2BSBA

E. coli f17e-g lectin domain complex with n-acetylglucosamine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
176
structure length
162
Chain Sequence
b'AVSFIGSTENDVGPSQGSYSLPFVYDTGYNIGYQNANVWHISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17G ADHESIN SUBUNIT
publication title Impact of Natural Variation in Bacterial F17G Adhesins on Crystallization Behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 38
structure length 162
sequence length 176
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 2bsbA00
3F6JA 1O9ZA 3F64A 2BSBA 2BS71 1O9WA 1O9VA 1ZK5A 1ZPLA 2BSCA 1OIOA 4K0OA 3FFOA 2BS8A
chains in the Genus database with same CATH superfamily
3OZLA 4WHYG 4OZFG 1ORQB 2Y2WA 3NCJL 3KJ6H 4XCYB 5DYOA 5KSAC 2NY6C 1VKXA 5DMGC 4HUCA 5C08B 4X5XB 1S3KH 1RU9L 2OJEB 1WIUA 5HHOD 3BLPX 1TVHB 4HV8A 2ZSVB 5CGBA 4KPHL 3QAZC 5EOQL 4C83A 4FFZA 1OANA 1KJMB 2K70A 1KJ3H 3RWIB 3CFBA 3OR7B 2WGXA 1SF5A 1MWAH 3MX0A 4FQCL 5SWSA 3NA9H 4N85A 3BPOB 1PZ2A 1BM3H 1QLFB 3V7AG 2NY0D 4KKLD 1XTMA 2ZCKH 4CVUA 5EBGA 4KK9D 4WNJA 2CDEA 4L3CB 3SQBA 2FJUB 4PCSA 2PKDA 2NDFA 5EEZA 2NQDA 4EI5D 3RTQB 5F9DC 3S96A 1U93B 3FQWA 4E42B 5HGHB 1CBJA 3LN4A 3LPWA 4B5ZA 2RHEA 3RVXD 4J6RL 1WBXA 3AT9A 4K8RC 1FAIH 5CZRA 3KAAA 1N10A 4ONHB 3RPBA 4GSQA 1WIPA 3V0DA 1JWSB 4FQIH 3MOAL 4GAGL 2EDTA 4CN6A 1A47A 2ICCA 3QFDB 2HPOA 3MLPA 2BHFA 2FGWH 3JWNC 1BG1A 4NQED 5KVMC 3NSXA 1BVKA 4Y4KD 2FR4A 2E9BA 1MREL 1PG7H 4N8UA 4ELKB 3HB3B 5IW3A 4Z8FH 5I1HH 3V7MA 1JD9A 3L9RB 3GBEA 2XLLA 4QXWA 1Q0YH 3G5VB 5KSVA 4OZFB 5AVVB 3FTSA 5BV7C 3WN6A 3NTCL 2FQGA 2IPTH 4WHCA 1SMDA 4PTUA 2ADYA 5ICYB 4MCZB 4FFTA 2C9AA 3U79A 4AENA 4I0CC 2CHZA 4PJ8D 4UQEA 4HC1A 2OP4H 5EEYA 2XPYA 3HBZA 3CSPA 4JFUA 4L29B 4RAUB 4Q56A 3NG5A 5CU9A 3A6CL 4F5CA 3SDAD 5LWYL 4P9HL 3HN8A 3D30A 3VSTA 1FFPB 2NMSA 2YFOA 1Z0NA 5F9WB 4X50A 3GUFA 3GINA 4LPWA 1ZT7B 2EE6A 5IHBA 1L9MA 1IKNC 3GD1C 1HKFA 4FJYA 1EUUA 2A9MH 3QDGA 5I2IA 4ZO6A 3AITA 3ETTA 1L9RA 1QACA 3GJEA 3O3EA 4KDTA 3EDFA 3NCMA 4LSRH 5CEZL 2R0ZL 1ILSA 4XNZC 3HCVB 2PP9A 1OCOB 4QT5B 2GJRA 3MR9B 4PJDA 4NO5B 3HHMA 2ATKB 2K9UA 2Y36H 3QO0B 3S34L 1J5HA 1E6JL 1AD0A 2O6CA 5IJCC 3CHOA 2OYKA 5CO1A 1F58H 2ZG1A 1E5BA 1P5VA 3PXLA 4EZLA 1BLNA 4F7TB 2OM5A 3MO1B 4YSSA 3GNMH 3HZYA 1O6VA 4XHJC 3RPIA 3BKCL 2VDLH 4WFGD 2A74B 1T5XB 1ADQH 2K6WA 4TUOB 4N2AA 2R4RH 5ANHA 1PD6A 1EAJA 2X4RB 4YDKL 1A9EB 2JTYA 2YAPA 3TP4A 2NY6D 4OLWL 3IVKB 3O4LD 5DMGD 4F7MA 4X4KA 4R5VA 3MREA 2DICA 5GGTH 1XL4A 2WKOF 4RMBA 5IB2A 3T6QC 3UBGA 3DUSA 3BAIA 3H2WA 3M8OL 3SDCB 2NY3D 4OCLC 3VI4A 3B2DC 2VUKA 1TLKA 1YN6A 3BH8A 4P07A 3PHOA 3UTSD 3O6KL 4P2AA 3I6SA 4D0CB 3QIBA 4W9KC 1I9IH 5E6IA 2HJFB 4PGBB 3GYRA 4Z7VA 3MLXH 4N1HB 3DJSA 4Y5YB 2TAAA 3BSGA 4H0IA 1J48A 2OXHB 4MYWB 4TRPH 3T6WA 3ESNA 2AQQA 2F8IA 2WXJA 1CGVA 1OQOA 3D9AH 2LW3A 5GS1C 2HB0A 4G80A 2XN9A 1KXVA 2OSLA 1AZZC 1G9NL 1MLCA 3IAQA 4APQB 4KNQA 3CX5K 4B41A 2NY7L 4FFYL 4JO5A 5HPMA 3M1OA 1WH0A 2GBUA 1N5AB 4ZXBC 1NCWH 3V0WL 3BZDA 1UXWB 2E46A 3EDKA 4P2QB 4KPHH 5EOQH 4PMEA 2D3NA 1S9VB 1UOLA 3T0AA 4YH6A 4KMQA 4MJID 4IYKA 2IDQA 2E76C 1M05A 4L4VB 2ZYIA 2B5IC 3SO3B 2AXHA 4XP4L 2PCPB 1NGPH 4XVJL 3V0FA 4KITB 3AXIA 4JRYB 2ZX6A 5F97E 3RUGA 2ALAA 4ALAH 1QP1A 2OTWA 4XOCA 3VRIA 4ELMA 4LSQH 2OCFD 5ADPL 1A4KB 5K9KB 1OALA 4KUCF 5IBTL 4HEMA 5E56A 4AY0A 1MOEA 4XNYL 3WELA 1D7BA 1KJVB 4R83A 3H4HA 3BI9X 1ZK9A 2DYSB 3VTAA 3K80A 2JF1A 5AOZA 3ZVVA 4AMKL 1GZPA 3LKOB 2F61A 3TO2B 3MRRB 1CFTA 3RA7H 3ARZA 2R9HC 5FOBA 3IAGC 4WWKD 4A6YB 5EDXA 2VZSA 3FT4A 2P45B 4XH2B 3TBYA 4Q6KA 3P0VH 5AYQA 5H8DA 1PAMA 1XGQB 4PLOB 3INOA 5IBLC 2ENSA 5F1KC 3DRTB 2L7EA 3BUDA 1P53A 3KD4A 4HJUA 4KC3B 4I3GA 4U2YA 4AYID 5FKAA 3RNKA 2ZPKH 5JW4Q 3PV6A 3WS3A 4YSUA 3BYTA 4HJSA 1J9QA 5KW9H 5KS9F 3UADA 5C7XL 2DW5A 4Z7AA 3V8OA 4X7FC 3EW3B 2PCYA 3B8SA 5DZPA 4XR8C 4A6YL 4AW7A 5CEZE 1A7RL 3ZYIA 5C6TH 2QKIB 3B7SA 2BY2A 5HHVL 1PY0A 3WNNA 1H8LA 4H8WH 3B7TA 1ZA3B 1M6OA 2XYBA 3D0VA 4WI0A 3FZUC 3QRGL 4L37A 2X41A 4MBRA 2TSBA 1JV5A 1CL7L 1EHNA 3N06B 4YIQB 1IKFH 4W9CC 4XXDA 3V7AE 3G04B 3U4EA 1T4KA 3BN3B 4P4KA 3PJLA 3GDBA 2NDGA 5GGSY 2R2HA 2YKLH 3RTLA 4K71C 3VD9A 3BWZA 1RPQA 1CFVL 3DSNB 2V5SA 2XDHA 4QTHA 1CT8A 3ROLB 1LE9B 4PJAF 7FABH 5H37H 4X7TA 5FCUL 1BQRA 1NCJA 3KL3A 5IOPB 3FU7A 3BWAA 4JN2B 5KSBB 5GSRB 1NOAA 2CRZA 2ZUYA 1G43A 5DQJB 3VQMA 3Q5OA 2AI0L 1YN7A 5DWUH 2OSXA 2W88A 4HWZA 2EDJA 1E6JH 4BK5A 2ED7A 2D7OA 4BFNA 5KYNA 4GNKB 1QSFB 5INCB 3K2MC 3QI9B 4QRUA 1YEEL 5BQ7B 2DMKA 1HL9A 3SQRA 2OMZA 4X4ZA 3V95A 2GCYA 1DQDL 3TPUB 1GR7A 3T2NL 4C58B 4HLEA 4HXAH 1DVSA 1M71B 3V52L 1S7SA 4M7KH 1WVZA 2YJLA 1OCRB 3B3BA 4YDKH 1UA7A 4GG8A 5IVXE 4EE2A 2P52A 2DIJA 4GIAA 4QJ3B 3DTXB 3TONA 3VXMA 4HUXA 2EH8H 4B9KC 5IHLB 4XPGH 1LE5B 2BDNL 2EEAA 2AVFA 2UWEA 3IXAA 5T33L 2JB6A 4BXSV 4JFSA 4XPHH 1MH5A 1XGUB 4JFPA 1GS6X 3D2UB 5KBPA 4PWHA 1XF4A 3LZPA 2O61A 4NN7C 4ZYKB 1UKQA 1NCCH 3I6KB 3VWJA 2WWKT 2B1HH 1PIGA 2MHAB 2QEJA 3EF4A 2EXYC 4QHLB 4PRPD 3LKPA 3R19A 3HVNA 4GOSA 3TNMA 1R9FA 4OJFH 2EYRA 2R1YB 1K72A 2JLPA 1A7OH 1E4KA 2AXGB 1QBLH 2NY7H 4FFYH 1VGEL 2JLLA 3N0AA 5IQNA 1S7UA 2Y1ZA 3WO4C 3QZWG 2A6JA 3V0WH 2VGLM 3U1SH 3Q06A 4HYTB 4YDVA 4DCQB 4HIEA 1FZKB 3QHFH 4PJCF 4ZO9A 5HDLA 3UJTL 2R9HD 1EJ6A 3HE7A 5ANMA 3TEXA 3U36A 3DLQR 3OJDA 2XWJB 4GIOA 3BQUC 5LHDA 3FO9B 2ENYA 1A1MB 4JPKL 5AVRB 2E7BA 4L23A 3U25A 2ZAHA 5JO5B 1YZZA 2CJTA 5A43C 2J72A 4JRYE 3GSVA 4NHUB 4XVJH 3G6JF 4EXKA 4YHIB 4K23H 1OW0C 2J1XA 1KCWA 5E4AA 4NKDB 5D5MB 5IBLD 2ADIB 3JWOH 1UOVA 4WTWA 3L3OA 5I6MA 3VG9B 1AKJA 1FVEB 5C2UB 4M9PA 1UXSB 4I18B 3SY6A 3RIFF 2ICES 4L1SA 5F9JB 3CFKA 1EERB 1OAYH 4HH9A 1KIQA 2JIXD 2FWUA 3D05A 4NWTH 3PABA 2V7HB 2VOTA 4GUPA 5CS7A 3BSHA 4BGDA 3GXIA 2XVKA 4MMZA 5FM8A 1UT9A 2X2YA 2WXIA 1IARB 5T1DH 1F4YL 3FZUD 3UBXG 5EO0A 1JF1A 5DUML 4YAQB 4S2SA 4PJEB 2CHXA 2UZIL 2ZJSH 1R47A 1BIHA 3T3MB 5GJSL 3LZFL 5LO7A 2F5BL 4X4YA 5DUBA 4KXDA 5C70A 1S9XB 4IS6B 5EBMA 1XD1A 3QS3A 4NZTL 1IAMA 2NUPA 3KS0J 1OAZL 2HWZH 5HTSA 5KBDA 3LZNA 3MRLB 3MA7A 4YHNB 3BUYA 1MI5D 3NAAL 3QZWB 4D94A 2HYMA 2XVBA 2P8PA 1EQWA 1IE4A 5HI4C 2MNUA 3L4ZA 3A22A 2COVD 5HHVH 1EXHA 3H9SB 4K15A 3S36H 3P3RA 1O7DE 3MRQA 2V37A 3FQTB 4WRLA 3ZXAC 2GK2A 3UAJA 4AGMA 1BD2D 3QRGH 1NEUA 1SRDA 4BYHA 4GKSA 4KQ3H 5HY9A 1M1SA 2OULB 5EIIG 2G0LA 3QISA 3W39A 2P3YA 2WQWA 2IALA 3CQFA 1SEQL 3HE6A 1OQXA 3WMQA 4Z6AT 3RZCD 4Z3HA 3GRGA 5E6UB 1ZVSB 2DZEA 5DMIL 5BPPA 2AXFB 1AQDA 1JWUB 3CHXA 5E8NB 4RX4A 3DVNA 4U05A 3MV7B 5CIPA 2DH3A 2MKWA 1WD8A 5D1ZA 3VXUB 2Z1PA 2QGBA 3G9AB 4FTDA 2A6KB 4HBQA 4AEFA 1MCQA 2FT6A 3TIDA 1Y0LB 1CUOA 4WUUA 5DVNA 3UAEA 4K9EC 4FYTA 1HHKB 4DKDC 3RQ3A 3BSZA 3TOPA 1KIRA 4NRXB 4P23B 4XBEH 4Y2DA 4PJXA 3CFMA 2Z8VC 4NDMB 5DMKA 2KPWA 4V1DB 4JPQA 4X8GA 4YXLL 5HBBA 1ZANL 5IMLA 4RGNC 3NUKA 5JXEA 4LCIL 5C0IB 2B7DT 5I71C 1DJHA 4MA8H 3NMEA 4FG4A 2EXYD 4A68A 1RUAH 3FTWA 2PTTB 5E6SB 1TXKA 2XNAB 1SNRA 1RJYA 4YGVB 4EEEA 1FUNA 4EDWL 3QFJD 2OAAA 2H6PA 5I76A 4U31A 3D69A 4IHBA 3RJQB 4XNXL 1UG9A 5FDWA 2AZUA 4WGWB 4U1LB 1EEYA 2WOYA 4RRPM 5FOJA 3MFFA 4FTVD 3BQUD 1CFSB 2B1AL 4M8UA 5FO7B 4KZDL 4QTIH 4OZGA 4X8XA 5EIIB 3Q2CA 1R3IL 5GRJH 1S5IH 1AJ7L 2J21A 4FMKA 3KH3A 1VFUA 2XXGA 2MJWA 2AK4E 4HZ1A 3S3PA 4E9QA 1A8ZA 1NGZB 1D7DA 3JSSA 2FB4L 4PYHA 4ZFFA 5CR1A 3N44B 2J44A 2DJUA 2VXVL 1KG0A 3JV5A 4F1SA 4MRBA 3H3KA 2IBBA 2QADC 1UWYA 5J8OA 4MQTB 3ISWA 4OGXH 5JDSB 3EGDB 1G7HA 5T5NG 2LABA 3HLAA 1OP5K 2ICWA 5EEVA 1RZKL 4HSQA 4W4OC 4FEMA 4JW3A 4BEIA 4QRAA 1OP5H 3K6DA 1B88A 2ITDA 3KPTA 4XO5A 4OF6A 3ULUD 5I6LA 2Q5BA 4JX0A 5FUCE 2NTFB 3QJUB 2EO7A 3BCFA 5EOCL 5L9DH 5LQBL 2A1WL 2DDQH 4JFTA 4ZDHB 5IBUB 3B6SB 5HYJA 1FIGH 1T0NB 1UB5B 3QAQA 4WEMB 3EJCA 4HFUL 3ZSSA 3K4DA 1ZA6A 3QUZA 3RWJA 2R27A 2J8UA 1FLRL 2FJHB 2YQBA 5DK3A 4TTGA 3UYPB 2C9QA 1DFBL 1YECH 2PWGA 4QI3A 4JHVA 3RY6A 3L7FB 1U3HC 1PG7W 2H5UA 4X6DE 3APMA 1QW8A 3TYGH 1K9TA 1F4YH 4PJEE 3VGHA 3O8XC 1I7TA 4G5ZH 1A0QL 4HQQL 1GXEA 1HL4A 5D96C 3H42L 3LZFH 4ZD3L 2VL5A 1UD6A 2BZDA 3AREA 4PCYA 5T1JA 2AFNA 3BZEA 5IT2H 5LGHH 1JPFA 3BDBA 3PNWA 4PJBB 4ZAKB 4B0MM 4C54A 3UDWC 2MTPA 4WHTA 4A7SA 1FG2B 5K59E 1VFAA 4DETA 3GSRA 3QULA 2GHZA 4R8WL 4EBQH 3NAAH 3DA0A 4HUNB 2ORBL 4RA3A 1SM3H 4JPWH 1JUFB 3LN5A 4KV5F 3LHAA 4D0BB 3H9SE 1LEGA 1JN6B 1K4CA 3BPLC 2YBRB 3DMMA 5EU6B 2R2BA 3IU4L 1YUHA 5I5RA 2Z7UA 4PY8J 3WIFB 2NYYC 1FRGL 2J6EL 2EVIA 3O0RL 4O02H 2DMBA 2B0SH 2Z0UA 3MV8B 1VGKB 5BXFA 4DO4A 1FL5A 1HHJA 3AXLB 1DZ0A 3L3GA 4XNMB 1Z6JT 4WK0B 5GS0H 3X14B 1LEKB 3MRGA 4N8VG 2W9DL 3OZ9L 3FTGA 3MV7E 5DUJA 3IGKA 3VXUE 3W5NA 2O5NA 1ZHLA 3V5DA 5DRXA 1WGVA 1F4XH 1RK7A 2RBLA 2YPLD 3ZE2B 2JKWA 4HKXA 2E9GA 1J18A 3NJFA 3JWDC 1JV2B 1DE4A 4MDRA 4YUEL 4GW5A 4DO6A 3O6FC 1DHKA 1JNNH 3HA0A 3O2VL 3F12A 4E9XA 1ZGLB 1NBZB 3RGVC 1FFTB 3QC6X 2CCWA 2MCMA 2PW2B 1OSPL 2DQGH 1ZANH 1KBWA 4N0UB 4WO4C 3ILDA 2OA9A 2QSVA 3ZDXB 4GRLA 5B39A 2H1LM 3RY4A 4S11A 1AR1B 4AVIA 3ZYZA 3LHPL 8FABA 5IM7A 1DBAH 3ZKSD 1CDHA 4CUCA 4Y4FA 1TJIH 1PZAA 4TULL 2C9SA 4G7QB 1U8HA 2BXYA 2QADD 4CSSA 4ZTPL 2LV4A 4EDXA 2PXYB 2J5LC 3HG1B 4YDMA 1BZ9A 5EBWA 4FQXB 1M4KA 1ZPUA 4XNXH 3QQXA 4LOUC 1I4FA 3UGUA 4GSRA 4W9JC 4GH7B 1H0DB 2EIJB 5C86A 4LDOB 1SXZA 5IK3A 3ULVH 2B1AH 1XH1A 3IDYB 2VMJA 1R3IH 2J12B 5E94B 4GY4A 3V4PH 1BEXA 1V8HA 1Q9WB 3DSFL 1SQ2N 5AVXB 4WUKL 5AZ2L 1E4JA 3RURA 4A38A 4X2UA 2EYSA 4P3CL 3S2AA 4K0OA 2WMPA 4G43A 4Y4HB 2BVOB 2IPKA 1HE8A 4N8VB 5KANG 3ZQXA 1IQWH 2OW7A 5GGTA 1X4ZA 4WV1A 4GO6B 1TEFA 2B15A 4MA3A 4ZZFA 1UC6A 5F3FA 3JYBA 1T7WA 3F58H 3QIWA 3ESOA 1M3JA 3P73A 2WLMA 2FEEL 3WXWL 1U3HD 4H8UA 5F1NB 1I3UA 2VISA 3N85L 4OD2A 5KBLA 1NC2D 1BGXH 2RGSA 4KKBC 3RHWF 1LILA 4ZMLA 5BO0D 1HILB 4YFLF 2WQRA 4IBWA 4L8DB 1ORSB 1JRHH 5FCSH 5LGYA 3ARBA 1SXNA 3L6FA 4N2HA 4RGMB 3Q43A 4OLUH 1Q72L 4UQ3B 5G2NA 4BSVB 5JPNB 4IIQB 5I1IL 1ZT1A 4HFUH 4H5SA 4K4KA 4WJ5B 3DYOA 4WWID 4G6MH 1JI1A 4PJGB 5FWQA 1I3GH 2IG2L 1G7MA 2ITCA 1ASQA 1HEZA 2B4CH 4YDZA 2XV3A 1ZLEA 2B9BA 4WI8A 5F96L 5I19L 2P5EB 4NQDD 3DX6B 4JRFA 1ZDSA 3EZ8A 4A39A 1ORQA 4MKMA 5I18L 4YHYB 4XCYA 5ICUA 2MRYA 1A0QH 4HQQH 2BY3A 1DUYB 2VDMB 4PCKA 5DHDA 4X5XA 1WF5A 3VACA 2OJEA 3RI5K 3LNEA 1TVHA 2ZSVA 4M5TA 3JTSB 4Q6YA 2V5RA 1TQBC 1UFUA 3E1ZA 4JREC 1KJMA 1OO2A 2P9RA 4LAJH 2XT1B 3RWIA 2ORBH 4U1MB 1H6FA 3OR7A 2WUBL 1BFVH 3UZVB 3E2HB 1I3VA 2VMCA 1NMBL 5EU6E 4AMWA 1YHPA 3AUVA 5TF1L 1QLFA 3O6FD 1L5GA 2VDML 4R4FH 2RCSH 3TLRA 1BYOA 4PEEA 4L3CA 1FRGH 2C4XA 2DY2A 3OHMB 1HYSC 3MGTB 4M7JL 4A7GF 4K5LA 4NKIH 3RTQA 1U93A 4E42A 2B8OT 3GI8L 4ZS7L 4Z1PA 2L8AA 4I2XE 1W15A 3ZT6A 1FZMB 5FHAL 4LEXL 2VDKB 4ONHA 4E41E 2V4LA 2CGRH 2WLHA 3X11B 2W9DH 2FECL 1L9SA 1JWSA 3MUGB 5DHXB 3RVUD 4P3WA 4S1DC 1GGCL 5HJGA 2J71A 3QIUC 4R97B 3QFDA 3EJPA 3KE0A 5T1LD 2ZXEB 1NPUA 1GCYA 1A4AA 2APBA 4LOUD 2HT4C 4ELKA 1DO6A 3SPJA 5AVQB 1J0JA 1FN4A 2N0MA 3L9RA 3SDYH 4ZW3A 5LBVA 4UOJA 4IBVA 1WFJA 3G5VA 3L4YA 4U33A 3H54A 4OZFA 2APWA 1IBDA 2QR0B 3VFWB 3CIQA 3MLZH 4LCVA 1A7PL 3BAWA 4OD3H 1OM3H 4UIMB 4MCZA 4HIQA 4MCYB 4I3RH 4JNXA 4JN1L 4ZPVA 4JRXE 4O2FB 4XC3H 1C12B 2ZOKB 2FX7L 5CM1A 3D85B 5H37A 4RAUA 4L29A 4NX0A 3V10A 4Q52A 1P4LB 2AF2A 4OKVB 5FM5M 1GA2A 1ET7A 1HIMH 5C6TL 3W0WB 4BKLA 5EUOF 3FCUB 3ROOB 1BZEA 1TJHH 5LAXB 1X9LA 5FXCH 3ZYJA 1FFPA 2EXWD 1DL7L 2YAOA 5FFLA 3QGVA 4KTGA 4R4ND 1G4RA 1ZT7A 4FQPA 5E24E 1CTNA 5DCCA 3KPRB 2OL3H 2O6PA 3FJTA 3VQ2C 1YY8B 3AGVA 3H7LA 5L0QB 1OK0A 3CXHJ 3IN2A 2CU9A 1T80A 1NCAH 4KJPC 2WLJA 4X7EC 4OZHF 3WXVL 2NY4B 1QFWM 2J2ZB 3HCVA 5J1AB 1E90A 5DZAA 4P3CH 5MI0C 3QG7L 4QT5A 4TUOA 4YBQC 3MR9A 2O4EA 1OTTC 1PZBA 4XMWA 3L3KA 3QO0A 4RNRB 5FGSA 5DD5L 1DJYA 4NCC2 3TM6A 5D93C 4F7TA 4GMSL 3G5YB 5FYJU 1JYNA 2HFTA 2DIAA 3MO1A 5CD5D 3HI5H 1MZYA 4YE4L 1KYUA 2P42B 4MCNA 4Y9FA 3TA3D 1N12A 1YEDB 5ALBL 1GIGL 3N85H 2A74A 4PMFA 1T5XA 3ZMNA 2OSYA 4F8QA 1A9EA 5JOPD 3IVKA 4DP4X 5IVXA 4I0PB 4OCSH 3IT8D 4LPCA 3DKHA 4UT9H 3ZHDA 1HU8A 3CZNA 3KGUA 4ICWA 3EDEA 1OB0A 1GYUA 4FFYA 5EO1B 4QXUH 3SDCA 4BSWA 1CIUA 3UG3A 5I1IH 1TMCB 3H53A 4PJGE 2DI7A 1YSOA 4D0CA 1W16A 5I30L 2HJFA 4PGBA 4ECNA 2O5ZH 4Y5YA 2GT9B 2P5EE 3TX4A 1GOHA 2OXHA 4GFXA 4HCFA 1XXFC 5CEXB 2CA4A 2E0PA 4LHJB 3QSKB 5EMYA 1NMCC 2O6EA 3VFVB 4M8VA 1AANA 1DVFA 3KLQA 2NY2C 1EO8L 3ZE0F 4BFKA 1IEHA 1N5AA 2CIKB 5D8JL 5F72S 3DIVA 4QNPF 4XCCH 4P2QA 5TGBA 2K7QA 1JZHA 1ZLSL 4NP4L 1S9VA 1WWAX 3E1F1 4KO7A 4S1DD 5F6HJ 4L4VA 3FSAA 4EOWH 3H2QA 2A77L 2PCPA 3WFDL 5FECB 4FZ8L 2VDMH 3AG3B 4JRYA 4UM9D 3V5KB 2BWDA 3PGDB 3QNFA 3ZL2A 2W8CA 1I8MB 5GJTL 4TUUA 1A4KA 5I1LB 1I1CA 2G30A 1TCMA 4KFMA 4Q9RL 4ZS7H 5HDOA 2XICA 3F83A 1TNNA 1QFOA 1KJVA 4KXCA 1CI3M 1E8WA 1EDQA 1Q94B 3LKOA 4UTCA 3TO2A 3DPDA 2EKJA 2I5YL 3BGFC 3D12B 3MRRA 4YN3A 3L5XH 5T1MB 5C2BL 2E4TA 3CCHB 1JMZA 3IE4A 5F7UA 2MEJB 2XX1A 4G8GB 2X1PA 3QJRB 4A6YA 2ZXDA 2VM9A 1ZVNA 4XH2A 3N41B 3BKML 5C07D 1W6WA 1THCA 1T0PB 4MLSA 1E2ZA 1XGQA 3P3SA 3FUFA 1AZUA 5JW3L 2C7UB 3DRTA 3RB7A 1P2CB 3K6IA 2VDKH 2IFGA 4KJPD 1OEZW 5GZND 3Q2NA 3DHPA 2IAMD 4QPEA 2JJUA 4WZ9A 3LPPA 1DEEB 2QKIA 1MN4A 3ALPA 5TQ2H 4O9HH 3LPGA 4LGRB 5IFHL 2CRMA 1ZA3A 1H9DA 1DL7H 1TPXC 4G59C 4K94C 5D2LE 4F58L 1LEIB 4H88H 3OG6B 2RQ8A 4D0DB 4JANA 1Q90A 4N2FA 4X42A 2DJ4A 3LPOA 1PF3A 1T7VA 4HHGA 4Z23A 1RZGB 1R3HB 4OIAA 3QQDB 3OMAB 3DSNA 1W8OA 3CSYB 4E5XG 3ROLA 1LE9A 2WAQA 4KDTC 3AAZB 3P02A 4TQEL 3HTLX 5IOPA 1XR8B 4X6BA 3C09C 4JN2A 2M83A 5KSBA 5GSRA 3EAKA 5DQJA 1QI3A 3X17A 2D0FA 2PF6A 3EJUA 5IQLA 2QSTA 5I9QC 4A1RA 3NACL 1BFTA 4JFFE 3QI9A 1TQSA 3LNIA 2WIIB 5BQ7A 2IEPA 1EVUA 5GGRY 2A4ZA 5IHWA 4Y19B 1AC0A 4YE4H 2EDLA 2PWHA 3TPUA 4JDTH 4FQLL 4PJFE 3BYYA 1PGRB 1GIGH 2HKAA 4O58L 4LXFA 3FU0A 3K81A 1IL1A 4Z0XB 2BINA 4X6CF 3T09A 4NAMA 1XF5B 1T1WB 3RX9A 3DTXA 2EDBA 2LAGB 4HIPA 1RAMA 1RULH 5LXGH 5JHDB 4KY1L 2Y2TA 1LE5A 1EV2E 3GLAA 1LO0H 5F93C 4QAMB 2Y6TE 4W1TA 1OHQA 2F18A 3EO1B 4WFED 4N8CL 4UUJA 3CG8A 1OL0A 3D2UA 4M43L 5FKPB 2IWGA 4TVPL 4ODTL 2WXOA 2BIMA 4PR5B 3QIBC 5E6IC 3NEXA 4ZYKA 3WHXA 3BIBX 3I6KA 4U2ZA 2J43A 5I5IA 1AQMA 4WJG3 3WKMH 1RK1A 4QHLA 2LQRA 4QRQB 5EU7C 3MI6A 1W72B 4GP5B 2RACA 3ABLB 1SOQA 2IMNA 4MS6A 4XXWA 2WO4A 2EO1A 2GUOB 1TT6A 2R1YA 1KXVC 3OKOB 2CE6A 1F6AB 2N7AA 2AZAA 5CWSB 3Q5TA 3TCLB 3THML 1MFEH 2AXGA 4E5XB 5JOEA 2VN5A 3N1PC 4G11A 5EIVA 1OAKL 5EUKB 2VABB 1CVRA 2I24N 5D8JH 1EO7A 3VI3B 2A6IB 1FZKA 1FLTX 4Q4EA 5MEOA 1R1CA 4N3TA 4ACTA 9CGTA 2XWJA 2VTFA 3FO9A 1A1MA 1W72L 4XN2A 4EPSA 5AG8A 5JO5A 3UAAA 4OFYA 4NHUA 4TVSa 4CKQA 3LRSA 1MCSA 4KRPB 4YHIA 4X0KB 1XT5A 3KJ4C 2EXTA 4NKDA 5D5MA 2ADIA 1XWVA 4BQ6A 3UBHA 1AXTL 1C5BL 3O9WD 1FVEA 3SKJL 2QSQA 4EN3A 3V0AC 1UXSA 4I18A 2AW2A 5F9JA 1I9JH 3LD8C 3GZQA 1KC5L 3AG1B 4ELDA 5GS2H 3U30B 4G1MB 5C7ZA 5FYJE 4JVWA 5D9SA 5I15L 4G8GE 4HCRL 1NFIB 2FHCA 2FYYB 3TC9A 1LO4H 3JVGA 5JPMB 2GBVA 4YAQA 4PJEA 5ESVB 4AM0B 2J1WA 3PWUB 3EYSL 4PJHB 3W56A 4LAQL 1NCOA 2QHLA 4P48A 2P5WB 5LAPA 4GKOA 5LNDA 3ERXA 2Y0SA 1DTUA 2F08A 2WUCH 4IS6A 4KDVA 1D3CA 3HMWH 2NCEA 1XQ4A 4K5MA 4HOWA 3POCA 2FX8H 3ZUCA 5L7XH 4MB4A 5A3IC 4WQOA 4Y2LA 3QZWA 3L48A 4OIBA 1C08B 3EOYG 4NZJA 1EZVX 5D4IA 3T4YB 1U9KA 2AV7A 6FABH 2GC4C 1FNEA 3H9SA 3SOBL 2BIQA 1DANU 3ECUA 3FQTA 4ZMTA 2J20A 2J88L 4X8CA 3B9EA 3P3TA 3B1UA 4GJTB 5IROA 4UIKL 4BCYA 1R5VB 4P4KC 1CFQB 3SGJA 1S7WB 4FI8A 3D39E 4YZFE 4FABH 4L3FA 3ZX1A 5F9AC 1ZVSA 1XBRA 1WUNT 5TDPB 2AXFA 3O2DL 1HWWA 2VLRD 2BX5A 1AOZA 2I27N 1JWUA 2ZX9A 5E8NA 1A7QL 2IFFL 2DQJL 3KYKL 3MV7A 3IJHB 4KX7A 5DI8B 3VXUA 3B43A 1Y6NR 2V5TA 3CFNA 2A6KA 4JM2C 4MQXC 5HGAB 1Y0LA 5DJXB 1AQHA 1HHKA 1XH2A 3HNVL 4BK5C 4NRXA 4P23A 4WI6A 1GC1L 1RL1A 1S8DA 3B9VA 4NDMA 2ZCHL 3SE9H 3TBTA 3TWYA 3UJIL 3UROR 2WKLA 3S5YA 5I1JH 3I9IA 2ZP9A 2KYIA 4JRXD 4V1DA 4Y19E 5D1QB 1CC3A 2JQAA 1ZKAA 5C0IA 4TVPE 4Y16B 3WE6A 4CDGC 5JW5B 5CR8A 4KJYB 1WWCA 4LEBA 5J6HB 5TFSL 2VR3A 3FCSB 4OGAC 2XNAA 1EJ8A 1NAMB 2EDXA 3R7QA 4YGVA 4S1QL 3K2KA 5JHDE 4HX1B 3NIDF 3GM8A 4OCXL 1N7MH 3U2IA 4K2UL 1YMMB 4MZIA 1MFNA 1J0KA 3TTSA 4PVBA 1A5FL 2FWOB 4U1LA 3S4SB 1VSCA 5FHBH 4M43H 5MEQB 1WYJA 1KYOJ 1BWWA 5ILTH 4FZEH 4E0RB 5FO7A 1ZTXE 5IVOA 5EIIA 4WI9A 1RP8A 4N0RA 3VWJC 3MNVB 2E7CA 1EX0A 2WHVA 1VERA 1NGZA 2DI8A 3SDXB 4LRNL 4FNRA 3QJOA 3THMH 4JFDB 4FQHA 4B0MB 2C7FA 4XPBL 3ZHLA 4ATTA 2X4SB 1RFDL 2OJZL 2VYRE 3C87A 4ONFL 4UT6L 1LK2B 2DJMA 3GQFA 3D08A 5JDSA 3EGDA 4RMQA 2W65B 4MFHA 2V5MA 3O4OC 4BUGA 4PB9L 4XMTA 2ENPA 3QZOA 4GRWE 3OQ3B 4I5BB 1W72H 1DJSA 4XE0A 4P59H 3U4BL 3AJ7A 5CZKA 5T3ZL 5EZLB 1L3WA 2UX7A 3QJVB 5E23A 2NTFA 1M7DB 1P4BH 5BZXA 3IGAB 2P8LB 4LBAA 1C5BH 2DJSA 3L3OC 3FSOA 4PV9B 3SPHA 3WKQA 5I16B 1XGRB 4ZDHA 3B6SA 3SE3C 1T0NA 1UB5A 5EZOL 4K5NA 2NYZA 2WCGA 1OARL 3AMLA 3CFUA 1DJXA 2Y2YA 3LNHA 5GGUB 3B2VH 3NJNA 3O6LL 5K39B 1X7QB 3UH8A 1AQKH 1T21A 5LJYH 4MMZC 2YHGA 3X3FH 3VSQA 2A99A 5E9AA 4KZEL 4GI6A 2AJSL 4CC0A 4JFZH 2FLBT 3NPSB 4PJHE 3ZZSA 5E00B 4GUOA 2K3TA 4PIBA 1Z5LA 4G7RB 1ID2A 2J6EA 3I74A 3ZU8A 4NJAL 4AKPA 4EF3A 4CW1B 4YQXL 2ENQA 3IKKA 2PTUA 4ZAKA 3U6RB 3B1TA 3Q1EA 3NIFF 3RDTB 1JNLH 5FA3B 2OI9B 4ZMXA 4WLCA 1KTKE 1JUFA 1K2DB 1RK0B 2Q8BL 2X9XA 3DGCR 4WEBH 2CHDA 3NCYP 4JM2D 4D0BA 1JN6A 2EUVA 2YBRA 4CJ0A 2MH4A 2X9WA 5EU6A 2ZWNA 4HBCL 4G9FD 4G6JL 1G9ML 3LKSB 5A2BA 1H8SA 3WIFA 2CO1A 4K9JA 4YNYB 3NCBB 2ADGB 2LOEA 1BBJB 1ETJA 4Z7NF 3D07A 1VGKA 1JPEA 3QCTH 3AXLA 3HE6C 2F0CA 3RBGA 1CPUA 3UC0H 5DEJA 3UOAB 2HMIC 4XNMA 2X4QB 5CUSL 3X14A 4AQEB 4DIXA 4ORGA 1Z5HA 3LEXB 4X80H 3TURA 1LEKA 1KYDA 2VZOA 2JELH 1JFHA 1NAKH 4TLTA 3L3IB 1CK0H 2YMOA 1KEGH 1HQRB 4ODSH 1KIPB 3VXMD 1JV2A 4FCHA 1Y1UA 4RAVA 4X7DC 5E5UB 1UKTA 3ULSB 1UM4H 4WGKA 3X3GL 4P5TB 5E2JA 2XXFA 3HNVH 1EGJL 2PWFA 2WBJD 4Y2DC 1ZGLA 2OS7A 1NBZA 4NAJA 5D1QE 2IANB 5IKCB 2PW2A 3EH4B 2YC1B 4N0UA 5IMMB 3GMPB 1UASA 3GTTA 2JXMB 5JXEC 1SYVB 4LEEA 1T22B 2CAKA 4ODHH 5A7EA 5SX5K 4BCXA 2CM5A 3NFSH 4ZTEA 2UXTA 4CU7A 4G7YH 1BBDH 3AS1A 3PHSA 5HYFA 2EVJA 5SX5H 2OSWA 4WIQA 5D1XD 1OTSD 2AQ2A 3T08A 2PXYA 3HG1A 4QD2E 5GQBA 4K2UH 4A2EA 4FQXA 3ATEA 5BVJB 3VMPA 4JM4H 1JPTL 5B1BB 1XSJA 1TZGH 2AGJL 25C8L 4HJIA 4J1UB 1UWGL 1CFBA 1H0DA 3KPNB 4MX7B 2EDHA 3K5RA 1DBML 1MFDH 1IBBA 1SBSL 2FO4B 4M6OL 5J56B 3MZGB 5EZPA 1SQMA 2D31B 1NAMH 2YJQA 3INUL 5CD3A 3TEZA 1CXKA 1Q9WA 2IV8A 3BE1L 4K5PA 5FR3A 1AKPA 3NJKA 3LKNB 4JFDE 4LRNH 1UJ3B 3IDJB 5DFTA 3N3EA 4Y4HA 4BUQA 2X40A 4IRJD 4NEHB 5AW0B 4XPBH 4N8VA 1NIDA 5IY5B 4UT9A 1RFDH 4LOFA 4ONFH 3GO1L 1CLYH 2E6JA 5ISZE 1HJCA 2ZKYA 4N22A 1TTAA 4Z5RB 1L6ZA 4Z0BL 3TBSB 4Z7UF 5D55A 4TNVF 5K1VA 2PLTA 3GFUA 3ZHFA 4PB9H 4Q6IB 3B2PA 3F7YB 3C6LD 5CINH 4YVUA 2ADFH 1GYVA 5KYYB 2BIIA 4KVCL 3SE4A 2OMVB 5F1NA 1CE6B 3BRDA 1T66D 3LIZH 5T3ZH 2WB1A 3Q8FA 1P6AB 4BBWA 3KXFB 1HILA 3M07A 2R59A 4L8DA 1ORSA 4CSZA 2WCPA 5I6OA 3O11B 2AJZB 2V8LA 3RYMA 3NJIA 1T04B 2H32A 4UQ3A 4ANKA 4BSVA 5JPNA 1IBGL 1U3ZA 3PWVB 4AI7A 4JFEE 4IIQA 4OZIF 1BEYH 3RVVD 1AIFB 4EAEA 3DC0A 2DWSA 3T3PE 3FO2B 4PJGA 1DVUA 1DVYA 1A7NH 3FQ2A 3L17A 4YDLC 4DN4L 1PEWA 1U58B 5ICZB 2P5EA 4ZT1A 2WZAA 3RY6C 3EOAB 2OK0H 1ZMYA 2AJSH 2N0KA 3EADA 5BRZE 3NQKA 1HXKA 1DUYA 2XRAL 3BT2H 4BFRA 4J4PA 1U42A 4OCYH 3AREC 2VERN 2B3IA 3MUY1 3OM3B 4YQXH 3JTSA 4DKEH 2JKTM 1GGIL 2G0KA 1N70A 2AKRB 3CXDH 3PAYA 5DJZB 4U1MA 1QPKA 4KVNL 4GW1A 4PLKD 4YWGH 4L4JA 2Q8BH 4MNQB 4KI5E 3UZVA 3AZUA 1AYOA 4MS8C 2PYEB 2JQZA 5BMFL 3MLVL 3D4CA 3DMMC 3PAVA 4GQPH 4G6JH 1G9MH 3FSWA 3LXUX 1WITA 3RAJH 4LB8A 3FHEA 3Q2VA 4GI9A 3X1EA 2VJ0A 5ECGA 3TT1H 2X3BA 1N0XH 3MGTA 3ZUNC 4FJZA 4LSSL 1VZHA 2XYCA 3DO4A 2AJXL 1M7IB 2GFBB 2V5YA 3FC8A 4PRHE 5GGVY 1BYNA 1FZMA 4QRSB 1CO1A 3PUUA 3IMTA 5F0JB 4PJ7F 5I6XB 1WHPA 2WXHA 3X11A 4ODVH 5BZDB 1F18A 1FFNB 3MUGA 2GJ6B 4FKHA 4E68A 3T0DA 5DQDH 1UT1A 5HGBB 1QFHA 4YC2C 1PX8A 2EIKB 3KLAB 3P0GB 5AOIA 3X3GH 5JIIA 1NUGA 1BXUA 2FHFA 4B9FA 2AQSA 3MRCB 4GKLA 3TJEL 1AHWB 1KUMA 1OP9A 3MOBL 4ZOCA 1MJUL 2BNRB 2QR0A 3VFWA 4DGVL 3IFLL 5C6PB 1J12A 2L7QA 4WVRA 2F74A 4UIMA 4MCYA 4LCYB 4GRLC 4AZUA 4HULB 1BAWA 2UXVA 5FYKD 2DQIL 4O2FA 2BS71 5J12C 1C12A 2ZOKA 3WY3A 4DGIH 3GBMH 2PR4H 3D85A 3PWNB 1P4LA 4OKVA 4Y4FC 1E6OH 4XX5A 3WNLA 3W0WA 5AG9A 4PVLA 2M26A 5LAXA 5PAZA 3ZZ1A 4ZOEA 4OB5L 4GPVA 1B3JA 2AGJH 3PWPE 25C8H 1UWGH 3KYAA 2ISDA 2A3TA 1SJHB 5DT1L 1KBGL 3ZKQD 2GBTA 3RILA 1SBSH 4PTTB 1KEML 1EVTC 4FXKB 1MVYA 4AH2B 4PS8A 1IGTA 4HJ0C 4R2GB 4WW1B 4BH8B 5L8KB 4IMKA 1NWPA 4LLWB 3QUYD 3TWCL 2J2ZA 1AQ8A 1M6UA 4IKKA 4DK3A 3IETB 1I1FB 4OM1L 5DO8A 3W9EA 3WV0A 4RNRA 2BIHA 35C8L 1SY6L 3TT3H 4HAGA 3FUJA 4UYQA 3AWFA 3KLLA 2XWBB 2ICWJ 4WV1C 3VFOB 4FDWA 2VW7A 4HWUA 3G5YA 4JFFA 2X09A 3QQ9C 2CGZA 3QIWC 2ETWA 4CGTA 3DUUB 1CBVL 1UWXK 2BVEA 1PSKL 1H3PL 4WSGA 4PWEA 1YEDA 1JWMB 2XU9A 4NXKA 1UWXH 4BM7A 2VDOL 2ZWZA 2YWYA 3PP4L 4L3EB 4ZK8A 1Q1PA 3EGXB 2XBZA 2K45A 3T71A 3ARBC 1HSAB 3ARED 1E9QB 1ETZA 1G0XA 3BFWA 2DQHL 3O0LA 2DWDA 1XCTB 1E3FA 3L5JA 1KSRA 4JG5A 5FW6A 1RUMH 3NH7H 4WDIB 1WT5A 3ISRA 4MRCA 4FKKA 2HUEA 3OMIB 5L4FA 3AG4B 2GTQA 2GT9A 3ECBB 1A6VL 5C0GA 2X0VA 3DMMD 4HH8A 5CEXA 5CJXA 5GRZA 3WY2A 1QZ1A 3X13B 3VFVA 3FYEB 5JIHA 2XA3A 3VD4A 1ZVYA 3FH5A 2GPZA 3WU1A 2BSEA 3BUTA 3PFUA 3I9PA 1FZOB 2WN3A 2IDCA 3UCQA 4O2EB 3W9DB 2YAQA 2AVGA 1A25A 4K3HA 4KVNH 3QEQB 5EPMB 1L0XA 3BRFA 3SBWA 4KK6C 1M9SA 1L0PA 2PABA 2HXAA 2VR6A 4NB7A 3DBXB 3BPOC 4KKNA 3N40P 5FECA 4ANUA 5KAQG 1HYRC 4TSCL 3V5KA 3Q9QA 3CVIL 3PGDA 2WLYA 4NC0B 1J1XL 1I8MA 4GMTL 5BJTB 5CBAA 5I1LA 4JFXB 3T1FB 3TF4A 5F3HB 2XY2A 1HT6A 5C0RH 1TTUA 3RTQC 4KOCA 4FA8A 4YSCA 2AJXH 1JRHI 1GJWA 3QHTC 1MFBL 3B2UD 4XOAA 2D9CA 3VWKB 5I1KH 1J5OL 1Q94A 2JNZA 4AIXA 5J6GB 2JQMA 1RJZB 5T1MA 1HNFA 3CCHA 4N0CC 2E74C 4G8GA 3PV7A 3UMTA 3T1WA 1JSYA 5AW4B 1QR1B 1V27A 2QL1A 3CBJB 4APXB 1W2KT 4XBPA 3VG0L 4H8WC 2V9RA 5IMKB 3SY0B 3BDYH 2BHUA 3HB3C 3QORB 2C7UA 3TJEH 1MFCH 1KN4L 1RKRA 4K8RH 1QFWH 1P2CA 3I84A 2DQMA 4G72B 4HU8A 3IFLH 3DTUB 1QRND 3ZTNL 1FYHB 4Y2NA 4HJ0D 3QJSB 2XFXA 1EO5A 2C1OA 1FNLA 4G8AC 4GXVH 1WA2X 4N20A 1DEEA 3JWNH 3UO1L 1TO5A 2XWDA 1GMEA 5ACLA 5M7QA 1LEIA 4OB5H 3MV9E 2O1AA 1OD9A 5F9WC 1X5IA 1AS7A 1QBAA 3QQ9D 4UDUA 3QIWD 5CSGA 1X6NA 4D0DA 3LXCA 3ZTCC 2H7WA 5DT1H 2LVCA 1RZGA 4K71B 2QGDA 1R3HA 1EJOH 3QQDA 1KEMH 3KM1A 3F8UB 3CSYA 4GP4B 4RDQG 3RJOA 3RL2A 2YOCA 1XR8A 2QLYA 2EH7H 2H6UA 2B14A 3D48R 3H9ZA 4RMTA 1ZAGA 2CCLA 2WBXA 2Q0ZX 3ARBD 3FU8A 4IKJA 4MMXB 1TQCB 4BK4A 1TG8A 3OKNB 4PJ5D 5E7BA 3S8WA 1A7BA 5HHMD 4YSPA 3QS2A 2WSPA 2WIIA 3L5HA 1A8JH 1FH5L 4KH9A 1PAZA 4Y19A 1OWRM 1CBVH 4LZKA 1BVZA 3DWTA 5AL8A 4R90L 1JHKH 2VDRB 3Q6FB 2E7HA 1XH0A 2A74C 2YPKB 43CAB 4K7FB 4Z0XA 4L3EE 1XF5A 2H6OA 2Y5TB 5MP6L 1T1WA 4JKLA 2X89D 4LASH 4LLYB 5C08D 4QKTA 2VR9A 1KCVL 5JHDA 2BSRB 1EAOA 4AYBA 1G9NC 2YXWA 3AC0A 4Q14A 3KPSB 2XBDA 3VMOA 5D70L 4QCIB 2SODB 4JPSA 3SDCC 3EO1A 3EJQA 3PHQB 2BSSB 3FK3A 3NIGB 4KWUA 4X8JA 5FKPA 5K93A 4BHUI 2V33A 3RWHB 3T0EB 2KLRA 4KK6D 2IGTA 4MB1A 1A6VH 1IGCL 4FMFA 3NCCB 4Y5YC 4YHOL 4DN3L 4HETA 4QRQA 5C0BD 1W72A 1NBQA 4BFIB 5GHWL 4V2BA 5T5FH 4UCFA 3OKOA 2GUOA 2HUHA 4E0RA 4MJJA 4G1EB 3TCLA 1F6AA 3P4MB 4E5XA 5JIQA 5L2JA 1LMIA 1QWHA 5H35B 5EUKA 2VABA 3QWOB 1QTPA 2G75B 4BD4A 2Q1EA 2A6IA 1BAFL 2H41A 2Y7SA 3T0BA 2K1MA 4GS7B 5CILH 3QUHA 4ZX6A 1X5AA 5DJCB 4DKAA 1DVQA 4N0CD 4FLQA 4ZPTB 3RIAF 1J7VR 5E0FA 1PZ5B 3PCYA 4GAYB 1HAUA 3QK0A 4HCRA 2G9HB 1WFTA 2R56L 1AGCB 4CVZB 5EEUA 1JS4A 4X0KA 3UTTD 4BWTA 15C8L 1INEH 3HB3D 4ZTOL 2WYIA 3JV4B 1UA6H 2E7LA 3HBPA 5F0MB 1KJ2H 2NXYB 3K2UL 1PTZA 5H2BB 3QBTB 4YVNA 4G1MA 3F5WB 1QFUL 1U3NA 2ZYHA 3CDZB 3V5HB 4AC4A 1GCFA 4XPTL 3VFRA 3I75A 5DS2A 3LIUA 4N9OB 2J6WA 5LGKA 1NFIA 1YEWA 4PVMA 1NIFA 2FYYA 4P5KB 4PJDF 4XVTH 4ZUSB 3D50A 3FTZA 4GW4A 4M02A 1M1XA 1SMOA 2AHIA 2V2XB 4BZ2L 5ESVA 3PLYA 1MFUA 3U7YL 4AM0A 3PWUA 4U1NA 4PJHA 2QV2A 1XH3B 1MELA 1PNCA 4E9LA 5F7HA 1KN4H 2JKJA 5AZEH 5CJ8A 5AVYB 5MHSE 1OGSA 3ARFB 4QRTB 4PV8B 3LNGA 3MJ8A 2WVUA 2ARWA 1IIKA 2HFEB 1C08A 3KPMB 3ABGA 3D87B 3O2DA 3T4YA 2BWIA 3V0IA 1P0SE 4FCAA 4ZSOB 2QKIC 5DD3L 1PDKA 4HMEA 4FNTA 5DJ0A 3T0XA 3EYUL 4CNIB 2FYVA 4RRPA 1O9ZA 3ALWA 3VB9A 3WI9A 1YJDL 1CICD 3CHQA 1AHMA 3CFQA 3VI4F 1R5VA 5HHXL 3NSYA 3Q1SL 4FYQA 1ONQB 4DK5A 1W80A 4NN6B 3MCLL 2J5WA 5ESQB 2XBTA 3NDZE 3KS0H 4TS6A 5TDPA 4JG9A 3GKWH 4LKCB 3HFMH 3EDDA 3ARDB 4GUQA 3N1GC 2H2SC 4MSWB 4FULA 2XCMC 5KANI 3PDOA 5DI8A 4M7ZB 1FNSL 4FC3E 4JQIH 2CJUL 1SXBA 4KBPA 1LO2L 3K46A 1P4UA 1QKZL 2FECI 2O5XL 2R51A 5DJXA 1HCZA 1B2WL 5BO1H 5IQ9A 1U92B 1B0WA 1S7XB 3QI9C 4PY7B 5D1QA 3AWEA 1JTOA 1E4XH 7PCYA 4Y16A 1PCSA 3T2OA 3DJZA 1I8KB 1JZ8A 1PZDA 2XWRA 4JPVH 4MAYB 4CJ1A 4KJYA 3CWGA 4G6AC 1E5CA 3BAEL 2WANA 2RTTA 3CLEL 3FCSA 3KLDA 3WKYA 3LDBB 5AKRA 3RUGF 5L4JA 3QDMB 2BNQE 4EIZC 4APQD 1NL0L 5AVTB 1CU4L 4ELMF 3NCEB 4HX1A 2VITB 3HAEG 4PSRA 1F4WL 4PRIB 1WE5A 1YMMA 2ESVB 3SGDH 4L5FL 4P2QD 5IF0B 4LPVA 1ITCA 1V54B 4UT6A 4UINL 3QR0A 2NNFA 3X1GA 1WA1X 3HMXH 1A65A 3T0EE 1WZ1L 2ZD0A 5MEQA 2E9IA 4AQOA 2JB5L 2VDRH 4L4VD 4HUKB 4QO1B 1CFNB 1J86A 4XZ4A 2Q76B 3C5ZB 4XB8A 3P11H 3D0LB 3LIZA 3P2BA 3VSVA 4G3YL 3SDXA 4HGKC 4C56D 8PAZA 5I1DB 2UY6B 4HEPG 3AWGA 1PJ9A 4JFDA 3ZY7A 4U6VL 2F19L 4P99A 4MLIA 2X4SA 2YMXH 4FGMA 2OYMA 5ISZA 3ABKB 1LK2A 4F2MB 1W9XA 2Z35B 5DZ9A 2EKSB 1MCIA 1EWHA 1G6RB 3MRJB 1JPST 5HP5A 1W6LA 4QR7A 2V9UA 3QUXD 1IBZA 4RSVA 4L2YA 5L6YH 3QT2A 4I5BA 1WRFA 4M3KB 5C0NC 5J57B 2C3HA 2Z6FA 4W9ZA 5EZLA 5A7BA 2R56H 1SOKA 1SJEB 2HH0L 5DEFA 1M7DA 3UPRB 3MLUH 1TYJA 6TAAA 3IGAA 2P8LA 4AQ1B 3GLZA 3NEEA 5AKVA 2VJ8A 2GJJA 5I16A 3VG9C 4EN3C 1XGRA 3LEVH 4I18C 5F7FA 1G6RL 1PVHA 5E2TL 3ZKNC 4ONGH 3MVSA 4KQ0A 3GXFA 1QFUH 1XCQB 3FU3A 3HAEB 3FQ1A 5F7DB 4XPTH 2YD7A 5K39A 1DDTA 4IKNA 5B1JC 4JM2F 4WEEA 4H1LB 3FH8A 4XN5A 1BFOA 2C1PB 5JXAH 2IQ9L 5CLZA 2A9CA 3OPZL 4MXWH 3JVGC 3U7YH 5IHUL 5E00A 1QSED 1VPOL 4OCRH 1P4IL 5D7KD 4PBXA 4YPJA 2F58H 4CW1A 3S8FB 1KBPA 1K85A 4XP6H 3U6RA 4D9QE 1DVXA 2F1EA 2VM3A 5FA3A 5I0DA 3VXTA 1BREA 1WFIA 1KBVA 2FJGB 1K2DA 1RK0A 4ZUVB 1V3JA 4ZSOE 3WOVA 1DFXA 3BUBA 3MNDA 4LHUG 2R0KH 4XXCA 2R69L 4CVXB 2MCPH 4L4TB 1J8HB 2UWEF 3LKSA 3NK3A 5EB9A 3FN0H 3X1BA 2JCWA 1GYWA 1A3LH 3SB3A 1QSFD 4YNYA 3TBBA 3QI9D 2ADGA 1BBJA 2YD5A 3L5WA 1EGJA 5IROC 4JB9L 3LQAL 2VM4A 1MFVA 1IZJA 4IJ3B 1IZKA 4WI2A 3SGJC 3MCLH 3QUGA 2X4QA 2Z31B 3ASOB 4AQEA 2X1WL 3LEXA 5D7IB 3BVVA 3HW7A 2G4GA 3NDYE 1M2OA 3L3IA 4FQ1L 1HQRA 4DKFL 1KIPA 2YOAA 3TYFB 5BZZA 1AACA 1QKZH 1WA0X 3PJNA 4OBRA 4QXVA 3KWUA 3UIYA 3ULSA 4P5TA 4PB0L 5IOKA 4AVHA 1YPZB 3OB0K 1W0VB 3QPXL 5T1KA 5CLYA 3C8HA 4P23C 2EEBA 3DIFB 1JZ5A 3P40A 3P4OB 3U7WH 4L5FE 3K5SA 4CSTA 3OB0H 2QHRH 2IANA 4NT6B 4UAOB 5IMMA 2YC1A 3GMPA 1XF1A 1LP9B 1RURL 2JXMA 2WXQA 1NDMB 1SYVA 1T22A 3LRGA 2QSCL 1IIIA 1XX9C 4NUMA 1MRDL 4P46B 2JTDA 3WKPA 1TJXA 1RJLB 1S7VA 1HHIB 2Z34A 3QNYA 5E1GA 4MASA 1FNGB 2PO6B 2ZXQA 3K71B 2ZXCA 3NVQA 4PRIE 1TU2B 5IZ7A 4H0LC 4FG6C 5DWPA 5BVJA 12E8L 3I9GH 3TBCA 2BVPB 3GXPA 4RFOH 3U9WA 5ALCL 3ZOAA 4FHJA 4J1UA 1PLGL 4MX7A 3QDHA 4RISH 2Q8AL 1IFHH 2CHNA 3EYFB 2EECA 2JB5H 3VFUB 3VD7A 1IU1A 2VC2H 1TYEB 2FO4A 2L3BA 2Y6SC 2PWEA 4G6KL 1R5IB 2D31A 1FIEA 1ZXKA 3HKFA 3K6FA 3EBIA 3BP4B 1TQVA 4LOEA 3LKNA 1S78C 3VAEA 4BWUA 1E4HA 1UJ3A 3IDJA 3HN5A 1FNHA 1TZIB 1A2YB 5E4EC 1R19A 3H9HB 1SHSA 2CNYA 5MENE 2IBZX 4Z5RA 1E5YA 2IXQB 3KCPB 1GHFH 3TBSA 1EBAA 2VNCA 5IJVA 4BGLA 4WI7A 1QA9B 1EZVY 1UCBL 1XF2B 4Q6IA 5E4OA 3C60B 3EBHA 5G4NA 4M62H 4MHHG 3F7YA 3WNIA 3ZE1B 2IPUG 2WZ5A 2CDFB 1MF2H 3QEHB 2OMVA 2QQQA 3PAZA 3MLTB 4JO1L 2C3XA 1CE6A 3D3VD 5AYUH 2AABL 5AUMA 3SKUD 3VXOB 3KXFA 3CFEB 4A66A 3O11A 1F4AA 3RKPA 4QRBA 3FDWA 5I5JA 3VFPB 1T04A 4J3OH 4DP8X 3ABZA 3DX1A 1N64L 3RY5A 3PWVA 5E2TH 3AB0B 1AIFA 4E9TA 5GS0D 1X9QA 3LEYH 1FC2D 5EEWA 4FQ2H 4CL7A 1U58A 1M7XA 4B3VA 5ICZA 2I25N 1K6QH 4ZZKA 1YNKL 5JORB 1C8PA 2QQLH 2XIBA 1IC5L 3OPZH 4M48H 3F7VB 5FEBA 4PJXF 5EV7A 4UT7L 2AQTA 2F5AL 1VPOH 5IROD 4A55A 3F62A 4ODBD 3EUDA 4IDJL 4C47A 1R3KB 3NJLA 1WFMA 3U0TB 4XB7A 3OQRA 1EAQA 2VKXA 4KMTH 1YVLA 2AKRA 4HCGA 5CMAB 4ZAKC 4K7PY 5DJZA 5C0AE 4GEIA 2C9VA 4I8DA 4H1LH 1FGNL 1JVLA 3OD3A 3VTMA 3NSDA 1UHVA 4MNQA 1IC7H 1YEFL 1G9EA 2PYEA 3WE1A 1FH2A 4LCWB 3F7QA 4JZOB 2R69H 1ZHNB 1GVIA 1QUNA 1DJZA 2E27H 4P23D 5I17B 4WTZG 1TNMA 1FF5A 4K5OA 1OE1A 2XWEA 4NGHL 4V1DD 4NUQA 5I6PA 4AT6B 2ZX8A 3PPSA 2GFBA 1M7IA 2OKMA 4Z77A 1B4JL 3E7JA 4QRSA 4W9HC 4OZGF 1LO3L 5D7IE 3ULVD 4GSXA 2DQ6A 5CHNB 1EAPB 1UQSB 3PQYB 3EF7A 4PD4K 1G1CA 4X5QA 5BZDA 4HOXA 1FFNA 1JTPA 2GJ6A 4Z9KB 3GBLA 5HGBA 1DBJL 1CXEA 2WO3B 3GUTB 5KS9E 1GKEA 3KLAA 3V6ZB 3MRDB 2P8MB 1QLEB 5B38G 3QPXH 2SEBB 1U95B 1ED3B 2NY5L 2WLNA 4U4IA 3MRCA 1QRKA 1AHWA 2OMYB 1ADWA 3DGGB 3FFCB 4JDEB 4L3AA 3LYRA 5BUGA 2PR9A 4P2OB 4D7BA 4UOQA 4LCYA 4ZMZA 2W5PA 1RY7B 1AR1C 1ZE3C 5DMJB 1S78D 2NY1D 1IGYB 3C8DA 1FYTB 3JWDH 3MBXH 3PWNA 3QCVL 3T5WA 3RWGB 4X9IA 1UOKA 1J1PL 4P4RB 4WFHD 4WHDA 4LF3B 1S9KC 1F3RB 1QHOA 2BK8A 2PXYC 2YXMA 5C09B 1JXJA 4IW4C 3RRQA 3K1DA 4EO5A 4FQXC 1N6QH 1SY6A 5G4OA 3EJTA 1RHHB 5JQ6L 1Y6MR 4Z3JA 1FFQA 1Y18B 1SJHA 2Q8AH 4PIRF 2J8UF 5KBNC 4PTTA 1MFAH 1MDAA 5TPWL 1D5BB 4QOKE 2NZIA 5ESAB 5A2LH 1DSYA 4FN0A 4AH2A 4F20A 5JLZB 4G6KH 2EDFA 3IDYC 1QD0A 1UGNA 3K8MA 4O51B 1JE6A 1CE1H 1X9RA 4XTRC 3ZHKA 4Y1AB 3EHBB 4XCNA 3IETA 1I1FA 4LDLB 4Y4HC 5EOCJ 1ECZA 1SF3A 2AEPL 2GIXA 3NZUA 4OCMC 4A67A 4Z7WB 4LL9A 2XWBA 2JV6A 3VFOA 3EGSA 5EU5B 3GSWB 1HL5A 2JI1A 1MY5A 3CXHK 4FHBD 5B38B 3DUUA 4LK4A 3CHPA 4YO0B 3EFFA 4TMPA 4LPYA 4QRRE 1EJFA 1JWMA 4TN9A 3SE4C 2DBLH 1OGAB 2W94A 1AO7D 4DAGL 5B4MD 1MPAL 4DVBB 3GRWH 3WY1A 1KPRB 4L3EA 4AYMC 1DJGA 5T5FA 1ZLUK 5IESL 1FZJB 5KVDH 1HSAA 2ICEB 1E9QA 2VXTH 5DJ2A 3E80A 4RGMC 5KYXB 2IQAB 1ZLUH 1XCTA 3VGBA 5GGVH 4AOFA 4GO8A 4FQJL 5HDRA 4ZAKD 5JPNC 4Z3FA 3QUMH 4M6NL 4U6TA 4IIQC 2PPDA 2V0AA 4XGZB 4WDIA 5KVFL 1XEUA 4NUGH 4Y9BA 1PY4A 4DUWA 5CZVL 3WDJA 3ECBA 3HHSB 5C92A 4OIIL 3QG6B 1LM8V 1AGFB 3CIAA 1KCSL 4FFVC 1JGDB 1ZLDA 3Q01A 3X13A 3T77B 3W37A 4X0NA 2GY5A 3MU3A 4NC2B 2NY2B 4HWBL 4YHYC 2MNJB 3F2LA 3HJEA 4DW2L 1VKXB 3KR3L 5KSUB 1JFQL 1YAZA 4PBWD 3MV8D 1YG9A 1KXQE 3LJ3A 4TM9A 2MCAA 4J4PC 1FZOA 5BS0B 2E47A 1DVZA 3UTOA 2D7PA 5IUCA 4O2EA 1B4RA 4OJYA 3W9DA 4I87A 4G7VH 2Y7NA 2R2EB 3LOWA 5LBSL 1AZRA 3O6ML 4N2GA 4AYSA 3DX4A 5EPMA 1P1ZB 2QELA 3PDDA 1DBKL 1DQQB 5JR1H 4JLRA 2FEDD 4LCWE 2W95A 5SWSB 5K9QI 3E2HC 4XCEA 4MD5A 3ZMEA 3RB5A 1KXHA 1UKSA 4F3FB 2GSIA 1BOYA 5F88B 4FL4B 5JW4N 3MGAA 1Z3GL 1L4IA 4JFXA 1RUQL 5I8EB 4NGHH 2WN2A 2F7OA 2VLLB 1GGBH 3US9A 1J5CA 3S96B 1KMGA 3CZSA 3EJJX 1N0LA 1B4JH 4HK3N 4MXVE 5KWYC 3QJZA 2OTPA 4JFOB 2VRKA 3VWKA 3RBSA 4XODA 1AR1D 1DQML 4ERSH 3JBG7 3MHZA 1HCVA 1XV8A 2XY1A 5J6GA 5LNGA 1RJZA 3MXVL 3H3BC 2VO8A 1KGCD 5K9JL 4IRZL 4XMLL 1NM9A 4R97C 1PQZB 3CLFL 2PXYD 4UTBL 3HG1D 3OC8A 1QR1A 4FQXD 4WEUD 4APXA 1HDMA 4RWYL 3QWRA 5IMKA 1KN2L 3SY0A 3SN6N 3QORA 2NY5H 3PU7A 1UADC 2K9FB 3FFCE 4K3JL 4LVHB 5KSVB 2DL2A 3C08L 5D7EA 5MEPB 4XWOC 3SD2A 2AK1H 4N5EC 1II4E 4HPYH 2WD0A 3MXWL 1KFAH 1K8DB 4AL8L 1YY9C 5E2UL 1FYTE 1TOXA 4HLZG 1WAEA 2DRUA 4B9PA 5CAYB 1KB5B 1U2HA 1F1AA 3O3BB 2VXQL 3NP3A 3GEFA 1R3JA 1EZSA 2Y3NA 1QLEH 5C09E 3OL2A 4OVUA 2VR5A 4WW2B 4U7KA 1X5YA 1NEZG 2JH2A 3TVMB 3K6SB 1H3WM 4OV6F 5JQ6H 3KG5A 2CLRA 1SLXA 3NZHL 3CZKA 2X70B 1PZCA 3UP6A 4GXFA 5I74B 5L0QC 4XWGH 5HYIA 1UYWH 3EFDL 4I7ZC 1KB5L 1HQ4B 3C09B 4IMKC 4LSVL 2NY4C 4Y1AE 5HYEA 4N86A 4HMCA 3M1CA 5FO2A 1QBMH 1BQLH 1YEIH 2Q86B 2X44D 5DO2D 4MMXA 5EWIL 1RUPL 3C9NB 1A4CA 3OKNA 5LDUA 2F54B 5HDQH 4O5LL 2YLHA 1UA3A 2Y06H 2X4NB 4H26B 4UU9B 2KZWA 5J0BA 1U3YA 4U6XA 2WXKA 4FAAB 3IJ8A 5JDJA 1ERNA 3HZYB 3Q0HA 4MAUL 5ES4B 2JMRA 1O7VA 1OGAE 3Q6FA 4FFVD 2OXGB 1WEJL 4NM8L 2YPKA 1NCBL 2TRYA 4K7FA 43CAA 3ET9F 3AT0A 2Y5TA 1OAJA 3GM0A 1H6EA 5GRUL 3II1A 3GI9L 4I0PC 4OLYL 2VR4A 2EZ0C 2BSRA 2GEQA 5TK2A 4J4PD 3QXDB 4NWUL 5DEZA 5KTEL 3KPSA 5E6YA 1KCKA 4GBXB 2F7IA 3LMJH 4QCIA 1CGYA 1YNTB 3PHQA 1MAJA 3BH8B 3WFEL 3UG5A 3FUIA 5KVFH 3BOVA 3T0EA 1WT5C 5TTRA 4WCYH 3RU8L 1NEZB 3NOIA 5CZVH 2HTKC 2WTRB 2HSIA 3EG9B 4DZBB 5KBMA 4M1GH 4UQBA 1PG7X 5IVZB 3M88A 1NGWB 5CJXC 1A3ZA 4BFIA 3WAJA 5CCKH 4G1EA 1KB9J 3P4MA 1C9SA 1MLCB 4M7LH 1G0DA 5HPMB 5AB0A 2YEVB 2G75A 1UACL 4ZJ9A 4JBSA 2LAAA 2BCKB 1NIBA 2DM7A 3ZTJH 4AV5A 3A47A 4LGSB 1JHTA 5E8DL 1D5MB 2Q3ZA 2X5PA 5A2JH 1JNHB 5BUPA 5DJCA 4QDGA 1DBKH 4ZPTA 4IU3B 3SBWC 4B6ZA 1PZ5A 4GAYA 5DC4B 5HDBB 2CMRH 4I3SH 2G9HA 4Y0GA 1AGCA 4CVZA 1JNJA 3FUHA 1A21A 1P6WA 2GIYA 3ATAA 4YSTA 4YHLH 1QTSA 2ED9A 2VLMD 4OH2A 3JV4A 4BZ2A 2H0PA 4PS7A 3WD5H 5GISL 1DQKA 4JEGB 4XWOD 1E7UA 5H2BA 4N5ED 3NJJA 3QW9A 1OAQL 1NGQH 4AZ8B 1I31A 1IC4H 3UABA 1F42A 3F5WA 3CBKB 3V5HA 5FA4A 1FQ9C 4Q74A 4EI5B 3I50H 2F8OA 3HOGA 1HH6B 2ZCZA 3I2CL 1CFTB 4N0YL 5CZXC 3V55A 5C0CD 3PL6D 2CBPA 5K9JH 4JJ5B 1ZD6A 1LWRA 1Z32X 4P5KA 4ZUSA 3CLFH 3W0WD 3ZDZF 5BW7A 3TBYB 5LGJB 5FS5A 2V2XA 3EH3B 3QDAA 4JO2H 2ZYRA 5HD8C 4KV5E 1F2XK 3GS4A 3SJVE 1BYPA 4H2CA 4LSPL 3HC3H 1BQUA 1XH3A 1MIEL 3KPRD 1CLCA 4HDIB 1WC7B 2KKQA 3C08H 2PTVA 4NQEB 4Z76B 3ARFA 4QRTA 4PV8A 4Y4KB 3PV6B 4UMGA 2XWTB 4JY4B 1IX2A 3FCGA 3AM8A 4YDIH 5ICXB 2DYPB 2NY4D 2KZ1B 5GRWA 3VA2C 3AG2B 1ZRUA 3T4AA 3TBVB 4ZSOA 1DQJA 4YS4A 3PRZA 1YC8A 2XKSA 3KPLB 1WPCA 4CNIA 1I8IB 1M6OB 2J4WL 1A1NB 4L37B 2CXGA 4XOBA 5LCVL 4BCZA 1JV5B 4XXDB 3R8BB 4ATWA 3HC0B 4D9RE 5EC2B 1T4KB 2UUDK 1MCWM 1MCOL 4TKWA 3SDAB 1ONQA 4KQ4H 3T0VA 2WP3T 2FQDA 4JAMB 2ZUUA 2UUDH 5ESQA 3F7KA 2VXUL 3U9UB 2J7LA 4LKCA 1CT8B 1OTUC 3ARDA 1A6UH 3KLSA 1OCZB 1RD6A 4X7TB 4PGDB 4QXGL 2JJWA 5BVPL 4I0PD 3FXIC 4NIKB 2J73A 4W9IC 3HS8A 4DEUA 5KVGH 3TF7C 5DC9B 2F54E 3BJ91 3DYMA 3TV3H 4O5LH 2ARJB 5DFVC 3A4AA 3RVWD 1TETH 1S7XA 1FWXA 2F68X 3S3SA 2DLHA 4PY7A 4ICXA 1A6WL 2OMZB 4HD5A 4LSDA 5JIDA 1GJUA 4G8FA 2A4EA 5F89B 2OR9L 1I8KA 3KNBB 1UM6L 3IFOB 5DSCB 5J5EA 1QFWI 4TSBL 4JQVA 3GXTA 4F57H 2VZ3A 2OFQA 2XWZA 3HNTL 3GI9H 1A14L 4HUXB 3FOMB 3KVPA 2VITA 3WFBL 4PRIA 2ESVA 1KGYE 2XHNA 4RLDA 2Y07H 4LNRB 4PWGA 4XO4A 2XZQL 4XZUB 1NUNB 1ZPLA 2K0RA 1XMEB 3CGTA 3QHZH 4JFPB 4Q97A 4N90E 2G5RA 5GS2D 3V0VB 2Z3FA 3WFEH 4DGUA 1XF4B 2UY7B 4WSJA 4HOZA 1CFNA 1X9UA 2YO3A 4PW3A 2Q76A 3C5ZA 3I6GB 2NY3B 3W2DH 1UEMA 4ZMQA 2YEQA 2X0WA 3LKPB 1KGIA 5AAWA 2AJYH 4UAHA 4F80A 5I1DA 1LXMA 2UY6A 1UXMA 3MQIA 1TFPA 4MVBC 3ES6B 1FHGA 4F2MA 4M93B 2Z35A 5C8JB 2EKSA 1KYOK 1G6RA 3MRJA 1L7TL 1SVCP 4JHBA 3G9VA 2YAEA 3LH8A 2MOVA 5HHOE 3HE7B 5ANMB 1FORL 3U36B 3LS4L 2XG4B 4HIJB 3D51A 4ZBJA 3MBED 2XQYG 4M6AA 4XVSL 1RZ7H 1SJEA 4OLVH 4PJIF 4TSAL 5HD8D 3VB8A 4MQSB 2VLJD 4ANXA 4LVNB 4ZS6D 4PS3A 4KRPC 1IMHC 2N59A 3HN3A 1UD2A 3LZRA 1HESA 1KCBA 4NN5B 1RUKH 5DD0L 4HS3A 2E7LC 4TNWF 2LFEA 3EUUA 5SWZD 1NBVH 2E7MA 1BPLB 2CALA 2Q2LA 3V4VL 9PCYA 2Q10A 5DZJA 3U30C 1XCQA 3HAEA 3WS6A 1JGVL 1I7UB 3OKLB 4DGYL 3G6DL 5EA0L 5F7DA 3ZDYB 5KSBF 3ZRFC 3N42B 3H0TA 2CO4A 2WZPA 2H1XA 4H1LA 4IGBA 3LXBA 4YSDA 2C1PA 4TLUA 2O26U 4HUUB 4WAFA 1IQDB 2R69A 4S2SB 1XGYL 2GQHA 2ADJB 3DX8A 5JPMC 3G3LA 3WMSA 3FQRB 3CU1A 1AGDB 4WWKB 1QO3B 2EDYA 4CADA 4U1KB 3TJHD 1AGBB 5B21A 5ITBL 4NQEE 3UTPD 5ID1B 4M5ZL 1LD9B 2PN5A 4OSUH 4ISVA 4HEPA 1UM5H 4MZRA 1OTUD 1VB9A 3A23A 1G4MA 4LARL 3MKGA 2I69A 5DLMH 3RKDC 1JYWA 2GUYA 2FJGA 2XTJB 2X3AA 5A16B 4ZUVA 4PH8A 3KWXA 3MKKA 4XO8A 1RMFH 3QB7C 4U6HA 1B90A 5IV2B 4PCTA 3MRFA 1T89A 1J8HA 1ZSDB 2J8OA 5F7BA 3MMEB 3IJSB 2V6HA 3CC5B 2BVYA 5AAMA 2OMWA 3NP4A 4FXLA 3OF6A 4MJ6B 4JGNA 1HINL 2F1BA 4AIOA 4DP7X 3CX2A 1GC1C 2HRPL 2XIDA 4KHTL 5KJ4A 3CZUB 4KHXH 3UL4A 1CGSL 4TOYH 3OLIA 2Z31A 4TUJB 2HKFL 2ZCLH 1RPUA 5DC0A 1ILUA 2ZKHH 2CO7B 5D7IA 4I89A 4XAWH 5TE4H 2KS0A 3NGBB 4G71B 4LIQL 1RQ5A 5I1CH 1J10A 5D1ZB 5AW7B 4PRAB 3TYFA 1AZVA 4GAJL 2XTLA 5KS9A 2KZKA 4WUUB 4OVVA 4LKXB 1W0VA 3EBGA 4FLSA 3SHSA 3DIFA 4AJ0A 3C5SB 3P4OA 4TV3A 2DMGA 5DMKB 4NT6A 2HX8A 4X9YA 1I7RB 4BA0A 1ZCRA 1LP9A 3MYZA 5D1QC 1S5HB 1NDMA 3KPPB 5FO9B 4Y16C 1GTFA 3EOTL 5B1KA 1UM6H 1GRWA 3SZ6A 3VD1A 1GJIA 1MXGA 4RDBA 1Z1WA 3ZTDC 1XL6A 3ME0B 4PLJC 4NZRH 1RJLA 3SD5A 3CFDB 2DWEB 1XD0A 2GJZA 1CF8L 5D5MF 3OPUA 1FNGA 2PO6A 5I75B 4XCFH 3K71A 2CKBB 1TU2A 4MVBD 4WFGE 5E5RB 5I76B 4ZX5A 3D69B 3WFBH 3HUJB 1IILE 3M6DA 3SDDD 2BVPA 3O4LE 3MFGB 5L2JB 5EIQA 1BF2A 1AAJA 5GRVL 1RJCA 4YGAB 1I9EA 3DXAD 3EYFA 3S3JA 1GW6A 5DHYB 1H3GA 3VFUA 4AEIH 1A3QA 5T3XL 4U1HA 4QOKA 1R5IA 3NYKA 4TL4A 1TIUA 3UTSE 5F1SA 1FP5A 4JO4H 4KRPD 3BP4A 4PJEF 3Q8EA 2EDKA 5D7JD 3CZEA 3T3MF 1TZIA 1L7IH 2F2HA 1BVNT 1A2YA 2E9WA 2YA0A 3FAXA 3KCWA 2HTLC 3H9HA 4XVUC 4N2KA 4PRPB 3MUHL 2IXQA 3LS5L 4X6CB 3KCPA 3D18B 5GPRA 1QA9A 2BSDA 4KK5C 2ICWB 3C60A 5AVWB 1K3IA 3CMOL 4GQZA 5F2FA 3QCUH 1FORH 2CDFA 3LS4H 3A4FA 4PRNB 4LU5H 1KACB 2ZX5A 3NCFB 4JKPL 5ETUB 1E4XI 1FI8C 2F53D 4JG0L 2W91A 4QRRA 1DQIA 3VXOA 2R7EA 3CFEA 4MJIE 5DA0B 3H3PL 4NNXB 5A2FA 5JW4R 1KZYA 2L0DA 1V3MA 4CAGA 2X2UA 1U8KB 1AE6H 3BN9C 3FN3A 3WIAA 2P5WD 2PPFA 5TQ0H 2FBOJ 4DHLA 1VFBB 5HYJB 4B60A 4JM0A 5IQ7L 3D8MA 4GXUM 3ZE0E 3SGDI 3MLWH 4V33A 3QUZB 4KTYA 2WNKA 5DU7A 4QNPE 1Q0XL 3CZLA 3TN0D 2X10A 4NNPL 5JORA 4M8QB 3V0HA 1TTCA 3FUKA 3NPZB 3VRLE 3X1FA 1MVUB 2VUOA 2ZSWA 3F6IA 3F7VA 1G9MC 4D9LL 3KYOB 3QRLA 4I9WD 4M5ZH 1KXQA 1Z3RA 3HI6H 2X38A 4HGMA 5CMAA 3FCBA 4WHTB 3ULVF 2LU3A 5J1SC 2OI9C 3FQYA 3TEWA 2A9NL 5D72L 2NQCA 5L88H 3KZ8A 4G7SB 2Z7WA 1LEGB 1Q9OA 4U7SA 4LCWA 4LIQE 2D7TL 4JZOA 4KI5C 3HR6A 1Q0EA 2QVMA 1T1XA 4KJWC 4XXCC 1ZHNA 1MI5B 1DLFL 1UXLA 4BKSC 4E9SA 1AFVL 3I3DA 5I17A 1WSST 4IU2B 4MNGE 3KLHD 1OOWA 1FL5B 2EIBA 2W60B 1HHJB 1UJTA 4Y16D 1WP6A 1BD2B 2J56A 1EAPA 1J11A 1H9VA 1UQSA 2HFGL 4PLJD 4Q9QL 1EK3A 3PIQA 5HI3C 3I6LD 1JAEA 3GUTA 5DRXB 3RZCB 3NRPA 3N44F 4ENZA 4HF5H 2AJVH 2AEQL 3VD5A 3D0AA 4GW5B 3V6ZA 1YMMD 3MRDA 1AG6A 4P5TC 3FMGH 3DUHA 4UQ2B 4WFFD 1ED3A 1JK9B 2EVFA 4DSYA 4DF9A 2V8MA 3DGGA 3FFCA 4JDEA 1YEKL 4IBYA 4HW6A 1AXIB 3L5IA 4P2OA 3L4WA 3TFKC 2AP2A 4XP9H 1NFKA 1NFDB 1C16A 4GRLB 1JF5A 4YHKL 1F90L 4YXKL 2H47C 3R1GH 1WWBX 5CIPH 3SBRA 2UXFA 1QPXA 2FNWA 3UPAA 3S35L 1IGYA 1OPGL 1FYTA 1U8NB 3DO3A 4OLZL 5TE7L 3TH2T 3FBKA 4Y4FB 3NJHA 1IEBB 3RWGA 2NLJB 4P4RA 4XVUD 4LF3A 3BSZH 3HUJE 5DA4A 1NLBH 1BZ9B 1NUDA 5EBWB 5C09A 5B3JF 4UI2A 5HVWA 3J8F7 1RHHA 3MUZ1 1RIUL 3KBEA 3LRLA 4KK5D 4K3EL 1X5GA 4B7IA 3QFJB 1YQVL 3RI5F 2MPAH 4PJ9B 1EMTL 3WHE1 1IVTA 1D5BA 5I66B 4WTZA 5T3XH 3MLRL 3BQVA 2G5BB 1G1YA 3T8MA 1NLDL 4X83A 1CVSC 4IIZA 2CKBH 4Y1AA 2WMPB 1UJ3C 4G43B 2IPKB 2MPVA 1P7BA 2W0FB 2FWSA 4PRPE 2YD0A 3H1ZA 5EORH 1E30A 4L1TA 4XP5L 1QLRB 2XQBL 4X6CE 5L4IA 1DBBH 3BZ5A 4PJBF 5LN8A 4Z3EA 3KEHA 4MA3B 1LL1A 3SQOH 2WQ8A 4YHML 1OCWL 4C4BA 1MJ7L 4U3SA 2FD6H 4R26L 3GSWA 4PY8I 5EU5A 3P73B 2BJML 2WXLA 5B38A 3CMOH 4YO0A 4Q6IC 2W9EH 3T6XA 3GZKA 2W0PA 3MCYA 3SGKA 3TZVB 1V7ML 1EFQA 1ZOXA 2VISB 4JKPH 1OGAA 1EHLL 3EFOB 2W9LA 4DQOH 2DQTL 1IAIM 1E67A 3T65A 4DVBA 2WXRA 1GSMA 1KPRA 3S8GB 1C5CH 3VXRD 2VSKB 1FZJA 5B1AB 4HWBA 5TF0A 4I85A 2ICEA 2YGOA 4XN9A 2XKNB 3T2LA 2D7QA 1GPOL 3IKCB 5EBLA 1UEYA 1DVTA 4H8HA 4XE5B 3RFZA 1M9WA 3RDTD 3VFGL 3CFIC 4OLXH 4XGZA 5KVEH 1J8RA 1Y1DA 2OMUB 1COBA 4C8XA 2LLGA 3OGOE 1G7QB 3TEYA 1IKOP 3ZE2F 5DVKA 3QG6A 1CDCA 3QE5A 4KJWD 4FOMA 2P80D 1AGFA 1QEWB 1JGDA 3IU3B 3A0OA 3V6BR 1UOWA 3L81A 3T77A 2RD0A 5CCGE 3ARGA 2H8PA 1AP2B 3KWTA 3ULUL 1IM9B 3H6JA 4DERA 5ACZB 1GOFA 4N68A 5KSUA 2ROXA 1N8OE 5BS0A 1J0YA 4JO3H 3ZDXF 4DVRH 4ZOBA 3MRBB 2VLKD 1NC4D 3BVTA 5TE6L 2Z91B 3IRCA 3QDJD 3KBFA 2R2EA 1Z7JA 5HI3D 2JI2A 1LNUB 3V6OE 1OAUL 2A9NH 1P1ZA 3AROA 3FQNB 3QQ3B 4FG0A 1DQQA 5D72H 3WTWA 4PBDA 1CGTA 2YAFA 1ZV2A 3PREA 2X1XR 2D7TH 2DM3A 1T0MA 3BAXA 4F3FA 1MI5E 1L5GB 2P49B 4ANWA 4NHCH 1NCTA 5F88A 1NCDH 1RCYA 4UTBA 4MKTA 5IJDC 1NGYA 1KCLA 2IGFH 3ARWA 5CJQL 5I8EA 3MCG1 2IAND 4LFHD 2VLLA 1T03H 4HPOL 4UMSA 3TFKD 2FNBA 2DQUL 1BD2E 4WY7H 4JFOA 4CMMB 1NEPA 4M61A 5I6XC 2BOCB 1U21A 5I1GL 4L9DA 3BXNB 1F1DA 3L95B 1L9TA 4J8RB 1RIHL 1T7YA 1PQZA 1X5ZA 2MSPA 3P30H 1U3JA 1S9YB 2CCVA 3PGCA 2BNUB 2HT3D 3HC4H 2YD1A 3APFA 4LEOB 2A9DA 5IB3B 2D8KA 1FN4B 1OF0A 2X9YA 2YR3A 1AHWC 4K55A 2LLNA 5MEPA 1JXDA 3IMWA 1NFDE 5CCJA 1N8ZB 2V7NB 4HT1L 3T8XB 1K8DA 5DR5L 4ZPVB 3QQNA 5F7AA 4Z7NB 4CBPA 2A0LD 1BJMA 1OPGH 5TE7H 1KB5A 2X4OB 5IJBC 3O3BA 3B9DA 2X4UB 1MW0A 3OG4B 2BC4B 2DTML 4GYBA 1H8NA 1QAWA 4HK3J 4JDVB 5M95B 1ACCA 1I1YA 4BKLB 3CVHB 5C3TA 4WW2A 3RWFB 3TVMA 3K6SA 1YEHL 2DD8L 5FWRA 2CK0L 1PX3A 4X5LA 1K5NB 4HXBL 1KELH 3QFJE 3VU2A 1VAHA 4NC1E 1VESA 3OX8B 1S3RA 3GMOB 2X70A 5CGYD 1EMTH 4LQFH 3MV11 2GIMA 1OVZA 4FXKC 3VYOA 1L9NA 3DX7B 2WYZA 4NERA 4P0DA 1FE8L 1HQ4A 4R2GC 5HI5C 1JI2A 1F00I 5E2WL 3KXFD 4ZUTA 2R29L 4FTVE 3TBWB 1D9KA 4A2HA 4YJZL 3CVHL 2QTVA 5ABAA 1JD7A 2Q86A 4JHAL 3WSQH 4XMVA 7PAZA 3L3KB 3C9NA 4Z78B 2F54A 4XP5H 3HEIB 3TU6A 3JT2A 4HJEA 1MNUH 3RZWA 1HKLL 2X4NA 4H26A 3EXJA 2VT0A 3U2JA 4KVPA 4UU9A 1DSFH 1MJ7H 1PY9A 4N9GB 1VJSA 2VJXA 3FQXB 3OKMB 3MRPA 4L1HA 1ZHBB 5EDSA 2CDGB 4R0LA 2OYPA 3VXSD 5DXWA 4E9WA 1GMIA 1XZWA 2OXGA 3BMWA 3Q2WA 3O3UN 5FV1L 4O4YH 4AUUA 4DP1X 5KSAD 2OTUB 2YZ1A 2VDNH 3IMVA 4XMKL 1BPVA 4NPYB 5IVXB 5HVHB 3ULUE 3PNRB 4XB3A 3QXDA 5AKSA 2J1YA 1NC2B 3BUIA 4GBXA 2XA8L 1D5IH 1WCBA 4BSWB 4Q9CA 3VFGH 1YNTA 2IWKA 1TTGA 3E8UL 1KBKA 1MKFA 1NEZA 2APTA 4YHZL 2WTRA 4MNQD 2OYLA 4S1SL 5AKTA 3EG9A 2PYED 5IVZA 4RETB 1NGWA 3ABMB 4G9DB 2AMUA 4N87A 4OFDA 5J7CC 2HX9A 3UGEA 3NCJH 1VACB 4BE5A 1DVFB 3L9BA 3ULUH 4M00A 2O72A 5EH1A 4IHOB 5AB9A 3AQYA 4UV4L 2VWEE 5J6SA 3HNSL 1RU9H 4NQDB 3ZKMC 1TMQA 1L6XA 4NPJA 2BCKA 1SBBA 4WWNA 4K8RD 1BHGA 3VXQB 5TGBB 3TEUA 4KK8C 3IDXL 5E0QA