2BS71

Crystal structure of f17b-g in complex with chitobiose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWSVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Natural Variation in Bacterial F17G Adhesins on Crystallization Behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
molecule keywords F17BG LECTIN
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 2bs7100
1O9WA 2BS71 3FFOA 2BSCA 3F6JA 1O9ZA 4K0OA 1OIOA 2BSBA 2BS8A 1ZK5A 3F64A 1O9VA 1ZPLA
chains in the Genus database with same CATH superfamily
2OMNA 4JKPH 5FO7B 5B7FA 4NERA 4CC1A 1NGWB 1R3HB 2QADD 5TQ0H 2XCMC 3RWIB 1VDGA 1OAKH 5FWRA 4ORZC 2F19L 4MD5B 2C4FU 1USQA 2CPCA 2GG1A 1L9NA 2DQUL 5AAMC 2DH2A 3QH3A 4LF3B 4RNRB 5ACLA 3O3AA 3JWNH 3R19A 2EXTA 5AAWA 3G6AA 4YSEA 1LNUB 2OTUB 3GMLA 4XN5A 3T1WA 4JFTA 5I1CH 4FXGC 1GZHC 1OB1B 2WO2B 5DD1H 4YDKH 1J18A 5A16A 5FEBA 2DJSA 1D7DA 2HJFB 2YQ3A 1A3RH 4NO2A 4OBRA 4AMWA 5EC1B 2UUDH 4XAKE 2I7SA 3FQXA 5CLXA 1QFPA 1FUNA 5T1LA 3LSOA 1L9QA 4I18C 4J6RH 1HE7A 4K3EH 3EFOB 5ID0A 1RJZA 3BN9C 2VXVH 1AHWB 2DQEH 1UT2A 1JTPA 5FGBA 1HEZA 1JPSL 1HJCA 2DI9A 1Q1PA 1TNNA 1OK0A 2E27H 2XZCL 5ECJE 4HCRH 1YNTA 4N6RB 2EABA 4FLOA 2F0CA 4LSRH 4J27A 1DLHA 3ZDWA 3GNML 1BD2D 1CIUA 1JPTL 4GQZA 1DEDA 3ULUH 4J8RB 3RL2B 2HJKB 1I8KA 2WP3T 4LRIC 5FC9A 2E6QA 2VSMB 1FNGA 3US1A 4OCLC 4N2HA 1X6LA 4X5WB 2OX5A 1Q0YH 5CHNB 2OL3B 5DGQA 4YNYB 4OIFA 3VWKC 3KYNB 3N1FC 4QRSB 2IDTA 3IJSA 1W8NA 5HHOA 2ENSA 4OLXH 2XG5B 4G8GD 5IHWA 5LG6A 4PJHE 1LMIA 4G8GA 2JE8A 1Q9KA 3QDJD 5EO1B 2RIKA 3PYCA 1QTSA 5CEYB 5DGRA 3GSWA 3MO1B 3O0RH 4GG8B 2J8OA 3QS2A 1MIMH 1QVOB 3NGBB 1MFDL 3QK0A 2F54B 3LKNA 1AZNA 2FE0A 4GG6E 4N2EA 1NBCA 1UADC 1VACB 1WAAA 4OQTH 1I9RL 4Z77A 1UKQA 1NLBL 4ODHH 4WY7H 2O6DA 2AQQA 5M94B 5J13C 1DQQB 3GF8A 2X0UA 4GYBA 3RWDB 3EUUA 4EVNA 1HIML 4FG6D 5L7XL 5TGBA 1TPXB 4XO5A 3GTTA 4FZEH 3BVTA 1MHHA 4JM0A 2WXOA 1SMAA 2ZOTA 2WTRB 3H85A 5DD6B 4R4FH 3UZQB 3HE7B 4HXAL 3LRSB 5K9JH 4XMXA 5BQDA 1NPJA 3SGEH 5EA0H 4X7TB 5AB1A 2OJZL 3GPSA 5GGQL 3VX1A 1MWAA 2WWNA 4WU7A 2NY6C 1UXLA 3FSOA 3KDPB 2YBRA 4QR7A 2L04A 5E0FA 3UJIL 2IDFA 5A2AA 3R8QA 5E6IB 3I50L 5F1IB 5B38B 2HMIC 1OT4A 5E0QA 1SXAA 2JJUA 1TJIH 3KWWA 2YKKA 4XOBA 3STLB 2OMVA 3BH9A 1JGIA 3J07A 5BV7B 3HZYB 5B1CA 3WFBL 3ECBB 3K3QA 4L4TA 2F5BH 3HS9A 2OSXA 5KUMA 1VPOH 4KFZC 2D2CC 3U6RA 1HHKB 1KB9J 4UM9B 3MFFA 3RBSA 2EDNA 5D8JH 2Y24A 5C0JA 2X4TA 3VXMB 1J8HE 4IHOA 4H1LG 4U2ZA 3SCMB 3MRCB 3ZQWA 4NWUL 1PDKA 5DFTA 2WLLB 2R2EA 4M6OH 1P7KB 3UO8B 2A74C 2EDHA 1MLBA 5E6UB 1KJ2L 3KJ4B 4PW4A 5D70H 2R15A 4EI0A 3VI3E 1ICTA 1G7HA 2A74B 2YD2A 1SUJA 1T7YA 3D39A 3Q6GL 4Y4KD 3RUGB 4A2DA 3T4AB 4IK7A 2F6AA 5DDHA 1IM9B 4MJID 2BP3A 2WUCL 4XXDB 1AG6A 4H8WL 2W60A 5I0YA 2APXA 4WUKH 1J8HA 1EO7A 3MV9E 4OVUA 1HILB 4ZW5A 1ZANH 2J57A 1TENA 5BRQA 1KJ2A 4Z78B 4L9LA 2IPUG 2CAKA 3A24A 4ZO6A 1GKEA 3EOTH 3AM8C 3MBXH 2FEEI 3V5DB 1QI5A 2FO8A 2XN0A 1O6SA 1GSKA 4MCZB 4RGOH 5KOMC 2R8SL 5KZCB 1BQSA 3K2UH 5MEOA 3H9SE 2EICA 3QBTB 4UWQB 43C9B 3V5HB 4HS8H 4OI8A 2J1KA 2YA1A 4KHXL 1KXVC 2LU4A 3TNNA 5ID1A 3V95A 4IBLT 4HGWA 5CN2A 3ZLQC 4MAYC 4DK6A 1TCMA 1F00I 4P0DA 3SO5A 1JNJA 5C3IA 1I3GH 4LU5H 2DLHA 2VN3A 1DL7L 3EYUH 5I9QC 3Q9PA 3S5LG 2VLKE 4PREB 1GHFH 2WYHA 4L2YA 3FSZA 4TSAL 4ISVA 4LFHG 3DIFA 4HUVA 1MFCL 2AK4E 5EC2A 3RWCA 5E08H 3VI4F 4HJIA 3PWJB 3O2WH 3FOMB 2BFVH 3FT9A 1IMHC 1SXZA 2Q5BA 2YN5A 1B4TA 3H7LA 3P9MB 5EOCL 2H3NB 2JXMA 3V4VL 1BGXL 5CUSL 4XMPH 5D7LA 1N3NB 4JB9L 4M1CC 4PJXA 3WKQA 1BYPA 3ELAT 5EU3B 1GPOL 3CHPA 3F12A 3SDAD 3PG2A 2WVVA 5CWSA 5GRVL 4JY6A 4TNGA 3NCYP 5J12B 3EKCA 2V3DA 1HL5A 1KIQB 1NANH 1QSVA 1X7QB 2XZAH 4Y8DC 5JHDE 3RQ3A 2B4CC 2KMWA 3O3UN 2VLRA 3VSQA 2PO6C 3FSVA 4WDIA 3IETA 4R7NB 4G82A 1MXGA 1E9PB 1IARB 1INDL 2ZWYA 1S3KL 5EDSA 1I1AA 2BC4A 4PD4K 5CEZL 3UG4A 4JQIL 2EIEA 5CZXD 2ZUWA 3SQRA 2D9CA 1NEZB 3HIZA 3VFVB 2XQ0A 4WHYH 4ODWA 4POYA 5J0BA 5FUOH 5DTFB 4QHKI 1C7TA 1JWMA 4WK4B 5K9OA 1Q9WB 5HJ3B 3ELQA 3N41B 4J4PC 3EH3B 3QORB 1SFHA 4EE2A 1MFAL 3BO8A 2G75A 1JXKA 1OHQA 2Z91A 3QFJD 3DYMA 4AVKA 5EOCH 3TN0D 2CKBA 3KXFA 1DE4A 2NXYC 2WAHA 4GI6A 1BM3L 1TTBA 1TYJA 2CU9A 3FRPG 4MJJA 2B16A 4XPFH 2G0KA 5EO0A 1QQDB 1JYXA 3TEWA 3Q13A 1GPOH 3DJ9A 1OP5H 5GIRB 2VYRE 4IHBA 3ALXA 1FI8C 5B1AB 4NS0A 4F15B 3QR0A 3ZQXA 1KWKA 5DFVD 4PRIB 1QKZH 1R4XA 5L2KB 1IBZA 43CAB 4QYOB 4K23H 3LZLA 5J1AB 5FOBB 2HB0A 3RU8H 1J9SA 4CW1A 3W3BA 1JZDC 5KYNA 4M7JH 3QHFH 4HH8A 1CYGA 2O6EA 3L7FA 2XY2A 5C07A 5CWSB 4JQIH 1N0XH 3SOBH 2ADGB 4L4VA 4QRQB 2DTSA 5B3NA 5KVGH 1RUML 2TAAA 3T3MF 2X5PA 5K1VA 1FJ1B 4X0KB 4ZX3A 3EJTA 2XIIA 3QUZD 2NNRA 5ISZD 2YK1H 3OMNB 2J1YA 3DIVA 1E5UI 4YBLB 3MA7B 3GSQA 4DKEL 4DKTA 1B0WA 1T66C 2LE9A 4LHJB 1I9JL 5IMMA 4YBQC 3SGDH 2X09A 1CXKA 3ARFB 3HEIB 4XMKH 2C3GA 4MMZA 3HC3L 1DE4B 1GOGA 4Y19A 2FQFA 1HSAB 1W72H 1BMZA 2CDFA 4FXKC 5E2TL 1KC5L 2AEPL 5BW7A 5C7XL 1T6VN 4RCAA 3OKEA 3WMQA 2MCPH 5KZCD 3BO8B 4UTBH 4QLRA 1K72A 3HC2A 3PLYA 3HBZA 4Y9EA 4QXUH 2ZCLH 3TIEB 5ESAB 3IPEA 4B5EA 2ODHA 4IIQA 3BFQG 5SV4A 4CUCA 4IKLA 1RZ8B 1UOVA 4U1MA 3MX0A 3GUTB 4RGMC 3WAKA 4MMXC 1SF5A 4CMMB 4B9KC 2XHNA 4C59B 1NCBH 3FBQA 1T6WA 5JOEA 5JPNA 2R4SL 4UAOC 4IRZL 4XNDA 3DTXA 1NMAH 2XKUA 3QUMA 2DPKA 2M1KA 2R27A 1H5BC 2X6AA 2O30A 3C12A 4HDIB 4P2AA 1A5FL 3UEZA 3WKML 1N9PA 3V0AC 1G7HB 2A74A 2UY6B 3LPGA 1E90A 2G2RA 3UBHA 3MV11 3F05A 1MKFA 4QRFA 3KJ4C 5E9DE 4ZTPH 3EJZD 4TSBH 2XYBA 3H9HB 1TYRA 1ZD6A 5FDYA 3NIFE 4ZYKA 1GGUA 3PHQB 3SDXB 2DH3A 4XWGH 3CAFA 3SYPA 5EZIH 4CRPA 3QYCA 2ISDA 3JWNE 4OJFL 3TVMC 1HH9B 1F4AA 4NM4L 1F5WA 3AMKA 3QQ9D 1RULL 1AR2A 4G6KH 4G8AC 3NIDB 2OMVB 2P9RA 2WOBA 2GYSA 2C9XA 5E00A 5D2LA 1U8KA 1XXDC 2CLVB 2G5BB 1CGSH 2BS71 4G80B 3BUQA 2DEWX 1LEIB 2ZJSL 4LE8A 2Y7LA 5ERWB 4AIZA 2G4EA 4ZZKA 4E5XA 1T3FA 4M5TA 3RI5K 1DQJB 4GP8B 3L1FA 3C60C 4JFUA 2W0KA 5TDPB 2EVFA 4OF0A 3JWDC 3CN2A 4UQ3B 1B6DA 2DQJL 4N28A 3MUGA 3WKMH 1CB4A 2FIRT 1EVUA 4PH8A 1XCTB 1UT9A 2R0LL 3FT1A 3HJEA 5IB2A 3RWDA 3OHXC 2RR3A 3LN4A 4ZBJA 2EDOA 5CD5D 1EJOH 3PHOA 4J8QA 3BYYA 2GITA 3GSRB 35C8H 1VACA 3DOHA 5JXEC 5C8JB 1E27B 2R2HB 4DGIL 3ORJA 3QRBA 4M8QA 3OMZA 1RULH 4Y2OA 2C9AA 3ILEA 4WJG3 2VO5A 3NQIA 3KLAB 1YEDA 1FC2D 1MRDL 3DRQB 3F7QA 2H32A 1LHZA 2K4WA 2Z3FA 3OKLA 4K3HA 3MRCA 1NQBA 3NIDF 5DJYB 1O0VA 2J73A 3F7YA 2XV2A 3MRHA 2XA8L 2CMRH 2HT3D 4BQ8A 2PTVA 1IUZA 2N7AA 2NQDA 4NO0D 1EGJH 5FGCB 2VLME 2BSED 7FABH 4Y16C 1QFOA 4PWIA 4JPVL 1TSHA 1GYVA 4NQVA 2OTWB 1I8KB 2CJTA 3LH2L 4PWHA 1KB3A 4G7YH 5G55A 2GSMB 5B38A 3HZVB 4O02B 4H5SA 4BGLA 5L4FA 1A21A 3CSBA 3VQ2C 1PAZA 3QJSB 4IU2B 1RZKH 4OD3L 5I6MA 1TITA 3DTDA 1EHNA 4HULB 5EOTA 4I77L 5SWSD 2WC7A 4F9PC 4DETA 2YPVL 4GW5B 4HQQL 3VXQA 4M9OA 3O6LL 5E8DL 2GHWB 4HXBH 5D1XB 1I3RB 4YWGL 1IL1B 2IGTA 4OZ4B 3UAJD 4U1IA 1KJ3L 5DS1A 1U3HA 3NMEA 5TK4A 1QSEA 3T6ZA 5KJRL 2I9TA 4U7KA 1EPFA 3W82A 3DX8B 4NPYA 2GKIA 4FQXD 4GFXA 3D3VB 3OAWA 4CJ0A 5FYJE 1GZHA 3S2AA 3O8XD 4ABVA 4DAGH 4MNGB 4ZK8A 3F7VB 3BLKA 1K2DA 3GMRB 4XE0A 2XJLA 1GGIL 2ENPA 1CICD 1JCKA 4WNSA 3MXWH 5E2UH 4KUCD 2F54A 1DBJH 2CR0A 1NCAH 1MJ7L 2QFPA 4R97B 1OGSA 1DDHB 3BKJL 1L9PA 5IHUH 1A6VH 2CBTA 3SPJA 3VFOB 3VM5A 2YGVA 3S5ZA 2WQUA 5JR1H 4PRPB 2MJWA 4F20A 2Z1KA 3E7JA 1T83C 1WS8A 4YZFE 1CYXA 5E2JA 2H0PA 1N6QL 4KQ4L 2FQGA 4P5MA 4XBEH 2COQA 2D4DA 2APFA 2HRPL 5E4AA 4KBPA 1NSNL 3VWKD 4LVOB 5IWLC 4JR9H 5I71C 4YXHH 1TTGA 3QWNA 4LRIA 4DW2H 1T1ZB 3TH4T 3T3PB 3HI5L 4NP4H 5C86A 1AOHA 2HFEA 4PJHB 2ERJC 3LRMA 2QGDA 4XZUA 3G5ZA 4G6AD 3MGOA 1U92B 4YS4A 4D3CL 1HSBA 2ATAA 2VDLH 3L3HB 4ICWA 3GMOA 4FQ1H 3D25B 4Z18A 3B8SA 4ZS6C 3CPLB 4DAGL 5IB3B 3RWGA 1R75A 1KNOA 1FG2A 1ASQA 3NBNA 2PPEA 3BEWB 3GMQA 1ZAGA 1GR7A 2MSPA 3BT0A 3GXDA 1F4HA 1WG3A 1FGVH 4FABL 3QA3A 3MRPA 5E2UL 2DWDB 3SKOA 4PCYA 2NY4D 5DURD 5HP5A 1WBXB 4F80A 1GJWA 2J2ZB 4Y2DD 2VITA 3U7YL 1DVSA 3L3HA 4JCLA 2UXFA 3KWUA 2DAVA 5F96L 4J6RL 4WSGA 1G0XA 4UOJA 3PE9A 4ZMNA 2HRLA 4HOMA 4P3WA 1AVAA 2O61B 3HE6C 1UENA 2R0ZH 1OCWH 5IREA 1KGXA 4LSQH 3ZT5A 3A6OA 4V11A 3BRDA 2VLJD 1XR9B 2XN9B 3MRQA 3NSFA 1WHOA 1UA6H 4XPAH 2WXPA 4NQDE 4HHWA 4UQIM 3PWPA 5EOCJ 1T21A 2AZAA 2HMID 5IJVA 1H15B 3H56A 3T8XA 2RCSH 1P6AB 1VLXA 3K2KA 5D93B 1ETJA 3V9FA 2JB6A 2JKWA 3F8UB 3LEVL 4H25B 3KYOB 4MXQC 2XETA 4YDKL 5C0BB 4IBVA 1MJJB 1BPVA 1BVKA 4YXLH 1UB5A 2QVKA 1TVBB 4IKKA 2BP8B 3DSNB 4R26H 4Y16A 1K2DB 3GMRA 1N64H 1R24A 5IV2B 1G7JA 1CG9B 1REIA 1JYWA 3PL6D 3MRKA 3N6YA 4FRWA 1PS3A 2WMPB 4H8VA 4F15C 1DSWA 2DF3A 5I1JL 2YMXL 4UB0H 4PJAE 5EPMA 5I6KA 2AJVL 2E74C 3E2HC 4K8RD 2QV4A 4O02H 2YPLE 4GKZB 3FCGA 1GZQA 4XZUB 4YXKH 2ZOLA 5KS9B 1TTFA 3E2HB 5EOTB 5IMLA 3K6FA 1G7MB 1YECL 1ZKAA 3T0EE 3ABLB 2Z92A 4ZDHB 3L3OA 5HJDA 5I0WA 2PTTA 4CVZB 4N22A 1VA9A 1P7QB 2OJZH 3PJSA 2VDKB 1IEBA 4FEIA 3HC4H 3IDUA 1JFHA 3MMEB 2BNQA 1FPTH 1MCHA 3V0IA 1QLRA 4KGJA 4WUUD 4JY4B 4LLQA 5JPMC 2JKXA 3O2VL 4WUUA 1S5HA 3HCVB 5SWSB 2YFOA 1N5AA 4NGHH 1BXXA 1BBJB 2ARWA 4WY7L 3FYEB 5KJ4A 3QWRA 2GTZA 4FLHA 3F7VA 1QACA 3S3CB 3OMIB 4OZIE 2K1MA 5FDWA 1BVLB 2CGRL 4YHNB 3GSOB 3L7EB 2FATL 2KQMA 4OV5B 2ZX5A 1SHWA 3E8VA 2NT1A 3MAWA 1KPVA 1FFTB 1NTDA 1U3HB 1DBKL 2R1YA 1BAWA 3BVNB 1J8HD 1IL1A 4Y4HA 1JZEA 4NHUA 4QKXB 1XBRA 4NYLB 1S9WB 5J7CC 1VRSA 2CGZA 4AENB 3TPUB 2CG9X 4CMHB 2ZKXA 2QVMA 4GEIA 1EZUA 4OGXH 4UAOB 5D7JC 3FO9B 3GI8H 5D6DC 3FTYA 3PHAA 2R1WA 5DHVA 1W9XA 5GRVK 1RSYA 2CGYA 1MCNA 1NCJA 3KPSD 3TZVD 2AJUH 5HYJD 4OLVH 4LPTA 5IGXH 3Q2CA 3MKGA 4WGKA 4YPGB 3P3YA 2IBBA 2Z64C 4PM1A 1OCRB 5ABDE 3DI2B 2OMYA 3GK8L 1HKLH 2EDWA 2IGLA 1CC3A 3IDXL 3D85D 2W9DL 4P23B 5MP6L 5FFLA 5EWIL 3TBTB 3DXAA 5GRJH 1E9QB 1QFHA 3I85A 4HT1L 3OZKA 3UXFA 4FG0A 4QGYA 3ZL2A 2EDJA 2NXYD 3SQBA 2D0FA 5HYFA 3MRMA 1DQLH 1I1FB 1WYJA 5CCJA 4HIIA 1IBHA 1DO6A 1T22B 3INUL 4D0BB 5E08L 2QQQA 1C1EL 2QGEA 4X4YB 3OBAA 1IAKA 4UV7L 2X6VA 4F3FB 1OSYA 3X11A 3B8YA 1HQ4B 4CKQA 4ESKA 1GXEA 2WINA 3EOBB 2Q10A 3CK0H 3M1BB 1I8UA 4NKDA 5L4IA 3GPEA 1F4YL 2BH0A 1K8DA 4ETYA 2ZE0A 1NBQA 3RY6C 2YXWA 4ODTH 1ZVYA 1T1WA 2F8OA 3ESMA 4J3WA 1U3NA 5DJXB 2XFXA 7PCYA 4LGRB 1WFMA 3QPQC 1NM9A 1DN0A 1EFQA 4JRXE 3UBGA 4M7LL 4K8RH 1ZEAH 3LB6C 1W72B 4PEEA 3GB7B 5D72H 2JQAA 4B0MB 3WTTA 4FQJH 4PR5B 3HN8A 3D51A 2NOYA 3GBML 3CSTA 4NB7A 4X7DC 4QUOA 4APQC 1V5JA 3ESNA 5BRPA 2J20A 3SJVE 2L7QA 1NDMA 1PLBA 2ZCKH 3TJHD 4X6FA 4LQ1A 1SJEB 3AVEA 4ZFOL 1HH9A 2NNXA 1XIWB 1Z66A 3FB6B 1ZLEA 2OM5A 2R7EA 1R0AH 3MBWB 1NIAA 2NMSA 2ZUSA 1FRGH 3G7TA 4X7SL 1U41A 4ENED 2EYTB 3N42F 1E5ZA 4ZFGL 3AITA 3ZGHA 4XXWC 4FTVA 5F1SA 4MB1A 1SQ2N 3JTTA 1TVHA 4RMTA 4XCFH 2W0LA 1CBVH 4G7QB 4J4PD 5CJOH 4GLRH 3TA3A 2Y25A 2IBGA 3ZIYA 1G7PA 1MCFA 1I8LC 4JG0L 1EXHA 2FYYB 4AIXA 4DGYL 4OM0H 3T8MA 1W0WA 3EJYC 2BNRE 1VFUA 3WLBA 5D96C 2Q76B 4ELME 3D7PA 5FOBA 1X5JA 3AXHA 4CGTA 1UH4A 5J56B 5DZJA 1KB5B 1XD0A 3GHBL 3SY0A 2VLJB 2XN9D 4MJ5B 4AZ8A 5F72S 4JFFB 1F86A 1YJDL 1T7WA 1WFTA 2OMXA 4J2XA 4F8NA 2AITA 2E5EA 4DKAA 2O4EA 5BO1L 4AH2B 2GTWB 2Y7OA 1RZQA 2EZ0C 3QQXA 1QP1A 4N2LA 3RTLA 3FJTA 4Q0XL 3VFPB 4JPIA 1UC6A 5E9NA 5DO2C 3QORA 1BPLB 4NDMB 1J8RA 3LRGA 4FF9A 4KMLB 4PCSA 3BWZA 2VLKB 2MTPA 1F3RB 3O8XC 3AG1B 4FTVB 5ILTL 2JJTC 4D0CB 5JYLA 5DJXA 3WHXA 1OAUL 1XCQB 2IANA 1ZLUK 4XVJH 3BQUA 1AGCB 3SZKC 3ZDZE 4N2MA 2ADGA 2WSPA 4PRAB 3TN0B 1KPUB 4YLCA 4QJ4B 3WS6A 1BVNP 4N0UB 4B5ZA 2P5WA 1BZOA 2YA0A 4G1EB 2Z0BA 3DVGA 3ECUA 4K71C 4WW2F 3RNQA 4AJ0A 2DLIA 2OK0H 3MNZA 2XWTA 3DVNA 2LU5A 3N2JA 3V0DA 1P5VA 1SXNA 3EDJA 4K07A 3O9WD 2K70A 2PP8A 1UB6B 3QEUB 2BCMA 5CILH 4HFWB 4MMXB 4MCNA 2MQCA 1KXQE 4JO8A 3KD4A 4EAEA 1IFRA 2CLRB 2ED9A 3CC5A 3OXSA 4M6AA 5JORA 4AQ8C 1CFMA 2JCCB 5I30L 1SPDA 3QQDB 1MHEB 3GO1H 5F0MB 2XY1A 1G6RB 3BUIA 1XO8A 2ZCLL 4YZFF 3IPFA 2OMYB 1CICB 4MD0B 2X2YA 4QHPA 3K0YA 4XAWH 4G6KL 4QRPE 3DROB 2IAAC 3X1NA 1FVEB 1OAUH 1YHPA 4ALAC 3MLUL 5DJ6B 1YVLA 3V5HA 2FYVA 4N8CH 5DZPA 4Z3GA 5DEJA 2C9UA 4X8XA 3UTZB 1A6TA 3S3JA 1TIUA 4HIIB 5CEZE 1TG8A 2D03L 1CMOA 4JFED 2EKSA 2D73A 3IDNA 3VYNA 5ACZA 4JFVA 3TCTA 1WCQA 4HS6B 2BY2A 4LCUA 2VDPH 4NJAL 1C5BH 1GW6A 4Z0XB 3HFMH 3UACA 4FJYA 3M1BA 4P5TB 1WF5A 5DEZA 4Z3HA 3EOBA 3RA7L 4NZTL 2WKOA 1QOKA 4UQAA 4F3FA 4MAUH 3F12B 4S1DC 4NN6C 3ZPDA 3ZN6A 4B95C 1ULVA 3RY4A 3D09A 3IJYA 1OLZA 4NN6B 4UIMB 5H37G 2AVFA 1E4KA 1HOCA 1U58B 3ULUD 3MJ6A 2FGZA 3C60B 3DSFH 3CZUB 5HHMD 3VXUE 1V8HA 4N0FA 3LKQB 4WFFE 1DQKA 4FMVA 4Z7AA 1YEFH 1WPCA 1FZKB 4L8DA 1WZ1H 4KVPA 4X6DE 3TEUA 4BKLA 1P1ZB 4DFHA 1C12A 3TXAA 3AWEA 2W92A 3I9PA 4LGPB 2Y1AA 1N68A 1TU2A 5I1KL 1NCDH 1S7QB 4OGQC 3S4SB 2AXJA 2CIKB 3AJ7A 1F3JA 2XQBH 3H9YA 5LKNA 4ABUA 5KSAC 3S5LB 3VDAA 2PXYB 3RB7A 1HEHC 1IGFH 1KLUB 3L3OB 5DRWB 4UQCA 2AKRB 2MHAB 3FFCE 5KSAB 3NIDE 2PUQT 2WIIB 3GBDA 1QI4A 5LCVH 3ZYJA 2YBRB 3VMOA 2QADC 3ZMEA 4BXVA 4MQ7A 1E43A 3VGBA 4JN1L 1NKOA 4DKFH 1FL5A 1YYMH 3AW5A 3I6GB 5E4EC 1Q8MA 4JY4A 4LLQB 3ILDA 3O3BB 3L48A 4JRXA 3UG3A 3AUWB 4MFHA 3NIFB 3SBWC 3Q2LA 1XF4A 5I1IL 4CVXA 5E1AB 2X1QA 1IBBA 3KPMB 1TMCB 3N5AA 4FMKA 2RGSA 5ALCL 1V10A 4KUZH 2PLTA 1RUPL 1MQ8A 2YRZA 4PQXA 1P7KA 5GGVY 1L6ZA 3GEFA 3UDWA 3MJ9H 1A6PA 4X5QA 4MHHI 5T5FA 4JPWL 1E5CA 1W80A 2BWQA 3OKYA 4JKMA 3T6XA 1S7RB 3ZTEA 5GJTH 3SBRA 4JFQA 1SHSA 4Z7OF 1BX2A 4AVJA 5LDSA 5CEYA 3ARBA 1Q0XL 4LMQI 1T20A 3MMEA 3DBSA 1OW0C 4NJ9L 1FLRH 3W57A 2FX9H 3QI9A 1MCWW 3MXVL 1H8OA 5D1XC 1J05A 3OZLA 2EYRA 4LLYB 3IF1B 4JAMB 4JJHA 3VFTA 3QIUC 1RZFH 4H1LH 5JIQA 3PGFH 4O00A 5T1MA 4CBZA 1ZVNA 1TO4A 4AM0B 5JMOC 2YPVH 1NPNA 2O61A 5E8DH 5E8NA 5SWQB 5E4OA 3APMA 3EG9A 2X4PB 4HJJL 4WGWB 4F57L 3DPBA 4HP5A 4U6VH 5BRZA 4HKJA 1DJIA 3TBVB 9CGTA 3HLAA 1ZGLP 3N41F 1NBZA 5CD5C 1HOEA 3FDWA 2VZTA 4M48H 4OFPA 5E94B 2VDLL 3UZVB 4JKWA 3O6FD 3PDOA 1UM5L 2A1WL 5A16B 4OUUA 2MNWA 3V0HA 2R23B 3JV6B 2ICWA 4NENA 2VR5A 5D2NC 3S37L 2P24B 3LZOA 3KGUA 3BH8A 5KOVC 3CN4A 2GCYB 2CHNA 4YDZA 3O3AB 5I76A 1N6QH 2HJLA 5F0PB 4NQEE 1H15A 5C08E 4XBGA 3F6JA 5LO7A 4QHUB 2ID5A 4QRSA 3K2MC 4UIKH 3C9NA 2GC4C 2GJPA 1FNAA 3B9KC 5DA0B 4N26A 3H55A 3T2LA 1T1ZA 3VA6A 5ICUA 1U6AH 3QAQA 2VQTA 1KLFB 2JJTA 5FYKL 4TF4A 5D7IE 1P6FA 3RL2A 5KVGE 5IG7B 4XNYL 1GCYA 2BNQE 2MOGA 1KCLA 2DWEB 5EN3A 1VZGA 4H8UA 5TE7H 4OGAD 5D1XE 2FO4A 4XPAL 3NESA 5EUOE 4FFZL 3OKKB 3D2TA 4Y4HC 3V4VA 3KBEA 2E4FA 3MJ7B 2R23A 1RUAL 3MV7D 3L8QA 2SODB 4EIBA 1BFOA 3SEPA 1VAHA 1AD9A 5GZOC 2VERA 5IK3B 3QJFA 4U1KA 4M6ML 5FX3A 4QJ5B 5GGUA 3VYOA 4AM0A 4KK8D 4TRPH 4X8CA 5BXFB 4QTIL 3LEVH 1GAFH 3D0LA 5LQBH 2IWGA 3BW9A 1AXSB 3VFMB 5T1JA 2VE6B 3WUWG 1OAYL 2WLHA 1J05B 1ZIBA 3D3VE 3EBHA 2H0EA 1O7SA 3C6SA 3O2DA 3MGOB 3M17B 5F1OB 4A2GA 4L0PB 2ZXWB 1I1YA 4H40A 2OW7A 5SWQA 1IM3A 1BOGA 1GSMA 3GBLA 2HFEB 4CSSA 2NUTB 4HC1H 3RGHA 4CGUB 5FR3A 4LCIH 5FUCC 4WWOA 3C6LD 2PCPA 4H8WC 3V4PA 4BELD 3K71A 1KULA 5D7JA 2Y5TA 1YA5A 2XPYA 4RFEB 1JGLH 5FM5M 1E5YA 1HHIB 3F64A 1NFDF 4BZYA 3A6CH 2OTWA 2DQCL 1N0LA 2DMBA 4IOIB 2WZ0A 1BEYH 1SJHB 2YEVB 5KSVB 1CUOA 2H2SC 2P44B 3AS1A 4U3CA 4BKTC 5TDNB 3OR7B 5FPIA 4IEFB 3L5WA 2X4QA 3QCUL 1J48A 1YSOA 1FGNH 1HWGB 1DUZA 2YIHA 1B0IA 1U8PB 3AREB 2OR9H 2ROYA 1G1KA 4KI1A 4M1DL 5LQBL 4Q52A 1PGRB 4JO5A 1KFGA 3PABB 4NSKB 2WLNA 1OHZA 1JZ6A 1IKNA 1K6QH 4YDVA 3UFIA 4PJEF 4OZGA 5K33A 4TSCL 3ZDXF 5AB0A 3MLVH 4GS7C 2V5TA 2I9TB 1HESA 2XZCH 4OVVA 4O02L 1ZCRA 2IAMB 4WU5B 5DUMH 1ZSDB 5E70A 3KYKH 5F9JA 5E9AA 2EQDA 1ZVSA 2FATH 2GBAA 3SDXE 3AABA 3MLYH 1J0KA 4YSDA 4EN3B 1L0PA 4N0FB 3V7AG 2R69L 4IU2A 2DQGL 1W2KT 1ZHNB 2YWZA 1E6OL 4XN8A 5KSAA 2FSEB 1G0YR 2E0PA 3UTZA 3BP5B 2G3NA 1X4XA 4JPKH 5D1ZI 3AS0A 3MLZL 5DUPH 4OGXL 2EO1A 4JRFA 3GI8L 3ARUA 2NZ9C 2QSVA 4B0MM 4LCWA 2ZOWA 4N25A 4GG6F 3BT2L 1R3KA 3EBGA 4W6YB 5I5RA 4P5TD 1JJUA 2G5RA 4FS0A 3REVB 3TU6A 3W11D 1L4IA 4HUMB 4KY2A 3ZRCC 1L5GA 2M2DA 2XTJC 4KAQL 1MI5E 1KJMB 1GOFA 2VSCA 3JYBA 1X5ZA 4AVIA 4RRPG 5HI4D 1I9RH 3V7AE 4ZQTA 2D9QB 1JPST 1UA7A 5EBLA 2CRIA 4OLZL 2WQVA 4OKDA 2UWEE 1M71A 4GQ9L 2J1XA 5DJ0B 3SDYL 1ESOA 5GRJL 2HKAA 1B9KA 2XQYG 4N6QA 1XF3A 1F13A 1UZ8B 3SDXA 2EDMA 3KYKL 2AABL 3NJIA 3S36L 2OMWB 5I24A 3D12B 4MSWA 2VDOL 2JJSC 1LEIA 1JCVA 5I16A 4F93B 4JLRA 2AFNA 4GKNB 5I18H 1AQKH 3HB3D 4ZW8A 2V5RA 3EDKA 1KPUA 1UATA 1IT9L 4WUKL 4LQFL 3OXSB 1Y18B 5JPNB 2DTML 3D30A 2XWEA 4HX1A 3M07A 3RJDA 5GXBB 3VMNA 5DJZA 3S34L 1L0XA 2G0LA 3QZPA 2VDPB 4Z7UF 3CTTA 4KJWC 4HZLB 5GZNC 3KLLA 3DUSA 2AJSH 4OCMC 2AEQH 4MD0A 1MI5A 5I15L 4HKXB 3WS3B 2V4LA 3LN9A 1UJTA 4H8HA 4PJGE 1IQDA 1OZTG 3I9GL 4ZO7A 2Y7QA 4ZZFA 2FLBT 3UTTA 1RU9H 4H88H 4CADB 2OYMA 2VDRH 4OH2A 2ZOOA 4W6XB 4XNQB 3EYVA 3FO0H 3CFKA 1JXGA 1JIBA 1EFXB 5FYKU 3A4DA 4H13C 3DK2A 1A4BA 2J55A 5DC2A 3NG5A 5HI3D 1OGAB 1U8IB 5EG6C 5HGDA 3EGDA 1KTKE 3KHOA 4KRPD 2DQDL 4PRIE 4DOHE 1CE1L 1ET8A 3NABL 5J3HC 4Z7VB 3KNBA 5T33H 4EDWL 1AOZA 3OMAB 5FKAA 2AHIA 1DEEA 2WYZA 3DGDA 4PP2A 4IQHA 4ZSOE 4AV4A 3R1GH 1PEWA 1D5ZB 2X1XR 4G1EA 5IMKB 3VFPA 3QQ3A 2YAOA 3SPCA 4PBDA 4PAZA 4ABWA 3L3JB 4P49A 4HF5L 1MCWM 2I27N 4PBVC 2EH7L 3LPOA 1U91B 5H37H 1BD2A 3QDJB 4KKZA 2XWBA 1RIUH 1P5UA 3QQ4A 1Y1UA 2H0JA 4LAQL 2OJEB 1BW8A 4MWFB 2E86A 1RH8A 2ZOUA 2AJSL 4JO2H 4JS7A 3WGVB 4QXVA 4R2GD 4XOEA 5DZAA 4ZXBA 2Z35A 5C0CD 4JM2F 5AW3B 1PIGA 3MGAA 4RA0C 5JHBA 3MRRA 4OR1A 4X0KA 4HGMA 4KI5D 1DBBL 5J6SA 4B9IA 1J8SA 3EH1A 3WTUA 1PZBA 2O5XH 1GGBH 2ZP8A 2XFGB 3RZWA 4KTEL 2O5ZH 1SLVA 3OHMB 1MFCH 3AUVA 1W15A 4KJPD 1QNZH 4PJDE 3C8DA 4BJLA 4PJ5A 1CI3M 4PJCE 2EIMB 1TKWB 2PMZA 4V1DE 5H2BA 4BQBA 5KYUB 2GY7B 2YGOA 2V17L 3H7BA 5IB4A 43CAA 2A9AA 4GLRI 1D5IL 2CJ3A 3JQOB 3MUZ1 2FJSA 1P9MC 1IC4L 3KXFD 2BOBA 3K4ZA 5JLZB 2EAEA 2V7NA 4HIPA 5G4NA 3SQOL 2QZQA 1LJMA 1VZIA 2FNBA 1OGAA 1QMUA 1T1WB 4Y5VC 5TE6H 3ROOA 1EFXA 5MHSE 3QXTA 4PJFF 5C2UB 5SWZD 2GJ6D 2TRHA 5CGTA 3EFFA 4CNIA 4V2CB 3LHAA 3FQRA 1KGYE 4JO2L 1T2QL 1KCVL 1IQDB 2FX8L 2CRZA 4WO4D 4XH2B 3II1A 5D2LF 4FJZA 5ICYA 5IROA 1KIQA 1PZ5A 1RUKH 3KH3A 5FKAB 1WDAA 2WXNA 2VC2L 1IAOB 1R3JA 1YJDH 5C07D 2MPAH 4JDEA 1OEZW 3V8OA 3QUML 3ROOB 4KK5D 5FYKE 1HWWA 3MQIA 3OKOB 5L2JA 2JK5B 2XI9A 1HCYA 2R7EB 4GMSH 2D2OA 1MRFH 3FB6A 4FNLH 4Q9QH 3LZPA 4HX1B 4O2CB 5EO0B 3O2DH 5DEFA 5A2BA 1G9MC 3ZDXE 1Y18A 3F5WB 3DX1A 4UDTA 4X6FB 1ZMYA 3CC1A 5ADOH 4MCYB 4FG4A 4OZFH 2YAMA 3QFGA 2V9UA 1KENH 2J8UF 4F2EA 1Q9WA 2Q6WB 1FZOB 1OE2A 2HH0L 5KSBE 2CZNA 1S7TA 2IFFL 4KKAC 1T5KA 3NCJH 3R18A 4JFPA 5ETUA 2OYKA 3RIFF 1AG0A 4IRZA 4JM2D 5TE6L 1FO0A 4FA8A 5A3ID 4AEEA 3ILPA 3MGTA 3UBXG 3TVMD 3VTMA 4RGND 5GZNA 5EBLB 4JE0A 3FHAA 4PWEA 3TF7C 1EAPB 3QUZC 2H3NA 2JXMB 4J3VA 4BHUA 4PWJA 3X3FH 2FEDD 4GKLA 1JDDA 3K81A 1RUKL 4X99A 2A9BA 3P9LA 3RAJL 4Q9BA 1QFUL 1S8DA 4QRPD 4YR6A 3HKZA 4X6CE 1XB8A 4Y4HB 3P2DA 3UERA 4Y5YB 2JKIS 2BLFA 3STBA 2EADA 2X4UB 3KPQB 4EI5B 1BLIA 1NUDA 3HMWL 4JFOB 3ZTJG 2VXUH 5ENWB 1CICC 5HYJB 1MW2A 4DKEH 1Z32X 1AGEB 1Z1WA 4TNWF 2YRLA 1LP9F 4HBCH 5D5MF 2XSKA 4BBWA 2VLJE 4EQ3A 4RX4A 4X5RA 2NQ3A 1ZHNA 3EYFB 4MAUL 1PBYA 2GTZB 5FFOA 4MCZA 1KTDA 1KENL 4M43L 1RLWA 3NJHA 4TQHA 5FYLL 2AERT 5J57B 4EI6A 4H1LB 1YQ2A 5AYQA 1KGCD 1QO3A 1ZE3C 4HMCA 1AE6L 4GSDL 3QWOA 3NCJL 4HJGA 2IMNA 4ADJA 5BNXD 1KPRA 2MRYA 3ECBA 3V0JA 2K9UA 4OM1H 3VXOB 1JWSB 4IYKA 3GSXA 5LUMA 2LTQB 5AKVA 4IBYA 4NUJA 3UMTA 1FZMB 3V52H 1GY1A 1CGWA 1J0IA 1O6SB 3DURA 1LDPL 5BS0D 5D7IF 2VTFA 2WLLA 2VQ4A 1XAKA 3KAAA 4U0QB 5LGJA 4J7RA 3M46A 1RZIB 5F3FA 3VRLF 4TNEA 3EYSL 2R1YB 4TSBL 3G5XA 2BNQB 1BZQK 4KVCH 4RIRA 4PRBB 2GUOB 3KPLB 1KT2B 5I5JA 1VB9A 2HTKC 4N87A 1L9RA 3HBQA 3L3OC 1THAA 4HXBL 3KWWB 5D1QB 3ZE2F 3CIAA 4DERA 1IV8A 3IAQA 4G1MB 3FH5A 3W5MA 1A9EB 1AGFB 3SYAA 4M43H 4AGMA 5EMYA 4I2XA 4B9ZA 3QRFM 3DSNA 4UQEA 2KZ1B 1G7MA 1OV8A 2VIRB 1CZ8H 2FVNA 4KZCA 1BOGB 1EDQA 3DLQR 5FOJA 3SYCA 2EC8A 5CD3A 5IIEA 5IBLC 4JZNB 3M17A 4U1GB 5DT1L 5AVUB 5FGBC 4J3TA 4M6NH 5T5NG 2APSA 2VZSA 3K5RA 3HG1B 4OM1L 3X12B 3V6BR 2C3XA 1ODUA 3WY1A 3P3SA 2G5UA 4IMLB 4N2NA 4HOWA 5KBKA 2ZF8A 2VXTL 4UYPA 4DGVH 1MJ7H 5I1HH 1JGEB 3NRFA 2ROXA 1L5GB 1J88A 5ITBL 5AVRB 3FFOA 5JPMB 4S0SD 1ILUA 3BKJH 3STZA 1EGJL 3EAKA 4ZFFA 3LEXB 2FQDA 3IBOA 4AVHA 4GUQA 4OIIL 4PJIB 4KMQA 2WJ7A 4KXCA 2X2HA 5JQ6L 4X5WA 4F8QA 2AMUA 1YYML 3B1UA 2ED8A 3U30C 3TM6A 5IMLB 1GS7A 3LH2H 4GRLA 1EZVX 1TVBA 2C1PB 3VXUA 3K8MA 4Y4FA 5C0BD 4KJQC 4Q9RL 1BZDA 2CCVA 4DW2L 4RAUA 2ZWZA 3NVQA 3QR1A 2FLRT 5AALA 4PRHE 4C56D 3FQUB 4JN2A 5AG9A 5HGBB 3WE6B 2WMPA 2OQJB 4JL2A 1SOKA 2CCLA 4AW7A 5LG1A 5H37A 1DQTA 4Q6IC 4AI7A 1DJSA 3P0GB 2IQ9H 2EKJA 4U6VL 3ZKND 1P4UA 1CWVA 4Y5VB 2P8LB 1ZLVK 4XNXH 1UB5B 4LIQL 2QQKL 2B1HL 2NY5H 2GK2A 3MJ9A 4HJSA 4WNJA 1XGQA 3TGXA 4FFWD 3ZHLA 3S88L 1D5MA 2HUEA 3O41B 3K5SA 5B1JA 4KITB 4L8BA 3NSCA 4N6RA 4BZ2H 4JPVH 4GAJH 1OPGH 3OPZH 2Y3AA 4G7VL 1OCOB 2GSGA 4FYQA 2X4QB 1KY6A 1PYWB 2JKJA 1PKQE 4GIOA 3NIGF 3SE4C 4JRYE 5LDUA 1ASOA 4OD3H 4P59L 2RTTA 4G6FD 2Z7YA 5CZKA 3U0WL 3BYTA 1OB1A 4U6HB 2J8UE 4I88A 2ITCB 3CXFA 4IKJA 1RHHA 1WWAX 1WO2A 5SX4I 5GISL 2XXMB 1JYNA 3NPSB 4P5KA 4WTWA 2BXYA 4F58L 1OE1A 1GGTA 2ERJB 4PTUA 3WXWL 1Q72H 2GK0A 1OAKL 5DHEA 5I9QB 1OKEA 5ID0B 1QLEB 3IWUA 2WLZA 4LSVH 1VHPA 2GPZA 4MJ2A 2WLKA 2Y4SA 4MA1C 2BRRL 1U8LB 1U8NA 1OWRM 1JAEA 1MCPH 5KWYC 4HS3A 2GY5A 1QSEB 3GMLB 1WK0A 1DJWA 3VRIB 5C70A 2D3JA 5BXFA 1AP2A 1A3RL 1KN2L 3GZQA 4QOKB 5K39A 1S7WB 2JELL 3ZRSA 3FH7A 1D2OA 3BAKA 4L3CA 5IQNA 5FHBH 4KTGA 4GH7B 1NIDA 2VIRA 3N91A 4L3AA 4P06A 1ERNA 1JPGB 1IGYB 4XT1C 5I1DB 2A0LD 2BJMH 3E6HA 5DQDH 3V4VB 1JPTH 3WHE0 4AGOA 1OZUA 2JIXA 4OTXL 4CVUA 1WTGT 1C8QA 2IV8A 4W9JC 1RMFH 4HIHB 3KPLA 3SODB 1NA8A 3QIUD 1A4CA 1AIFA 4PRPA 5C0AA 2Z4TA 2ZPKH 5ESVB 5HHOE 3D18B 4UT9H 2NY1D 2GB2A 5GGRA 4GAYA 2JKLA 4P2OB 3MYJA 5DJ2A 1CFVL 1HWHB 2DL2A 5F7NC 3VNZA 1CT8B 4YSPA 4GW5A 4QAMB 3AU1A 5IHZB 1QA9A 4JJ5A 5T1KB 3L9EA 3FN9A 1BEYL 1KEGL 4MQ7B 3DX4A 3MLTB 4L3EA 4PGCB 2WXKA 2H5UA 1IFGA 1IX2A 3BIAX 3U0TA 1UJ3C 4XBMA 5DS8B 4PJ7F 4FHKA 5M95B 3S5LA 2YN3A 4TVPD 2VQ1A 1FFNB 3QJQB 2NX5D 3DXAE 4KI5C 3DMMD 4Y5XA 3E0GA 3TCLB 2GITB 3EF7A 4P46D 2ZXDA 1SYSB 1UEMA 1SBSL 3GS7A 4HHAA 4R4NC 3IAGC 2HX9A 4NN5B 5BVJB 2H45A 3HOGA 3MLVL 1J5IA 3CG8A 4FZEL 4N8VG 2BJML 5DQDL 1EBPA 3ULUL 2EIBA 1YEIL 3FUEA 2WBKA 3KLAA 3U82B 2JLLA 4AQ1A 4KKBC 3L08A 3CMOL 4IM8A 1UWFA 3MREB 4LOFA 4YXKL 3AS2A 2IALB 4YOKA 4FFVD 3WJMB 4K3JH 5HYSG 2AW2A 2BSCA 3BHBA 4E5XB 2EEBA 4WWKA 1E27A 1S7QA 1Z9SB 4OCRH 4QXWA 3KVQA 3VSUA 3OKDB 4TOYH 2JH2A 2F74B 5GGQH 3ZDYB 4ZUUA 1EHKB 2DYRB 4JRYB 4QRPB 1ZOXA 1QBBA 1PD6A 1L3WA 3GBNH 4XO9A 3BAJA 3CSYA 2JKRM 5CBEB 4XN7A 2CA4A 3RB5A 4EN3C 5KYYB 1KT2A 1TJIL 2XQYA 3V10A 1T20B 2UVEA 4LFHD 3TN0C 2BZCA 4UQ3A 1FH5H 2QT6A 3KWXA 4KV5F 2GABA 1RURL 3OL2A 3IB4A 4TTDC 2PR9A 5D7LD 5EWIH 3SKUD 3IMUA 3WJLA 5JW4M 3LRKA 2AQ1A 5CMAB 1CO1A 2C5DC 2CO4A 2CPUA 3V7MA 3NSYA 3QARA 3UZEC 1UG9A 3NJLA 1BHGA 2WO3B 4X9HA 4N2DA 3FU6A 2F15A 2P7TB 5LXGL 4XNZB 1IC5H 1KDJA 1E4KC 1PLGH 1TTRA 1KJ2H 2IH8A 2V9RA 5JOFB 2P28B 3FFCD 3QXWA 2FBOJ 5EIIG 4HU8A 3S36H 4UZSA 3ZTJH 5J89A 4WKZB 5ICXA 4LASL 4DPAX 3IMWA 3UEQA 3UJIH 4K3GA 5IBTH 2EXYC 3V0EA 4RAVA 3DO3A 2JK5A 1ZVHA 4G2AA 4I1PA 4OCRL 4JRLA 4TVSa 1ZANL 1G7LB 1E4WL 1RZ8A 2IMMA 3HPJA 4LSUH 1MCQA 1UYWL 2FJUB 5F7EH 4JDEB 4FNUA 2UWEF 1LEKA 3SY6A 3O3DA 4WI7A 1PZ5B 4KU1A 1P5VB 1S9KC 2G9HB 1NMBH 2FL5A 1KJVA 1IE4A 4I9WE 3GRBA 4JREC 4JFXB 4QHMA 5LAXA 4YHKH 4DH2A 5HYJA 1T4KA 4HS8L 1CFBA 3S4SA 5B3JE 2WTPA 1CBJA 4EI5A 1CR9L 2CLRA 3I3DA 4I85A 4P2RA 5KBNC 2MH4A 3QAZC 3I3EA 1JNLL 2ZUTA 3F7PC 1M7IB 5GGSA 4X99B 2A9CA 3GS0A 2AJXL 5EUOF 5A2CA 4F8TA 3H0TB 2Q1EA 3WKPA 2RACA 2R29H 4ZO8A 1RZJC 3VFSA 4EDXB 2XWTB 3DVNB 3FHEA 3H7BB 2UY6A 3MKKA 1NGQH 2Z4QB 3WELA 5T33L 2QDWA 5ENWA 4M8UA 1NFIA 5CSZA 2VOTA 2FD6L 3AXLB 3GRGA 3HNTL 3ULSA 4HZAA 3MBXL 3ARFD 3TT3L 5E1QA 2FLMA 1ND0B 4MX7A 4F7PB 3T09A 3FZUC 1FL6A 4UINL 4AGPA 1TJHH 4EBQL 1OGTB 5BO0D 1WFOA 1TOXA 5B39A 3WFCL 4EZKA 2VLRD 2AJUL 3I75B 5A2JH 4GSUA 5DWUL 4ZXBD 1ZT1B 3ZTCC 1MWAL 1QSFD 1KSRA 5C0CB 1B0RA 1JHLL 3CSGA 5A2LH 4N9GB 1OM9A 3PWPD 4X2UA 4PLKD 2WP3O 4JPIB 2QJDA 4KK5C 1GRWA 2DMKA 4OZHE 5CEZH 2IIJA 2ORBL 1FVEA 4IOSA 2Q76A 3S37X 1EO8L 4X6EA 1CFQB 2G3XA 1DBBH 3FXIC 1R3JB 2BHZA 4CW1B 4ZODA 4APQB 1W6WA 3T2OA 4U1GC 4QYOA 3EW3B 1MVYA 1MPAL 2F61A 3I2CH 3U2SB 3FQRB 4AGNA 5F3HA 4NQXA 1N8ZB 1LILA 4MZ2A 4N3UA 1DZBA 1R0AL 1LP9B 1LQBC 3A3YB 5D5MB 1MAMH 4CSPA 4PRDB 4OLUH 3EXJA 2XV3A 5BJTA 3CSPA 1U8IA 1BZ8A 3MBWA 1P69B 3F00A 2WSKA 4HKBB 1QLFB 2NSQA 4KXAA 5EOQH 4DVRL 5IMOB 2O6FA 4I0KA 4YHPB 5JLZA 3ERXA 1S3KH 2KQNA 7PAZA 4S1QL 4OJYA 4CADA 1D3CA 1TZGL 3UAEA 4OJCA 1EEUA 1ZTXH 3LKOA 4X5XA 3QO0B 3VXNB 2L3BA 2WBJA 1JHTB 3RZCB 1S6NA 3WEOA 3P30L 4KQ3H 4DPRA 4YC2C 3V6OC 4A67A 5KEZA 3QUKA 1OTTC 4OCXH 4FQIH 1CTMA 1KCSH 5HD8C 4P3CL 1NDGA 5I1LA 2N1TE 4U1HB 5F89A 1QLFA 2Y5QA 3F01A 5LBGA 1KCVH 3KR3H 4RRPM 4OCNC 4ONGH 2GJ6E 5TPWH 1QQDA 2VABA 2ZKHL 2F53A 1LEGB 2F8XC 4ENZA 2F53D 4P2QA 5IFJA 1R47A 4DKDC 4N9GA 1K8DB 1ED3B 2ZONA 5EC2B 3TT1H 1ZT1A 2CKBL 4JGMA 2G75B 3OSVA 3X1EA 1HHHA 4WDIB 4PREA 1E5BA 5DSCA 3HAEA 2ZP0T 2IH3B 4QPEA 4PR5A 1IC4H 1NIFA 2XWBB 3KHQA 2XTSA 2WINB 4OCSH 1ET7A 2F08A 2OCJA 5KW9L 1S9VB 4KK9D 4TLUA 4TL4A 2IWEA 2XWRA 4I5BA 2IFGA 2Z31A 1NINA 3SSGA 4P9HC 4YDJB 5BUGA 5CSGA 4HLZG 1D5ZA 1N3NA 2AEPH 5C7XH 2HH0H 1UCTA 5BJTB 2MCG1 1E3FA 3W5NA 2HVJA 1ZHBB 2VDOB 2WUBL 1AHMA 2WK2A 5IFAL 2ZF9A 1QSFB 1BIHA 2OJEA 2VLRB 3BC9A 2WXIA 3TO4A 2J1WA 2OCCB 1KBGH 4RFNB 4ODVH 4AUUA 4YQXL 1VERA 3LDBC 4GBXA 3L3JA 2R4SH 4NNPL 1T7ZA 1NC4B 4BDVA 4LSPL 1NBYA 3IFOB 2XVGA 2P8PA 1DYZA 3QIBB 4WNQA 2P5WE 4KH2A 1GGCL 1DEEB 3REWB 6FABH 2HLFD 2CO7B 3I6LE 2A9ML 3FQNA 3QIBC 2Z7UA 4IDJL 2K8QA 3QDMB 4KKLC 3ARDC 5HHVL 3T9WA 5I8KL 3IGAA 5T3ZH 1TYEB 3VFGL 5INDA 3DUHA 3CXHJ 1I4FA 3BVNA 4N8PA 4L4TB 1RPQA 4L1BA 5FGRA 4PJDB 5GPRA 1AQHA 1JVKA 1UGNA 3TWCL 4I1NB 5IFHH 3RDTB 4IMKC 1EZLA 2AQTA 1QR1B 3MLSH 1EZVY 5G4OA 1M2VB 4K7FB 1B88A 2EDQA 2E75C 4GSRA 5DFVC 5EBGA 4TS6A 2OYPA 4OU3A 1A6UH 4Z7WB 2R2EB 4PCTA 4AYGA 2ZJSH 3H0TA 1KDIA 4BFRA 3IRPX 3SCMD 4YSQA 4L9LB 5D1ZC 1HH6A 2XFXB 4YSOA 3VXMD 1X6NA 3BDXA 4ALAL 1ZV5A 1A2YA 3GXMA 4N2KA 4U3SA 3MFFB 3WBDA 1KYFA 2VWEC 3ABGA 3TBSA 4L18A 3D4ZA 4XXDA 1KPVB 5L4JA 3B2UC 3PREA 5TGBB 3VU2A 5B8CC 4C4UA 3IDIB 3IJ9A 4NC2B 1UACH 2B1OA 3O4LD 4N2IA 2HP4A 2IXQA 2G9HA 5KYXB 1CIDA 3G3LA 3UC0L 2E9IA 4B53A 1OAJA 1BBJA 2FJGB 5FKPA 2DWTA 2FB4H 5F2FA 3VGAB 2Q3XA 5HTSA 1SDYA 4R9HA 3SGEI 1IC7L 3EOAA 3QPKA 5EPMB 3X17A 2HAZA 1Q9KB 4ZUWA 5J06A 3DUUA 2J5LB 4O58L 2D31A 5C9KA 1INEH 3EO0B 2EXWD 4JPWH 2VM4A 4WJ5A 3E9TA 5EEYA 3L3DA 2I60H 3IJEA 3AREC 2P80A 3J7HA 2P7TA 2PYEB 1FWXA 2D03H 1E40A 2DKSA 5FF6B 4X6CA 4DGVL 3FFDA 1AD9B 5C71A 4X7TA 3RP1A 5DEGA 5CMAA 3LEYL 3WIHL 3QNYA 3BKYL 2DEXX 1KCKA 3BP5A 4ZS7H 1VFAA 5LCVL 2AK4D 4RWYH 1CL7H 4PTTB 3UC2A 5AOLA 4ANKA 4G8GB 1Y6MR 2X05A 1MCRA 3PXJA 4L1SA 3QYNA 1TJXA 4XNMB 1AQDB 2ZKWA 3KYNA 3UH8A 4B9JA 3W0WE 3IE9A 4RVBA 3MYJB 5DJ2B 4YAQA 4U6YA 4PJCA 3L5WB 2HG5A 4K4KA 2DMCA 5CINL 1SRDA 4J1UB 1M6OA 5LWYL 4I1RA 1BFTA 1PKOA 1CE6A 2FGWH 2R1XB 3BDYL 4OV5A 1R34A 2DKUA 3R4RA 2TSAA 1IKFH 4IGBB 4OI9A 1IBGH 1YEEH 3MROA 3DX7A 2P47B 1KTRL 1R5VB 4ELMB 1EA9C 4LIQH 3E6HB 3N43F 1WAPA 1NCDL 4P4KD 3Q0HA 2A4CA 3GFUA 4J5VA 4AL8C 1VENA 4PJ9D 3CVHB 4EIGB 4GIPD 4ELMF 3RKPA 1NCCH 4P2OA 1WIUA 4C83B 4KZDH 2WCGA 5TDNA 5FHAL 5K39B 4XVSL 4Y19E 3SGJC 3F62A 3NCFB 3ABKB 1JMZA 3BVUA 3PDGA 3RKDC 2X28A 5L4MA 3EJRA 2BW5A 1NMCB 2YSSB 4G5ZL 4YSTA 2WOYA 1G9HA 1U8NB 2R39A 3MODL 3MLTA 1V7NL 4L3EB 3FU0A 1UWGL 2B2XL 4JCWA 4BKSC 1RIVL 4XNYH 4QRRE 4U1LA 4LF3A 1YNTF 5JDSA 1HL8A 2AJ3A 4YGVB 5CINH 5IW6A 2VDLB 2YD9A 3CHSA 5KVFL 5KYWA 1DSFH 3ZJAA 1J5OH 5F1NA 3FQXB 4L4VE 3L2LA 3CN0A 4LLDA 4PS4L 4BRJA 2X1OA 2NY5L 2PWEA 3RKDD 2CHDA 3WXWH 1KNOB 1S7VA 3UAJA 2ZXEB 3B2DC 3W2DH 3MRLA 4GAFB 5FCUH 5I1CL 4M6MH 3CZSA 3FB7A 1DBJL 3QI9B 3P3TA 1NFDA 2AC0A 2Y2WA 4EF3A 1JF6A 2CO6A 4QF1B 3WFHB 4XC1H 5GGTL 3IJ8A 5DMGC 5JXAH 2FAUA 2JCWA 2M83A 3IDMA 4M56A 3FQWB 4C83A 2KLRA 5AW1B 5D71H 2W94A 4OKVA 4FXKA 2CKNA 2VXVL 3NPSC 4NRZA 2XZQL 4ETQB 3RWIA 2JB6B 3RE0A 4BQCA 4HISA 3F58H 4BRVA 1WWBX 2B15A 3OLIA 3SPVA 3CLWA 3DX7B 3RX7A 5GS0C 5FO7A 1CLOL 5I5MA 4Z3FA 2B9BA 1LO5A 1SLUA 3Q43A 5FV2A 4ZFQA 4LSRL 4P2YA 1OCWL 1YPZE 3HHSB 3EZJB 1BD2E 2XT1B 1PZCA 3P02A 5C0DB 1FDLL 1XF4B 5IVXE 2IH9A 4OTXH 1NEZG 5FS5A 3K1KC 5KG9A 3AGVA 4ZMZA 3L17A 1KTLA 2PABA 1I8MA 2VMFA 3CQFA 3H6AA 2H1PH 4U1LB 1CQYA 1DP0A 2F8IA 4TL5A 1F58L 1T0MB 3QCVL 3WG7B 5IUSA 2W5PA 1U8QA 1YY8B 1DHKA 4C54A 3QCUH 2IC2A 2TSBA 1WEJH 4W9HC 1ZDQA 3LAFA 2QKIA 1X3DA 3Q5YA 4OAWA 2YSSA 5JIPA 2EDDA 5D7IB 5EU4A 3MRGB 4FQQA 5AOMA 2P43B 3FUMA 3IFNH 5E8NB 1F11B 4AV0A 2JELH 3MRPB 5LB1A 4MMYB 5EF3A 2BP0A 2ADFL 3HBPA 1NL0H 1NLBH 4ODHL 4XNMA 2QVFB 4LEBA 3IF1A 2ESVE 5I1JH 4AEIH 1DQIA 3MACH 5FLUA 3PL6A 3QXDB 4M61A 2VN7A 4RMBA 2HVKA 1FCGA 2YC1B 5MERA 1HSBB 1OE3A 4A7GA 4WEBL 1D5MB 1KXHA 3O41A 4HCGA 4QEGA 1WICA 1BJ1J 3SD2A 4N1HB 3BRGC 2AQ2A 2FWOA 1OL0A 5B1KA 4WWKD 5LBSH 4MZRA 3L1EA 2R2HA 2GIMA 1DBAH 3KXFE 1IEAA 2ZYHA 4Y5VA 4A1RA 4XXCC 2DQUH 2HG5B 3TTYA 2GSIB 3LEXA 3BPOB 5CF3A 2QTEA 5KYXA 2EYRB 4LLYA 3WTWA 5D1QA 3WO4C 1IU1A 1F58H 5MHSD 2B39A 4R0LB 3UL4A 1YEHH 2IDQA 2H32B 2Z34A 3IDIA 4M5ZH 3CZFA 5DC9B 1DCEA 2GEQA 3P11H 1DDTA 4OZGE 2R0WH 1NEUA 1OQOA 2V2WB 2XTLA 4WHYG 4KOBA 4Y2OB 2DN7A 1MOEA 5ANME 4YHZL 3U1SH 1PTZA 2W95A 2FR4B 2H9GA 5E2VL 4UMGA 2DICA 5IBUG 3EO9L 3BGFB 4M3HA 1Q9LB 3O2VH 3EOYG 1KUMA 2XN2A 2DQEL 2YMOA 4OLZH 4OQTL 1CICA 4UB0L 2B7DT 2DBLL 2AJZB 4ZPTA 4OIAA 5AVVB 1DQDL 4YDNA 3O8XB 5DF0A 3CFNA 2DJUA 4JZJA 5C0RL 4WJ5B 2NNAB 5TQ2L 4WEBH 1F4XH 1NAMH 3G5VA 2F2HA 4KNQA 3EF4A 3TFKC 3TF4A 3QDJE 5HVFB 5K1JA 4YE4H 5I18L 5E24E 4D8OA 3F2LA 3L3KB 4NO3A 1FL5B 2OCFD 4PG2A 1XF1A 2OMUB 1Q4NX 2QZ5A 4PJAF 2AQRA 2VSDA 2K45A 1H0DB 2YWYA 5DK2B 4AIZB 4LSSH 3GJEB 2MHAA 1IKNC 2XIDA 2LFGA 5F7AA 4CN4A 2MQ0A 2OA9A 3GSXB 5F7EL 1MNUH 1X9LA 3LCYA 5LVEA 2EUXA 4N0UA 1X9RA 4IJ3C 3H9SD 5H94B 5I15H 1GTFA 2VJ0A 4GBXB 2QMKA 2EDKA 4NRXA 3WHE1 2F5BL 1U8MB 2AEOA 1KV7A 3IDGB 2W9DH 4FHJA 3PP4L 1I3UA 3GHPA 4L8DB 4CMMA 1XCQA 2IANB 1I3GL 4LU5L 4P5TA 3TBBA 2WN3A 3GK8H 1QEXA 4MKMA 4ZNEE 3MU3A 1RAMA 4X7FC 3GSVA 2VRQA 4LBAA 4MBRA 2VMJA 1CDCA 3OKLB 4AV5A 2VLKD 3BAEH 4QJ3B 2I7OA 2KZKA 3H9HA 5I0VA 4KY1H 5KTEH 3MUUA 1M1XB 2BINA 3Q8EA 4IRJD 4M6OL 4W6WB 1HIMH 5CP3H 5C0RH 2K3TA 1SGKA 1A6TB 4E9QA 1TF4A 4Y9CA 2OXGB 2JKTM 3D39D 5LGHH 5I8OH 3GJFB 4WO4C 2C9QA 3VXOA 1EV2E 3WNLA 4HEPA 5ETUB 5IVXA 4HW6A 1DVFD 2P52A 3K72A 4ZT1A 5DJ8A 5IBTL 3HI6L 5JZ7D 2QQLH 4TTGA 3LHPL 4KUCF 5D1ZB 2EVHA 5INCB 2K6WA 4DO5A 3FU7A 1JF1B 2YAQA 5CS7A 4UOW0 2J6EL 3QPXH 2FD6H 5LGKA 2XKNB 4JFFD 4Z3EA 5MENB 1QSFA 4EKJA 4LSSL 1WVZA 4LKCB 4PRHD 1DCLA 4JFDA 1I53A 3QS3A 4HV8B 1AKJD 2XUWA 2Z31C 4F2MB 2QHLA 4XPTL 1JNNL 3E8UL 5EU7E 2LTQC 4X4XB 4GRWH 1NIBA 2Z31B 1DQJA 3QG6B 5C3LD 4X98A 2J72A 4ERSH 3UIZA 3L95B 5IW3A 4FP8L 1RK7A 2I26N 1S8DB 2WQRA 3MV9D 3CFTA 3TA3B 1LXMA 3QORC 4XH2A 3R8BB 3V4LA 4BUGA 4KRMB 3IMSA 5EIVA 1TDQA 3FU8A 3H9ZA 1C1EH 4YK4B 3U1PA 4F37F 1EEZB 3QO1B 4YHIB 2YLHA 3GZOA 4XP9L 2X3AA 4QRRA 1O9ZA 3PWVA 8CGTA 3JTSA 4PY7A 4MVBD 4YSRA 1NKRA 3IS0X 3LMJL 1QLEH 1VCAA 2HPOA 1I75A 2QFRA 4B3VA 1AR1C 1CFNA 1J9QA 1I7ZB 4BV1A 2FHCA 2A9DA 5DRXA 4D7BA 5IB4B 4LLAA 1QKZL 2V33A 3LKPA 1LYQA 4J4PA 4XCFL 1OM3L 3T4YA 4EOWL 3G9AB 2P5WB 1QWUA 4HF5H 2OR7A 3WLWD 3CZGA 1JWMB 1VF5C 2F58L 2XBDA 3O9WA 1TZGH 4AGQA 1OXYA 3QJOA 4WEUD 2APBA 5EV7A 1UOKA 4U1HA 1RU9L 3K46A 3KGTA 5FO9A 2NSXA 2J71A 5C0CA 3N3EA 3RIAK 2VRAA 4BSWB 1XTMA 4OIBA 5ICYB 2Y23A 1JHKL 1OLLA 4MWFA 4C4BA 5BO1H 1R17A 2BVEA 4HJTA 1CFNB 5DRNA 5DC0A 3TT1L 3ES6A 3TURA 4XMPL 3KPOA 1PLCA 5DMKB 1W0WB 3NJFA 5IMMB 5FM8A 4G9FB 4QD2E 3IS1X 5HSFA 2OMTB 1WIPA 4QRRB 5ACMA 4HGKC 1UWEH 3EDFA 1P9MA 4WFHE 2J6WA 3P9MA 1TVHB 3FONB 3SE9L 5ES4B 5B38G 3SGKA 3KPNA 3S98A 5L9DL 1HZLA 5LNGA 2ZXQA 1Z0NA 4Z7NE 1OGTA 5IHHA 5H2BB 1IB5A 5KYUA 3V0WL 1G7IA 1XGTA 4Y1AB 3ZU8A 4UU9B 2D3LA 3GKWH 3RU8L 5C0IA 1T2XA 3KR3L 5HJGA 3TWYA 3L7FB 5H94A 1HYSD 3HS8A 2RH0A 3CVDA 15C8L 1M05A 4GXFA 4E9LA 5C2BL 4X4XA 4G9DB 3TZVB 1KWGA 1IGML 1QBML 2B1AH 5FO8A 1BMWA 2OK0L 4AIOA 2P42B 4LHQB 1GA2A 1H0DA 3MNWA 5KANI 5AOZA 1DLFH 2WB7A 3EGDB 2BS8A 4OUOA 2H8PB 4TVPE 5EIIB 5AVZB 4KRPB 5GIRA 3RDJA 3L3KA 1NBVL 2NX5E 1N10A 2EE9A 2YPLD 3DXAD 3IGFA 4DGUA 3QQ4B 4ANXA 3WN6A 4YHYC 1J8HB 4RFNC 2V17H 4MX7B 4R4BA 3VFUA 1HQRA 2AXFB 4D9RE 5IVXB 3A67H 1E4HA 2VUYA 1IM9A 4XMKL 5ALBL 2Y7QB 3RG1C 3QQ3B 5L8KB 4QLWA 1QHOA 2Z91B 4JLRB 5H4YA 5AKSA 4XVJL 1CFTB 3G6JB 1B4JL 2WB1A 5CKGA 3D5OF 2BWDA 2EVGA 1CDIA 1PD1A 1Z3GL 2DJMA 3FUHA 4PJEB 5ISZE 1CF8L 3PUCA 5DJZB 2E8YA 2XZZA 1L7TL 1I1AC 5F7MC 2FSDA 3P54A 5AQ0A 1AMXA 4K5LA 5KVEE 3NA4A 5EU6D 2XC8A 2W60B 3QUXA 4MNQD 4A7SA 3IK2A 2CUIA 4QCIA 5AWNH 1H3UA 5CLTA 4PG2C 2PO6D 1E9QA 1PZAA 4QI3A 3STLA 2HFGH 3SN6N 3QIWA 5I16B 3K6NA 3KH4A 4NJAH 1PVHA 3MV8D 1F56A 3EYSH 1E2WA 2GSIA 1YEKL 4NUMA 3L4WA 2Z92B 2NY3D 4X6DA 2ENQA 4X80H 5T3ZL 1UACL 4A2MA 5I8KH 1G7LA 1RVFH 1DVFC 1D6VH 3IGUA 4N90D 5JZ7C 5BV7L 3B2VH 2PR4H 4ZSOA 1I1FA 2F5AL 2EH8H 3A4FA 5DVMA 3J8F7 2A6DA 4PJXE 3WNKA 5KN5B 4AQ1B 4FL4C 2K4AA 3MBEB 5F88B 1HNYA 3GLZA 3L1GA 4JE4B 3F6IA 2Z93A 5FA3B 3DIFB 4MS8D 4PSRA 3MBEC 4U1JA 4K9JA 3Q8AA 3BZEB 5CZRA 3TYFA 3U9WA 4LNVA 4G6ML 5GRUL 4CU7A 4XP6L 3ABZA 3O9WC 2CXGA 3AQDA 1MWAB 4WU7B 4Y16B 3VGAC 2KKQA 4Y5XB 4NN7B 1LLAA 2CCWA 1G9NH 4TNFA 3DGCR 3UZEA 1QVOA 1FIGL 43C9A 5FM5O 5DS8A 2ZXCA 4UQ2B 2YXVA 1BQ5A 3GSWB 3MO1A 4GAAA 3NEOA 1YY8A 2J5LC 3LNGA 3DI3B 1FF5A 4RMSA 2J4WL 3ESOA 1O7DC 1LDSA 1UM6L 4ZMLA 1CPUA 4FD0A 3SZ6A 1A7NH 4NYLA 1HCZA 4DVBA 2EIJB 3TCLA 3BH4A 1BLNB 1RVFL 4XVTL 1HN1A 4X5LA 1JFQH 5J1SC 1G0DA 2PKDA 3L7EA 2EDFA 2FWOB 2JLPA 4HWZB 5H4ZA 4B96A 3N04A 2PTTB 2X6CA 2ZWLT 3MREA 5BUAA 2NR6D 1FIEA 3A21A 3VUAA 5I1KH 3T3ME 1AZVA 3W0WD 4HPYL 1C5DB 1VADA 4A2LA 3ALPA 2AV1B 2A7BA 2ENYA 1IM3B 2HLEB 2WNKA 3WGUB 2VH5L 1WBXA 5AL0A 4QGTA 1FLRL 4MQXC 4JGJA 5HDQH 2V6HA 4FE9A 5IHUL 2CO6B 3ARBD 4Z7WE 3ARZA 2FZ3B 4M5YL 2PWGA 4J8RA 3BH9B 4ZS7L 1RPKA 2HJFA 4E41D 3ZR5A 3HAEG 4X9YA 3HLKA 3C5XA 4HS3B 2B5IC 4TYUA 5I26A 4JO3L 5FHAH 1U9KA 4S1RL 4MGXA 4DN4H 3VQ1C 2XDHA 3H3KA 4HFUL 4PHXA 4UMSA 4YLBA 4NZJA 3ZE0F 3D0LB 3EHBC 1U92A 5DVKA 2GQHA 5IW6B 3U0WH 4P9HH 5I1IH 3C09B 4MXQD 1DUZB 1LD9A 3Q01A 1YZZA 5T1LB 3UZQA 5C0BA 3ML9A 3BWUC 4P5KB 2E7HA 3DRTA 3ESPA 3MRBB 4TVUA 1MHHB 1HE8A 2V8LA 2NCMA 1IKOP 5BQ7A 4ENEC 1W16A 4NO5A 1HAWA 3D8MA 4P5MB 4P57B 4ZFGH 1KELH 1ZWIB 4BCZA 4HIXH 3SGKC 4XPGH 2XBTA 4UTAA 4QNPE 3ZRFC 3US9A 4X4MA 3II3A 1QBLH 4ZFZB 3RIFK 3V4PB 3D52A 3QE5A 3OC5A 1IAIL 1U8HA 3ME0A 3F7LA 4FJ6A 4NRZB 1TZHB 2BOCB 1C16A 2BVOB 3VWJC 2J44A 4NKMB 2YZ8A 4JG1H 1TQCB 4C4KT 2F54D 3VWJB 1BMGA 3WTYA 1CXEA 1WAAE 4H25A 3MJ7A 1NCAL 2HJLB 3LJ3A 2H32H 4OF5A 3MROB 4H0LC 4G7YL 1QSZA 2ZUQB 3PJLA 4JM2A 2WGNB 5HHOB 1KBWA 2X44D 4WCYL 4S0HA 3X1BA 3DX8A 4NPYB 2ZG3A 1QRNE 2ADJB 4Z7VF 4PB0H 5GS0H 1G1CA 1MREL 1ETZA 2BNRA 2OP4L 1CLOH 4LLDB 3OB8A 4PJCB 2EDXA 4Q2ZA 5E94A 4YGVA 1T04A 1OAZH 3F83A 1CLZL 1OCCB 3PV6B 2E46A 4PJ9B 1BF2A 2DQIH 3VVVA 4AQAA 5JQHC 4NKQB 2CE6A 4M48L 3QWRD 2BRQA 3RL1B 2X1WL 4FTVE 3S35X 1MFBL 3TBVA 4AL8H 4UTAL 1GTNA 1MN4A 2A83B 3MRNB 5BRZD 4FULA 4X50A 3JBG7 2WBJC 4RAUB 2EE6A 1JNHB 3TNMB 4KQ0A 2D7TH 3P0VH 4NQCD 1M6UA 2QQNL 4MLSA 4QRBA 1KZQA 4MDJB 4NUGL 4MDIA 3UZVA 3VXRB 1H9VA 2CR6A 3AG4B 3VMPA 4A7VA 4MXVF 4PJFA 3NK3A 4DSYA 2N59A 1FG2B 4YZWA 3QZBA 4ZFFB 1A6VL 2K6YA 4HUUB 2OQJA 3ZE1B 4PJBF 3HMXL 3DRQA 3VD1A 4L8BB 4BA0A 3V0VA 3ZHKA 3X12A 2R2CA 2F68X 3VH8B 3TP4A 1NL0L 3ML8A 1FBIL 3D33A 4Y4FB 4JKPL 1Z9PA 3F65A 3MACL 3VX0A 2CD0A 4JR9L 3CMGA 5TQ0L 5DR5H 5JHMA 4TUKH 1TZHA 1M6OB 2P49B 1BQHA 3QPQD 1G1YA 1YYLH 1I82A 4LCIL 1E30A 1ZY9A 1BVNT 1AXIB 1IQWL 1T6BX 4JW3A 1SFDA 2XTJD 3OJDA 3HLAB 3WNIA 2RFXB 4FQ2L 2UZIL 1WEJL 3LXAA 3FQUA 4JN2B 1BX2B 3LXUX 4HKJB 3HC4L 1FO0L 2W8CA 2W88A 3BLPX 1AXTH 4OGYL 1I8IA 3L4VA 4PMEA 1OAYH 3T0VA 3FFDB 4OFQA 2JQZA 3WXVH 1D9KA 4XTRD 4WUUE 5I1AB 5FECB 1T7XA 2I9LA 4JDVB 4LBEB 5T3ZE 3C6LC 5FF6A 1A1MB 3G6JF 4PLJC 1S7XA 1BOYA 5T1MB 4DP5X 4LPWA 1KN2H 3TYFB 3QZLA 2AQSA 4LOUC 3BE1H 3NACL 3O6KL 3FO2B 3EO9H 2VDKL 3GS4A 2GI7A 3ESVF 2QSTA 4WKXA 2Z93B 4IBWA 4FEMA 5C9JA 5IZ7A 1FBIH 4KROD 4TPRH 1B0GA 2YMXH 1XD1A 1RZIA 4OB5H 5F7LB 1QO3B 5GQBA 1DVZA 2H3KA 3KZ8A 3MLYL 2RAMA 3F7YB 4BK5A 5CD3B 5IIEB 4A04A 1IM3D 3BVDB 3UJJL 1PFOA 3QJHA 1GC1L 2K6ZA 3LKQA 5FKPB 1FAIL 3FQNB 3VNYA 2V2TB 2DQGH 1WH0A 2VW7A 2W65A 4AYFB 2PXYA 3VXUD 2MEJB 4UIMA 1T5XA 3K2IA 1FYTD 5L6YL 2ZUYA 4DEPC 1NC4A 2OMZB 5CP7A 3E6FB 4LVNB 3OAZH 4QRUA 5E8EB 3L4TA 3WFBH 4Y5YA 2X1PA 3GBNL 1IGJA 2YD3A 1VPOL 4DVBB 1PSKL 2WWKO 4HG4J 3BWUF 1HH6B 2MNJB 1PZSA 1XSJA 4P23C 4M5SA 2ILLA 4EUPH 5DMJB 1CGXA 4Y7OC 1NC2A 4TM9A 3C60D 4PJ5E 4RA3A 3DMMB 3E3QC 5DUML 2NX5B 4IS6B 4I48A 3KGSA 1LE9B 1KLUA 3HG1E 3PDDA 1LWHA 3VD5A 1XH1A 5L88H 5KBLA 4ZOEA 3NPZB 5D4IA 4JFPB 4E2OA 1I31A 1H3XA 2P8MB 5JO5A 3NCBB 3UO1L 5LXGH 4I18A 1ML0A 3K1DA 3P9LB 1H5BA 4UF7C 5DSCB 4RMQA 5I8OL 5LGHL 2H8PA 1FAIH 4U33A 4GBXC 3GSQB 1U8KB 2CLVA 1KTDB 3CBKB 4KKPA 2JCCA 4MCYA 3CLFH 2X3BA 1MNUL 5EULV 3WY3A 2GJZA 1PW3A 2NW2A 5I8CA 2AV7B 1QYGL 4ODTL 1QTYT 4XBPB 5EZJA 3W39B 3UP6A 5HDRA 2AEQL 4W4NA 5F89B 1OPOA 2X88A 2NY3B 2Q20A 1AR1D 1N5YH 1JNNH 3MRFA 2FUTA 3I9GH 1BM7A 1ES0B 4F9LA 4KNSA 3LKOB 4X5XB 4G3YH 4UQBA 4OGAC 3DVGB 4AQ1C 3IVKB 1B4RA 4PRIA 4XN2A 1PJ9A 4I3GA 4UDTB 2PO6B 4FKHA 1JNLH 5G4MA 5BZDB 4EZJA 4YX2H 4FC3E 4GW4B 3HPLA 3QJZA 4A2HA 4BK4A 4F8LA 4LCCC 3HI6H 5DJ6A 4PRDA 2DYPD 4I5BB 1MCCA 1YY9D 4QYAA 1HFUA 5DRNB 2QL1A 4LQFH 4TULH 3G04B 1EQWA 3R1GL 3IXTB 4XP5H 3QFDB 3LPPA 1CI5A 3LVTA 1WTLA 1A1NA 2X9YA 1XZWA 4ATTA 1YG9A 5GJSL 3QQDA 1E3ZA 2X6UA 3H54A 2M8XA 1HSAA 2CDFB 4DGYH 3KPRA 5J11C 2YRPA 3F5WA 3BPLC 4C4KO 2IADB 3MJ8A 4B6ZA 3UTOA 5BCAA 4FQLL 5D96B 3B9DA 5E51A 2R9HD 4FCHA 5F70A 2OMXB 3BZDA 5HHQA 2DEYX 5EIIA 4FQIL 3RVTD 2GIYA 2VXSH 1FYHB 3MRRB 4YHKL 2XV6B 4IIQB 4QOKE 1B0RB 2JJWA 1IAOA 5BOJA 3MOBL 1N70A 1XGUB 4FXTA 3E80A 4KTDL 3RZCA 3DK0A 2ZYSA 2Y1ZA 4FQJL 5T5FL 5B39B 1OAXH 2X4OA 3BX7C 1SN2A 2ORBH 2D7NA 3U7WH 1AR1B 3QUHA 5FA4B 1EMTL 2QVIA 3KVPA 3N0AA 1U91A 3FQ1A 4WHCA 1UT1A 3HHRB 3UGUA 5BZZA 4M03A 2DWXA 4XPBH 1XGTB 3N44F 3SYQA 4A37A 1UQSB 3WHXB 5JXED 2Y9RT 5LCVA 4FFYL 1O75A 4NUQA 4FQXC 1V54B 5KVEL 2E76C 2Q7YB 4L4TE 5F3HB 3PIQB 4F5CE 1SYVB 4GO6B 2O5NA 1Z6JT 2D0HA 4NDMA 1BQHG 3PAVA 3MC0A 5JW3H 2LABA 4PV8A 2OMTA 3GZKA 4R7VA 3IMRA 3U2IA 1WV7T 4M4PA 1ZPUA 3OX8A 4PGBA 5T1DH 1BZ9B 3LN5B 2LV4A 3FT4B 5DWUH 2DQTH 9PCYA 4FNPA 3KLKA 4KK6C 3VXRE 5FW6A 2MCMA 3C09C 1KYDA 5I1EL 2FYYA 5IMKA 1WC7B 4ONFH 4QHMB 3UTTB 4FHBD 1HAUA 3OLDA 3CWGA 4KJWD 2JJVA 4XXWA 5JIIA 3QDHA 3G6DL 3WS3A 3QIWC 1XGUA 1TQBC 5TJWK 5IROD 3IU3B 3KNBB 3OLEA 3V9CA 3DUSB 4LKCA 5T5FH 1VZHA 1EJ6A 3NT0A 3SKJH 1JXJA 1P84K 3CCHB 1MUJB 1AACA 3BOVA 3HAEH 2V7HA 3MJ8B 1MCSA 2BC4B 5CSBA 1FP5A 1BQLL 1IM9D 4PY8J 5KBMA 3AG2B 3K8LA 1NFIB 5CSZB 3SE8L 2FRGP 1BJ1H 4HUNB 5JOFA 3L54A 1M57B 3DBXA 5ESQB 5DRXB 4JNXA 3EJQA 3L9RA 4Z7VA 1S2EA 5E99H 3EO1B 3NFSL 4FXGB 4XAWL 3VW3L 1SM3H 1NEZA 2OZ4L 3U4BL 4S1QH 5GGSB 4MASA 2DQTL 3FTGA 1M71B 4L0YA 1MDTA 4UM9D 5IVZA 5EBWA 3CE1A 4KPHL 2VC2H 2HKHH 2QSCH 1NDMB 4HWBL 4LDEB 2EYSB 4L9DA 1QSEE 4JFXA 1UCBH 5A3IC 2EEFA 4RH4A 4ISVB 2ICCA 2O6PA 3GHBH 3ZGIA 1KBGL 1X7QA 4GMSL 3X14A 2XRAH 2BHYA 4WV1A 5TPWL 1DLFL 4KKAD 4NHCL 4LCWB 1HINH 4GUCA 4JY6B 3NCMA 1CU4H 1U2CA 4QHLB 5T3XL 3U0PA 5KJ7E 2H6OA 4W4OA 2AK1L 3HE7D 2VL5A 1KG0A 2ENJA 3SQBB 5FM4A 4F24A 2QEJA 1T5WA 4ANWA 4IDJH 1BG9A 1W8OA 3SE8H 1JZ3A 3FO9A 2B0SL 1F02I 4E9TA 3HB3C 3ZTDC 4ZOBA 3ULUE 4AZUA 4P23A 3TPUA 3RI5F 5HHME 3VFGH 1B4JH 3T5WA 1RPUA 4MJHA 2CDEA 4HYTB 5GS1C 3K6IA 1PZ3A 5E8PB 2KLTA 3DV4A 1U95B 1DVFB 4GRLD 5IB1A 1T22A 3QZNA 3D39B 1N2RB 1QFUH 2FSEA 4YDVB 1LDPH 4K94L 3P3UA 1GS6X 2C8NA 5F9WC 4NQSB 1A6UL 4AE0A 1M1XA 3EH4B 3IDYC 1KYOJ 1R3LB 2VM9A 4YQXH 4WZ9A 1D5BB 3JWOL 1G9NL 4DP8X 4MA7H 3IJSB 4GEJA 2X89A 4FYRA 3PQYD 4ALAH 4PY8I 1CURA 1DR9A 1KJ2B 4Z78A 3D2UD 4LK4A 4YL4A 5TE4H 4IHOB 3C6EA 5BOPA 1CL7L 4GAYB 2X4TB 4HBCL 2VXQA 2Q7YA 5E4EB 3K6DA 3RTQC 4JM4H 3O6FA 5HY9A 4MS6A 4KKRA 3AY4C 5I6OA 1Z9NA 4L23A 5E5UB 2MTAA 2ZKYA 3HZYA 4MNHB 4AT6B 4TLTA 4CVZA 4UI2A 1AY1H 1MIEH 1J7VR 4L1HA 4KGLA 3C5ZA 3GO1L 4IDLA 5CEZD 4XMWA 3VFNA 1UM4L 1F3DJ 4HC1A 3WO4B 2A4ZA 4YBQD 3IGLA 3CV5A 5EDXA 3GINA 4O58H 1ZSDA 5F9JB 1AP2B 3TV3L 1HI6B 5GJTL 1FCCA 1NUFA 3G5VB 3H8NA 2A6JB 1QWNA 3BPNB 2Q86A 4E41A 2YARA 3JVGC 3KPPB 3SPGA 4L29B 3SD5A 3BD3A 5EU4B 3ZZ1A 3H3PL 4EVNB 4RMVA 1HNGA 2G2NA 3H42L 3GSOA 4JHWH 5ITBH 5B4MD 2YSTA 4XVSH 5EORH 4AJYV 4ZPTB 3SYOA 2BCKB 2VDPL 4I13B 3U0TB 3EBIA 3MRDB 3SCMC 2VXQL 1NOFA 5CU5A 1KCWA 3C5SB 3VWJD 4WO4A 1N5AB 1UEYA 4G5ZH 4YEEA 3KM2A 1I8IB 1CT8A 3I02A 4WFFD 1IE5A 3A4AA 4GRWF 4OSUL 4PJ7E 1MW1A 3GLDA 3UYPB 3GJFH 5AW4B 5KSVA 1MJ8L 1E7UA 4C56A 2O5YL 4TLKA 5AKRA 1FAKT 3MRIA 5E5MA 3VO0A 1MEXL 4AKQA 5J3HD 4HZ1A 2GJRA 4UV4H 5F9AC 4JGUA 5JHAA 3BW9B 1T1XB 4CU6A 1F97A 1G7JB 2ESVB 3B7SA 3HRZA 3SPVB 5DC4B 4CBPA 4GMTL 3ZIMA 2W07B 4EPSA 1PYWA 1QHPA 2V0AA 2XA8H 2LQRA 1KELL 2VH5H 4BZ2A 1ZA3A 2CNYA 3HUJA 4H20H 5MEQA 4KKNA 1CTOA 3FQWA 2Q8AL 3QRGL 2FECL 5TTRA 3KLDA 4OIIH 4PJ8D 1EAJA 1TVDA 4CSZA 3VRIA 2OJ1A 2EIZA 3D87B 4PB9H 2EIKB 3MLXL