2BSDA

Structure of lactococcal bacteriophage p2 receptor binding protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
254
Chain Sequence
TIKNFTFFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR BINDING PROTEIN
publication title Lactococcal Bacteriophage P2 Receptor-Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Enterobacteria phage p2
molecule tags Receptor
total genus 60
structure length 254
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bsdA02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2bsdA01
2WZPA 1ZRUA 3D8MA 4L92A 4RGGA 3HG0A 2X53A 2F0CA 3U6XA 4L9BA 4RGAA 4IOSA 3DA0A 4L99A 2BSDA 4HEMA 2BSEA 3EJCA 4HEPA 4L97A
chains in the Genus database with same CATH superfamily
1HN1A 2ADIB 3UTQA 2ZXWB 2NSMA 1MAMH 4OFPA 1MQKL 4PJ8D 5A16B 3ZKMC 1AOZA 3OXSB 4WO4C 3EO1A 3GXFA 4U0QB 1JPGA 1DBMH 4LNRB 1J0IA 4N3UA 3G5WA 2GI7A 5CP7B 5D7JA 2WP3O 3ZHKA 1L9RA 1A25A 2Z35B 1Z3GL 4ESKA 1UB5A 2H45A 4B95C 1BZ7B 4I1RA 2WBJB 4GAYA 5IKCB 1M56B 1TF4A 1S7UB 5KVDL 1YYMH 5C6TL 2R1YB 4NZUH 5GS0L 3RHWF 3F7KA 3UOAB 4QI3A 5IB3B 5E6SB 2R83A 4KY1H 2Z93B 3T0EB 2QELA 4HULB 4HIIB 5TTRA 4B9PA 1B4RA 1BVLA 4TRPH 4XBPA 4YEFA 1J0HA 4WJG3 1IGTA 3CXHJ 4AI7A 5IMKA 2XTLA 2P8MB 4NZRL 4X4XB 3T3PB 3NJKA 4ZMPA 5D1ZD 5KANI 4ZFGH 2BVPB 2IOMA 4X6EA 4FHJA 4F24A 2N4IA 3BUBA 4MA8L 3BUYA 3T09A 2AXJA 2EO9A 2RALA 2GTWA 5GSRA 1GZQA 4NC2B 5H4YA 2HVJB 3D0LA 2XPZA 3NRFA 3QZMA 2QTVA 2OSLA 3NPSC 1OARL 3O6LL 2YSSB 4G80B 3VM5A 2BHFA 3ZVVA 1CK0H 2F2HA 2X4SA 4JFFA 3DURB 3MJ9H 5KS9E 3S36X 3BRGC 5K5YA 2H3XC 4LGSB 3Q44A 4OF3A 1G9NH 2AEQL 2AK4B 2DQIH 4Q14A 2UZIL 1LE5B 2DLFL 4QHMA 4DK3A 4X50A 2CUHA 1RJYB 2YD4A 3GMNB 2DV6A 4XBGA 1BM3H 1ND0A 5HY9A 2VB5A 1XD0A 5TQ2L 2NY2D 3NJVA 1QVOA 3APMA 1WA0X 1OK0A 4HISA 5B1JA 4JRWA 4P06A 5J1AA 3ZT6A 3VJ6B 3HNSH 2O4EA 2ZYSA 3LSOA 1NANI 4KXZI 2KUTA 3VRLE 3ZR5A 5E24E 2H0PA 3I9IA 2VM4A 5B7MA 2WVVB 2ITCB 2MRYA 2WOBA 1KB5L 2MMXA 4P2QB 1UTDA 5D2NE 1SUHA 1T4WA 3S96B 4MAUH 1IT9H 1B0IA 3N5AA 4AKPA 5LGKA 2EE0A 2ZXQA 3L4TA 3X13B 2EIDA 3NSDA 3EFDH 2J72A 1N4XH 1FDLL 3AWEA 5AYQA 2XWDA 3CC1A 4UNTA 1HSAA 2Q1EA 1JPGB 1MJJA 2DIBA 1A9BB 4GG6E 1F3RB 4WY7L 4F93B 2KL6A 2APBA 1H3TA 3AQDA 1PMYA 2XXMB 3LX9A 5E9DE 4S0HA 3VD1A 3RA7H 4UBDC 4DP0X 4M9OA 2CLZA 3KPRD 2CIKA 2ARJB 2BNQB 6CGTA 1Z5YD 2ZIDA 3JTTA 4GKSA 5CLWA 1GC1L 1OTSD 3GBEA 3K4AA 2N1KA 3ZLQC 3ZGIA 2BS9A 4NQCA 4MD0B 4PW3A 3JVFC 3P4OA 2W9EL 3FO0H 5J12B 3GJFK 2C7FA 3N1FC 1RXLA 3CSYA 1KC5H 5MEOA 3HZYB 4NC0B 2Z4TA 3ZXAC 2E6JA 2VDPH 4OGYH 2WXHA 5E5LA 3BAIA 4JPQA 3TN0C 4AEIH 4PGJA 1MWOA 3IJYA 2NY3B 32C2B 3KPSB 4Z8FL 2A9MH 4AM0B 3CLWA 3G08A 4F58L 4F2EA 4C57C 4UAHA 1JBJA 3CLFL 2G5BB 4GKZA 3RY5A 3BD4A 2AI0L 2C3GA 1KEML 4WSGA 5DS2A 4NRZA 3K5RA 3JVGC 4ODBD 5I16B 3TA4D 1JYXA 4IMKC 4JFFB 3GJFA 3Q6FA 1D3CA 1GR7A 1E5CA 2ATPA 1P1VA 2F1AA 1HWHB 4XCCL 3OLEA 4PY8I 2PWDA 3L54A 2R9HD 1FNFA 4QXTA 3A5VA 1RP8A 3D39B 4N5UA 4JFDD 2TAAA 3BP6B 4AZ8A 3MBED 1KCVL 3UP6A 1JPST 4YHPA 2EDEA 4LOEA 1XBRA 2F5BH 4LU5H 2P5ED 3VD5A 3ARDD 5GS2H 5JLZA 4Y4FC 3VXPA 4NNYB 2ERJB 4MAYB 3OJMB 4PJ9B 5BVJB 2XN9B 2EJ1A 3ZE0F 1NGWA 4HC1H 1JRHL 2C1PA 1NJ9A 3GUFA 5GZNA 4R7VA 4UT6L 2QSCL 2ADJA 4KKCC 4G6JH 2JQMA 2K9FB 4ABWA 3TBBA 4YO0B 1C8QA 3BZFB 3WY3A 5JHMA 2UXFA 4AQAB 4GSUA 4PRNA 2QPEB 1X7QA 4UU9B 1N64L 3FU6A 4X8JA 3OKDB 1A1MA 4U6HB 1BZDA 5JOPD 4V1DA 3OXRB 1E2WA 4KJPC 1KTBA 4X4KA 3D69B 1SF3A 2AABL 1KIUB 2SODB 3AS2A 3TBTB 2V37A 1HEHC 3VE0A 1ZGLP 5IMMA 1ETB1 1IAOB 1T5KA 3HC4H 5T3XD 2FO1A 2HMIC 1TYJA 2H32H 5AB2A 1CFNB 2YMXL 5DRZB 1WC7B 2RQ8A 4OCNC 4YUEH 4BWTA 3MRDA 1BXAA 1J9TA 3ZDZB 1I8MA 3ZGHA 1FZMB 2G75B 1NEUA 4BCZA 3SKJL 5FLUA 2OMVA 5EZLA 3VW3L 3QZBA 5DZNA 4LVHB 4FKHA 4LHUA 1USZA 4JZJA 4M7ZB 1IQDB 1K4DA 2GSGA 3CSYB 2JKIS 4CUCA 2N7AA 3FCUB 3WS3B 4BSWA 3VWJD 5JIIA 1OP3H 2NY4C 3KL0A 3ZTEA 2AS5M 4JFPA 4U05A 1IEBA 2YPLD 1I3RB 5EB9A 2NX5A 1JV2B 4FQHA 3A22A 4PYHA 2H2PC 3ILPA 2X4QA 4Q6IC 4PP1D 1DVFD 1B3JA 2LABA 3QIWD 5IQ9A 3POHA 3RWIB 4HVBA 5JPMC 1VCBC 4X6CA 2PYEA 4FDWA 3LN4B 1QG3A 4N5EC 4TNVF 4Y2OA 5KBKA 2VQ4A 1WICA 1ACYH 5DD3L 3FCTA 5JXED 5IT2H 2ZNWA 3FOLA 1AD9A 4R2GB 5HDLA 3NJMA 4PSPA 3X3FH 2YWZA 1M1SA 3VXRE 4JDEB 5IMOB 1HOCA 4QRAA 4LCYA 4UINH 2DQDH 4I77L 2Z4QB 1J0KA 5MP6H 1R3KA 4OLZL 5GJTL 1X6LA 2CJSA 4UCFA 1VEMA 1J0JA 2B20A 4RAVA 3UAJC 1FH2A 1AGDB 2QPDB 4J6IA 2R4RL 3FCBA 3LKQA 2AERT 1HCYA 3EYSH 5INDA 1KYUA 1ZE3C 1T1YA 2P80A 4ONGL 1NZRA 5H2BB 3MX0B 2DTSA 5AVUB 1A6AB 4IRSA 3SE8L 4MNQA 1TMCB 3BWAA 4QGYA 1KYAA 4S1RH 5KSVA 4H8WL 2GBVA 4KK5D 1OSPL 2Y7NA 4FJZA 4MCZB 4YBQC 4L18A 5FK9A 5DI8B 3GI8L 5EIIB 4AJ0A 2AQQA 4XXDA 2JCWA 3R06A 1KPRA 4PD4K 3EYVA 4B5EA 4Z3TA 2VRKA 3O4LD 3D4CA 4XOCA 1S7XA 5JHDB 5L8JB 4JL1A 3I3EA 4TUKH 4MTMA 2EDNA 2HTLD 2NLJA 4XVSH 4P3WA 4KDTC 4PQXA 3TVMC 1MOEA 3QUXA 4GAJH 1Z9SB 1U8IA 4WHTB 4KZEL 1KB5A 1D9KA 2ZUYA 4XVUC 2A4EA 2DBLH 3FU7A 3IJSA 2J8UF 4UIMA 5SWSA 1ZLWK 4ODHL 4G1MB 5T1MB 2CRMA 1ZVNA 3KLSA 4ZQTA 4K55A 2J4WL 1DZBA 1BFVH 3FO2B 2VR6A 3HFML 3PAVA 5D6DA 1FG2B 4EBQH 1RZFH 3PG2A 3GIZL 3CGTA 4UV4L 4XP9H 1MCWM 2K0RA 1AO7B 5B39G 5KBLA 2XI9A 5DLMH 2K4WA 3N43B 1F3DH 4JM4H 3QORA 5IQNA 4HF5L 2DQHL 3FU0A 4JVUA 3PDOB 1P7QD 2H9GB 1CFSB 4JPKL 4X7FC 4EOWH 2C26A 1XIWD 3L4VA 4F7PA 3PWPE 1W0WA 4GT0A 2YAHA 3AS3A 3GHBH 4MNHA 4PWGA 4Y2DC 4XP6H 2XA8L 3MRLA 4Y19E 4C56B 4NQQA 3RWFB 4KNTA 3VB9A 1JAEA 3HBQA 5TFSH 1NGPH 1YEFH 4XRCA 4C4UA 1YECH 1RPQA 1UADC 3H9HB 4G6KL 4WWID 3DX6B 1NC4D 5K1JA 5I1LB 2HA1A 1JDAA 4LLDB 3UIZA 4LSPH 2I26N 2QR0B 5IJVB 2OKMA 1KBWA 4PVMA 4LLAA 2JNZA 4JFQA 4L4TB 4KMTL 3BPOC 3PWVA 2X9YA 3TC9A 4BK5A 5CP3H 1A6WL 3IGAA 3ZTJH 1KBKA 5BO1H 2XKNA 2IAND 4KKPA 1ZT4B 3DBXA 1KLGB 2MCPH 3THML 3W82A 5HI5D 1T1YB 2GK0B 4HK0A 1A6TA 1IAKA 1L9SA 1M4KA 1UYWL 1KDIA 1RHHA 2CO6A 5ALBH 2CO7A 4YH6A 1CICA 3ZOAA 2LOEA 4KO7A 5CEZL 5JQIB 2UXTA 2Z8VC 3SQBB 3GSRB 3LEVH 1YC8A 5AVVB 4HPOL 4RQQA 5B7EA 4A7TA 3MV8E 1XF4B 1OCCB 4BM7A 1FZKA 4JZOA 4AJVA 3VFTB 1BOGB 1ORSA 3SBPA 5D7JD 3FRUA 4BFEA 4NKMA 1LEKB 3BJ91 1QRNE 3HS0B 3VU2A 4CVUA 1YEHL 2DJMA 4UT6A 1BREA 3IJ8A 3P77A 3OKOB 4F7TA 3U9UA 3U1SH 4FA7B 1DUYB 5G4NA 4ADGA 1JPSL 5CWSA 4PRBB 4K3GA 1ZTMA 3QHZL 3MRMA 1PD6A 3C08H 5FGCE 1MJ8L 2E5EA 3JWNH 1LWRA 5EU4B 5F3FA 4H0GA 4KZDH 2IQ9L 4GNKB 5ESQA 1KPUA 2MJWA 3WKNA 4AGOA 1G94A 2J1YA 4YR6A 1HWWA 2DTMH 5IW6B 3G6AA 1R17A 1MFVA 1CIDA 1X5JA 2OXGB 2FDBP 1O9VA 3HG4A 3VXUB 3RU8H 2VISA 3VTAA 5F9OH 1OCRB 2WHVA 1BAWA 4G6AD 2WGXA 5DJXB 3RNKA 1TSHA 3PIQA 5BO0D 1IGIH 3KS0H 4WHCA 4DZBA 3WLWC 4IBLT 3CZGA 3TFKD 3P3SA 4GMTL 4HBQA 1HHJA 4HKJB 4I18C 3K2UH 4PY8J 4V2BA 1RUML 4PG9A 3ZE0E 5HI4C 1YY8A 3NIGF 1EDYA 2Y9RT 4FE9A 1DO5A 4A6YA 3RTLA 1TZ8A 1D7FA 4GI9A 3CJJA 2C9UA 1I9IL 1LYQA 1VEOA 5IB1B 5FA4A 1X9UA 2VDQB 5LHDA 1M7DB 5CKGA 4BE5A 3ULUH 2MNJB 1S5IH 2Z92A 3EO9H 4JFQB 3W3BA 2OCCB 2VZTA 1ZK9A 1DBKH 3PWVB 3RTQB 2EC9T 1ODAA 3FUNA 3DOHA 4JPIB 4LFHD 3TP4A 3BQVA 3BN9C 1DVYA 5F9WB 2NW2A 4G8GA 1TCRA 5GGVL 5A6LA 1Q94B 5GGRB 1YYLL 4N0FA 3SEPA 3JTSB 3MR9B 1NSNL 4JANA 4PRDB 5ADPH 4XVTH 2W0FA 1VGKB 1JF1A 1LK2A 2C9XA 1KJVA 1ZGLA 4RMSA 5J9PB 5D93C 3UJIH 1FZKB 1CFMA 3RWEA 1UKTA 3QWOB 2GTZB 4R0LA 1KNOB 2PW2A 5EU7E 5KTEH 1UD3A 4P46B 1OSEA 3BKMH 3AWGA 3W0WD 4FYTA 3OGCB 4LLYA 4Y16D 5CD3B 4TQPA 1TJGL 4ZMAT 5IK3B 4Y8DC 1DN2A 3P4MB 5HGBA 1BVKA 1F00I 1O5DT 1T6VN 4ZW6A 3UTSA 5DJCB 3CFMA 3KPOB 3D3VD 2XWCA 1P4BH 3VFRA 1FBIH 4WI2A 3QJZA 1P84K 2Y06H 4I48A 1XXFC 5TQ0H 3CQPA 3LXAA 5C0AE 1MJ7H 5KSBA 4Z1PA 2GAZA 3RZCA 1PG7L 5H8DA 3O8XB 4DO5A 3HUJB 5BQ7B 4B53A 3QG7H 5D1XA 1JXFA 4LEBA 2VUOA 2IG2H 2NY5H 4NN5B 3G6AB 3QNXB 4RGOH 3MLRH 2DMHA 3DDGA 4F91B 3ZPDA 3MFGB 4MB1A 3L3IA 2VLKB 3ULUF 1MNUH 3VGEA 3CZKA 1C08A 1UXSA 2AXWA 4NCDA 1UM5L 5CGYD 3E38A 4P23C 1KTLA 2BS71 3DX9A 5CEYA 3E9UA 4TVUA 3GBNL 3UTZB 2A1WL 5AG9A 5LN8A 1KTJA 2ZCLH 2GC4C 2M2DA 3IM1A 4OGAC 3FHQA 2AXGB 1H8LA 2ZWNA 1A9EA 4OIBA 1Z0MA 2H2SD 4BQCA 1F6AB 3AQZA 5F3BB 3QJFA 2ROXA 1DQKA 3H7LA 2O61A 4PJ8C 1M2VA 3D05A 1KGCE 1X5KA 5C8JA 4MB5A 3KWWB 5TE4H 4P0DA 4G8IB 3CFBA 2L8AA 2ZSVA 3V0IA 4AYSA 1HILA 2BW5A 2A77L 1KGUA 1KCUL 2DS4A 1YPZF 5JXAH 5ERWB 3C5ZA 5D96B 1PEZA 4BUHA 1MREL 3BIKB 3G9AB 2VSMB 1BVZA 1DJIA 2R69H 3MMEA 4DGUA 3ABKB 3L4ZA 2BY1A 1ICTA 2ZAIA 5LNDA 3H9YA 2WWKO 5GZND 3MUUA 3Q43A 5L9DH 2WVTA 4OF0A 2J8UE 1SEBA 4F8OA 4Q8BA 3QARA 5I0ZA 4UT9L 5EOCH 1LK2B 2DBJA 4E9TA 3CSTA 2WLNA 3EZJB 4IRJB 4Z3IA 4K8RL 4PJDA 1GGUA 3WEMA 5D1ZC 2OZ4L 5T1KD 4G7QB 4MHHI 2OTPA 1BMZA 3N06B 4PTUB 4OVVA 2AQNA 1TMQA 1ES0A 2IGTA 4FX5A 5JA9A 4P3DB 4X6FA 4H2CA 1E5AA 2FEEI 5FGRA 1TLMA 4NNXA 1AQKL 2VWEE 3VXNB 1FPTH 2OTUB 2XVKA 1CFTB 1VKXA 3OSVA 5F8RC 5ICZB 5I2IA 5HGHB 2B5IB 3HNTH 4NSKB 3WDJA 1LO4L 3GBML 2IV9A 4E9XA 2K3HA 5HHOB 3W39B 1R75A 1WFNA 1FN4A 3L13A 3WFDL 2DEXX 2XJKA 3FFCB 1PGRB 3S98A 3MA9L 1AOHA 1RY7B 3CFEB 1SF5A 5KYYB 5TDPA 3ARFC 1HX0A 4RSYA 2YMTA 2PNDA 3JV5A 5DUBB 4ZO8A 4M5YL 3UBXI 1DEEA 3DGDA 1NBCA 1T0MB 1WZMA 4WV1A 4WDIB 2NY2C 3KH4A 2R7EA 4JO2L 4OJAA 2OA9A 2A6KA 1DE4A 4N28A 3MRHB 4ERSH 1XCWA 3A67H 1LO2L 1SZNA 4NWTL 3CZLA 4OIIH 4Y4HA 3STLB 5FO9B 3VRIB 4YDNA 2PYED 4MDRA 4XN5A 4FQIL 1TOXA 4PR5B 4PJBB 3E8UH 4MQTB 2VLRD 5D7KD 4AE1A 1GH7A 1IAII 3KDMA 1SBSH 3MCYA 4N8CH 1HWGB 2WLKA 3HZ3A 4GS7B 5E2WH 5F21B 4AT6B 4YC2C 3AUWB 1U9KA 2O61B 2FT7A 3CVHH 4L8DB 1SY6H 3WXWH 3B2XA 4XOEA 4DKFH 3ENEA 1BZ8A 1CFBA 1HU8A 4EDWL 2V3DA 3PWUB 3RGVD 1V7NL 3UH8A 2YUWA 3EYOB 4QYOA 4PJAB 5C2UB 1A1OB 3HG5A 2KZ1B 2WQXA 2EP6A 5E2TL 4MDJB 4B97A 3DPDA 1JZ6A 2GK2A 5CCKH 1WD9A 1FP5A 4Y9FA 3WKPA 2VABA 5K9KB 3E3QC 3S88L 1CDYA 1WCBA 3ZDWA 1OTSC 2LU4A 1W72L 3SDCA 4L4VD 3SO3C 2JI1A 2AQ3A 4ZDHA 4FEMA 1W2KT 4YNYA 5J1SC 3CPUA 1BQ5A 4LCUA 1BJ8A 1UD8A 3IBEA 4P9HH 3BVDB 4RBPK 3T77A 1GMEA 2ENQA 2F68X 3F6IA 4OFYD 4G6MH 4XBEH 2JKLA 2UUDK 4LLMB 1A7QH 1WV7T 1F90H 1UEYA 3D50A 1M3JA 1MWAL 4YX2L 5TD4A 1SOXA 3H53A 4OV5A 1MCKA 2VAAA 4XNZC 1TJHL 3DXAB 4BFOA 3FAWA 5HHPB 5I26A 3IFNH 1BWMA 2WN2A 3U4BL 1D9KD 1ANUA 2P24A 4ZNEA 3NCEB 3HR5B 1NBVL 2B3RA 1GGIL 3HZVA 5EOQL 1EIBA 2XWXA 3N0PB 2R9HC 4Y5VC 1UOWA 4HLJA 4ZFOL 4GRWB 5BV7B 1SQ2N 2B2XH 1J8HE 4XPBH 2PP8A 3NIGE 1YJDL 2NNAA 4LT7A 3MBEC 2PTVA 1N18A 4NO5B 4Q2ZB 3V5DA 1FVCA 5C0JA 3CSGA 3VDBA 5FKAA 4AUUA 3HAEH 1U8PA 2AGJL 2W0LA 3ARDC 4F5CA 4BINA 1KIQA 2R7EB 3B5GA 3VXSA 1H3WM 4YLCA 3CZUB 2F74B 1YEJL 1MQ8A 1NOFA 2NW3A 4XPTH 4ORZC 4Y5XA 1DSFL 4QT5A 5E1AB 3C8KA 4BZ2L 2BZDA 1KB9J 1E42A 4RGNE 4EI6A 1CU4L 4LLVB 5IV2A 1NA8A 5FCUL 1T21A 1FJ1A 1ZPUA 4O2FA 4TVPL 4Y4KD 2A6DB 3SDDB 4OI9A 1YUHB 4UAOC 1NINA 4NCC2 3W38A 4MRBA 3BDYH 4LFHG 2JQAA 4KKRA 5CM1A 3GDCA 1X5IA 4HUKB 1HH9B 2X1XR 3QDME 4P05A 1OP4A 1HHKB 4X4YB 3WJLA 5LAPA 5IZ7A 4FNQA 4EIZC 2LGNA 4UI2A 4L3CB 5HJ3B 4AQ1A 2FBJL 3VSQA 1T03L 3HRZC 3WN5C 2ZG1A 4IW4C 1HXYA 2I9LB 5CR1A 1E6JH 2CDEB 4ONFL 4WFED 3U9WA 1AGCA 1EUUA 3V4VH 4UQ2B 3FZUD 2VXUL 3FQYA 4Z76A 1CICD 2QHRL 1BFSA 1Q9LA 3DSNA 2K70A 2ZOLA 1PKQA 4JDZA 1RIVH 1VEPA 4Y1SA 3GRGA 5CJQH 3VWJC 3MA7B 4OF6A 3BAYA 1UWEH 1O75A 2EXYC 1YMMA 2I7OA 4N0UE 4BDVA 1XSOA 3TJPA 4E41D 4L0PB 5CZRA 1CL7L 2JF1A 3GO1H 4YE0A 5MHSD 2GSIA 1DVFC 3RX5A 3QIWC 3T8XB 4LOFA 4ZYKA 2RBLA 3NSJA 1JDCA 2QZ5A 5J11C 2VXSL 4QF1A 1RK1A 2P24B 4WLCA 4AV4A 1CQKA 3ULUE 1RZGA 3EBAA 4UT9A 3GMOA 3FYEB 4LQ1A 1U6AL 3GS7A 4FTVB 3STZB 5C9JA 4BIKA 5JXEC 5F7MC 1JN6B 1C5CH 3BXNA 3F00A 1BQKA 1NMAH 2D3VA 2H3NA 5KZCD 2OZ4A 5D7LA 1JGVL 1SHWA 4LLWA 3H2PA 1TTGA 4Y1AE 2ZOOA 2Z0UA 2VXQH 3U1QA 4LVOB 2LFEA 1L6XA 4GOSA 1Q1JH 1P4IH 4WK0B 4OF8A 1KIQB 3M7OA 4XXCA 3GSWA 4YSSA 2VLME 3MJ7A 4HGMA 2ESVD 5GS3A 2VLLB 2KLRA 4XNXH 1QR4A 4NUJB 3KXFB 4P5TB 1IGCL 1KXTA 3FQXA 3V9EA 8PAZA 4LL4A 1YPZE 1PIGA 4KK5C 3DVIA 4DUVA 2ZD0A 1FJ1B 1UWGH 2BDNH 2WXFA 1BQSA 2H1PL 2VMDA 4KQ4L 1AIZA 2Q76B 3L3HB 4X6BA 5JDJA 2CLVB 2VL5B 4PP2B 1J5HA 1UHVA 4KUCF 4PJ7B 3O81A 1RUQH 4KH9A 4PRIB 2HTLC 4E9WA 2H3KA 5E5RB 3D4GA 1VFAA 1G7IB 4LGRB 2YQBA 1HSBA 3ZTNH 1ZLSL 3DVGA 2PABA 4UILH 3GGWB 5DWUL 1X9LA 2FIRT 3VTTA 1H5BA 1SXNA 4L3EA 5EIVA 1QLEH 3ZKXB 1G9EA 4CADB 2ZKXA 1A7OL 4NENA 4Z76B 3NG5A 1M9WA 1S4IA 1AHMA 1F3JA 1GYWA 3AMLA 3GSQA 1P0SE 2TSAA 1HVXA 2DKSA 4KUZL 5JDSA 2XG5B 2BVYA 5DVNA 3UZVA 3UMNA 4HH9A 4XMUA 2QADD 3PAZA 3ZZLA 3UDWA 1TJXA 1AE6H 2VDRL 4RMVA 2WM0A 3MXVL 1DFBL 5DHVA 5IGXH 3LPWA 4MMXC 5DYOB 1W72A 3REVB 2Z31C 1RZKL 1H6EA 1XB6A 1XIWC 3O2DL 5GGQL 1GS8A 1ZAGA 3TONA 4DP6X 3PWLA 3U0TA 1ACZA 2ZAGA 5L6YL 3OC5A 5HHMB 3WFZA 3RPKA 2ZUQC 4GFXA 3GMOB 3VFPB 4JCWA 1BJ1H 2J5LC 4JB9H 5KVFL 4BCYA 5EFIB 5B4MD 1VADB 3J2PA 1OSYA 1Z9PA 4U6XA 4XP1H 5E4IA 1UUNA 1MWAA 3QR1A 4M6NL 3HB3D 5EZIL 3RZCD 4B7IA 4LSSL 4AH2A 4RISH 5FW8A 1I7RB 5L2KD 3UBGA 3CCHA 2F58L 3FC8A 2CMRL 5I6XC 3GPEA 1FHGA 2DKUA 3TBVB 4F7MA 1WFTA 2HKFH 1KV3A 1MI5B 2BP8A 4OCRH 4PGDB 1LE9B 3A6BL 4ANXA 5I8OL 2CH8A 4M48H 1R3LB 1ZHKB 5CD5C 3EO0B 3TCLA 1CFQB 3F7VB 4ZFOA 4FRWA 4FQ2H 4PYGA 3V4UL 1FV1A 3OPZH 3ZUNC 3QIUA 1FSKB 4HUWA 3BUDA 5I28A 1ZT1B 4LCWD 4U1MA 3WUWB 1RV6X 2NT0A 4X6DF 2HVKA 5TE7H 2HLAB 3E8VA 2HLEB 3NACL 5A2LH 3VI4F 1NUNB 4AL8C 4LASH 2CGZA 1OGTA 3MLVL 1Z5LA 3P4NB 4JCMA 3AAZB 4RNRB 5IHWA 2AV1B 3CXDL 3UFIA 5D7JC 1FO0H 2KBGA 3C8HA 2ORBL 1NGZA 3FN0L 4DQOL 4BZ2A 4DETA 4H26B 2X28A 4KRPC 1WEJH 4FXGA 2OM5A 4IRZL 3SJVE 5A1AA 4BHUI 1FI8C 3PPEA 1QUNA 2QQQA 2YAPA 3CZFA 4G9FD 3HW7A 3PGCA 1YQVL 4XH2B 1H5BB 4BSJA 1J1OL 1DDTA 4YN3A 5TK2A 3VFVA 2I25N 5I1DA 1A14L 1NAMH 2H8PB 4HIEA 3QG6A 4XZ4A 4ZD3H 2AVFA 4NENB 1LTXA 4F9PC 3ZZ1A 3TEXA 4FNRA 3U2IA 1NCUA 5IMLA 1YEIH 3VQMA 3CBKB 3DMMD 3GNMH 4ZG1A 4HETA 4PHXA 5JORB 4XPFL 1LEIB 3RWCA 3KYOA 1DQLH 1XF1A 4J4PA 2ADGB 2D0HA 4HEME 5C7ZA 2QPFA 5SV3A 1QFOA 3AXLA 5DJ6A 2WKGA 4U1LB 1ID5I 4ZPVB 2AK1L 1BQUA 3F7YB 1TENA 3VGHA 2C3WA 1M6OA 3C2AH 4FI6A 4IKJA 5CGTA 4G6AC 1OGAA 2QVKA 4HEPG 2YD3A 2BERA 3INUL 1MY7A 4TNEA 1OAZH 2PO6A 1S9XA 4J3OH 2J8HA 4ZX6A 4OKVB 1UZ8A 1U92A 4B9ZA 3RFRA 1IM3A 1T0NA 4FLQA 4ZUWA 4JFXA 2D31A 2R56L 3RWDA 4M03A 1WK0A 1WUNT 4GI6A 4K07A 2HH0H 4OV6F 3MPCA 4TNWK 3N85L 5AKTA 3WNIA 2J56A 2C9VA 3L8QA 4PPTA 3WY2A 1CD8A 3BT0A 4J7RA 1RZJC 1VLXA 1KN2H 1R19A 1YNTB 5B1JC 1ZDQA 3HPJB 4MLSA 4PJEB 5F70A 4KK8C 4ZW7A 2WANA 3GIVA 4K9EL 3BEVB 4Y4HD 5F8QC 4A2MA 4L9DA 3F6JA 1A4JA 3O0RH 2CLRB 3H9SE 3FTVA 4E36A 2VDNB 4ENEC 1I1AA 3IJEB 5TDOB 1ILUA 5F7BA 3TH2T 1BXVA 4ZFFA 5I18L 1IO4C 4XE0A 1NLBL 2F1EA 1JF6A 1PZUB 4XTRD 1KPVA 3GS4A 1RLBA 1V3KA 4G43B 3OVUB 4PJHB 3QCTH 1IFHH 3X12B 3ARTA 1JV5B 5LAXB 4Y16C 3OB8A 3V55A 1RUKL 2IF7A 4N8VG 3ULVD 1IGYA 3M86A 3LKSB 4OU3A 2VE6B 2RJMA 4Q0XL 2MSPA 2DM7A 1G84A 5DEJA 3CDYA 3GMMA 4C8XA 4MXQD 3T65A 3U4AA 3A4FA 5MEND 4J3OF 4JN1L 2K8QA 4PLKD 2XNAA 2WKOA 2FZ3B 4HKZB 4KPHL 3NRPA 4YMPA 1B90A 5F9JA 2W8CA 3C2SA 3DIVA 4GXVH 2UWEB 2NZIA 1EDHA 3WKYA 4NQEB 2NUPB 12E8L 3OKMB 2D3JA 3P0VH 1Z1WA 4I2XB 2ATAA 2FK9A 3QI9D 4XGZB 1QTYT 1DQDL 1KY7A 1UENA 2IDSA 1M05B 1A4CA 3F62A 3IDYB 4FGMA 5T1DL 5CGYC 5IFJA 2A7BA 2E9BA 4FZ8L 2P45B 3VM7A 3QEUA 3CDFA 5EEVA 5FA3B 5IB2B 3KJ6H 2EDTA 1JDDA 4K4KA 2H2SC 1PW3A 3GMRA 4R3SA 2EE6A 5EV7A 4ZXBA 3QDJA 3UPRA 5K9QG 3ZKSD 1OQXA 3UJTH 3RWJB 3OGOE 1A6ZA 3VSVA 2Y1AA 2JQZA 2IJ0C 3VFWA 2DB8A 4FFWD 4YXKL 5I5RA 1JZ4A 3O2DA 4X98A 2HJLA 4C83B 3CMOL 3VXSD 3EGSA 5KBMA 1K5NA 4KKNA 2FSEA 5F0JB 4GP5B 2DQUL 2P5WE 4KROD 4Q6KA 3WU1A 3B1UA 1IKFH 2DM3A 1AQMA 1TKWB 1R3IL 3UCRA 5SX4I 5M95B 5GZNC 4CW1A 1QSEA 2V33A 3IDXH 4P2CG 4FG6C 2Q8BL 1WQVT 2WTRB 1KENL 4F37K 5C0CB 2ZCHH 5HDBB 1OAXH 3ARGA 2DH2A 4PJ5A 4ZMLA 4MNGA 1U91B 3OKLB 2NQCA 3G5XA 4K0OA 2YK1L 2CR0A 1IVLA 3TPKA 2ENSA 3FQRB 1N70A 1B6DA 1NC2A 1U3NA 1JXGA 1GXEA 1INEL 4JM2B 5HYJB 1WBZB 4F57L 3JWDL 4X5LA 1NCDH 4YXHL 4N90D 5ANME 3G6DH 5E94B 2VIRA 3I02A 3KJ4C 4JJOA 1EFXD 2BCKA 4XI5D 3OWEA 2WO2B 1I1RA 1QFWH 3KWVA 4K94L 3BKYL 3MLUL 4E5XA 4KKBD 3MZGB 4DVRH 3V5KA 2BOCB 4D0CA 5ISZE 5DD0L 1KXQA 3U0PB 3O41B 1CS6A 3UO1L 1KN4H 3H0TA 3DJZA 5CEXA 5EU6E 3QDGE 4W81A 3HCVA 4IRZA 4HUXA 3FRPA 1OLZA 4FQQA 2HFFA 2AW2A 1ECYA 3CSBA 1TZGH 5I6PA 5EC1A 5A43C 1E9QB 3A6CH 2D0GA 3HMXH 1A3LH 5I74C 5A2AA 1OE1A 5FUOL 1J48A 4NUPA 3UROR 3OX8B 2ZYIA 2VDLB 4Z7AA 3GC3A 4I9XA 5CBEB 3UABA 4OZIB 1PEWA 5AL0A 1BVNP 1C1EL 3JUYA 2H0EA 1E3XA 1QTPA 1ZLDA 3C60D 4NPJA 2PCPB 3HE6B 4ZOCA 1X3DA 3TIDB 4EI0A 3WO4B 2F54D 4HU2A 3G6JB 4X6DE 1AGFB 3VI4E 4DW2H 1JXDA 1AC0A 2DW5A 2ZWZA 1L4IA 1I3GL 4IYKA 1ZLUK 2J57A 1KJ3L 1UXWB 3VH8B 1NMBL 2IWFA 1XGPB 3HG1D 4OQ1A 4L29A 5AB1A 3SGEH 3O9WB 5E51A 3VVWA 2QKSA 1J10A 1CE1H 4X80H 2XT1B 2EUXA 1JNLL 3PJSB 3P30L 4UM9A 1M7XA 1OB0A 1T22B 4YHML 1MAML 2EADA 3B1TA 4JG0L 4M6OL 4OZHF 1AMYA 1JWUB 4ZO9A 5IVXF 1EVUA 5DRNA 2X4UB 4M1CD 2C9PA 3KH3A 1CT8B 4WWPA 3FB5A 4FG2A 2RA1A 5EBWB 5MEPB 2L04A 3R18A 2GYSA 3FB8A 1YYML 3KW8A 1NCCH 3L3OB 4TS6A 2P8LA 4XODA 1BLNA 25C8H 2FBRA 3MQIA 3NJGA 4AENA 5J5EA 2ZG2A 1D9KC 2IPKA 1MHEB 3TM6A 3NP3A 1QSFE 2CJUH 1AR1B 2E47A 1A2YB 4Y2LA 3SKOA 4PJIA 4DKEL 4IDLA 3H55A 5E8OA 5EDXA 4EUPA 3LD8C 4K5LA 5KSAA 5D6DC 1J5OL 3MRNB 1T89A 4WCYH 5KS9B 2WLMA 4UNVA 3EG9A 3VACA 5C08B 1LDPL 5I19H 1KV7A 1TR7A 2APWA 3DV4B 3GEWB 2BSTB 3MYJB 4OLYH 3AS0A 3TO2A 4E9QA 3OG6B 1Z32X 3IXAA 5EU3B 3APDA 2HRPL 4U6VL 4Y7OC 1S9KC 2IQAA 4JFWA 1PX4A 1PYWB 4XCNB 3C6EA 1PFOA 3FT3A 3MV7E 2WYIA 1LO3L 2DQCL 3GM8A 4LHJB 2KQNA 5F44A 4ZUVB 4ISVB 4M4PA 2VXVL 4JG1H 2AQSA 4QOKD 3U4EB 5HDQL 2A74C 3IDIA 3LRSB 1SJEA 4FNUA 5FYLL 4A55A 5JW5B 2FUQA 2ZUUA 2X4NB 4Q9RH 4EXKA 1WAAF 2XQBH 3GSXB 4Q9CA 5J56B 2HT3D 4Y4KC 2PWFA 1L5GB 4EDXA 4BRJA 4NHUB 5HHVL 4ZSOA 3ARXA 1RSFA 5D2NB 1E4XH 2E46A 4BQ9A 1BA9A 4ICWA 1EHLL 4BQ6A 3QPXH 3RFZA 5FECB 2CHZA 1SHXA 1YAIA 4AIZA 1T3FA 1DQMH 2NY1D 1KSRA 3VFUA 4MSWB 2LLLA 4DK5A 4ZO6A 5ESVB 4GG6B 1BQHG 3B9VA 1LM8V 1CN4A 3BSZL 3QJOA 2GCYA 3PP4L 1Y0LB 3SPVA 4X4ME 1QQDB 2OBGA 1ZT7B 3IVKB 4QDGA 2MCAA 3M1OA 3V4PB 4PRHE 1WAPA 2FJUB 5SWZA 3CHSA 4L97A 1B0GA 5IOPB 2LTQC 1CICC 3U48A 1CD1B 4D94A 4MS8D 2X4RA 4W9FC 5T3XH 2OL3H 3FT1A 1LD9A 4B9GA 4I89A 5KANG 4DKDC 4UOJA 4HIJB 2J73A 4ES9A 1W6LA 1E4WL 2PPEA 3VXMA 4DGIH 5BS0E 5J6GA 5ITBH 4IBUA 3LKOA 1BLNB 1B2YA 3EH2A 3SBQA 1N7ML 4B9CA 1OEZW 1TG8A 5KAQG 3HHSB 3ECBA 1DJYA 3EFOA 3WMSA 3MUGB 5IBUG 5DGQA 4WHDA 4YDJA 2C1OB 2OSYA 4JHWL 2QDVA 1SJXA 4GMSL 3GK8H 3O6FA 3RWGA 3JZ7A 3NK4A 2PXYD 1KC5L 4D9QD 8FABA 1CXKA 5IBLD 5F7WC 2GJ6D 5I1IL 1P84J 2V8MA 4KV5F 4LSUL 1RFDH 2A6JA 1XTLA 4UZSA 4EN2A 5LWYH 1N6UA 4AEIL 2XKSA 4UTBH 3QFGA 1VZGA 4HIXH 3TO2B 2XETA 1E6OH 4GQPH 4HOWA 1OW0C 1UM6H 2EO1A 4FQXD 4GAGL 3US9A 3FO1A 4JO5A 4J4PD 4N2IA 4P9MH 4UDUB 3FMGH 1GTNA 3K2IA 1E43A 2WIIB 3O2VL 2AQPA 2OYLA 4QO1A 3MV9E 4YHYC 1G4RA 2JWYA 5BUAA 3UTTE 4HOZA 1KCRL 4EEEA 3UC0L 3ASOB 4AYDC 3O6KL 1JOIA 3FQWB 4P4KB 1WFIA 2CNZA 1NGYB 4MB4A 4NKOA 2FGZA 1OVZA 4MA3A 5T1JA 5IW1B 3N41F 1J0YA 2X1WL 4B9FA 5FV1L 1NQBA 2XWJA 1HDMB 1MCPL 2WXRA 3D9AL 4PS7A 1UWYA 1KT2B 4JRYE 4S1DC 2Q6WB 1G7JB 2ICWA 3ESPA 2PTTA 4TF4A 4YE4L 4PB0H 1IMHC 4G9DA 1PTZA 1T83A 3FQNB 3VXTA 2BFVL 4OZFH 2JIXA 1PG7W 1D5ZA 1U2CA 4FYQA 2L7UA 1S9YA 2IFFL 2CDGA 3W9DA 3BQUA 2NUTA 2BNRE 2HUEA 3DROA 3GLAA 1T7WA 1YNLL 5KVMC 4URKA 3IETB 3H54A 1BPVA 1AY1H 1XL4A 3IMWA 4RFOL 3M46A 2J12B 4OFQA 5MI0B 1JSYA 2OX5B 1RK7A 4I9WE 3BPCA 5EO1A 5KYNA 2W65B 2A4ZA 4ZW3A 1A9VA 5CIPH 2QADC 4JO4H 5H37H 1T4KB 3WTWA 1S2EA 2OV0A 2TRHA 2VM3A 1EEZB 4E2OA 1RUPL 3QUZA 1EEYA 1NPUA 2B0SL 4Z0BH 5C0RH 3O3EA 4UTAL 1CDIA 4EQ3A 3TWCL 1DQQA 4H8WC 4WEUD 2OJ1A 2QVMA 5F0PB 1QKZH 2QLYA 5F72S 5C07D 3KYAA 4TQHA 1UQSB 4WKZB 1RMFH 4PIBA 4OM1H 3AREA 4OF5A 2VGLM 3RNQB 1BAFH 1SXZA 4P59H 4WI0B 4BFNA 4PCSA 1NM9A 2XN0A 4X99A 3RZCC 4AUYA 2ZTBA 3OZKA 4PREB 1TT6A 2VITB 4IHBA 2NOYA 3VXRB 4QRPE 3L3JA 4J2XA 2H7WA 4TSBH 1MRFL 1FIEA 2WBJD 2NSQA 3GKZA 4HHWA 5KVEH 2CKBL 2KQMA 3FT4B 5D6CA 2YQ3A 1L7TH 2HT2D 2KMWA 4GJTB 4LLUA 4R8WH 4G83A 3U6XA 1QI3A 2YFOA 5TF0A 3CPLB 2FR4A 2VDML 1USQA 2IVFC 4G5ZH 5CGMA 4S2SA 4GXUN 3QRGL 2X0UA 4E42A 3T0ED 1T7VA 1MPAL 3BN3B 2EDLA 1UJ3A 4PCTA 5FHAL 2V0AA 4NZFA 1I1FB 3N1GC 4MX7B 5ITFA 1ESOA 1ZV9A 4JO1H 5MP6L 2HTKD 4OLEA 1U8HB 2Y7QB 2VR5A 3QC5X 3HEIB 2IDFA 3NMEA 4OZHE 2DM4A 4DK6A 5C2BH 2QQLH 4LDLB 1CPUA 5IVXE 2YLHA 1L0XA 4NQDE 1HS6A 3K6NA 4WI9A 4H20L 3QNYA 4GW4A 5E99H 2LVEA 1SMDA 3UCQA 1UCBH 2VXTH 3Q9PA 3JT2A 2BSDA 4N1CA 4S1RL 1V8HA 4UB0H 1X5XA 3G5YA 3QJQB 2LQRA 2CXGA 3CFIC 3KPMA 3MRKB 4TVSa 1G9MH 5DEGB 2AK4D 3WNPA 1AQDB 3FSWA 1HINL 3DTXA 3P02A 4RFNB 3U36A 4TUKL 5FOBA 4D9LL 4B3VA 3HE7A 2X89A 3DMMC 3V52H 3K74B 4PJ5D 4HSQA 5TGBB 4N8PA 5FYJH 1EHAA 4XCYA 6PCYA 1ETA1 3K8LA 3BSZA 2CCVA 1FAIH 3T0DA 4GW1B 4MMZA 4QAMB 5IHHA 4OGXH 1ZGLM 1NBYA 5GISH 3HZMB 1FNAA 4YVUA 2J1XA 4WI5A 4QRTA 3W9EA 2KDYA 2YA1A 3V5HB 2O1AA 1JHLL 5DQJB 2V7HA 4P2QD 1G1KA 3SCMB 4DP9X 2FX7H 3L95B 3OAZK 2CGRL 2XU9A 2GEQA 3PWPB 5KN5B 4H13C 3GXPA 4XP9L 2ED7A 1DSWA 4JMNA 2R2HA 4M7LH 3QEQA 4Y19B 1D5IL 1WAAE 3A47A 4KVNH 5EO9A 4HWUA 1CXIA 3GSOA 4KAQL 3HR6A 1HQRA 1B0WA 4NWUH 4WV1C 2OS7A 3L3JB 5DK2A 3EXLA 1RU9L 4JN2B 2WLZA 3VSTA 2HJKA 3IDGB 4NUMA 4UT7L 3PQYE 4KKQA 1R1CA 4PV9A 4F80A 3IE9A 3F12A 1CF1A 3S3DB 5BZWA 3GHBL 1A0QL 4FL4C 1H3PH 4W9JC 1JNNH 4AMKH 1P2CA 2R15A 1NDMA 4Y4HC 3HPLA 4XAWH 1W8EA 2Z8RA 3NCJL 4R26L 4YL9A 1E50A 4KTYA 1A1NB 3IFPA 1PQZB 2F18A 1YEFL 2R2CA 4BD4A 2I5YL 2DQFB 1OGPA 2XUWA 2YPVL 1C5DB 5C7XH 4DOHE 3WNOA 4Q56A 1MFEL 3QQ4A 2QKIB 4CVZB 4F8LA 2YQ2A 5BOPA 3DIFA 4FOMA 1SOKA 4M6MH 2J88H 3FQTA 1D6VH 3DA0A 5G4MA 1K8IB 1OAJA 3DHMA 2EIJB 2NY3D 1DQJA 3KPSD 4HBCH 4I3GA 4TNFA 1Y6KR 3MV8B 4D7BA 1J1PH 2ZKMX 2FWOB 5AW6B 1MFBH 4M5SA 1EA9C 1WTLA 3KLAB 3RX8A 1CFVL 3KWXA 4HG4K 4YDIH 3A24A 3LNIA 1BEYH 1T7YA 1X5LA 3SE4C 3ULVC 3B34A 2DEWX 2FATH 3GBLA 1LK3L 4RZKA 4V2CB 2ZP9A 2WLIB 2C3XA 3FH7A 4O5LL 1ACXA 1CYXA 2BNUA 4P5MB 5DYFA 4P2OB 3SDCC 1L0QA 1L9NA 2EECA 3IYLW 2CJ3A 4G1EA 2WB7A 3D39D 4QHPA 3D85B 4K3JL 1YHPA 4PLKC 3DTXB 4L99A 2O5XL 3KNBA 5DD1H 5BQDA 2HG0A 5FGCB 2WLLB 1NFIB 3UG4A 3ABLB 1WWBX 3R1GH 5D1QA 4PAZA 4KV5E 3D2UA 1N8ZB 4YK4B 1YZZA 3K71B 1U8QB 1VIWA 5E70A 2B1AH 5CZKA 3QI9C 4JDTL 4MAYD 4PJ9D 2XN9D 5C70A 4GKLA 1EO7A 4LEEA 1FFTB 2X6AA 5DUPH 3FTGB 3MGOA 1YEEH 4IHOA 2X70A 4OUUB 2I69A 4X2UA 1S9VB 3DX2A 3GHPA 1Z0NA 2AP2A 2BWQA 1I7UA 1P5VB 1S5HA 1HCVA 2EDHA 3B2UD 3MFFB 4NQVB 3QJHA 4U1IA 4YPGA 5I5JA 2B3IA 2CIIA 1IQWL 5DD5H 5B38B 4K5NA 3OAUL 3ZE0B 4BUGA 1ZEAH 2VN3A 5EN2A 3RAJL 2DOCA 2D73A 5E8EB 2FX8L 2XC8A 5GRUL 4ORGA 3TTYA 2XN1A 4FFWC 1ZA3B 3LMJH 4UTAA 4K3EL 4RSVA 4C47A 4OD1L 4WUUA 5IG7B 3FH5A 3GJFH 3LH2H 3RUGB 1F4XL 3CX5J 3QK0A 4KROC 1KWKA 1IGJB 4M29A 1UA6L 3B9DA 3TPUA 3SY0A 1P2CB 4Y5XC 4AYGA 1RULH 2CBMA 1I9RH 2EEAA 5C71A 4JQIL 4NO3A 4JZNA 5FYKU 4BFIB 4Q9BA 3DVNA 3PABA 4LPCA 2VDPB 2CRYA 5AZEH 4RRPA 2NXZD 5FAAA 2FO4A 1XR9B 3K81A 3B7YA 2DQ6A 5A2BA 4AG4H 4F2ME 4L0YA 1CBJA 2YD6A 4J6RH 2CKBA 5K9JL 2OMWB 4YDLC 3II3A 5KG9A 2IGFH 3LKNA 3AW5A 3C09B 3LAFA 4G71B 2APTA 3WJLC 5KJRH 4FZEL 4Q97A 1N3NA 5F71A 1DBJL 4WNQB 4AQ1C 1BF5A 5AW5B 1HQ4A 2VLJE 3WFBL 3EOAB 2XA3A 3ZDZF 3Q2LA 4R7NB 4DTGL 3N9GL 2D2CC 4XHJD 2B59B 2BRRH 1OM9A 3TA3A 4RH4A 3WLBA 1KCWA 4QY8B 4KKBC 1EXHA 3JZYA 1ZY9A 5F0LB 4R2GD 1OAUL 4OLXH 4ZMVA 4LBAA 1FYTA 2O5YH 3UJIL 3T4YA 2IALB 2XXCB 3GLZA 4NO0B 1W16A 5IESH 2NXYB 3X14B 4IOIB 3VFNB 3BKJH 3I2CH 2A83B 2VJ8A 3BW9A 5T1LA 1BZOA 3AS1A 2FGWH 3D07A 2YRPA 5D72H 4IGBB 1R0AH 4HMDA 2CK2A 1MQKH 2V5TA 4ZAKA 4WFHE 1LQSR 1TZIA 5K1VA 3X1GA 4NT6A 2AC0A 1PY9A 2LW3A 1I7TA 2OMUB 1Z3GH 3CE1A 5JIQA 4ZMQA 1T1WB 1WBYB 3WHE1 5KVDH 1I7UB 2ENYA 5CU5A 5C6TH 4K8RC 2I9TB 3QISA 5JPNB 3C60C 2I07B 4V11A 2IG2L 1GZHC 1C8PA 3G9VA 5JHDD 3ECVA 2IAMB 2H32B 4G8FA 2VRQA 1R5WA 3D0VA 5F93C 5FW6A 4TM9A 2R0LL 1NEZB 2G3MA 1DJZA 1FZJB 1MCNA 1F42A 4U1KA 2WNKA 5ICUA 4NZRH 3MRCA 1OWWA 4E9VA 4ELMB 3B9KB 3IU3A 3RL2B 4YHLL 1E90A 1MXDA 4PJ6A 4MA8H 3TURA 1FZOA 2UXGA 1JVOA 2Q7YB 4L9LB 5EEZA 2DD8L 4H25A 4EI5B 2GBAA 1MHCB 3JV0A 3S5LB 1ORQB 3MRGB 4KQ3L 1YAZA 1M53A 2Y2YA 3BGMB 4M1CC 1AO7D 1OARH 1TTAA 2VQTA 3O6LH 1J11A 1T2JA 1OB1B 3P73B 4YQXH 5A40E 9PCYA 1GPOL 3K8KA 2ICES 3US1A 4W9CC 4N2KA 3U30C 3X11A 3QQDA 2AEQH 2YIHA 3W81A 3BZEA 2DYPA 2UZIH 4C58B 2DLFH 3CBRA 2ICEA 4TLKA 1J9CT 4YOKA 5INCA 1G6RL 3QIBA 3OR6A 1HQ4B 2PP9A 3P0GB 3WBDA 3C5XA 1J5DA 3TNMA 2YPVA 3RQ3A 1JIBA 3DDFA 5TQ2H 4DP2X 3P40A 3SODB 4C56D 5KVEE 3MRIB 4LPUA 2VR9A 4HKXA 1GJWA 8CGTA 1PCXA 3F7QA 4EIBA 3NCWA 5I1EL 3BHBA 2VTFA 2WBWB 4AEHH 1Q9KA 4R5VA 1CUOA 2Y7SA 5CLTA 1KB5H 4FNPA 3DV6A 1AIFB 1WWAX 4L4TD 3RURA 4OSUL 1HE7A 1LXMA 4A2FA 3B37A 4HJGA 1HC1A 1VACA 4DUWA 4X6CF 3QEGL 4QHLA 1FDLH 1Z5HA 1K2DB 3ZIMA 2WO4A 1BD2B 5E7FA 3EDKA 2EKSA 1A65A 2QPUA 2FEDD 4JGJA 1ZVSB 3V7MA 1SN0A 5IEHA 4R6UA 2HT3C 2V9TA 4AQ8A 3L9BA 4IIQC 4XNMA 4HCRL 2ZX5A 3ARED 2UY6A 4HHAB 3HG2A 1ZLWH 2JVUA 3RIAF 3BT2L 5EC2B 5CN2A 2L7EA 1GC1H 3G5VA 5F96L 3TFBA 2EAEA 5C0DB 4GFTB 1KCKA 2NY1C 4DFHA 3R0NA 4YXLL 1TQBB 2W9EH 3KYNB 4OIIL 1U8OB 3GTTA 3UO8B 3BVNB 3DYMA 2AF2A 1VRSA 5C3IA 2UX7A 5FYJE 4Z8FH 2ZCZA 3OKNA 1I1YB 1VZHA 1NKGA 1EK3A 1SBSL 4YBLC 4F58H 3VFGL 5FO8A 1YJDC 3EOBA 3LKRA 3K4ZA 4MS8C 2YGPA 1JJUA 2AI0H 2WK2A 5CSBA 1KEMH 3KPQA 1XL6A 1MHPL 1BFOA 4G11A 1SXAA 1JWSA 5AEAA 5B1BB 1BCIA 1P1ZA 3OAYH 3OHXB 5FS5A 3NH7L 4EN3A 1NWOA 4XCCH 1O6SA 3VXUD 1KXVA 4ODTH 5KYUB 2LT9A 5DJ0B 4JQIA 2WSPA 2VERN 4CNIA 4JRXA 4JG9A 1KCVH 1JXKA 4K71C 4PH8A 3F7LA 3C9NB 1KZYA 1URZA 2WY3B 4GLRI 2O26U 2W91A 1SJMA 3EF4A 4JY5L 1DJHA 1J86A 1LP9B 3RIFK 1SMOA 4Y5YC 4JFFE 1T1ZB 3NN8A 2C3VA 3WSQL 3DJRA 1Z9MA 5IBLC 5EPMB 3DUUA 1JRHH 1TZHA 2EEXA 2TRYA 3SGDI 1XGQB 2R2BA 4UT6H 2QSCH 5D5MB 4PGCA 3OKKA 3RL1B 2WXPA 4B3EA 4R4NC 1OZTG 4FQXC 1J8HB 1E8WA 3GT6A 3NIGB 4J4PC 3EH3B 2MCG1 4BK4A 2FJGA 2RH0A 4Z7OF 4HU8A 2FEJA 4Z77B 4PTTB 1N64H 2YEZB 4PRPA 3WFEL 1YEDA 4OZGB 1S7QB 1R5IA 2CG9X 4F15B 5JZ7D 3BZ4A 2AABH 5EMYA 1S7VA 5I76A 5C3LD 1Z3RA 4RGNB 5AZ2L 1R3JB 2AMGA 1FL3A 3KVDD 4DERA 3TJHC 2FNWA 2YMXH 1G7HA 3IPBA 1UH2A 1MUJA 2HX7A 3MNZA 1LMKA 1RZIB 3S3CB 3COOA 1SLVA 3BDBA 1JGUL 1TJMA 2QLVB 4PMEA 5F7NC 1J88A 3PHQB 3SKJH 3IAQA 1Z6JT 3D25B 3VW3H 5DVOA 1JZ2A 2PYFB 4QHUB 1ZANH 4WGKA 5DJDB 1A7RL 1YN6B 4GBXA 1EJ6A 4PCYA 1U93B 3T2LA 4A6YH 4U1NA 2VAJA 15C8L 4O2EB 1JZHA 4MAZA 5L2JB 5FX3A 5C0EB 1E30A 1J0ZA 4E9YA 2D8KA 4JS7A 1U30A 3JWOC 1WF5A 1ADQL 2VQ1B 3QUYA 4GRLA 2VDOL 4NQCE 4X5WA 2YN5A 1HHGB 5E0QA 3OR7A 5IR1B 3O8XD 4RIRA 2UYLB 5GS1A 3SKNA 3BP7B 2GC7C 3D5OF 5DD3H 2X1OA 3NQIA 2Q10A 2ZKHL 3S6CA 4LF3A 2EIBA 4TUUA 1U8LB 4MD4B 3MGTB 1SVBA 1E0OB 1XGTA 5E00A 4JPVL 1E40A 4N0UB 1T6WA 4I77H 2P43B 2E86A 2YQGA 4LSDA 4MCMA 4OLZH 3DGCR 5B22A 5GJTH 4OAWB 1UEMA 3CHXA 1XCTA 3S36L 5GRZA 3ILEA 5BUPA 2R4RH 5JIMA 2IC2A 3VYNA 2YKLL 3M17B 4ONGH 4NKDA 3MJ8B 4Q9QL 1FFPA 4YHNA 1EZLA 2XBTA 3SDYL 4JUTA 1WZAA 3SE8H 1S78C 5D7EA 3L3GB 4I0PB 4H8WH 4EE2A 1G6RA 1OSPH 4FFYL 4P48A 3LIZL 2WBJC 3QT2A 3I6GA 2XVGA 3M1BB 4XC3H 3O3UN 4OD3H 2UV3A 3MBXL 4TTDD 3GI8H 3S37X 3QHFL 5L0QB 1PZBA 5EIIG 1U58A 1XB8A 5CILL 3BH9A 2RGSA 4PY7B 2YOAA 3SPHA 1KLFA 1IBHA 1C5CL 3T0EC 3GI9L 4DO6A 4XO5A 4KZEH 1MVUA 2EYSB 2Y4SA 3QNZA 5ESAB 1A3RL 2HTKC 3Q8CA 4IRJD 1XH3A 4ODHH 4BH8A 4ZXBC 1JD7A 2FJSA 2N1TE 1DP0A 2CHWA 1P4IL 4P5KB 2J4WH 2OMYA 2X10A 3HFMH 2V3FA 5HYQB 1XF5A 2JH2A 4OBRA 3VGAB 4L8BB 4V1DE 3ES6A 1QW9A 4MZ3A 4L4JA 3BPNC 3UACA 2FECI 1FGNL 2SEBB 3LJ3A 1GA2A 3GKWH 1AXSB 4LHUG 4KJYB 4NQXA 1UATA 2DWEA 1UKQA 5F1KC 1JK9A 1QZNA 2Z7YA 5HHOD 4HCRA 1RCYA 4JJ5B 1OT1A 4FFZL 3TO4A 3FFCD 3V6OC 4A7UA 2BDNL 1JHTA 4HF5H 4MCYB 2DQHH 2Z91B 3VMNA 1MCRA 5EEWA 3DO7A 4WJKB 5E8NB 2N56A 2V9QA 3S3BB 1WUZA 2FIKB 3Q7JA 1G87A 4G42A 3WFCL 1JZ8A 3GF8A 5HDWA 3NDYE 1P53A 1DLHA 1ZSHA 2XA8H 4MMYA 3BWUF 5EOTA 3SDAD 5E2VL 3GUTA 2EE3A 1N59A 4NIYE 5IEKA 5KVDE 2LLGA 4WFGE 3WTSA 3BUTA 2NX5E 3X1FA 4G6KH 4LOUD 1BZEA 2J1KA 5H94A 3WN6A 1PY4A 2BCMA 4KKLD 3V8OA 4X6CE 5C0GB 4NBYB 5HPMA 5MEQB 2IPTL 4KMTH 3VRJB 3I9GL 5KSBF 1G0DA 2IAAC 4H1LH 4K2UL 3NESA 2X9ZA 1MRCL 3NFSL 1EAPA 3THMH 2GABA 4J8RB 4OLVL 4OGZA 4CDGC 5E8PB 1UYWH 5ANHA 3SD2A 1JNJA 2CAKA 1F45A 4HDIB 4EZMA 3AFLA 1EAOA 1WT5A 3U2SA 5A7EA 1N2RA 4WFFD 4WO4B 5CEZH 4PRAA 2OLDA 3ULSA 4A67A 1TUPA 4HPOH 3IFOA 5FWQA 3ILQD 4HJUA 1MCOL 1ZS8A 3SKMA 2NR6D 4TSAL 1HKLL 3U25A 3IU4L 3GSVB 4XB3A 3ZHLA 5BUGA 1PDKB 1YEHH 4TUJA 4MNQE 4EO5A 5BZDA 3QH3A 4XP1L 2A6IA 1NCWL 1FGVL 3T08A 5J12C 1XT5A 2WNXA 4PJXA 4ZMXA 1NGQL 1GVIA 2MOVA 3Q3GB 1JPSH 4G5AA 1RZ7L 1GJIA 3B9AA 3KCPA 3P0YL 2APSA 3CHRA 5AOIA 5HYSA 1G1YA 3QHZH 5EBLB 2GY5A 4QJ4B 2NY3C 5IF0A 5E6IB 3SQRA 3DXAD 3TCTA 4QRSB 3OM3B 2IQ9H 3TN0A 4AKOA 2DWSA 5CLXA 2WZPA 4NJAL 4QHNA 1M42A 4DGVL 1TFPA 1HNFA 5SWSE 2AFNA 1FFOB 4XHQA 1ZTXE 2X4TB 2O6EA 5FLVA 4ELKA 3NTCL 4ABVA 3PJLA 4HLZG 1OSZA 4X5XB 2TSBA 3JVGA 1KACB 2X42A 3NA9L 4PJDF 4IMKA 1B4JL 3TBCA 2IPUG 4GMTH 1ZA6A 3QZWB 5BPPA 4HS3A 1BVNT 1RUMH 3R7QA 3NSXA 5BOJA 1VHPA 2Q86B 3FDWA 1E27B 5C09A 4QRRA 1V10A 2VT0A 2W60B 3QB7C 2UXVA 1GCYA 4LL9A 3NSCA 5JQ6L 2ERJC 1OO2A 4LLQA 1TTCA 4MAYC 5DD6B 2ALWA 3T8VA 3TYGL 1I9IH 4UOW1 4KHTL 4XNYL 3C5JA 4R96B 1N12A 3QIBD 4Y4FA 1ADQA 1RLWA 1XR8B 1U95A 3D1MC 2VKXA 4Z7OE 1WBXA 1IBGL 1TO5A 2MKLC 1A21A 1NAML 3BISA 3CVHB 3QS2A 4M4RB 4N25A 5BVPL 4GRWF 1C7TA 3SDDD 4AXWA 3PYCA 3KCWA 5BW7A 1SYSB 3C5SB 4K5MA 3NK3A 1G7LA 3FHAA 5GGVH 1T89C 5T3ZL 5KSAC 1YYLH 2NCEA 1X5ZA 3IEAA 4DZ8A 4X9YA 1JD9A 4I0CC 3BUPA 4B6ZA 1DN0B 2BINA 9CGTA 1U8NB 4QTHB 2OQJA 2ICWJ 3E1ZA 4HAGA 3UZQB 1MIEL 2CALA 1IL1B 4RBPH 4I0KA 4G70B 3V0AC 4KXZH 3HC0A 3PWNB 2FX9L 2UUDH 3O6ML 5BRZB 2YKKA 1NAKL 1PFCA 3CFNA 1TJGH 2NXZC 1JCKA 3QFJA 4M7ZC 1HJBC 2PR4L 3LKPB 4FFYA 3SYAA 3UL4A 3LIZA 4NP4L 4Z7UA 3CC5A 1V5JA 1IEAA 2EH7L 2YBRB 3QHTC 4ZUTA 4M93C 5F88B 3KR3L 4QXVA 2L7QA 3Q0HA 4G2AA 3ZE1B 5L4FA 3RFZC 2I85A 1IUZA 4FEIA 2WUCH 3PWJA 1GZPB 3LV3B 2H6PA 1ONQA 2YD9A 3H85A 5EF2A 5HTSA 3WIIL 3FBKA 1RIHL 1PG7H 3WTUA 3CSPA 4JREB 4PFEA 2VDKL 3IE4A 4O51B 4Q6IA 4XHJC 1ZJBA 5JIDA 4FTVD 4JLRA 4MWFA 4M8RA 4R2GC 3P69A 1QATA 3HAEB 3EGDA 3Q2VA 3T1FA 1UM5H 4LAJH 1AKJA 4CSZA 5BZXA 2K7PA 2YD0A 1T5XB 1BIIA 2V5YA 3KPNB 2GITB 3GBNH 4N68A 2A1WH 3QULB 4DIXA 1OGSA 5EBMA 4ZQKA 5TK4A 4FULA 4L37A 4I3RL 4UMGA 5CINL 4QXGL 4ETYA 4J23A 1KFAL 1QPKA 4NRXA 4EN3D 5B3JF 3FH8A 3U79A 2D0FA 2E8YA 5DA0B 2VLKE 4N2OA 3L3DA 5IVZB 5KYWA 4FFZA 2W07A 3ARUA 1U33A 3UAJA 3KVPA 5C0IA 3S4SB 4P4RB 2A77H 1D5BA 3UAAA 1NLDL 1MF2L 4ODWA 4X9GA 3MHZA 1KCUH 4JKLA 2VN5A 3L7FB 2VO8A 3QXDB 3DUSA 2R1WA 2BSRA 2G9HA 5DS8B 1MREH 1QFHA 2ZPKL 1OQOA 5LGJA 5HHQB 3HKFA 4A7GA 3TH3T 1GSMA 1XGUB 3V9FA 1LWHA 3P0VL 4NXSA 4PRID 4HGWA 1L9TA 4UF7C 4IBZA 5LNEA 4JFEA 1E4KA 3JWDC 4TV3A 5G4OA 1F2QA 3D09A 4UT9H 1HEZB 3SOBL 3VMPA 1U21A 3V4VB 4K8RH 3TVMA 3LZFL 3P9WB 5AUMB 1DR9A 5I30L 2OZ4H 4K94C 4G8GE 1A6PA 3X3GL 4K15A 1ZV2A 3ARQA 2F7PA 5C6PB 5CCJA 4DP8X 1NBZA 1M71B 2P5WB 4PV8A 3N55A 4PJFA 5BXFA 1N5AA 4YBHA 4BXSV 1AQKH 2WVUA 3U46A 3EJPA 4HK3N 3NAAL 4BSVB 4R7DA 2OYPA 3FK3A 4FQCL 1HE8A 2CDFB 2X1PA 3PUUA 1LO4H 1QFPA 1ZHBA 3GBMH 2WN3A 2GTQA 4MJIA 3DK2A 4CC0A 5I8CA 3MA9H 3MODL 3TNNB 2Z0BA 3F01A 4K5OA 4WGWB 7TAAA 3RKDD 4XO8A 1KGJA 2NY4B 4HSAC 2C5DC 2EYRA 3TZVB 2Y3AA 4M5YH 2XQYG 2IH1A 4W9EC 3GZQA 2R1XA 1I4FA 2MWCA 3MLWL 4ZNCD 4GBXD 5HHMD 1KG0B 1VF5C 4DCQA 2ED9A 3EYFA 4JO2H 3DRQA 3UTSE 4ZTPH 5JPMB 3L7EB 3K91A 1FNGA 2FVNA 3T6WA 4Y2DA 4AYFA 5C0FB 3C8DA 1LO2H 1CLZL 3KPLA 4NWTH 5LKNA 3VFMB 2C7UB 2EDWA 3LNEA 3V7AG 5CSZB 5KSBE 3QQ9D 4PBWD 2CBTA 1EBPA 4FQIH 5ISZB 1U2YA 2X7LB 1E5BA 1TFHA 5D1XE 3KLKA 2HP4A 3VFSA 3QCVL 1G7QB 1TQCB 4YDVB 1Q72L 4GW5A 4ZW8A 1N19A 5EU6B 3QDGB 1MI5D 5DA4A 2X2IA 4WW2A 3KG5A 1S7WB 3G04B 3IPFA 5E9DA 3VFOA 3QEHA 4QCIB 4ACTA 1T1XA 1TTBA 4PGBB 2DRUA 5ID1A 2WOYA 1V7NH 2DQGL 4L2YA 4ODWB 5CS7A 3EH5B 1UOLA 5E2TH 2E7MA 2V5MA 2X3CA 5E08L 3AREC 3WNKA 4IEFB 2YO3A 4IOSD 5FKPB 3WY4A 2AV7A 3S88H 1QACA 2A73A 5DHVH 1NIDA 2QSVA 2WQ8A 1W72H 1JUFB 1GGYA 4LQFH 3LEYL 4HW6A 1A64A 3HS0C 3PGDA 2DL9A 4YHIA 1A7PL 1T5WB 4WEBL 2B4CC 1QLEB 1U8MA 5DMJB 1NAMA 3EF7A 2FYYB 3GSUA 2DWDA 3LQAL 5F89A 4DGWC 4B9IA 3VI4B 4W70A 2UY7A 2BY0A 3WAKA 4U4BA 3H8NA 4AV0A 1MWAH 4YX2H 4TQEL 4N0YL 1IFGA 1NBZB 4DNLA 3BLBA 5BXFB 4ONHA 1TJHH 1FAKT 1QO3A 3QO1A 5DSCA 3KGSA 3U4BH 5GIRB 3QUML 3IB4A 5F7DA 2XZQL 2N01B 4UQIM 1FFNB 2R29L 2Z64C 3X1NA 1EH9A 4PJDE 2WTPA 4C4KT 1KWGA 4QYAA 1NBVH 1WZLA 2F53A 2XFGB 4B9YA 3ZRCC 1GGIH 3QJSB 1OTTD 5EOQH 1RURL 3ETTA 3PNWA 4M61A 3ALPA 4YFEA 1EX0A 1YJDH 4GQZA 5ACZA 4LCVA 4F8TA 4KRLB 1I4FB 4I4WB 3HI1B 1DZ0A 4ZO7A 2AGJH 4MYWB 3VO0A 1W80A 5CEZE 4PJGA 3TO4D 1YEJH 4S0TD 5F1NB 5F6HJ 1QR1A 1NFDA 1BW8A 3HNVL 4RFEB 4JDVB 1DSFH 3APFA 3KPLB 4BZ2H 1U4EA 4GRWE 1IRAY 3HTLX 1CU4H 5KUKA 2WXLA 2JELL 2E7BA 3CFUA 5FCUH 3V0JA 3SYQA 1NCCL 1ED3A 1O9ZA 4NN7C 1Z7JA 5T5NF 4EPSA 4TVPH 3SE3A 1A4KB 4P2RA 3GXNA 4LBEA 4MMZC 4FABL 2KYIA 2YXVA 4D9RD 1S3RA 4DN3L 1VPOH 4Q58C 3B7SA 1TVBA 2CKNA 4O02L 1QEWB 1NCNA 3MV7B 4O2CA 5JZ7C 7FABL 3I50L 3NJIA 4JFTA 4WWKB 2LU3A 3AACA 5G55A 3MC0A 1GW6A 3MNMA 5GGUA 2FBJH 1FO0B 1UG9A 2B9AA 1T03H 4Z3JA 5LQBL 2CA4A 4OLYL 3QFDA 1HNYA 1IIKA 3C87A 5JOEA 5EZJB 3P11L 4ONFH 4H8PA 4OCWL 4TUOA 2BP0A 2D03L 2MQ0A 2VXUH 1IIIA 5D71L 3HI6L 4JPSA 3Q8FA 4AQEB 3O3DA 3Q2WA 1NAMB 1HXMA 3T4AA 1B0RB 5CNHA 1ZPLA 4KHXL 1OK8A 2WLHA 4I85A 5F1OB 3ZT7A 3RZWA 5DJ8B 2PMZA 2BX5A 1CL7H 4BELD 4DESA 3PHOA 4WNJA 1AGBB 4RWYL 1X4ZA 1OF2B 4ZPTB 2VXSH 2K9UA 1XF2A 4PRHB 2DMBA 5I0XA 4G6FD 2NYYD 3O8XC 3VYOA 5C0BA 3EJRA 4APQA 1U6AH 4GUPB 4CVWA 5A3ID 4NZTL 1J05B 3ASNB 3LYRA 2W88A 2RIKA 1JGVH 1I8KB 3MRRB 4FJYA 5JQHC 1AZZC 2VZVA 2NTFA 5EN3A 2MIZA 2ZSWA 3L9RA 5DHYB 5B3JE 2JK5A 4L92A 5BS0B 3MREB 2CCWA 3DHJA 4KJWD 5I0YA 4A68A 4ZNEE 3A4AA 5GHWL 4W1TA 5E7BA 1OP5K 1L7IL 4P23A 2HG5B 5T3XL 4JKPL 3D34A 1SJHB 2HCZX 4I18B 5GGSB 3F7RA 3FUJA 4GRMB 4LP4A 1IE5A 2FH8A 2FYVA 1IGCH 1UGNA 1EXGA 2E9WA 3LDBB 4DN4L 4TULL 3D30A 4FQPA 4TKWA 3SGJA 5AENA 3KGUA 2H1PH 3O11B 4F5CE 4TTDC 4JO3L 3RX7A 3VXSE 4QRRD 5D96C 4HX1A 1JGEB 3L4XA 5K39B 2P52A 1MH5A 1H8NA 3FQUA 3KXFE 4JRFA 5LNGA 2G2RB 3QYMA 4L1SA 3K72B 4UUJA 4ELDA 4NI3A 4ZUUB 5DMIL 1BX2B 3MV9B 3BFOA 3Q8BA 3LS5L 5C0CD 3FT2A 3QXUA 1ZLSH 1U0QA 1FL5A 4A1RA 4GAFB 1XF3A 5DWUH 2A2QT 3JUZA 1F3DJ 2ZCKL 4HOXA 4TN9A 2W92A 1P7BA 4FFVD 5SWQA 5GRWA 2I60L 1A7OH 2XIIA 5D93B 4AWJC 2OMZA 4JM2D 5HYJD 4KVPA 4KUZH 5ABAA 2V7NB 4EXPX 3O3DB 4H88L 3S5ZA 5IP4A 1AI1L 1Q0XH 5TDNB 2VDRH 2HN7A 3WENA 5EDSA 2VW6A 5HDBF 3MXVH 1DFBH 1F58L 4TNWF 5B39A 4IMLB 4PUBL 3CN2A 1O7DE 2BNRB 1YDPB 1RZKH 5KSUA 5CUSL 3O2DH 4LDEB 5GGQH 5IY5B 1PKQE 2WMPA 5K9OA 3SDAC 1C12A 3ERXA 3UZEA 1PLAA 5KVFH 1YMME 3FKUS 1BQRA 3FT0A 5CGBA 3QJRB 2DF3A 1VFBB 2P46B 4KO5A 4LOUC 5I8KL 1PJ9A 1IM9B 4K3DL 4M6NH 5EZIH 4F1SA 5L7XL 1ASOA 3TBSB 4LSSH 2QMJA 3O3AA 3QWNA 2V2XB 2ATKA 5I82A 2Y3NA 4KKLC 5T8IA 3WUZA 2F58H 4ZK8A 3HA0A 2CMRH 1HH6A 4ZMOA 2DEYX 3QUMA 5I17A 2A9NL 4DGYL 3OBAA 4OLWL 4ZX5A 3VI3A 3WFHA 2R29A 1MIML 3A6BH 3NRQA 3MU3A 4GS7C 1IC5L 4LE8A 4G3YL 1BXUA 2K6YA 5D7LE 3HE6D 1CLVA 4HP5A 1T66C 3WAJA 3WTTA 3ME0B 3CFKA 1K85A 5DMKA 1SFHA 1N9PA 1JZDC 3QRBA 1AFVH 4H8QA 4PJ8B 5AKVA 4TPRL 3VWKA 2J1WA 1WS7A 4LB8A 4NYLA 4NRYA 3T6VA 4ODVL 5KJ4A 3WUWG 2FL5A 2I24N 3KYMB 3NACH 3ILQC 1QRNA 3LPOA 4LSVL 4Z78B 4U1SB 3MLVH 2JTDA 4YHOL 3T71A 3O9WD 3CXDH 3IDNA 2ZP0T 3FN0H 2ORBH 2Y2WA 4UUJB 4KI5F 1CG9B 4DQOH 1K4CA 1BAFL 4YHKL 1MEXL 4IRZH 1VA9A 5JMOC 4QRQB 5F7EL 3V4LA 3G6JF 1Y7VA 4YGVB 1YQVH 3FOMA 1J1OH 1UFGA 1A7NL 2BVQB 2J21A 4R8WL 1A14H 5AVSB 3T0VA 1PG7X 3AB0B 1YN7A 1CC3A 4UM8B 2D7PA 4O02A 5D1ZB 4OZHB 1KB3A 1RUAL 2C9QA 2H6OA 3KS0J 3PV6A 4Z7VA 2HT4C 5IVXB 3WL9B 1UOVA 1Y1DA 4XPFH 1F13A 3CUPB 4NQDB 5HGDA 2NRDA 4E9SA 1WZKA 1DJSA 1E65A 3IRZA 3BUIA 3E6FB 4L3EE 2AK1H 4XCEA 2JI2A 4A66A 3IJ9A 3TOPA 4DSYA 5BV7C 3FF8A 1PZSA 2Y0SA 3KLHD 3INUH 2DKMA 1M7IA 2GUOA 3ROLA 4ODUB 4W9DC 3BP4A 4Y5VA 3ARFB 1U3HB 2ITDB 4CVXB 4JFDA 4E0RA 1SHSA 2ZOKA 4RRPM 2EEFA 5ILTH 1S8DB 3MBEA 1VB9A 1YUKB 1NDGA 4BXVA 4NZJA 3OLGA 1CURA 1UM4L 1JHKL 1P7HL 2YZ8A 2R56H 4ZS7L 4F37F 3QSKB 3H42L 4N4YB 1L9MA 2IH3A 1MJUL 3QIBC 4LSRL 4OKDA 5DHEA 4AL8L 3RVUD 1L0PA 3ZO0A 2YUVA 2VC2L 4N9GB 4JPWL 1XGRA 3CH1A 1QLRB 1MLCB 4XPHL 3SDDC 1ZLUH 4FNLH 4X42A 4UTCA 2VL4A 3O2WL 3T0XA 3ABZA 3QJUB 4MJ6A 1RIUL 4K9EH 4PS3A 5HVWA 3OJ2C 3OD3A 5CJOL 3FNKA 2WINB 1U8CA 3MRPA 3HRPA 5HGAA 5GRJL 1AHWA 3ROOB 5K9QI 1F11B 2Y1VA 4TNVK 4HCIA 4YC2B 1R4XA 2R0KL 5I18H 3P9MB 3WJMA 1PZ5B 2MKWA 4EVNB 2EXSA 4EUPH 3WEXA 2F0CA 5E9DD 3MO1B 2CHNA 3IXTA 4W9ZA 3CDGB 5I8EB 5DFTA 2IGLA 5LUMA 3KPRB 3HRZA 3WN5A 3ZTDC 4ZX4A 1CXEA 2YEVB 3MBWB 3CN1A 4NO2B 4OT1H 3IF1A 4Z6AT 4OJFH 4MFHA 2NY7L 1GS6X 1ZLVK 4Y8AA 3SO3B 5CZXD 5JOFA 1FL6B 3CDZB 4Q0XH 5C0AA 5G5DB 4JKKA 1S7RB 1BLIA 43C9A 4UQ3A 4PWIA 3DI3B 4AC4A 3VWJA 3I75B 4JN1H 5HBBA 5DZPA 5DQ9A 4AYEC 4NHCL 2YPLA 3MN8A 1OD9A 4KPHH 3QA3A 4Z7VB 1ASQA 4L3AA 1J8RA 4KY2A 1JPFB 3HZKB 1DVFA 3FONB 3LQZB 4TVPE 12E8H 4D0DA 4M00A 2XV3A 3IDMB 5CBAA 1RZJL 3EFFA 3QAZC 3SPCA 2X9WA 1DQDH 3UG3A 2NYZA 4HFWB 2ZKYA 1EJFA 2J88L 2B1OA 1OOAA 5JXEA 5T1DH 3ZZQA 1INQA 4WU5B 4FZ8H 2QEJA 3E2HB 2VCOA 4WI4A 2IADA 3CK0L 3DPBA 4HV8B 1LHZA 5HHXL 3D0AA 4NQEE 1N0LB 4EN3C 1KF9B 3IK2A 5AVXB 2C4FU 1ZSDB 2DH3A 6FABL 2P5EB 3PE9A 1J1XL 1GGTA 1UWXH 3ARDB 4HMCA 4M8QA 3VDCA 4PJIF 1OGAE 3BC9A 5LGHL 5DJAB 1IB5A 4YXKH 3BP5B 4GB9A 3FQ4A 4P4KD 4HUVB 2BIHA 3CMOH 3PNRB 2MQCA 3CH1B 2P28B 3WIFA 1BYNA 2VMFA 5EOCJ 4NPYA 2X41A 1QOKA 2DQUH 1AGEB 2IBGA 4JHUA 5J4MA 2J8UA 1P5UB 3B83A 1R3IH 4WI8A 3TESA 4HK3J 1TSRA 2X6CA 5TPWL 2Q8BH 4NKIL 1KENH 3O4LA 1HESA 1FVDB 2WAHA 1EO5A 2NNCA 4Z5RB 1B2WL 3H7BA 1IX2A 2EINB 3N41B 5ENWA 3TH4T 5ELIA 3QCUL 1SN2A 4W6YB 1YEEL 2AEWA 2YK1H 1E9OA 2YRBA 4G82A 3MROA 5B7FA 2JTYA 4U3XA 3IN0A 4L1HA 4V33A 4CMMA 3LEXA 2HUHA 2OL3B 3L5WB 3L2MA 3QUKA 3ZKXC 1INEH 1PNCA 4WTQA 4F57H 3JWDH 4NC1C 2AJZA 4YXHH 1TZOA 2YD5A 3NJFA 5HDBE 4APXA 3NCFB 2BFGA 1SYVA 1OCWL 1WITA 5I1HL 1FNEA 4S1QL 5IB5A 3DYPA 4K94H 3BKYH 3MLUH 4W4NA 3CNKA 1THAA 3QYCA 3FB6A 1HZLA 4LCCB 5JW4R 2MTPA 3MLSL 4P8QA 3RKDC 2MOQA 3UO1H 2YC1B 3QZOA 4N0CD 3P9LB 1ZIBA 3K3QA 3U9PL 1ETZB 4KNQA 3V0VB 4GBXC 4JFOA 3MNWA 1P7QA 1CMOA 4EMZA 4MMXA 3QIWB 5J11B 3LPGA 2P7TB 4XC1L 4HXAL 2WLJA 5DTFB 1WFJA 5J3HD 4LPYA 3CZSA 1PPIA 4XB7A 1IBDA 3QQ9C 4U1JA 3CVIL 5FUOH 1DJGA 1KJMA 1W91A 2WCSA 5GS1C 1I3VA 5C1MB 3TV3L 3VXRD 1P4UA 4APQD 5HVHC 1BEXA 3REWA 3FU8A 1C1EH 1J12A 3CSFA 2X9XA 2V2WB 1BBJA 3F5WA 4AQZA 4L3FA 4P57B 3E6HA 2GT9B 1MXGA 3V9CA 3CFJA 1QBML 1I8IA 2IANA 2ZXEB 3GMLA 5DO2C 4OLXL 4I5BB 2EDFA 5FB8B 3JQOB 3NZ8B 4NM8L 4BGDA 1KJ3H 1NMBH 4HPHA 4ZI8A 4KI5E 1RJZA 4OZFB 3VH8G 1IE4A 2X87A 3QDJE 1ROCA 1Q9WB 1E67A 4F1ZA 1JNLH 1D5MA 1KTDA 1YMHB 3P30H 4X7TB 1H15A 3G6JE 4YHMH 4BZ1L 1M7UA 2H1XA 4JG0H 4M6OH 1EPFA 3UGXA 5JHLL 4KX8A 3FQ2A 3DX3A 1BWWA 2BMKA 4EKXA 2BVOB 4U6YA 5F1IA 3GJEB 1WTGT 1B88A 3PFUA 1ADWA 3LN5B 3TBWA 2HFEA 4NQSA 4ZUSA 4DH2A 2JKSA 4JVWA 5KVFE 4CC4A 3Q8AA 3MSPA 3ML9A 1G7MA 1QSEE 1TEYA 5CHNB 5CIPB 3WIHL 4ZFQA 3BX7C 3B7UX 4MD5B 5ES4B 1BJMA 1M1XB 2YGNA 1T2QL 3IKCA 1R46A 4PN6A 4APXB 4L1TA 1GYAA 4C59B 1QNZL 5ECGA 2CGYA 3BO8A 1S9WA 3DIDA 4MNGE 3VXQB 4QRUB 1NUFA 3SDXA 4F9PA 5F7UA 4DKEH 3WTXA 1B6UA 1OL0A 5L0QC 5DRWA 3BIBX 3P3RA 2G9KA 1FNSH 3K6SA 4DVBB 1J5OH 1MFCL 3K6DA 3LRLA 5GJSL 3HS9A 4TLTA 1LDPH 4X0KB 4HZLA 4PWJA 4POZD 4U6VH 2HRPH 2FJFA 3DJSA 3NFPB 2Z31B 4P49A 3TO4C 1XIWB 3PWPD 5F7FA 1SDDB 4I3SL 1LO3H 2DQCH 5I1AB 3IKKA 4F3FB 3D4ZA 2VXVH 4Y19D 5HDQH 4YQXL 5A6MA 5FYLH 4YEEA 4ALAL 2J5LB 5C08E 3NABL 2XG4A 3G5ZB 3GYRA 1A6UL 3EJZD 1NC4B 2FHCA 1S7SA 5ETUA 5HI3C 3QDMA 5HHVH 2AKRB 3E80A 4ZZKA 3ZMNA 4M3HA 1K8DB 1HHIA 2HKAA 4RDQF 4QXWA 5DZ9A 5I6XB 1EHLH 2WYZA 4U7SA 5DJ2A 3TV8A 2I32A 5F6IB 1UVQA 1D6EB 2BO0A 1A47A 1JGLL 4OI8A 3DRTB 1T0OA 3IGUA 4AEHL 2D4DA 5FPIA 4GQRA 2P26A 3BSZH 2O6FA 5KW9H 3PL6B 2JXMB 3QXVA 3MCLL 3PP4H 3ZX1A 1TQSA 4FXKA 5GSVB 5DURB 3BVVA 5K1NA 4U4IA 3UTQB 4H44C 3MV8D 4IJTA 1LNUA 4B27A 1WT5C 2GJJA 5IBTL 1GGCL 3IDUA 4IS6A 3VWKD 5DUJA 3EO1B 3FUMA 2CUMA 3NCMA 1A3ZA 3FO9A 4N2MA 5D4IA 5D7JB 1E8ZA 4R4BA 1F56A 1QRND 3W0WA 1UB5B 4GAYB 4Y16A 1M57B 1T6BX 4KRPB 1E4WH 1LDSA 1JF5A 5C97A 3IGKA 1N7MH 3S48A 1VERA 3D3VA 3LIUA 2NYYC 5I1CL 2EDYA 4U1GB 1BVLB 4NNPL 3S35X 4XBPB 5E1IA 5A3IC 3MLPA 4P2YA 4Y1AA 5ECJE 1IGTB 2AJVL 4JHWH 5AW1B 4GMSH 3T3MF 1P7KA 3OAZH 1HYSC 5IMKB 3C6SA 3FU9A 3L1EA 5I1IH 4LSUH 5E1HB 1XVSA 3R4RA 3ETBJ 3OLDA 1IFRA 1U8KA 4MA1C 1TVHA 3HLAA 3ZYOA 4X6EB 3IDYC 2BJML 4IDJL 3BUYB 4PVNA 1XV8A 1TDQA 5IM7A 5GGRY 4GAGH 5HYIA 3WIAA 4AW4A 1TJIL 2GTWB 1WCQA 1GZQB 5GSRB 1YPZA 3KHQA 4PJIE 4DWHA 2HFTA 3D0LB 4JFZL 5DC4B 3JSSA 3O2VH 4GSDL 4LXFA 5ADOL 4GUQA 2OSLB 3AG4B 5FYKE 4KXBA 4GKOA 4DEPC 3PAUA 2AQTA 3ZDXB 2X4SB 3B9EA 4Q4IA 1KCRH 3UC0H 2XY1A 3O6KH 4OCXL 1REIA 1JZ3A 1WSST 2W81C 3FUFA 4ODTL 2OXHA 4HWBL 4K7FA 1AQ8A 4MXWL 3UJJL 4GEIA 2C4FT 1S7SB 4QHMB 1H8SA 2FSDA 4PGEA 3NEEA 5SX5H 1T04A 3NCYS 4XBGB 1MCPH 3BESR 1ND0B 3D9AH 3L9YA 3MLYL 4IKIA 2E56A 4ZOAA 5F7AA 5HY9B 2VZ1A 5C92A 1QVOB 2X53A 1UD2A 2XIBA 3T6ZA 1FORL 4L8CA 4YE4H 3RDTA 5J1AB 3IJHA 2BFVH 1ODUA 4Z3EA 3LSOB 3KD4A 3N91A 3DBSA 1SGKA 2YR3A 2GIYA 4WJ5A 2IFFH 2FB4L 5BW7C 5DK3A 1QBLH 4ZSOE 3T2QA 3OF6D 4BFBD 2XTJE 4LCIL 4HJJL 1YNLH 3SE9L 4HAKA 2FQEA 4FFVC 4RFOH 3RUGF 1DVUA 2BXYA 4GKNA 4GG8A 1SN5A 4PIRF 4X9HA 5T1KA 1HI6A 4JM2C 2P5PA 3VXOA 1HSAB 2Y69B 1MJJB 4KO6A 1H0DA 1DUZA 2ZE0A