2BSBA

E. coli f17e-g lectin domain complex with n-acetylglucosamine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
176
structure length
162
Chain Sequence
AVSFIGSTENDVGPSQGSYSLPFVYDTGYNIGYQNANVWHISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Natural Variation in Bacterial F17G Adhesins on Crystallization Behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
molecule keywords F17G ADHESIN SUBUNIT
total genus 38
structure length 162
sequence length 176
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 2bsbA00
3F6JA 1O9WA 1OIOA 4K0OA 2BS8A 1O9ZA 3FFOA 2BS71 3F64A 1O9VA 2BSCA 1ZK5A 1ZPLA 2BSBA
chains in the Genus database with same CATH superfamily
1S7RA 1KGCE 3HC0A 5JDSB 4QTIL 4YOKA 2J4WH 3BPNC 4TUJB 2VW6A 5EOQH 4WEBL 4AEIL 4HGMA 2EIJB 2J73A 5IMOA 4FFWD 3RQ3A 3O6FC 4IBZA 4IOSA 3VQ1C 1BD2D 2PW1A 3MACH 3FQNA 2MTAA 4N22A 4XAKD 4LHUG 3RWHB 2OMUB 3GSVB 3VUAA 1SJEA 2DKSA 1Q0YL 1A8ZA 3HMWL 3LRSA 3TV8A 3MLUL 4NUGL 2QSCH 4X6BB 1OK8A 1QW8A 2CJ3A 3EH1A 3WXWH 1SMDA 5LN4A 3ZIMA 1KDJA 3GZPA 5KSAB 4FNTA 2VC2L 2XC8A 4N0FB 3TT3L 4PP2B 3RJQB 1NEUA 2C7FA 5CR8A 1CDJA 4JCLA 5E9AA 2QVTA 3FUMA 4YBHA 4YBLC 4KAQH 5I8CB 4V1DD 4MXVE 4KZ0A 1KTDB 4LE8A 3QZWA 3EJRA 2H26B 4A2DA 1OOWA 4RAUB 1XWVA 2JKNA 4FL4B 5F9JA 5SV3A 3QIBB 2ZOLA 5EUOE 1E27B 1LDPL 3V6ZB 4CVWA 1GCYA 1QYGL 3RB7A 1WHOA 1DEDA 3KEDA 3V4UL 2AVFA 3VMOA 5D93C 5E2TH 5DTFA 5E1IA 3C87A 3ZQ9A 3ARGB 4JO3L 4KOCA 1I8IA 4Z7NF 5HYSG 4L1SA 3GNMH 5DU7A 3U2IA 5ISZB 1U92B 2MKWA 1PFCA 3OJVC 2HRLA 4WHYG 3RIKA 3ROOA 3IKCB 4Y4KA 4D3CL 4NPJA 4ZX6A 4HSAC 1GPOL 1MIML 4B5ZA 5EZJA 3HAEA 4WDIB 3DURA 3OAZH 4GJTB 4KROB 2X38A 4WTWA 2CO6B 4JKNA 4QHNB 5JPMB 2NY4C 1Q9OA 3QW9A 3UERA 2VDKL 4L8DA 4N5UA 1FYHB 1A3LH 5DGRA 4PWEA 3WLWC 3QDMB 4YHPB 3L2MA 5KVDE 4WI9A 4PN6A 3WS6C 1WWBX 5AUMA 1FNLA 4ELKB 2W60A 1LO3L 5KBDA 1E6OH 1RIVH 3ZDWA 5LVEA 5I1EL 1NDGA 1I8UA 3VYNA 1J5OL 4Z95L 3RURA 2N7BA 5ID0B 4KO5A 2X3CA 2DMKA 2AQTA 3X1BA 1NFAA 2CM6A 4XCCH 4XVJH 4PGCA 3MBWB 3LS5L 1TNNA 3N40F 3DLQR 4OZGA 5FX3A 2Z93A 4NCC1 4JM4H 2J7LA 4M93B 3UJTL 2YD2A 2D4FA 5CJ8A 4JN2A 1XD1A 2J6WA 2H6PA 1F6FB 1T20A 2BHUA 2H32A 3FO2A 1W8EA 5HDQL 3DOSA 4FQIH 2WXJA 5E51A 2B4CH 3LEXB 4ZFOA 3T77B 1ORSA 5L88H 3GMQB 4PRDB 1RQ5A 5A2FA 1T80A 5KYWB 2VDMH 5M94B 1AANA 3DHJA 3EF4A 3FRPA 3OV6A 4N6RA 3FQUA 2WYHA 3BE1L 4R4FL 5AOIA 3X3FL 2ATAA 1ZKAA 3BUYA 4DW2H 1I85A 2WSPA 3PWPD 2C9AA 1OP4A 3JWOL 4JW3A 4LPCA 4UV7H 1J05A 1J9CT 1I9JL 3CN2A 2ZOWA 1M6OA 2J1ZA 3LRLA 4UOZA 5HHME 3D3VA 1GY1A 4K9JA 4AQAA 4BDVB 1J8HB 5FLVA 5LN8A 4XGZA 3ZGIA 4F7PB 3DIDA 4PJXE 2JH2A 2FWUA 3O11B 3H2PA 4RGOH 4D9RE 1MJ8L 1T3FA 5IFAH 4UMGA 2YFOA 2IV8A 1CFNB 2Y1ZA 5BO1L 4U1SB 2BERA 4KMTH 5IK3A 4X50A 2YLKA 3PGCA 4OJDH 3VRLE 2BCMA 2OMBA 5ITBL 2KERA 2F7PA 3T09A 4GQZA 1JZ5A 3K6SB 4ZNCD 4WHDA 1T0MA 3MV8E 3QISA 2VNCA 1DZBA 3ILEA 4KGJA 1UZGA 4ZFFB 3E8UL 4PJIE 4LBEB 3WTVA 5HHMD 2Z0UA 2HT3C 3SCMB 5AZ2L 4E9RA 1OT1A 4Y16B 4JDVA 1AR1D 3GSRB 1MPAH 3I3BA 4FZ8L 2MNWA 3X14A 1IC4L 1SUJA 2HRPH 3N04A 3TEYA 3T65A 2BH0A 5DO2C 3BAXA 4B27A 5F3BA 4H88H 1MJJA 4ES8A 4XMTA 1KB5B 3NABH 3I50L 4UILH 1PGRB 2UX7A 3ABKB 2QQLH 4E68A 3MRQA 4NRZB 1R5VB 1KJMA 2RACA 5JIPA 2JIXB 5D7IB 2FLRT 2A74A 2VLKE 4OFYA 3HI5H 4Z7VB 1ETZB 5J5EA 1FWXA 1T6VN 2VABA 1PG7L 1RMFH 2HH0L 3D69A 3QUXA 1KGCD 1YEDB 4P9HL 1HWWA 3EUDA 2EO7A 4TKWA 4MSWA 4OCYL 1IM3A 4AENB 2XOTA 1FCCA 3GPSA 2JJSC 6FABL 3C9NA 5FYKD 2JMRA 2CK0H 4ORGB 4OR1A 1LP9F 1SXBA 4S1SL 2WOBA 3ISWA 1F4AA 4NKIH 3CVIL 4KJWC 5EC1A 5GRVL 3WIAA 4BXVA 3T9WA 5C9JB 3SO5A 4AGMA 1QA9B 4LPTA 3LOWA 4BKLA 1BIIA 3REVB 2XWZA 5DVPA 2R15A 3AB0C 4HC1L 5CJXC 3BGFB 4TNWF 3VGHA 3CXHK 4JB9L 1OK0A 3DI3B 4UINL 2E7CA 1MCFA 4LCIH 4FXKA 1IIKA 3T4YA 4WFGD 2G2PA 1ZPLA 3TU6A 4HV8B 2YGPA 3FUEA 2DRUA 2WLIA 1YEJH 5IESL 3VD4A 2PP8A 3QRGH 1GYUA 5FB8B 5DS2A 3U82B 1INDL 3GXUB 2ITEA 3O6LL 3RI5K 4JK0D 5DLMH 1X7SA 1VKXA 1DVFB 4ZTPH 5BW7C 2UZYB 1TO4A 2XKSA 2NSQA 3PWPE 4AKQA 4E0RB 4PCKA 2J8UB 3KWWA 4U2YA 4OQTH 2B0SH 1A1MB 3GXFA 2YRBA 2WXRA 3KPPB 4HXAH 1L6PA 4ICXA 4UTBH 5D4HA 5IB4A 3W2DH 4RWYL 4IBUA 2G3NA 4NFDA 4ZXBD 3A3YB 3L9BA 1BFVH 2C1PB 1OWRM 4N85A 4NP4H 1NDMA 4OGYH 3R4DA 5KW9H 3KLLA 2JQMA 4CVZA 5A3ID 3FK3A 4OB5H 3VSVA 1VFUA 5B39G 2NY5C 1J18A 1RXLA 4YAQB 2XZCL 3KYMA 1A02N 1ZWIB 4HCIA 4ANUA 4YHZH 1KPRB 1FGVL 5D7LA 2DIJA 1KTCA 2C4FT 3DNKA 3LEVL 3B3IA 5DJ2A 3H85A 4X5RA 3S34H 3O41B 3VM5A 5IHWA 5J12B 3ABGA 4FMFA 4MNHA 1EO7A 3PJSB 5M7QA 3AMLA 1A9BA 2GJ6A 1DO6A 4R9HA 2OMVB 2UZIH 5AYTA 4P2QB 1NEZG 3RHWK 1VACB 4M48L 4WV1A 4PPTA 4E9VA 3MFGB 2VZOA 2YGNA 2HKFH 2X44D 1KGYE 3HJEA 1UWFA 4N8CL 5AVXB 5EIQA 1FL5A 4MMYB 4AE1A 2QL1A 4JQIL 2PPCA 4U1KB 4TVUA 2BK8A 5E8EA 3LQZB 1KYOK 2CBTA 4H0GA 4P07A 2DF3A 4EZMA 3MCKA 5IB1B 2BNQE 1ZV2A 1YO4A 4FFYH 3X11B 4P2OB 5F3FA 3ROLB 2P47B 4N0UA 2DBJA 4G70B 2AK4A 2NX5E 2XWTA 4RMTA 4ZZKA 4NJ9L 3O4LA 5K1VA 4YO0B 3WEAA 4L18A 1U8KB 3ZYOA 1S7UB 5CSZB 5EZLB 4HISA 1ZGLA 5EDSA 2HX8A 1JTOA 2A9NH 2Z7YA 3HG2A 2GC7C 2M26A 1JZGA 2B15A 1R19A 1CDYA 5ID1B 1G1CA 3G5WA 1RK7A 2IANA 4PJ7E 3S3BB 1AE6L 3N41B 4TSBL 4CA4A 5DEFB 3QG7H 2IWKA 3FNKA 1FZJA 4Q4IA 4JKPL 3DV6A 3V7MA 1JXDA 3CZJA 2OK0L 3NEXA 3UTSE 4G6FD 4JHAL 2QGEA 4MNQA 4A2HA 5C6TL 1AQKH 1BZOA 4CGUB 2NW2A 5CIPA 5L2KD 1FFNA 3WBDA 4KJPD 3ESPA 2HAZA 1YEEH 1QLEH 5IREA 3BZEB 1ET7A 3GMLA 1XR9A 2ZSVA 5ANMB 3FRUB 3QNYA 2D7PA 1ML0A 1P84K 2EYSA 3IFPB 2YQ3A 1MIEL 3VXMA 3QR1A 3U6RA 4L8CA 5HYFA 1LO2H 2PWFA 4M3KB 3ZE0B 5FLUA 2V9UA 5AVTB 1ES0B 1HU8A 2BNRA 2WM0A 2N1KA 3CFBA 4OQ1A 4DTGL 4E9QA 1NPUA 5HYJD 3OHXC 1BA9A 1E7UA 2IQ9H 1PZAA 2R0LL 1WQVT 1II4E 4A2MA 2IFFL 3PABA 5HPOA 4XNXL 4UDUB 2EEBA 3F65A 1JPEA 1U36A 4ZX5A 4XAWH 3TXAA 5HTSA 4HBQA 4BK8A 5E8DL 4RFOH 3DX7A 1BXVA 1KJ3L 3R8BB 4GSDL 3LSOA 1UENA 1D2OA 1AG0A 3O9WC 4MQ7B 3KYOB 4XE5B 4EO5A 3WFCL 1MG3C 1M7DA 3F7PC 2BZ7A 4JFHD 5C09D 2C9UA 3ZKNC 5E9DD 3BPLB 5BXFB 1G9NC 3PWJA 4IS6A 3MLWL 3D39E 1CICD 3O6KH 4PWGA 3WDIA 1BQRA 4AYSA 4K7PL 2X9WA 2UY7A 4GRLB 4W9CC 1XF1A 2HRHA 1MHCA 2WIIB 2FL5B 1GW6A 1DJYA 1OPGH 4IDJL 5I8KL 3CLEH 3WHXB 3F5WA 3EGXB 4HQQH 2CDGB 5ELIA 4FTVB 4G8GD 4HIPA 4Z23A 3QSKB 5C2BH 1JE6A 4NXKA 1KJ2H 2ZD0A 4YSEA 4ZMTA 1JTPA 1FFQA 1DFBL 3TWCH 3NK4A 1JYNA 1DJSA 4EN2A 3UYPB 2J6EA 3PL6B 3V0AC 4Q89A 3QHZH 1NC2B 2EE2A 3KCWA 1N5YH 5EU6D 1F56A 3G04B 3NCBB 1C7TA 3MLSL 2CGRH 4XVUD 2VDMB 4LSRL 3EO0B 2AGJL 1GZHC 1RJYA 2V9QA 2BIHA 2VTFA 1ZEAL 4G8GE 2A9MH 3L4WA 3LCYA 5CZRA 4ZPVA 5C0AA 3KGSA 1BZ8A 5IT2H 1SNRA 1J0YA 4PGEB 1UYWH 3VMPA 4ZZFA 4KKBC 4B7IA 5KVDH 1I1AA 5CD5C 1Q9LB 5I1HH 3UTQB 5MP6L 3KM2A 3RTQC 1RI8A 4I85A 4OT1L 3QEGL 4JFFA 5LB1A 5G4NA 3EO9L 5DMKB 5I16B 4TOYL 3IJSB 4P3CH 2VC2H 1U8IA 1IGCH 1MZYA 4PAZA 3SDAA 2Y07H 1MLBB 1DFXA 2GAZB 1KBWA 1WAEA 4EIZC 2E9WA 1FNGB 3NZ8A 2HFFA 4N90D 4DIXA 4CC1A 4U7KA 4Y1TA 1V7NH 2WP3O 5MHSD 1MY5A 4G9DB 3DX0A 1W72L 4Y19B 1W15A 5FFOA 5LG6A 4BH7A 1ZJBA 1ND0A 2WXFA 3BPCB 1NCGA 4K3JH 2DDQL 5DVKA 3MRBB 5LNDA 2XN9D 3S98A 2PCXA 2E8YA 3EFFB 1UGKA 4JPWH 4NQCE 2P3YA 2ZUQC 2FB4L 5MENA 4Z7WF 2AXFA 4MD0A 1FV1B 4M1CD 1RZJC 1P4LA 4A7SA 3DUHA 3CHSA 5JPMC 1D7CA 5B3SB 3HMXH 3S37H 3H4HA 3DARA 4DEWA 1N6UA 3QQ3B 1JHTB 1GGUA 5FF6B 4YXLH 2AAVA 3N43F 3S4SA 3MV7A 3NMEA 2ERJB 4HUCA 2NY2C 5DD5L 4G5AA 3V5DA 5LQBH 2P5WB 5D7KE 1BFOA 4QHMA 4UM9D 2G5RA 4EZJA 1KNOB 2XACC 4P46B 2EEAA 5BUAA 2VMDA 1ZE3C 3D39D 1MWAH 4HALA 1JVOA 3UZEC 3BJLA 2HT2D 4KJQD 4DP8X 1FC2D 32C2B 1XGYL 5D1XD 5IVOA 5KVFE 2C7UB 3K81A 1BZ7B 4JRYD 1YN6B 3I6LE 3MXWL 1B0IA 1OV8A 3KE0A 4W81A 3QIBC 4KI5D 3FB6B 1UT2A 3ZYIA 4GRWH 4HHGA 4XP9H 4UBDC 4KDTA 5CKGA 2P8MA 2GITB 5DSCA 3QJVB 4UTBA 5HHPA 4L8SB 1TCRA 1YUHA 3QO0A 5F7LB 2F0CA 1RJZB 3OM3B 4LEOA 1FVDB 5KW9L 4RGNC 1CFMA 3GXIA 5MI0C 2AV1B 4PGDA 3LB6C 2ZSWB 5EG6C 1MUJB 2F19H 3CFNA 4U0RB 3B3BA 4W6YB 4J4PD 2K6ZA 3K8KA 4UTBL 1D5ZB 3P0YH 4MDJB 5IM7B 5C0BE 4QF1A 4HHAA 5DRWB 4HFUH 3QRLA 4GT0A 3GSXB 4TL4A 3AABA 3F7VB 2ZONA 3KH4A 5D2LB 4UYQA 3Q2WA 3T3PF 4KK9D 3WMPA 1F8TL 2CRIA 1Z3RA 1IL1B 1RLBA 5FC9A 1QPXA 1UD4A 3CX5K 3LZLA 5IHHA 4Y4HC 1AHKA 2VKWA 1LDSA 5KVEL 1NFDE 2F1BA 3QUYB 1U3HB 1GYVA 3PUUA 3JTBA 4BK5A 5EH1A 2VZ3A 2OZ4L 4PEEA 3TEUA 4Z7OB 3W9EB 1CTMA 2MH4A 2FDBP 3BWUF 5D6CA 5GISL 4LMQE 4QJ4B 1DBBH 2A6IB 3ES6B 2EDLA 5EC2A 4O5LL 1RZJH 4ODSH 4P2OD 3H3PL 4ZOBA 1D6EB 5DCCA 3SKJL 1J1XH 4B9GA 1CL7H 4D0BB 1M6UA 4RSVA 4WI7A 4XMXA 3S5YA 4EIUA 4Q6IC 3L3GB 3BGMA 5DD6B 5ESVB 1VHPA 5DQJA 3MJ8B 2XY2A 1EXGA 3NH7H 4G8FA 4GP8B 5GGTL 4J8RA 3FB7B 3VWKD 3FHQA 3EJPA 4HPOL 3ETBF 1YDPB 2ED9A 3QRBA 1TMCB 25C8L 5DJCB 2C3WA 5E2JA 5C0DA 3CE1A 1AXTL 4W9KC 4XRCA 5HVHC 2GJ6E 1S9WA 1OGPA 2X2UA 5FV2A 3MI6A 4P2QD 2NQDA 4B97A 4DKEL 1DVQA 3JV4A 4FKHA 3KPRD 4JM2D 4KTGA 4DEPB 3QFJE 3M88A 4JRYA 2AQQA 4PG2C 1RUQL 2QVMA 2Z92A 3DROA 4QTHB 5E1AB 4AEEA 1EMTH 1BZQK 3MTXA 3VXME 3L3IA 1P9MA 4X4XA 2DQJH 4JPQA 5E24E 3K4AA 2JK5A 4BXSV 1VDGA 1FVEB 1W8OA 4LCYA 1JI1A 2L7JA 3WOVA 3CFUA 4FI8A 3S96A 5ICZA 1FL3B 2FO4A 2AZAA 3KYAA 4KQ4L 3ZKMD 4HCFA 3EOAA 3ZDYF 2CXGA 2GSGB 1NOAA 2IGTA 5HHOA 4BIKA 4M8QA 4P2RA 2JTYA 2L8AA 2V8MA 5DJDB 2AK4E 1ZTXL 2VDOL 2VZ1A 3FU5A 1KTLA 5K1JA 3MV9B 3KPRE 2H5UA 1G7MA 3H8NA 5JPNA 3VD1A 1E4HA 1NKGA 2DEYX 1DVXA 3CBKB 3DJZA 2C1OA 4YC2C 4I5BA 2AJYH 3CZKA 4JFDA 3SYPA 3N0AA 1FVCA 2OL3B 2H1PH 2KLSA 3N85L 3TP4A 3VGDA 2QEJA 3RFZB 5D1QE 1OT4A 3QZLA 4FYQA 3WS3A 1HCVA 4J6RH 4HU2A 3BFOA 1KB5L 2NY6C 4WI5A 4Z8FH 4AM0A 4A7GA 2XIBA 5EFIB 2I32A 3QARA 2A9AA 2E47A 4CMMA 3CHQA 3FQYA 4KRLB 1YMMB 4S10A 3VRIB 3O0RH 5C0BD 4ELMF 1JFHA 2F8OA 3GHEH 3GMRB 4KXZH 4NQSA 3TM6A 3VFUA 2ID5A 3IMRA 5BV7C 4ZMXA 4MBRA 2CLRB 2NY1C 5CEXB 1HEHC 2FWSA 3VU2A 1FLTX 4LASH 3RZCA 3NYKA 4K3JL 1ADQH 1DEEB 4OFDA 4DKAA 4J23A 1AIFA 5IFJB 4NO0A 5K9KA 5SWQA 3FMGL 3L95A 4RH4A 5F6IC 4XBMA 4Z3IA 4LLWB 1KACB 3IDNB 1RVFL 2N3JA 4GLRH 4QRQA 5BZXA 3QFJB 5MEPB 3V4PL 1NUFA 3S36H 4HCRH 3B1TA 1ZHBB 1T5XB 4GQRA 4XBGB 4JDEB 1IGFL 5EBWA 3OXSB 4OD1L 3ZE2F 4U6HB 2UY6B 2OAAA 3MJ9L 1ZV9A 3UP6A 3H42H 4WNQB 3L1GA 5IHBA 2VYRE 3EO9H 3POHA 3FQ2A 3QGVA 3Q5YA 4GRMA 2XWXA 4GIPD 4OKDA 4ELMA 1CGSL 4C54A 4O02B 4MDIA 4ZNEA 3HBGA 5CBEA 2OMYA 1TO5A 3TYGH 1T1YA 1MFEL 3DOIA 3F83A 5IV2A 2OKMA 2VH5L 4DP5X 2VLJB 3BKMH 3B8YA 4XP1L 1PX4A 1YLBB 4TMPA 1ZVNA 1U2HA 3BFQG 3SBPA 1T22B 3NJKA 3SB3A 4RCAA 1KCRL 4JFEE 3FCGA 3VD5A 1FQ9C 1DVZA 3LTVA 3CN1A 1IFGA 2XPGA 4XMPH 4YL9A 4FXTA 4JANB 3U46B 3BQUA 1L4IA 2NSMA 2CUHA 3M1CA 5FYKU 2DQ6A 2WTPA 1HHJB 3S35L 1S78D 2MOGA 1XEDA 4FQXD 4JO4H 5E0FA 3PYCA 1MWAA 2ALAA 1R5IB 2F1EA 2PKDA 1E2VA 4HLZH 3HPLA 2XZAL 1I9RH 3CDGB 2WBJC 3Q2CA 4HIEB 4KBPA 3TYFA 3V4VA 5E5RB 1MCEA 3FU7A 5IF0B 4WO4C 3MV01 2XBZA 1XIWA 3L1EA 1I3RB 4JFQA 4LLVB 2NNXA 4V11A 5AW9B 4PRIA 4NC2B 1JD7A 3DXAA 3OAUH 2X6BA 3GIVB 3LKRB 4PJ9A 4MLIA 4ZQKA 4Z7QB 3OWRA 2UX6A 3QUML 1JWSA 2VDPB 1SLWA 3U48A 1FZOB 1S7SA 2QELA 3OG4B 1CFTA 5GRXG 3SSGA 4P99A 3RJDA 1NBZB 3FJTA 1C16A 1D5XB 2QZQA 1PL3A 1IBFA 2FVNA 2LLLA 2AEIT 1E65A 2VIRA 3SQBA 1E9PB 1ZOXA 2NT1A 4MA1B 1IAIL 4IHOA 4Z1PA 2UV3A 3MLUH 4MCYB 1BXAA 5HHVH 5SX5K 2E7DA 4ZX3A 3DTDA 1PYWA 3B7RL 5BZDA 2XA3A 4FG6C 1I8LC 3SIKA 3K5SA 4NO2A 1J8HD 4O2EB 1Q1JH 2VR4A 4FZEH 1HKLH 5BV7B 3QULB 1ZXQA 2PTVA 1UHVA 2YR3A 4L1DA 2MWCA 4ODTH 1JN6B 1QTPA 5KTEL 1FC1A 2EDBA 2J4WL 1UJTA 3RVWC 5F7UA 5JOFB 1RY7B 2CJUL 4XMKL 3V0WL 3BKYH 1CDIA 1IAOB 3GB7A 4P06A 4Y2DA 3U7YH 1ZLUH 5BRQA 2V2TB 1CFSB 3MLSH 3RGHA 5GZOD 4P23B 2JWYA 2QLVB 4AYFA 3AQDA 1KCSL 3FT9A 2CDEA 4N6QA 3GZOA 4UOJA 1AACA 2ICWB 2FJFA 1IT9H 4LSPH 4PJGB 2ESVA 4NBXB 1EEYB 1WVZA 3IYLW 2E7HA 3IU3B 4FQ1H 3RWGA 1HCZA 1MW3A 4B3EA 4KI5F 1NC4B 1OLZA 1XGQA 5ISZD 2Y7OA 3HIZA 1QEWA 3DBXA 3WLBB 1JUFB 3ARGD 4U6XB 4MYPA 2IPUK 3HVDA 2YMTA 5JXEA 3VJ6B 4B9JA 3D1MC 2A73B 3O6KL 4UT6L 3L6FA 3FSVA 1OTUD 3D08A 3JTSA 4P9ML 3U9PL 1ACXA 4BINA 4L8BB 2F58H 3DK2A 4ZO8A 4V1DA 5DZJA 4P5SA 4TYUA 5C09E 1AGDB 3D87B 4PCYA 4RMRA 4ZMWA 2GT9B 3DGCR 5TGBB 3PHQA 4BFKA 3W0WB 5HGDA 1U6AL 4LEXH 3C8KA 2BSRA 3U30C 4DQOL 3PP3K 3SDXB 5D2LE 1HAWA 5JA9A 1A4JB 4WKZA 3EGSA 4FQXA 5F7KC 4LQFH 4KUCD 1GTNA 3H0TB 3QQ9D 4FCAA 5DK0A 1IGIL 1DJIA 1RZKC 2H3NA 3BDBA 1EO8H 3J2PA 4GG8B 2YBGA 4JY6B 5FGCB 4ZW8A 3EBGA 3QORD 4Y2LA 2IDUA 2PCYA 1FDLL 4OLXH 4KTYA 5C08A 5C3LD 3LEVH 2NY3D 2VAAB 1TVHB 4ALAH 4O5LH 4OLVL 4L9LB 5EU4B 5B39A 2AJXH 3MRIB 3TONA 2CO1A 3WL9A 4HK0A 2EINB 2AJZB 4K2UL 4OLYH 2GK0A 3VSTA 1PDKA 3HKZA 4WUUD 1CGXA 1ZT1A 4UMSA 5EIIG 1NCIA 5EBMB 4PFEA 4Z7NB 5GZOC 2CHXA 1B88A 1IBGH 2WXGA 3PGDA 4X98A 3RTQA 3W0WE 3HE7A 4UCFA 2QFRA 1B6UA 3PP3H 1BFVL 4PRPD 1KF9B 5FO7A 3O3BA 3KHOA 1BGXH 4HWEH 1WGVA 3TA4D 3SO3B 5HHQB 4CC4C 2WY3B 3GS4A 3QXDA 2JJTA 5BCAA 1AO7A 4G5ZL 3R18A 3ZDYB 3GJFA 1D7FA 4I89A 1PKQB 3Q05A 1F2XK 5DFAA 5T1LD 2ZUWA 3OKNA 3EYVB 3L3OC 4HSQA 4ZDHA 1CZ8L 4WO0A 3OGOE 1QHPA 4XB7A 3QUGA 3NIDB 2EE9A 4NJ9H 2KUTA 3TA3B 1S8DB 1PX3A 4GYBA 4GAJH 1M53A 4PGJA 3H2QA 4KWUA 1OTUC 2IBZY 4B5EA 2Y6SC 3WKML 5BS0B 5MEOA 2DM7A 5G4OA 4O51B 1J9TA 2HPOA 4LCIL 4NGHH 4K5OA 2DI8A 3RP1A 4A37A 3ULVL 4HIIA 1K5WA 2Q3XA 4FLHA 3MXWH 1I53A 2V2XB 5GRYA 4AKOA 4CSSA 4EI5B 2D0HA 4OZFA 1UWXH 1IC5H 4U49A 2A83A 2DL2A 4ZAKD 4F9PA 1ACZA 3G5XA 4L48A 5I0DA 4HS6B 1TQUA 2YEZA 1TZGL 4Z0XA 2JKLA 4ELME 2R1XA 1E4KC 4JPIB 4UOW0 2YJLA 4RVBA 3LHPL 4YBQC 1RVFH 1NEPA 1TLMA 3VSQA 2PCPA 1TVBB 2YXMA 3HFML 1JV2B 2AABL 2OX5A 3CNKA 2R83A 3CZSA 3GS7A 1U6AH 4LOUD 4XNBA 1ROWA 2D4DA 2X6AA 1QRND 1NCAL 2FSEA 1N68A 1X6LA 2GSIB 4NKMA 2W5PA 2VUYA 4QT5B 5SX4I 1AO7D 4NNPH 5FYLL 5K9QI 3AZUA 1KIPB 3H9SD 4KJPC 5CD3B 3V5KB 2VW4A 5B38G 1MCBA 1EAOA 3QUZB 1UB5B 4W6WB 2BOBB 3MRKA 3GD1C 3HPJB 5C8JB 3ULAB 2EH7H 3O2VL 1NLBL 4KKLD 1UWXK 3VFRB 2Y72A 3A4AA 2G5BB 4XCYA 4X7TA 1KB5H 1O7SA 5E9DE 3MZGB 5EN2A 1AKJD 1UWYA 2ICWI 2WBXA 1TSRA 4MXQC 3SJVA 3N06B 5HVFB 2MRYA 5F7MC 3BKJL 4P5RA 1ACCA 5GZND 3WIIH 4BFBD 1RHFA 1H8LA 2V6HA 2W1NA 1CE1H 4TUOB 4WEUD 4HOZA 3ULUE 5EF3A 3S88L 2CO4A 5H37G 2BSSB 4WU7A 5CFAA 3Q9PA 1L3WA 1WBYA 3US9A 1ROCA 3IE4A 2IEPA 4RGOL 2VDOH 4QRRA 4MCZA 4FA6A 3OQRA 2FQDA 5J6HA 2OCJA 4PLNC 4O4YL 3JWDH 1NSNH 4M7JL 3VXTA 1RIUL 4GSQA 1JWMB 4F7EA 3MQIA 1FFPB 5DHVB 1WFNA 1EO5A 1JWUB 4HUUB 1WIOA 4HUKB 4JB9H 4HVBA 2EIMB 3QDJD 4ENZA 2WXLA 2WZ5A 1NGPL 2EDEA 1ZT4B 7PAZA 3GZKA 3H9SB 2J2ZB 1MVUB 2NT0A 4FFZH 2BDNL 4LL9A 1ZS2A 3IJHA 4IBTA 1Q38A 5CUSH 1JWUA 5EF0A 5IB5A 1A4BA 3F6IA 5D7KD 4YVNA 3WAJA 4L9DA 2HXAA 1JWMA 1XCQA 1S9YA 4L29B 5J6HB 4NWUH 4RIRB 5CP7A 3ZT5A 4QRRB 5I8KH 2NNCA 3UCRA 1R3IH 2BSSA 3E2HC 1KBKA 3MV11 1NH6A 1DSWA 3T5WA 3KYNB 5F7EH 2X4RA 1IKOP 1CFBA 1WT5A 4TUOA 4CAGA 4N4YB 2XY1A 3RJOA 1GGYA 4YDVA 3U36B 4HT1H 1RUAH 3ZE1B 1EUTA 4S1DD 5DUMH 3OAUL 2B3RA 2DW5A 4X6CA 5D9SB 1IEHA 1TITA 1JPST 2ZTBA 2DMBA 1BEYH 3WN5A 3WFEL 3P3UA 3VFRA 4LSTL 5JPNC 1RURL 2VB5A 1FG2B 4X6DA 1UB5A 3QUZA 1F8TH 3BEWA 3TOPA 4ABVA 1F0LA 4FHJA 2R0LH 4JM0A 4PD4K 5KANG 4KGLA 3W0WD 1KCSH 4KMTL 3L5XL 4QT5A 5DMIL 2Y25A 5C0NC 2C8NA 5CILL 3MJ9A 4L4TA 3BP7A 4JFYB 1H0DA 2VKXA 1REIA 3G9VA 5E2TL 1JV2A 1MCQA 1QATA 2J8UE 1EAPB 2PPFA 4KK6D 2EDOA 1KCWA 2R1XB 3CN4A 4JPIA 1IC7H 4XC1L 2J1WA 7PCYA 1IGMH 4ANVA 2ICWJ 3FRPG 3I6GB 5DMJB 2YEZB 2ZPKH 4HS6A 1SXAA 2ZKHL 5AOKA 3CPLB 3GJEB 2ITFA 2ZKWA 5FCUH 4EI5A 2V2XA 4RAVB 3PRZA 2OK0H 4BM7A 1XGYH 2CRZA 2O6PA 2VSMB 4GIOA 4O51A 5BS0A 5MEOB 1J86A 1LO4H 4DKFH 1NGYB 3BSZH 1HJBC 4FL4C 4QNPE 1KLUB 4QRSB 3RL2A 1FSKC 2OS7A 3OMAB 1S8DA 3TA3A 4F37F 4F8QA 1CO1A 4PUBL 2YUWA 3B5GA 2WQSA 1AOZA 2D9QB 5I23A 5CO1A 2HTKC 1PKQA 2RJMA 4AZUA 2JKWA 3FAWA 4NAMA 3GRWA 4Z7OF 1G9NH 4J3OH 3K80A 3V6OC 4HKZA 5IHZA 3EJZD 3OPUA 3QXDB 1VPOL 3QCVL 3KWVA 3UEQA 1WWAX 2QHLA 4WW1A 5HHQA 4MA8L 3QZNA 1MAJA 3FTUA 1SEBB 4Y2OB 2XWCA 2CO2A 3NRQA 1P7QA 4EKXA 4U1IA 2DD8H 4LIQH 4JQIH 1AO7E 4OIIH 4X98B 3PGDB 5GGSY 5EBMA 3KEHA 3LB6D 1VA9A 2PF6A 1PDKB 3VXRD 5JXEC 1MH5B 2AVGA 5DD1H 4N68A 4HCRA 4M7ZB 3ZDXF 1FPTH 4HK0B 4K73A 1A6VL 3WL9B 3X1FA 3VM7A 3K2UH 4LEBA 5HDWA 5B39B 4L9LA 5EU4A 4PJIB 2GIYA 4LZKA 2VAAA 3MOBH 4KK9C 5C7XL 2OR8A 5FCUL 2R1YB 3F7YA 4LHJB 5C08B 4BZ2L 2WIMA 1T0PB 5EA0L 3BX7C 1AGCB 1XSJA 4YDMA 3QDGB 5T1KD 1UVQA 3TYGL 4M00A 3BFWA 3KWUA 1C9SA 1EBPA 3H0TA 5DK0B 4NBZB 1A6WL 5IQ7L 5CWSB 4G9FB 4FQXB 3EGSB 4WKZB 1A4JA 1N70A 3ZTNL 4Y9GA 4LDCA 3C8KB 5A6MA 5HGDB 5CCGE 1AFVL 3W0WA 5L8KB 3WIFB 4OFQA 3HI1B 4XOBA 5TGBA 2GT9A 3QDME 1AGDA 5EZIL 2CGZA 5FYJL 5IFHH 1KY7A 2CR0A 3S36L 2ZF9A 5DHVH 3JTSB 1EEZA 2YBRA 4OIBA 5I2IA 4LPYA 2XPYA 1IUZA 3NIGE 3L5JA 3IDGB 3W11C 8FABA 3KPSE 3N42B 2L3BA 4QOKD 4GI6A 5JQHC 4F5CE 3UADA 2V9TA 4POYA 4YHOH 4LOEA 5C86A 2EIZB 4JKWA 1TPXB 2Q7YA 1R4XA 2X7LB 1JUFA 2H2SC 3DBXB 1QEWB 3IE9A 3WLBA 4YZWA 4G2AA 1R3LA 2QKIA 1NGPH 4JM2C 4PBVC 4PJCF 3TEXA 3VD0A 4S1RH 2Q5BA 4DO4A 1AAJA 3V7AE 2EIKB 4ADGA 3RWGB 2AI0L 2Z65C 3IU3A 5FA4B 4RQQB 3QJHB 4BQBA 1PY4A 1R6VA 2ESVB 4PJGA 1KXTB 3L48A 3MGAA 3BWAA 4J3OF 4HZLB 4PG9B 4G59C 5D1QD 3K0YA 3US1A 1ACYL 2QSVA 2WLLA 3ECQA 4AYFB 2HKHL 3BIAX 2Z91B 1IVLA 4AOFA 4IIQB 3SCMC 1JF6A 3GTTA 3MRHB 4WU5A 5I1GL 4EI5C 1FE8H 2Z9TA 1JRHH 4Y2DB 1IAOA 3GB7B 1SVZA 5T3XH 5MENE 1UH4A 3C5ZA 2NXZC 3OLIA 2VR5A 2W81C 5BW7A 1SY6A 1DBJL 1JZ4A 4NT6B 4ATWA 3BT0A 3TEZA 2FHBA 6PCYA 1JN6A 5IW3A 5D2NC 2BIIA 1LGVA 1MFAH 2HH0H 4QUOA 2R56L 3AADB 3L4YA 5ABDE 1OANA 3QULA 3DJRA 4DGIH 3KNBB 2I60L 4O2EA 4YHLL 4NO2B 2FQFA 3BAJA 1BQLH 4UYPA 5I6KA 1TETH 1YPZF 5LGYA 4S11A 2ESVD 4IEFB 3HR6A 4MCYA 3P4OA 4HW6A 3GJFK 2FO1A 4XWOD 2Q8AH 3ZIYA 4WWKC 4L0ZA 3NIDF 3HZVB 1UD6A 2BM3A 5AVQB 3FUFA 3HFMH 5I6PA 1FZOA 1PLCA 4BGDA 1QABA 4CC0A 2WWMC 1UG9A 3VFGH 1DO5A 1T89A 1J5HA 1G7PA 4GS7C 3BVDB 5GGTH 3ZK0A 4GG6F 4Z3TA 1QHOA 3ARFC 3DXAB 5JTWA 3VXQA 1FE8L 1UD8A 3SJVE 4TVPD 1I3RA 4LLVA 1XIWB 1PLGL 3HC2A 2KPNA 3PHOA 3TYFB 3V4VB 4HIEA 3CDGA 1RFDL 3HPLB 5KOVC 1CL7L 2DYPA 3BMWA 3D0VA 3REWA 3RVTC 3UPCA 3ZTJG 1BYNA 1MWAB 1YNLL 3U2JA 2VDQL 4AH2B 1HHJA 4TV3A 2Q20A 4ZUUB 3NJNA 4M4PA 3BQUB 4JANA 3U46A 1NAMB 3PQYD 2XPGB 3JVGA 4DETA 3HUJF 4R7DB 3IXTB 2K3HA 2EICA 4F93B 4EI5D 3NESA 1AKPA 4PUBH 2AABH 4FJYA 1HXKA 2VLJA 2JI2A 3Q7JA 4AVJA 4BEIA 3QIUD 2ZYSA 5IV2B 2GJZA 5EZIH 5C3IA 4Y2NA 2OMYB 4ZMAT 1XXFC 5CBEB 1E5YA 2IBBA 3OVUB 4ELMB 4TOYH 1Q94A 1TJIH 4WNQA 5GS1C 5I1HL 3ULVH 2UY6A 1LO5B 5EU7C 4U1GB 4JDEA 5EBWB 1T5XA 4XBGA 1ASQA 1ZHBA 4FNSA 1BQSA 4QGYA 3VVVA 1IC7L 5MEPA 3QFJA 4JRYE 1E6OL 1RIVL 4EEEA 3PAZA 1BG9A 3IDMB 3ZKSD 1LO3H 3K6FA 2EDXA 3IDNA 4HJIA 3D7PA 4LLWA 4LSDA 5AB2A 3GLZA 4H2AA 4FQ2H 3VFMB 3WKYA 5JYMA 3ZE0E 3VGFA 1AZUA 2ZQKA 5SWQB 4P46C 4NO0B 4NIKB 4TQPA 5K9KB 2NY5L 5JDJA 4UTCA 1DEEA 3MPCA 2AQPA 1U3HC 4GQQA 2X6CA 5LCVH 4AY0A 3P3RA 2WINB 3NK3A 1XF2B 1OAJA 4L0YA 2VN6A 1MIMH 2GY5A 2CH8A 1DCEA 4X6DE 3MBXL 2DTSA 2VSDA 4Q9CA 2IH1A 4P4KA 3SDCB 5DD5H 1EFQA 2QKIC 2RGSA 4CMMB 3X1NA 2A3TA 1EJOH 4ZMVA 5EFIA 2JQZA 3CLEL 5BVPH 4Q74A 2HKHH 3NCYP 2YLHA 3WS3B 4NKOA 2HCZX 2XV0A 3IJEA 5E2VH 3KZ8A 3RFZA 1U2YA 2ZG1A 1Q72L 3JV6A 1FVCB 1J12A 3O6ML 5T3ZL 1YN7A 1LILA 1DN0B 4YC2B 1E50A 1UKTA 1CLOH 2C1OB 3O6FD 4LKXB 4UQIM 3IAPA 5E6ZA 4JJOA 4FABL 3KD4A 1G7MB 4EKJA 2VT0A 5JPNB 1LO0H 5DD0L 3MV9A 2EDRA 3JUYA 4H40A 1DYZA 3PGFH 4GB9A 5EU3B 2W91A 1F6LL 4M8QB 4P2RB 1DHKA 5HHOB 2GSGA 5E1HB 4M5YH 3FU8A 2CNZA 2XQYK 4F92B 4YX2L 4BGLA 1X9RA 3S96B 4N5ED 3IS0X 3NA4A 1HHHB 3QEHB 2HZHA 1QI5A 2JK5B 5A40E 4O2CB 2WGXA 1PFOA 3QEGH 4HJJL 4O9HH 4OT1H 1IB5A 1U93A 3L3IB 4H8HA 4LEXL 4TNVK 4X4XB 5DEGA 2NSXA 4TS6A 3KDPB 3K46A 4WEMB 3UAAA 1AOHA 2WZ0A 4JO2L 4JRYB 4U4IA 5IJVA 1TDQA 1MIEH 4F2EA 1S9WB 1QI4A 3GS0A 4UAHA 4XRCB 4EZLA 1A7BA 1M7UA 4KVNL 5GGVH 5IJCC 1YDPA 3PAYA 5CXPA 2C9QA 2Z31B 4HCGA 3GJFH 4G8FB 5D55A 2ICEC 3MJ8A 3OC5A 5DQJB 5GRUL 3RE0A 4HXBL 3L3GA 3DA0A 1LK2B 3QHZL 4LCWB 5EPMB 1FNFA 1HKLL 1NCNA 3FO1A 1COBA 2OW7A 3KR3L 3TO4D 1ICTA 1IRAY 4QIRA 4LCCC 5EC2B 5ADPH 4I87A 4RLDA 2R69H 4OCWH 2X4OA 1TTCA 4HBCL 2W9LA 5FYJE 5HDBB 1JVKA 1XR8B 2ADFL 1AE6H 4TSBH 3QQ9C 3TURA 3B2MA 4E9YA 4J28A 4TSCH 3QIWC 3ARYA 3I84A 3QC5X 3H7LA 3ZTEA 4A6YH 4YDKH 1U3HA 2EAEA 2Y7LA 3QUYA 1CU4L 4KC3B 3RYMA 3J7HA 3MJGX 4ECNA 5AALA 4GAGL 3MCLH 4IRSA 5CAYB 3HI6H 5DA0B 5ENWB 3QUMH 1Q0EA 4GXFA 4XNAA 3F7LA 5F1SA 4L0PB 5GS3A 3GSXA 1MDAA 4H44C 5EEVA 3RGVC 2V7HB 5CMAA 4LU5H 1RULL 4MDJA 5IM7A 3KPSD 2GEQA 1D5ZA 4MRCA 4XN9A 2DLIA 3GSUB 1TJHL 5SWZE 5LLIC 1V3JA 2OMXB 4NENB 1YNTB 2ZSWA 1E30A 3M07A 4Z0BH 2AV1A 4PGDB 3QS3A 4JO4L 4D9QD 5SWSD 1FVDA 2NY0C 2VDML 4WJG3 4LEOB 4MS8C 2ZG3A 4W9EC 2IFFH 2MCMA 1OCCB 3QO0B 3JSSA 2IQ9L 2X4TB 4PJBB 1PIFA 2GITA 2P8MB 2VDLL 4U6VL 5DSCB 3P9LA 1YA5A 4GRLD 1CE6A 3KL0A 4PYGA 4KMLB 1LO0L 4NC1C 5DD0H 5AOJA 1YN6A 1BZ7A 1GCFA 2M1KA 5GGSB 4X6FB 7TAAA 5IHUH 32C2A 4DKDC 1SYSB 3GUTA 2IG2H 3VXSD 4J3OD 1RPUA 2OMTA 2BVQA 4O4YH 3U0TB 5KAQG 3ZHNA 3K3QA 1HYSD 4NUMA 1BFOB 4QHMB 4YDLB 3EZJB 4AE0A 1A9EA 3ZE2B 3MV7B 3S4SB 2XZAH 4YL4A 1MF2L 3UFIA 3Q6FA 1NGZA 2GG1A 3OMNB 4Z7UA 2AJVL 2HLAB 3WJLA 5H8DA 3MFFA 4WTQA 4JKPH 5KWYC 4B3VA 1FV1A 4MD0B 3ZZ1A 3V9CA 4OQTL 1MEXH 2OR9H 4TVPH 2XYCA 1J7VR 5GRZA 3EYQD 4HH8A 3ZYZA 1C5DA 1Z6JT 2A9NL 4PW3A 3NJFA 3JVFC 1ND0B 3BPCA 2EXYD 5AAWA 3IGFA 4N0CD 3ECBA 5C09B 4DFHA 4F2MA 4DP4X 5DO2D 5IOPA 2Y1YA 4P5KA 3WY3A 1JZJA 1BJ1H 2HFFB 2HX9A 1FNGA 3NZ8B 2AQSA 1E90A 1YEGL 3N55A 4X80H 4I2XE 3F8UB 1WFUA 2GAZA 5E6YA 5B3JF 5ADOH 5KSBA 1MLBA 4AV4A 3SDAB 3VI3F 7CGTA 1F4WH 2ITCB 3M7FB 2V2WB 2VDQH 4NQDA 4XE0A 4NSKB 1U8IB 3IMSA 3IJSA 1NAML 2K7PA 1A5FL 1DDHB 5I16A 5DMKA 4HK3J 3B7SA 1D5IH 1IKFL 3LPGA 5FKPA 4OLXL 3UTQA 1Q9LA 3LRHA 3RAJH 2WTRB 1T1XB 1XGTA 2FEEI 3B83A 2AFNA 1IE4A 2UZIL 6TAAA 4F8LA 5C0AB 4GSUA 4ZPVB 4XWGL 2LVEA 4PVMA 1RJYB 1AYOA 1G6VK 3EO0A 2NYKA 3VFSA 5I1CH 1OVZA 2X3AA 4PB0L 4EBQH 1IU1A 1MNNA 3O3EA 5ITFB 5L2KB 2FGZA 3F01A 3PLYA 5T5NF 5MEND 1WFTA 3PL6A 4AYGA 1CF8H 2CE6A 3U9PH 4N2MA 1TQCC 3CGTA 2VJXA 3HN5A 5FFGA 3H3KA 4B9CA 5F7HA 2I27N 3CVHL 4TULL 4V2BA 3A67H 2F7QA 4K94L 2E86A 3SE9H 2VL4A 4TXVB 1KIQB 3EGXA 3F5WB 2WNXA 3WHXA 5C07D 4L4VB 3DX6B 4WWNA 4KITB 3O4LE 3AROA 1V54B 3RUGE 2FL5A 4POZC 2WIIA 3FH7A 5BQ7B 5H35A 2B0SL 4ZQTA 2R8SL 2CRMA 1U8QA 3VGAC 5CGYD 4PJ7A 4MAYC 4X7SL 2VQ1A 3QXUA 5BXFA 5BUGA 5DLML 2ORBL 1U8HB 5FM4A 5BNXD 2NCEA 2NXYB 5LAXB 5MEQA 4TTGA 5IESH 5FYJU 3KYOA 4MQ7A 4WI8A 3SGJA 5A3IC 3LN4B 4XTRC 3DX7B 4R96A 3PWLA 5HGGS 4MNQE 4K2UH 4UQ2A 3HN8A 3UIYA 3H9YA 3ABMB 5ISZE 5KTEH 3V0FA 3BUQA 4M7KL 2BVOA 4WNSA 1IGYB 1QR1A 4ZO7A 3DHPA 2WQWA 2BNRB 3SGEI 2KL6A 1SLVA 1E9OB 4G6KL 1KCUH 3MYZA 2HA1A 1R3JB 1AZRA 2PCFB 1O9ZA 1R0AH 3VXMB 1OGAD 3IFPA 1IAKB 1JYWA 3T4AB 4ODHH 1PAZA 3O45B 3FRUA 1LXMA 5D6DA 4ENED 4TNEA 3NZHL 3NH7L 4XP5L 1AC0A 5DS1A 3BZEA 3WGVB 5C0IB 4ETYA 1KCUL 2FBRA 1E6JL 4N87A 1FFNB 3QAZC 2NW2B 5CIPB 4K8RL 4TF4A 5IZ7A 3B9AA 4HC1A 3MRDA 3ARXA 4D94A 3QWRA 6CGTA 2N7AA 4JHVA 4U1MA 4LCCA 4FHKA 3SBQA 2W0LA 5D5MA 5INDA 3CWGA 2XG5A 4PJHF 1OTSC 4G7RB 4BFIB 5DEFA 3WU1A 3EYOA 3MLPA 5D5MF 2KI6A 2ZP8A 4YDKL 2BCKA 2R2EA 3WSQH 3APFA 3C60A 5EZLA 5CZVL 2VXUH 3CFKB 1G7IA 2CIIA 2UXFA 4YO0A 2VRQA 1CWVA 3JWDC 3MNVA 2VDKB 4WFEE 2XWTB 2AK4B 2R69L 3CMOH 4OCWL 3JT2A 1YY9D 4N0UB 4BKSC 3ROLA 4MJIB 2LR4A 4UQEA 3TNMB 4EPSA 3ARUA 1I75A 3MCKB 4M6NL 2DQEH 5IB1A 2H3XC 1ILUA 1RK0B 5KYYA 1MCWW 3LQZA 5E8EB 2DD8L 3T0WA 1MHHA 1NMCB 5L4MA 1PF3A 4HSCX 4U1KA 2DJUA 5D1ZI 5MI0B 4X9HA 3AMKA 4QXTB 4N9OB 4JG5A 5CGTA 2DTML 1OT2A 3ZE1E 2BNRE 1I3GL 3KGTA 2VUKA 3QEQE 2EDKA 4NNYB 4OGXL 3DECA 1A7RL 4WV1B 4K55A 5B7EA 1L3NA 2G75B 1CF8L 2Y7MA 2GJ6B 1A9BB 5DUBA 2AEQH 1M57B 4XN1A 5D1QB 2IADA 3UGUA 3B3IB 3P69A 5DJ2B 1BDYA 5C7XH 1K85A 2XN0A 3CUPA 5I1CL 2BVUA 4GKOA 2DBLH 4ERSH 1KPRA 5LCVA 2IXQB 5JHAA 4XWGH 4UT6A 2PR4H 3KYMB 3E38A 5H4ZA 5TDNA 2WBJA 2BHFA 4ENEC 3VXOA 2VLLB 4WNJA 1J8RA 3WAKA 4NFBA 5HDQH 3QHTC 2DN7A 4UOQA 3UG4A 1E3XA 5JXED 1IKFH 2C1PA 4LIQL 4P2CG 5DFVD 1OAZH 4YXLL 2BHZA 4M7ZC 5E4OA 3PY9A 1VENA 1ZA6B 5SWSE 4AYMC 3KPPA 5IB4B 4PLJC 4MAUH 1Q72H 2FB4H 4Q6KA 1R33A 4E0RA 1GHFH 2JIXD 4ZD3H 2UZYA 1YEFH 4K23L 3U4BL 1DVFA 3EHBB 1VKXB 5CCKL 3D2UB 2YARA 3OHXB 4MJIE 3TPUA 2KYIA 4CSPA 3B1UA 2GIXA 5FB8A 2KHAA 3KXFA 2WLIB 1DVSA 1J0HA 4KKPA 3EO1A 3NP4A 2QVKA 3ZZQA 1G43A 3HRZA 4NQEA 5K39B 4F2ME 4OD3H 2ZXDA 5C2UB 2ADFH 4PHZA 3CMOL 3GHBL 3CQFA 4FXKB 4PMFA 4HBCH 1XEUA 3MRRA 4QRPA 4H20H 3Q01A 4DPAX 1QD0A 4IBQA 1XDTT 1UD5A 4Z6AT 4XXCA 2C9XA 2OMWB 2XJLA 1ZTXH 1ZV5A 4NN6B 1E2ZA 2H0PA 5EC1B 1ZK5A 4CMHC 4JEGB 3QR2A 1MFEH 1X5ZA 2EXSA 5DT1H 1A7RH 3C9NB 3QCUL 3NJVA 1QVOA 2LFEA 3EH2A 1R46A 4MSWB 4AENA 1GGIH 4TLUA 1QFPA 2ZOKA 3QUXB 2YAEA 3D69B 2XG4A 3KLHD 1ILSA 2UZPA 1TZOA 4BE6A 1KXQE 1ETZA 2IH8A 4Z7VA 1N5YL 5INCA 4AJVA 2B5IC 2DQMA 3L1OH 3C2AH 1KJMB 3ZN6A 1R5VA 3MRQB 1KDIA 4NRZA 4PWHA 1PVHA 3APDA 4F2FA 2WQXA 3CQQA 3CZFB 4BRJA 3B2PA 2CHWA 1HNYA 2JELL 4DO6A 1MJJB 3LDBC 1OLLA 3VYOA 5AW5B 5G4MA 1KXVC 2NX5D 4GXUM 2ZOUA 3H56A 4KQ3L 4U31A 3T65B 1CD1B 2XUWA 3GSRA 4QNPF 4JDVB 3Q06A 4LASL 1G4RA 4IRJD 4N1HB 2I69A 4DSYA 2ZUYA 3V0VB 4RX4D 4I3GA 4QAMB 2P45B 4TQ8A 5FOJA 4ZFFA 1E28A 4ADIA 3K6SA 1Y6MR 4QKTA 1C8PA 1JF5A 4LVNC 1LHZA 4TVPE 3PGCB 1IBBA 1TYJA 1KGJA 3CFCH 2R23A 4U1SA 1CFNA 1MCSA 3EXJA 3LKQB 4HWBL 4Y1AA 2ETWA 3LKQA 4Y1AB 2EVIA 2X1WL 1THAA 2R23B 2WJ7A 4ZMLA 2GJJA 3K74B 4XGZB 4F7PA 1VESA 5I18L 4BDVA 5A2JH 3D3VB 4AQAB 1KTRL 1T66D 1V8HA 1E28B 4Z3EA 4YMPA 4BZ1L 1J05B 4U0RC 3V0VA 3BUYB 2OJZH 2NXYD 4GFXA 4HEMA 5CEZL 4FG2A 3FULA 1CD1A 3FRPB 1J1OL 2WVUA 3UO1L 5FM5M 2RHEA 3MZTA 4NZDA 1E5BA 1KN4L 2NDFA 5KYWA 1PLBA 4NHCL 3FTYA 3UABA 2X05A 1QW9A 2JJUA 3CZFA 4PRDA 3GMQA 5L7XL 4H8PA 2GBVA 4MQXD 3TX4A 2Q8BL 4YPJA 1BBDH 5INCB 3FO2B 2H32B 1T20B 2H6PB 1XCXA 1TXKA 4FXKC 2XG4B 1PSKL 2ZE0A 4F37K 4JHAH 3ZL4H 2ZOKB 3G3LA 3MBWA 1ID2A 4PGCB 4AVHA 5A2LH 1EVTC 4Z3GA 1MRDH 4EUPG 1QVOB 4YX2H 5AB1A 2Q2EB 2DJ4A 5T3XL 3V4LA 4OV6F 1NDGB 4M6ML 5C6PB 4CMHB 5KSAD 3ZGHA 1HL8A 4GMSH 4MASA 4C4KO 2AMGA 3HG1E 2W60B 5F0PB 4ELKA 1I1RA 2OMWA 4OGAD 3WGUB 2XSKA 3QDMA 4YHPA 5I26A 3VMNA 4X9IA 1Q9OB 3LH9A 1UWEH 2CO6A 4QHNA 3WUZA 5JPMA 1H9DA 4QRPB 3MRRB 3QJZA 1MXGA 3PP4L 3DURB 5J11C 2JF1A 4OZIF 1NTDA 3ZW3A 1OTTC 3KVQA 4NQEB 3HRZB 5K39A 1DLFH 1VEMA 3EO1B 3PP4H 4Y4KB 3IKCA 3ROOB 3DYMA 3QZMA 3S3JA 2NY0B 3KXFB 2VN5A 1N19A 1UWEL 5ISZA 3SE4A 1HOEA 1FRGH 3ILDA 3TPUB 3OHXA 1BQUA 4LPXA 3D2UA 1TQBB 4CDHA 3BAWA 3KLDA 5E08H 4ZMPA 3LH8A 2CCLA 3MNMA 1AQ8A 5GS0L 4DOHB 4MZ3A 1A14L 1YNKH 1GY2A 2ZOLB 3QIBA 3DVIA 1WS8A 3MBED 2ICCA 2H26A 2WKOA 3QZWB 3W3BA 1KTDA 3UMNA 3ZMNA 1U3ZA 3ZRFC 1ZA6A 4OU3A 4CN6A 5I8CA 5AW4B 3U0WH 3C08H 3ZTNH 3HZ3A 5EUOF 2NY5H 3G6JE 3AWFA 1PSKH 1NCDL 4DVRH 5CLTA 4N0FA 5KSAA 4URKA 5JQ6H 2HP4A 2YAHA 2VLLA 4QXWA 3VXOB 2WBJB 4QRAA 5TDNB 4TVSa 5L7XH 2J72A 1ZEAH 2AJUH 5JQ6L 1NMBL 5CLZA 2IXQA 4Q14A 2VR9A 4KK5C 4FNQA 1NCDH 4DVRL 1TJIL 3CUPB 3FQNB 4IJ3B 1SDAB 2PW1B 5E6UB 1ZJAA 2IADB 3IWVA 4Z18A 5D1QA 4FMVA 2F5BL 5IMOB 5DUBB 4X7DC 4OF5A 1F5WA 3D0AA 2XXGA 1ZXKA 2G75A 1KELL 1SGKA 4TUJA 3T1WA 4NS0A 1RZPA 4NNYA 5PCYA 3NCJL 3HC0B 3MLRH 5JDSA 1S7RB 2NX5B 2HT4C 4QXTA 2VAJA 1DE4A 4FFYA 1MHHB 4J2QA 1H8OA 2CHNA 5ALBH 1ZHLB 2MJWA 5KYYB 1RK0A 1YEJL 4AGLA 4N2BA 3NQIA 4KJYB 3TNMA 3LEYL 3F85A 4MJIA 4PBDA 4KXAA 3V0DA 4WFFD 4E9WA 1OTTD 4JUSA 2GPZA 1FGNL 1DBBL 4R5TA 4BH8A 1E8ZA 2APBA 1BPLB 3GQFA 3HA0A 4O00A 3VTTA 3D9AL 3MNVB 5G55A 4FF9A 2XA8L 3I6KB 3KBPA 5J56B 4WIQA 1G7IB 2CIIB 3CFKA 1OCWL 3D2UD 3JUZA 3MJ7A 3ULUC 3EJSA 2WCGA 2ZXAA 3C60B 2CWRA 2ZKXA 2R2EB 4UANA 2BCKB 3UP1A 5BRPA 4BJLA 3G08B 5FDWB 3UBXI 4JE0A 3DO3A 3U6XA 2H3KA 3EYOB 5GRVK 1YYML 4H26B 3A4DA 1KYDA 1SJMA 4ISVB 4Y89A 1EIBA 3TZVD 2O5ZL 4BFIA 5A2BA 2KMWA 3MBEC 5IMKB 2XG5B 5D5MB 5INDB 1MRDL 3MLZH 3CD4A 2O6FA 2J20A 4LCCB 4U1MB 5B1JA 4PS3A 3D48R 3H53A 4Y5XA 3MRDB 5GZOA 4LLUA 3RRQA 5F9AC 3VACA 5C0IA 5I75B 1A47A 3N43B 1RULH 2HT3D 4KPHH 3ZRCC 3U83A 1AR1C 3ATEA 2E27L 2X6UA 2BO0A 5EWIL 3O45A 3IDUA 3T4AA 4YEEA 1IAKA 3GRWH 4MMXA 2L7UA 3ABLB 2PCFA 1JXFA 1R3JA 4ODTL 5B38A 4Q8BA 3K6DA 1E9OA 5F7AA 1DBAH 4FFWC 1F00I 4IBYA 1EHLL 5HHXL 3V0HA 4DPBX 3PWNA 3CDZA 1I1AD 1P4UA 3CSFA 5K9OB 3ARBD 3DPDA 4F24A 1QR1B 1IGYA 2QLYA 2BVOB 2X5PA 3GO1H 1S7TB 4JFFD 2WSDA 3AAZB 1SXNA 4FQJL 4BCZA 3ARVA 4XPGL 3TJHD 1EANA 3EAKA 1W72B 1OGTA 5KN5B 4FQXC 4UQ2B 4KK8C 3PWLB 5KEZA 4R96B 4GG6E 3C5JA 2HMID 2ATKB 3QS2A 3LN4A 4LSTH 2Y2TA 5FYKL 3A24A 3T6WA 3D85D 5MEQB 1QZ1A 2WB7A 4HWBH 4WO4D 5LAXA 4L1TA 3FONA 4JFOA 4M56A 1U8HA 2AF2A 5IBTH 3WI9A 5E4IA 3U7YL 1XF4B 2KLTA 4P2OC 2VQ1B 4PJ7B 2FWOB 1GHFL 2WC7A 1U8QB 3H6JA 2ARJA 5F7EL 1MELA 2Y23A 5H35B 4J39A 5BQ7A 1NCHA 3NIGB 2DAVA 5H94B 5I9QC 1K2DB 5IVNA 3GYRA 5AVSB 3DX6A 4L4VA 4M5SA 1A1OA 2YAPA 3S5ZA 3T3MB 2ODHA 1KIQA 1FF5A 5ESQB 5HJ3B 3LKNA 2YRLA 3MRJB 4NYLB 5I6OA 4FADA 3LNFA 4H0IA 4HEME 2FJSA 2NCMA 2EXTA 2E75C 1JGDB 5KYXB 3LX9A 3HTLX 4PJFA 3N6YA 2W9DH 2PR4L 4NDMB 3AY4C 3MCYA 3WFHA 3TIDB 3MRLA 5L2KA 3O3EB 5ITFA 2B08A 1UD2A 1WGOA 5L4FA 4JM4L 2DYSB 4PV9A 5DZLA 3VFSB 4Q9BA 4XP1H 2OL3H 1KEML 4XMZA 3SDDB 1MI5D 3DUSB 4A6YB 4YWGH 4A7UA 1DR9A 2HLFC 1MFNA 2ZPKL 3CSTA 3KVDD 4OCRH 5GHWL 3TT1L 3BPLC 3L2LA 2EABA 4OB5L 2QQKH 3NFPB 4JQXC 2BOCB 2BXYA 4PV8B 5D4QA 1WFMA 1T1XA 1XGTB 2CUMA 2WTRA 4MZIA 4N26A 1RCYA 2ESVE 5FKPB 2BNRD 4JFTA 3UTSD 1TYRA 1OAYH 2CO3A 1EJOL 5JZ7D 5T33L 1DDHA 3C08L 3KJ4B 3ZSSA 4NSKA 2V2WA 2ITCA 1UT1A 4NQDB 1MW1A 5KSBB 1HHKA 2HFGH 3QJQB 2C3VB 2BOLA 1CDHA 1BEXA 1NMCC 1UOVA 1X5GA 2D2OA 1NCUA 2PXYB 3B56A 2K0RA 4P5KB 4PBWD 1R34A 1FYTE 5IOPB 4F2MB 3ECBB 5C09A 4HQQL 4P05A 1C5DB 5C71A 1ZTMA 1SF3A 4PJHA 3QWNA 4HG4J 4LLYB 2YC1A 4JRFA 2Q7AA 1HWHB 3FQXA 2Q86A 3VI4B 4WQOA 4F7KA 1LQBC 1RUAL 1NCAH 3MFFB 2HLAA 1VAHA 1EX0A 3RPBA 5EF1A 4Z7UB 1NGZB 3Q6FB 1U58A 4HC1H 1BD2B 2VN4A 3FHEA 4AEHL 4AL8H 1A9EB 1RZQA 5LWYH 2RH0A 4WWID 1P9MC 5C08E 1DQVA 4X5LA 1EZLA 4JRLA 5IJKC 1IEAA 3D85A 2IDTA 3P9MA 3AT9A 2WCPA 3U0TA 2BVQB 1TZGH 2OMTB 2H1PL 3FUHA 2O30A 3N85H 4R26L 3L3OA 5SX5H 4DKFL 3WEMA 2AXJA 2NNRA 3GUTB 1SYSA 4XN7A 2KDYA 4XPBL 4UIKL 4X6FA 5GGSA 5J13B 5FUOL 1BJMA 1OW0A 4FFZL 4NCDA 1CE6B 1Q4NX 3BIBX 5FGRA 3HI5L 1BBDL 3UAJC 4YHZL 3P9LB 4OI7A 2HLFD 3OKEA 4XAKE 3B5HA 2X4TA 3GBMH 4PJBA 4QMEA 5I73B 4BFGA 2NDGA 2LVCA 4EOWL 4NHCH 3NDZE 4P2YA 1NKOA 4H88L 4J2XA 3RILA 4MJ4A 3OR6A 1LTXA 1SXZA 1T21A 1YNTA 3JYBA 4KZCA 4NENA 2OMXA 5AW8B 1MZZA 3AY2A 4PTUA 5D93B 3WJLC 3GSUA 2R56H 1ADQA 1FG9C 1QP1A 2Z7UA 4W9LC 5C0GA 3WFDH 4R2GD 3INUH 3SDAD 1DSFH 5HDBF 5CMAB 2V7HA 1VZIA 3SZ6A 4GMTH 3MNZB 3LQAL 3BKJH 3DJSA 1SQMA 5I82A 5ENWA 4I3RH 4IRSB 2YA1A 4GMTL 4UNUA 3WNKA 1U8NB 4YLQT 1KZYA 5I1GH 4MXWL 4UU9A 4FLQA 3LY6A 2YKLL 1YNTF 3R7QA 2DQUH 2VMEA 2V8LA 1Z5LB 1TUPA 1A2YB 3Q44A 5AOZA 1XR8A 3BRGC 4JFPB 4U1JB 3OJDB 1A3RH 2X4OB 1XX9C 3DGDA 4K5MA 4PJGF 2VWEC 3NJXA 3PV7A 3FO1B 1USQA 3PWUA 2I60H 1J0ZA 2IC2A 5B3JE 5EPMA 4LCWA 1LK2A 4GKSA 1HZKA 2P48B 1T5KA 4FRWA 3ZKQD 5HHMB 2EKSA 3K8LA 2C9SA 3ZKXC 3W82A 4FG6D 2BNQD 4E9LA 2Z31A 4YHYB 3C5ZD 3T3ME 4Z7VF 1IGIH 3B9DA 4FNUA 4R26H 4X42A 4YEFA 3L4UA 1IAMA 5IJVB 2QTVA 2N1TE 1HHGA 2DWXA 3TCXA 3O8XC 5J1TC 4XO3A 2BVYA 1U93B 3BISA 5DEGB 1C7SA 3UAJD 2EADA 4O2CA 3UJTH 1OP5H 4JDZA 5DVNA 3QEHA 1HHHA 3UX9B 5IQ7H 3Q0HA 5F88B 1NAMH 5HJGA 3D07A 1NCOA 4IIZA 1MY7A 4UILL 2E56A 2EUWA 3V5HB 2GYSA 3EDJA 4Z7IA 5I1EH 1DVTA 2IMMA 1CVRA 1JFQL 2ADJA 1QFUH 2CA4A 3FC8A 5EU3A 2WANA 4KROC 3ZBMA 2PR9A 4MCNA 1QNZL 4X6CE 3J27A 3S88H 4LKXA 3FFCD 2BVPA 4BE5A 1AQHA 3RTQD 1DN0A 4WHCA 1YN7B 3MU3A 3ECVA 4KXZI 3G9AB 5GZNC 3JV6B 2E7MA 1JPTL 1TCMA 3VI4F 3PDOB 1OXYA 1NKRA 4CN4A 1X9UA 3IJEB 1A14H 4NKOB 1EEUA 3P0YL 1NJ9B 2K4AA 3FFOA 3MVSA 4I88A 1URLA 2AJVH 4HUWB 2Z6FA 2NZ1A 1D2PA 2CGYA 1OAYL 1EHNA 1JDAA 4K94H 3SDCA 1YEFL 1F45A 2C26A 2IH1B 2NUPB 4P4KB 1XTLA 5FHBL 5FM8A 2MPVA 1FLRL 4KKQA 4JNXA 2I25N 3MRNA 1RPKA 3K2KA 4FXLA 3T2NH 2WINA 1XF2A 4Q52A 2IG2L 4R8WH 1B3JA 2IH9A 4QKXB 4LCWD 2BSDA 3SGKC 1TEFA 3QDMD 1OAZL 4NZFA 5I74C 1OSZA 5E95B 2DJMA 3VFMA 1NFKA 2HKAA 1PKOA 4RESB 3IDMA 1QFWL 3SYOA 2Z0BA 4YHYC 4X8XA 2FO8A 1J0JA 2W92A 2N0MA 4BA0A 5EOTA 3VFVA 3C5SA 5KZCD 2Z64C 2WJ5A 4FQIL 1LO5A 4PJ8C 4RA0C 5T3XD 3RKDC 1IAII 3HCVB 1GA2A 1FHGA 1U30A 4Q58C 1SVCP 1XT5A 2O6CA 1Q94B 4KJQC 2VSKB 4WGKA 3RZCC 1XZ0A 2BVTA 3QK0A 2P1YA 5D1XC 4ZMYA 2OBGA 1OE1A 2JTDA 3F12B 1GMEA 3FBKA 2GJZB 3QIBD 4FG0A 4KI5C 4R97B 5CZXC 1VPOH 2DQFA 5IT2L 5JOEA 4KV5F 1SJHA 3RNKA 2R0WL 4F8OA 1I3GH 2Z8RA 4NO5B 4XNQA 5E8OB 3BT2H 3VQMA 2RD0A 1G0XA 2HRGA 4UQ9A 1IVTA 3QC6X 1B6DA 3Q9QA 4XC3H 5ERWA 4JGNA 3IXTA 2OJZL 4L4VE 4R7DA 1SOXA 2D7QA 3KGUA 2CIKA 3IN2A 1SZNA 2CBPA 1NAMA 1RUPL 1BCIA 3LIZA 3CFMA 4L4TE 4O2FA 3NT0A 8CGTA 3RKPA 2CMRL 4ZUUA 3FO0L 4G1MB 2A74C 4PJXF 4CC4A 4AH2A 1GH7A 4MLSA 1KULA 3S3SA 4QGTA 3REWB 3GTNA 2DYPB 3D0VB 5AW3B 5HVHB 1AD9B 5E9NA 4HJ1A 4FDWA 3A47A 3PHOB 5A43C 4W9JC 3TO2A 3NAAH 3BVNA 4TQIA 1P4BH 4Y4HD 1OF0A 2OA9A 4K94C 1UA6L 3VXQB 3ZKND 2FIKA 4DP0X 2AQRA 3KPTA 4AK2A 3NSYA 1G7PB 4FFZA 1CICC 5DRNA 4XPTL 2O5XL 3MLWH 2DL9A 2E27H 1OAKL 5L9DL 4N90E 3D05A 3V9EA 1XH3A 3WNOA 1FYTD 2HVJB 5JNYB 2A6JB 3F04A 2R0KH 1JDDA 1R3IL 3VB9A 3HZVA 1ZA3A 3CXFA 4M62H 1IGFH 2IAMC 2DIAA 5HDLA 5BZWA 5FA3A 1EAQA 3OB8A 3P4OB 4PWIA 3EYSH 4OJFL 5GSRA 4OBRA 4IEFA 2BIQA 2CNYA 1QR4A 4Q9QH 1WH0A 1KG0B 1E5AA 1B90A 5HHVL 4PJBE 1TTGA 3LZNA 4LQFL 5FECA 1HSAA 1YYMH 5CN3A 5JW4N 3KNBA 2BXZA 4DQOH 3SYQA 3QUMB 4DVBB 4XHQA 4OM1L 4UTAA 3AWEA 4JJHA 2B5IB 2K4WA 3BESR 4XVJL 4KKAD 5ES4B 3LRGA 4NT6A 3FT2B 2IPKB 5T3ZH 4XX1G 4J3XA 3C5ZB 4FS0A 5DT1L 1UA6H 2OZ4A 3MRHA 4WU5B 4BK5C 3HC3H 4MXQD 5EZOH 4IIQA 4WEEA 2Z91A 4TNWK 1CYXA 4HKBA 3BYYA 2WLLB 2UUDK 3QJRB 2W80C 4HZLA 3GM8A 3BWAB 4PG9A 3ZE2E 1KXTA 5D1ZD 3WIIL 3NCJH 4WF7A 2AJYL 3QJHA 2PABA 3FO0H 4RQQA 3JXAA 5FA4A 3WY2A 5K59F 3OKDB 4ZUWA 4M8RA 3SQRA 1MFCL 3GO1L 4DKTA 2FT8A 3B43A 3QPXL 4XMPL 2N4IA 2DQGH 2PWEA 3P77B 3OZ9L 5T5FH 1R3LB 2QKIB 2YGQA 3ZDYE 2ZX5A 1NIFA 2KPWA 2EE6A 5B22A 1KCRH 1N5AA 1JXJA 2X7LA 3DSFH 2EKJA 3QBTB 2EIZA 2J8HA 4HUMB 4MJ2A 1BVNT 1ETA1 5CNHA 1OSEA 2AXGB 2B59A 1N2RA 5F3HA 4K23H 4MYWB 3U4BH 3IDGA 8FABB 1OP3K 1F13A 4BQ8A 2J8OA 4IGBD 4IKJA 5I2IB 4KVNH 1ID5I 4UWQB 3I9IA 2YBRB 5EWIH 1EEZB 5KVGL 1RIUH 1ZIAA 2D0FA 4X4YB 15C8L 2XX1A 3K91A 2DLEA 3UBXA 3HI1A 3SDYH 4TQEL 3WIFA 2R2CA 1CXIA 4OIAA 3JWNH 4R6UA 2LTQB 4PB0H 4EBQL 2CPUA 4G9FA 1WFJA 2H1XA 5CWSA 4DKEH 5AEAA 2F9BT 4K4KA 1QSEE 1RSYA 2NMSA 1CGTA 2PMZA 1WZ1H 3LXUX 4W9FC 3EADA 2VDNL 1S4IA 1UVQB 3QDGA 4M5YL 1GYWA 3V4PH 4Y4HA 5KJRH 1AGCA 2XBTA 4EN3D 4NB7A 1QRNB 4HIJB 3NCFB 2DBLL 4ERSL 3F7YB 2R1YA 3VXUD 1N64H 1TMQA 2CR3A 4JGMA 1KTBA 4NLHA 5GJSL 1A5FH 4CVXB 1OCWH 4PJIA 4FABH 1CDUA 3MA7A 1KN2H 1JHKH 4KKAC 1EZVX 3N3EA 5F9WC 3MKGA 4EVNB 1MH5A 4G82A 5D1QC 3ZZLA 1X7QB 1D5MA 1TKWA 3NFSL 3DO4A 4OGXH 4DPCX 1EZUA 3PWPA 3O0RL 3L2NA 5KANI 4XO8A 3OZLA 1T7VA 1NLDL 4U1IB 1P7QB 1FA4A 1P7KA 4U3CA 4WFHE 1FH5L 4OLWH 3TN0D 4Y2OA 2RCSL 1SEBA 4BWWA 4PR5A 1F4XH 2VR7A 2FLBT 4HWUA 4TVPL 1NICA 4WW1B 3ZQWA 5BS0D 3DOHA 2O61A 1SDDB 5J6GB 4RMSA 5IHZB 4HKZB 2ZP9A 1JV5B 3IDXH 5LCVL 3L45A 4FG4A 1F11B 4F15B 3GZQA 4H1LG 5ANHA 4AYID 2IF7A 1SOSA 3QRGL 1H8SA 4IRJA 3TNNB 1EEQA 1Z9SA 4NQUA 1QSVA 3VXNA 3M46A 3RL2B 4KZEH 1KLUA 4QRSA 4BYHA 4V2CB 2FYVA 1NGYA 1HH6B 3PJNA 4XWOC 1PZ2A 3ALXA 4R83A 5E5MA 3U9WA 3UO8B 1G9EA 3N44B 1G1KA 1MRCL 3H54A 1XCWA 4M3JA 4RAVA 1CN4A 4YHLH 3UTTD 2ZAIA 3GJEA 2H4EA 3CPLA 5AG8A 4QHLA 1EMTL 1FDLH 2WWMD 1RAMA 4OD1H 3OAYH 1K5NB 3FUNA 1CLYL 5EULV 1J5IA 1MWAL 3I6GA 1CXLA 2QFPA 1ZVYA 1RKRA 3FQTB 1JCVA 3MDJA 3QQNA 1U21A 4BV1A 4QOKB 2RCSH 1EAPA 3PUCA 2FJGB 1UUNA 3VFOA 4N0UE 4K5LA 1H0DB 1RMFL 2LAGB 2D7MA 1NLDH 3BP7B 4JFYA 4L4TB 4AGPA 5J3HD 4M3HA 3WENA 4NO3A 1P5UB 1UOLA 3DI2B 1FL6B 2EZ0C 2ZCKH 1IC0A 2K8MA 3VH8G 4E42B 1NQBA 4FAAB 4Y16C 4BZYA 3BEWB 1FZKB 2VLJE 1WLHA 1YJDL 2FZ3A 4HF5H 4Y0GA 1FUNA 3PREA 2NR6D 3LNHA 5D2LF 1KN2L 4X6DB 2Z34A 1FG2A 4OCMC 3ZDZF 2X2IA 3AXLB 4L8SC 3F2LA 1QTSA 3WTWA 3EDEA 1EXUB 4N2LA 4QDGA 2E74C 4ZTEA 3WN5B 2O72A 4LP4A 2Z1PA 1UZ6E 3GHPA 4LOFA 1QLFA 4HJUA 3A21A 5D9SA 2Q87A 5D7LE 4X6CB 1B2WH 3L3JB 5DQDL 3KPRB 1NWOA 3L16A 1EO8L 3MYJB 2CLZA 4YDVB 5ADPL 3U36A 5TK2A 4KV5E 3SN6N 2X4RB 3KR3H 3KYNA 1DSFL 3L1OL 1XD0A 4B41A 5L0QC 2ENYA 2WUBL 3L7FB 3DV4A 1BOGB 1E7VA 3D33A 5CP7B 4RIRA 1RPQA 3E3QC 5B7FA 1ZAGA 4WWPA 1K6QL 1S9YB 15C8H 1XCQB 4L29A 5CGBA 4AIEA 4G8AC 5IB5B 5I1DA 5I66B 3TN0A 1BJ1J 4G6AD 1BQLL 3IJHB 1HT6A 2ZWYA 4JG0L 1MVUA 2MNJB 3BH4A 1VCAA 2J2ZA 3H9SA 5E6ID 5DJ8B 4JZJB 5GIRB 3TBYB 1ZT4A 1U3HD 3OZ9H 5T5FL 3QUYD 4CKQA 3OKKB 1MCHA 4DGVL 4KI5E 3MTRA 1I3VA 4HUUA 1HQRA 3BN9C 1FFPA 1AXTH 5DHVA 4F7EB 4OJAA 5EU7E 4OSUH 3GMOA 2CBMA 5FUCE 2FEDD 3VXTB 2NQCA 2IANE 1OSYA 3IDIA 1SYVA 2HJKA 5TDOA 4OIFA 4XB3A 4MCZB 2WO3B 1CI5A 5J3HC 4MKTA 4HFWA 1VRSA 3HHMA 1WBYB 4JQIA 2F7IA 1T0OA 1TJGL 4WU7B 1S7QA 1NCWL 1U0QA 1TFPA 5FYKE 1ZSHA 4GO6B 3RUGB 4AI7A 1U41A 3EDDA 2E9IA 5K33A 1BQ5A 5IW1A 4PLKD 3LH2L 3SJVB 3IB4A 3S2CA 4FQLL 2R69A 2YD4A 4N3UA 4BUGA 4PGBB 2X6MA 5CEYA 2NRDA 4XBEL 5EN2B 3QJSB 3RNQA 2DB8A 1OPOA 4X7TB 4XCYB 5TQ2H 2G5BA 4IJTA 2NXZD 5F0MB 4LF3A 2WTOA 4MTMA 4FQQB 3HBQA 1I7RB 3M1OA 3HPJA 5C8JA 4MJHA 2BOBA 3MRKB 3BYTA 1F3JB 4OAWB 1A4KA 1YMME 2D8KA 3V5KA 5CD3A 2A4ZA 4OZFH 1SPDA 4FEMA 1KIPA 1GPOH 4AC4A 4EJ1C 1JD9A 2DQDH 4XN4A 1S78C 2FSEB 2GSIA 4NKMB 4DTGH 5IFJA 2EVHA 3DX9B 2PN5A 3LNEA 4Y5VA 5T33H 2OX5B 3SGJC 4UI2A 1FFRA 3G6JF 1BQKA 4JFZL 1TVBA 2PCPB 1A6WH 3T0VA 3QDHA 2NY6B 4ZG1A 1P4IH 1T4WA 4OI9A 4WK2B 3WKPA 4XPTH 1LDPH 4GQ9L 4HAKA 5DMYA 2Y06H 2NOYA 5J9PA 1CYGA 4Z0XB 1Z5YD 4XC1H 4P3DB 4NX0A 4KFMA 3G5XB 5H4YA 5AENA 2NTFB 1Z0NA 4XR8C 4LARH 2A83B 5E6IC 5C6TH 5CGMA 3IFLH 2IFGA 4OZFB 2IAMB 1MFDL 2F54B 2IWGA 2NY1B 5GGRB 3TGXA 1J8SA 4HIIB 5JIHA 1RUKL 1ZD6A 3EUUA 5GQBA 3LZOA 5DMIH 3T04D 1XFPA 2R0ZL 4M6NH 3LIZH 5JLZB 4HCRL 4Z7UE 4F7CA 3TZVB 3Q2NA 3N9GL 4KO6A 4ETQA 5KSVA 1RUPH 1PY9A 3VNZA 4HUVB 4KKZA 3PIQA 2C9VA 1YAIA 4KVCL 4LQ1A 4QJ3B 3GNML 5I76B 1JZ2A 4ZDHB 3EYVA 3OKNB 1SY6L 5BZZA 4LLDA 2R2HA 2H0JA 5HYIA 3AU0A 1WUZA 3GJFB 1TJHH 2C3HA 1AO7B 1AS7A 3BKML 3LN9A 5IUSA 1E2WA 4LU5L 3IKKA 1GKEA 2Q3AA 3BGAA 4UQ3A 3VFTB 3LH2H 2V3EA 5G5DB 1AI1H 2XV2A 3COOA 1NFDF 5AW6B 3OHMB 3D18A 2W65B 1K8DB 4CSTA 3O3BB 2R9HD 5FO7B 4LB8A 4WFGE 1I1FB 2P44B 4KY2A 3HE7B 1TJGH 4HOXA 4PQXA 1TYEB 3RTQB 4Z7WE 2DLTA 2NY0D 1E6JH 2VE6B 1AZNA 1LWRA 1ZT1B 2DYRB 5CEZE 4GLRI 1ZIBA 2GK0B 2M2DA 2AJZA 1GGCH 1T2XA 4L3EB 1AC6A 4G7SB 4MD4A 3SDAC 3MRIA 2VXVH 3CX2A 4C4UA 2CXKA 3NP3A 4U7MA 3S34L 3K1KC 3QXVA 3O2WH 1TVHA 2BDNH 5E1GA 3NVQA 3G6DH 2XKNA 2NW3B 4U05A 4G8GB 5D7JD 3W39B 4A66A 4KNSA 3Q1SL 2B1AH 2P49B 5JUEH 1NIDA 2OULB 4APQD 2Q8AL 2WZPA 4UQBA 1PU0A 3T2NL 3WDJA 4TSAL 4JY6A 4GG8A 2W0FB 1NCJA 1UJ3B 1MRFH 3LNDA 4LKCA 4Y9FA 4JL2A 2H3NB 5SWZB 5GGVL 4G83A 1DQMH 4WK4B 4U3SA 2COVD 4JHBA 1H3VA 5F6HI 2YXFA 3ZOAA 4YE0A 4XCNB 4ZS6C 1FAIL 2CGRL 3SDXA 2Z3FA 2BSRB 2X0UA 4Y1SA 3V55A 3OKMA 2KT6A 3PHQB 4HJTA 4K3DL 3KDMB 2J1XA 3LS4L 3VI4A 4BWTA 5IW6B 4CUCA 4V1DB 3IGLA 4OFVA 4L8BA 1HQ4A 3RVXD 2I07B 4N2KA 2NY4D 2PLTA 5JQIB 3L6FB 2A73A 1HS6A 1IILE 25C8H 2DICA 3WTUA 2CA3A 2J25A 3K0WA 5DVLA 1WZKA 3VJ6A 1BECA 2O5ZH 1CI3M 1JPFA 2FUTA 3QORC 2R8SH 2A4EA 3SPJA 4U6XA 4I7ZC 2DWSA 1XGQB 5LG1A 3U7WH 1NC4A 4ESKA 4LSVH 1KGIA 2Z4QA 4HWBA 1XGUB 2K70A 2VGLM 1DJGA 1XMWA 3SE9L 2R29L 5JW3H 1JGEB 5DUML 1EEYA 3BMVA 3P02A 2HB0A 3IBEA 4OF3A 1JG9A 2FJFB 5C0AD 4HT1L 4K15A 1MXDA 2ICWA 1YMHA 1RZ8A 4B0MM 1BZ9B 3BPOB 2CDEB 3O3UN 3O81A 4XHJC 4NNPL 1TT6A 4S1DC 2RBLA 2YD5A 3E6HB 4JGUA 5E56A 4K8RH 4P23A 4NJAL 2GABA 3K8MA 4RGNB 4AIZA 1GJWA 1PCXA 1EFXA 1CFSA 4YHOL 4FX5A 4R2GB 1WTGT 1G7QA 3WO4B 2V2TA 3ULVC 4IBVA 2AC0A 4JBSA 3QQDB 4ODHL 4OCYH 5JOFA 1MQ8A 1X5IA 2FK9A 4LHUB 5F21B 4HPOH 4QWWC 3VWJA 3BAKA 5HD8D 4G6JH 4I0KA 4E41E 3QE5A 4K3EL 2W59A 1KY6A 2C3GA 3FUIA 1CD0A 5EBLA 3RWIB 1WAPA 3QZPA 1P53A 4FQ2L 2VO5A 4PSRA 4MAYB 5BZDB 1PYWB 1UXWB 4XOCA 1G0DA 4P3WA 1RK1B 4IHOB 1WSST 3DIFA 4G71B 3RX5A 2IMNA 3HZYA 4KK6C 1E9PA 5EA0H 2VIRB 2HLEB 3SQBB 4KRMB 2OZ4H 1PZ3A 4HMCA 1NEZB 1Q90A 3NJIA 1D5XA 1C16B 5C7ZA 1AQKL 1NBZA 3MGOA 4XPHH 3T0EC 3S9DB 3C09C 3QUXD 1CFTB 4XXCC 4XXWA 1S7SB 5J7CC 1P1ZA 1H8NA 2NUTB 4G11A 1JWSB 1GOGA 2NY3B 4IK7A 3W2DL 4RWYH 3PS6A 3EDKA 4HXAL 3HBPA 5AVUB 5DD1L 5CJ5A 3QG7L 1UM6L 2LU4A 2YXWA 3GIVA 3LKRA 4PJ9B 4ZQKB 5IG7A 4PP1C 1AH1A 4PRIB 2CBOA 3UYOD 4JFQB 2FQEA 4OIIL 2W94A 5IF0A 2ZT9C 3FU7B 4HGKC 5EOCJ 4ZMZA 1NC4D 3BH8A 3CTTA 2KZWA 1XTMA 1R5IA 1IX2A 1CDCA 1JPGA 4BSWB 4AQ1C 2GK2A 1OP3H 5E6RB 1GRWA 5MERB 2OJ1A 4N2CA 4NOFA 3AFLA 1EXHA 4Y19E 2IAND 4XHJD 2C5DC 3DVFA 5GGUB 2D9CA 3EJZC 1JHKL 2ZKMX 1CT8B 2YD6A 2BFVL 1IKNC 4IMKC 3GTVA 1T22A 4OZHF 4P2RE 3U4AA 1Y1DA 3H9SE 4XMLH 4NM4H 3IPBA 4R4ND 3RWJB 2MQ3A 1V3LA 2HKFL 2A2QT 4U6VH 3RDTD 1HI6B 3BEVA 3FW6A 1QFHA 4QWWD 5D96C 5E94A 4KU1A 1T1YB 3F58L 4YFLI 4X6EA 1BYOA 2D7TH 4MDIB 4O02A 1HTYA 4KNUA 3QI9A 3V6BR 3NN8A 4GRMB 3D50A 5LKNA 3QB7C 2ZX7A 4Z0BL 2CKBB 5HHNB 1IBZA 1V55B 1JAEA 2C4XA 4MBOA 4MFHA 1DBKH 2X4SB 3KYKH 3HZMB 5FKAA 4U6HA 3VDCA 4RZKA 3OXSA 5IKCA 5I0VA 1IGML 4DERA 3MXVL 5IGXL 4JFEA 2AQ3A 1IKNA 1JHLL 3BUBA 4QRQB 5KVGH 4EF3A 1FORL 1RH8A 4ZOEA 1G6RL 1BAFH 2EDFA 2F53E 5DC4B 3INOA 3L95B 4OZHA 4KRPB 3ZDXE 3RBSA 2L4OA 1AIFB 4DOHE 2BNQB 4IOIB 2FX9L 1SN0A 3RZCB 1RJCA 4TSCL 4XPFL 3NPZB 5CEXA 2CLRA 1RP8A 2UXVA 1TJMA 1NCTA 3E8UH 3N91A 5JIDA 2LFGA 3VW3H 2EXYC 4NQSB 4PP1D 3VFUB 2WN3A 2YAFA 3GMRA 1OM3L 1A7QH 1TG8A 3IBOA 5AW1