA 5CIPB 2MJWA 1MCWM 1NFIB 1TEYA 2VW6A 3ECBA 4TS6A 4GB9A 5E94B 2BVOB 3QIWA 1HDMB 2B4CH 4I9WD 1KG0B 4MAYB 3RGVB 3AREA 3UTTB 4GRWF 3ARGA 2QT6A 5JZ7D 1WCBB 2R0KH 2F5BH 4F3FA 2IC2A 5D1XE 1X4YA 1FLRH 1NEUA 4GKNB 5CU5A 5EU6B 5JOPD 5TH2B 3HHRB 4K5MA 1JAEA 3MV7D 2AF2A 1V3LA 2K6WA 4P4KA 1WFOA 4JFPA 2PO6B 2OMUA 4XR8C 3VX1A 3QDGE 4JFQB 4NXKA 3NN8B 5I18H 1YECH 4G7QB 4O02B 1MQKL 1JNNH 1O7DC 1PKQA 2UX7A 4PD4K 1VB9A 1X5KA 2J12B 2EIZB 3B2PA 2WNWA 5JW5A 3ZGIA 3FQNB 4LHQB 4XC1L 2XA8L 2OQJB 2GBVA 3K5RA 4AI7A 1OF2B 3US0A 1F6AB 2P80A 4JM2D 2WQSA 3TS8A 3QRFM 1TENA 3VRLF 2DQDL 3N41F 3MRIA 3B6SA 1I1AD 1RK0B 2XRAH 1GKEA 2ZXBA 1RUKL 4G7YL 5IVOA 2SODB 2C3HA 2Q76A 2Y22A 3BP6B 3HW7A 3AU1A 3OZ9L 4C83A 1YPZE 4LLQB 3W81A 5HGGS 1SDAB 2OR9L 4HEPA 2G2RA 4Z95L 3QEQE 4MCZA 5H37A 2OJZH 2UUDH 3Q1SH 4B9PA 3Q6GL 3QAZC 4H25B 1RU9H 4XTRC 3P9MA 3LQMA 1FGNL 2E4TA 1BQLL 4PCSA 1RZPA 2EE9A 2BX5A 4IHOA 4JRXE 4QXUH 3A6OA 3OJMB 3MBEC 4KAQH 3FQXA 1ZXKA 1V05A 1IGML 3GZKA 1DBKH 3D87B 3MNZB 2X4RB 5DJYB 2R1YB 3TL5A 1N3NA 3UBHA 4Z78A 5IWLC 3QUZA 2O61B 4OSUH 5GGSA 1BAWA 3MNWB 2VERN 2ZP0T 4MJ5B 3TBSB 4HH9B 4XPTH 3RDTC 3ULUD 1LEKA 3EBHA 1BVOA 1DZBA 1YDPB 4MMYB 3ARBB 4AEHL 4TL5A 3ALPA 4G9FB 3EDEA 1BQHG 1YN7B 2FDBP 3WSQL 3DXAB 4ACTA 1D9KB 4PRPE 1T2QH 1UUNA 1FAIL 3N6YA 4QYOA 3ULUL 4JFVA 5G4MA 3HMXA 5C0BE 4JKPL 5I1DB 4HOWA 3LB6C 3LQZA 5E8PA 2QBWA 3GSQA 1IGFH 1KPVA 4Z7QE 4O2CB 5ALBL 3JYCA 3JTSA 5I23A 4X6FA 3FQWB 3W9EB 3WJLA 1E9OA 1NH6A 1P7QA 3OKMB 2GJZA 1E8WA 2JMRA 2GCYB 4XVTH 2KHAA 2JXMB 3GMPA 4HBQA 1EJOL 5F0JB 3WMSA 1F02I 4P5RA 4J4PD 1I53A 1YYLL 4OM0H 1QSFB 1RIHL 3OAYK 2IGTA 4HEME 4PRIE 1CO1A 4X5PA 5K1NA 5EN2A 3DPDA 3WN5B 1K3IA 1MHEA 3PP4L 4U0QB 3EFFB 4ATWA 3L54A 1D5IL 2BVTA 3UC2A 5HP5A 4H8HA 2ODIA 2HKAA 1YPZB 3L95A 4L4VD 3RUGE 3FQ2A 3FDWA 3AC0A 5ADOL 3QEQB 3ZN6A 2J8UA 4YIQB 1BBJA 4YOKA 2Z31D 3MTXA 1FHNA 3FW6A 1ZRUA 2A5UA 3HEIB 1FFPB 1AI1L 1XWVA 4PJ8B 4PREA 5LCVH 1JZIA 3UO8B 1OAUL 2QZQA 1TTUA 4BQCA 4JRXB 2BNRA 1F4YL 4FFZH 4U1IA 5DUJA 1PD6A 2BJML 4L4TD 4PJCA 3L3KA 4UTBL 3A0OA 3ETSA 1M05B 3ESVF 4OAWA 4XO9A 3SJVE 4HXAH 1ACXA 1BMWA 1UB6B 4Q6KA 2QKIC 4KY2A 4L9LB 5DCCA 4AL8L 1UXSA 4BK4A 1XDTT 3V4UL 3QORB 3D4CA 1MN4A 2WO3B 4HUNB 3AT9A 4TSBL 2R29A 2ZAHA 1MFVA 4P59H 3RB7A 3HFMH 5I71C 3KLSA 4NKDA 5JIIA 3KWUA 4HMDA 3Q44A 1OT4A 2IALB 5TDPA 1BFSA 1RJCA 4PRPB 3FB7A 4PV9B 3LDBC 1OGAA 1FE8H 4MD4B 1HH6B 2IANB 1KTKE 2XWRA 4KO6A 2YPVH 5F2FA 2OMXB 1N8ZA 2VZTA 2ED8A 2FECI 2FLMA 1PEWA 1FL3A 5EG6C 4WWNA 1P6AB 1HZLA 2J55A 3V0EA 3N3EA 4JNXA 4GMTL 3BMVA 1DFBH 2MPAH 3II1A 4OIFA 3FQRB 2XXMB 4PD4J 2IOOA 2QV4A 1A6ZB 3DIDA 4HYTB 2QADD 4NZRL 3BVWA 1TVBA 4I2XA 5I17B 3T0EA 4N2KA 5C6TL 4LB8A 2YMXH 4MMXB 3ZMEA 1SVCP 3ZE2F 3HI1A 3FSVA 3NJKA 4JLRA 4V1DD 1GCYA 3AJ7A 1ACYH 4KXBA 5JPMB 1IGCH 4B7IA 3RE0A 2WC7A 1A1OA 3DHJA 3O6FD 1IGYA 4OJEH 3NIFF 2X41A 4M7LT 4LFHG 3H4HA 1AZBA 5AVVB 3UJJH 3PGFL 4R90L 3IJYB 3QB7C 2A6DA 2I7SA 4XCYB 1CE6B 4KVNL 4UQCA 5AVTB 4XN1A 1JPSH 4J5VA 4EZMA 4KOCA 4QRRA 2ICWA 4AC2A 4GBXA 1QSEE 3MMEA 3PJSB 4MA8L 4NP4H 4IU2B 5FCUL 5ERWB 4QO1B 2AKRB 1JPST 4LASL 5KANI 3IN0A 4M8VA 3VI3B 2ZOUA 3BVNB 4K2UL 3QJFB 3D09A 4X80H 2AV1B 4PVNA 1CT8B 3P2BA 2G5RA 2VDMH 1EXUA 3FC8A 1I1CA 1Z6JT 4AG4L 4D0CB 2V7NB 4QHLB 1NOFA 4OLVL 1KFAH 1L9SA 4ZUWB 4AYSA 1I1AB 3UTQB 4B41A 4HWNA 3FT1A 1P84K 2B1HH 4E9WA 4PGJA 1Q72L 3KWVA 4I77L 2BP8A 2HFFB 4TN9A 4FZ8H 4JQXA 2VQTA 1WWWX 5FIEA 35C8L 4NM8L 1J8HA 3FZUC 1IBGL 3WE1A 3FH8A 4NSKB 4XX5A 5DRNB 5TDNB 5IZ7A 3TBBA 1PTZA