2BSDA

Structure of lactococcal bacteriophage p2 receptor binding protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
254
Chain Sequence
TIKNFTFFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcal Bacteriophage P2 Receptor-Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Enterobacteria phage p2
molecule tags Receptor
molecule keywords RECEPTOR BINDING PROTEIN
total genus 60
structure length 254
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bsdA02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2bsdA01
2BSDA 1ZRUA 3D8MA 4IOSA 4L92A 4RGAA 3EJCA 3HG0A 4L9BA 2WZPA 4RGGA 4HEPA 3U6XA 4L97A 4L99A 2F0CA 2BSEA 4HEMA 3DA0A 2X53A
chains in the Genus database with same CATH superfamily
4EI5D 1AGCA 1IJNA 1S8DA 1NGYB 1GGTA 3KVQA 3SJVD 4EOWL 1EBAA 4N5UA 3RX5A 2X1OA 2R4SL 4WEBH 3EO1B 4LOUD 4X0NA 3HC3L 1BYPA 1EFXA 2VW6A 3KAAA 3W82A 3V4PL 2B1AH 2EEFA 1KWKA 1HT6A 4GQ9L 1N12A 3ZU8A 3G6AB 4PGEB 2Z7WA 1ETJA 5ITBH 1OLZA 2VDPH 3DO4A 1KMGA 3GBDA 1I3RB 3AS2A 4E5XA 3GBEA 3MRIA 3LKRA 4WWID 2GFBA 4PIRF 3TV8A 4HPYH 3VMNA 2WBWB 2VXQA 4NXKA 1YAZA 7FABH 3K6NA 2B7DT 4I18B 5AVSB 2WZ6A 5IEKB 3CU1A 5C0BB 2R39A 3F01A 3CFCH 4R7NB 1CLOL 4FE9A 3K0YA 4ZW8A 1QBML 1TKWB 4S1SL 1PNCA 1X9UA 1YYLL 2AEQL 4N26A 1JWMA 4XPHH 4YPGB 5DFAA 1K3IA 3ZDXB 1OV8A 4AOFA 4Z7OF 3DROB 3LRSB 3ZO9A 4ECNA 4NO3A 3TBSA 2IMNA 4MQ7A 4UUJA 4A66A 3K4DA 4EKXA 3UTSB 3LHPH 4JHZA 3QJSB 3CFDB 4JRYB 1T66D 3A6OA 1S7WB 2VZ3A 2J5LB 2VQ1A 3I2CL 5B1BB 3DOHA 1MREL 4NKIL 3LMJH 4QI3A 2W59A 2L04A 3CZGA 2R1YB 4ZXBC 4AT6A 4HG4J 2BWDA 1TU2A 3VMOA 4XCYA 2OK0H 4JPVH 4X4KA 4KFMA 5CMAA 3ARED 3TBYB 1JZ4A 5I0WA 1JV2B 5LKNA 2P5EA 3FTYA 1C1EL 1I7UB 4GAAA 4PP2A 1KXVC 1XSIA 5JIDA 4N6RA 4UMGA 1U8OB 2GPZA 2DRUA 5D1XE 4ZOCA 4R2GC 2EKSB 2ENSA 1BGXL 4X42A 5F7UA 4BFIB 4G7QB 4IYKA 3HA0A 3QXWA 4L99A 1A7PL 3U0WL 2GIXA 4WUKH 3WIHL 2G0KA 1F58H 2Z8WC 3VRLE 4O9HL 3U4EA 1EMTL 4HD9A 4JL1A 4KI1A 5AW2B 1L6PA 3QUZC 2IBGA 1Q90A 2O4EA 4RMBA 5LWYH 1DUZA 5C0AB 3D85D 1HAUA 4LCWD 1KTDA 1VSCA 3KWUA 4Z3HA 4IU2B 4EUPA 5H94B 4IRJD 4JFPB 4WFHE 5JQIB 4EOWH 1H6EA 2LFEA 1IGTA 5KYWA 3T0VA 4NO5B 3U1SH 3QXDA 4DKAA 3U83A 1IU1A 5H35B 1LDPH 3TZVD 2YPLA 1EEZB 1KG0B 2ZCLH 1AOHA 1A9EB 1BYOA 2CWRA 2R2HB 2N59A 3D30A 3PGFL 3UZVB 1G7PA 5DU7A 3T65B 4P46D 5GS0H 2AP2A 2XC8A 1NCJA 4YOKA 1MNNA 5HHVL 4NKQB 4ACTA 3CFKA 5HGBB 1BEYH 4HP5A 3UTQB 2ZKXA 3D08A 3N42F 3ZRSA 3TIDB 2EH8L 2Z93B 4JRXE 2IANB 2ZCKL 4WFFE 1PMYA 4AGOA 3S8GB 3HNSH 1S6NA 3B2UC 4UT7L 5EOQL 3IFLL 1S3RA 2ICES 2C1OA 4ABQA 1KPUA 2LFGA 2XJLA 2HKHL 2ED8A 1ZXQA 1CF8H 5JW4Q 5T1KA 1S9XB 4KK6C 3MLSL 3CFKB 5HGBA 5HI4C 3ATBA 3L5WB 1RERA 4QHNB 2HLAB 5EU3A 4KZEL 2MKLC 3P2BA 4H1LA 2BNRE 1XEUA 2CRIA 4I0CC 4XPBH 5CZXD 1GXEA 3BDYH 2GAZB 2W1NA 2AEOA 3EJSA 3OMNB 1G7MA 5D70H 2J8UE 2NNAB 4NLHA 1A4BA 1K3ZA 1YNLL 1CGSH 1KV3A 1OVZA 2APWA 3NP3A 5DJ0B 5KOVC 3IJHA 3S5ZA 2V7NA 3ZZQA 5IVNA 4YHLH 1CYGA 1JNLL 1T89A 2F74A 3PPSA 1T21B 2LTQB 3ZDWA 5EO9B 1EERB 1DANU 1YN7A 3QNYB 2QQLL 1P4UA 4AUJA 1FZJA 3RWJA 1S7QA 1UZ8A 5A40E 4LSRL 1N5YH 5C0BA 1HHKB 4HUCA 4H8HA 3D3VA 1N10A 2AXJA 5EMYA 1BW8A 5DVPA 1MZYA 1NCBH 1ZGLB 1UT2A 4NKDB 1OTTD 3GKWL 3BUPA 3HNVL 2XLLA 3PPEA 4APQD 1AHWC 1HIMH 1X9LA 2C9VA 4MNHA 2DQCL 3FUHA 2OMUB 4GB9A 2WGNB 2XIIA 4PGBA 3H9SA 1MRFL 5L2KB 1LEIA 4HAFA 1UZ8B 1THAA 3ZE1E 3NEXA 4ZW7A 1XH0A 3GHBH 4X7TA 1JNHB 4XBEH 4N90D 4JNXA 1JPGB 2BIPA 5D7KD 3GRWL 5MEPB 2R8SH 3MA7B 1PX3A 1XR8B 1YEIH 5AAPA 3W38A 2D03H 3GO1L 1GYWA 4W9IC 1JI2A 1YMHB 4XO3A 3BAWA 1HEZA 3WTYA 3O4LB 4Z7OE 1VFBB 2R1XB 2CHXA 1P1VA 2F9BT 1KBGH 4JZNA 3IMTA 1ZMYA 4JFVA 4KZDL 3GNMH 4K8RH 4AGQA 5D2NA 1N26A 4KTGA 2JELH 3KYOA 1NBZA 4LSTL 1QPXA 3FUFA 4IBTA 3RUGF 2P9RA 4D8PB 4L8CA 3JWDH 1O6SA 3LV3A 4RFNB 5DD0L 1NCDL 4J3OD 4QHMA 5IBLD 4O2CA 1JPTH 1KV7A 3G9AB 4F24A 4PVMA 35C8L 2Z31B 3WIIL 5LCVA 2DTMH 3VJ6B 4N87A 1F4XH 3WXWH 4LU5H 3DX6B 5KS9F 1I9JL 1G7LA 3ARDB 4X4ZA 4AQ1B 2H3KA 5IMMA 3L17A 3AJ7A 4P2AA 2YD8A 1I3GL 4MD5B 2ATPB 4OUUA 2UZYA 4PJAB 4Y7MA 1EDHA 5GPRA 4JRLA 4QRFA 5EUOF 4NO0B 4PP1D 3V6OC 2J1KA 3L9EA 3O0RL 5FUCC 4C56D 4ZI8A 1NGWB 3EOBB 4OVUA 4ODWB 1KENL 3BISA 1GC1H 4Y1TA 1TYJA 2VDLH 2X4RB 3KCWA 5DK3A 1RUQH 1J10A 3GLZA 4ZD3H 3JTTA 4UV7H 4GQQA 1EX0A 5EUOA 3SYCA 4OJEH 1I1YB 4X98B 4NUPA 4HFWA 4YHPB 3C5ZD 3T8VA 5KAQG 2AQ3A 3D9AH 5FC9A 4OZIB 3BKYH 1ZV9A 4NZFA 3MRBB 4M7KL 1GTFA 5HHOE 5BPPA 5ALBH 3BLBA 3WLWD 1QNZH 1HESA 2XV6B 3OAZK 5GGVY 1XCTB 2W92A 1BVKB 4XCCL 4LQ1A 4PD4J 4R8WL 5ERWB 3ZHDA 4ZFGL 4KV5F 2BSCA 3CMOL 1J86A 2I5YL 4QXVA 3REVB 4I0PB 1EZVY 2XZAL 3A21A 4EN3C 1ID5I 3KLDA 3GLEA 4GSQA 2WLIB 2WXGA 1YNTA 5E6IB 2CXGA 4NZUH 2YWZA 1ASQA 1E6JH 5FYLL 1BVLB 1KN2L 1MJUH 1CYXA 2CO2A 3WNNA 4ZRGA 4BH7B 4LCCA 2HJLB 4U1GC 4CW1B 4S11A 2HKHH 1MZZA 5DURB 4M7LH 4FQQA 3FUNA 3QUYA 5E0QA 1TQCC 4XX1E 2CRMA 1X9QA 2EKJA 3T2PA 3BCDA 3QSKB 4X6FA 3AU1A 3P11L 1A7NL 3MJ7B 2Z31C 1B6DA 2LQRA 4JN1H 5BNXD 1E40A 4CKVX 2WQVA 4AJWA 3KW8A 3MLUL 4FMKA 1R0AH 7PAZA 3O3AA 1JGLH 4PG9B 5BMFH 2APBA 3QG7H 1O7SA 3QNXA 3DJSA 2VDOB 4H25A 4LASH 5I1LB 3UTTE 5AWNH 1SXCA 1XR9B 1I8LC 1WS7A 5F1IB 3CIAA 1FGNL 5M95B 4M3JA 4PLNC 4PJ8A 5DUBA 1L6ZA 1QI4A 4JZOA 4JDZA 4WTXA 1MEXH 2HX7A 1FORL 1WAAA 4P2CG 4PU2A 1YAIA 4FABH 2GHZA 4AQAB 2E56A 2MNUA 1FL3B 4XP6L 5GGSY 1Y1DA 1JAEA 2WWOA 1B4TA 4UTCA 5DJ6B 2PNDA 1M42A 1HCZA 2R2BA 4GO8A 5DMJB 2LVEA 2IQAA 2WIMA 3NN8B 3HG4A 1G7IB 2KERA 1Z6JT 1FZOA 1U0QA 2YPLE 1OCZB 4XO5A 5DYOA 3SDAA 4RRPA 1FNAA 1RJCA 4DZBA 4ODUA 4KRPB 2V37A 4MJ6B 4R83A 5IT2H 4TQEL 2VR9A 3LEXB 2JJSC 4X6DA 4OCYH 2FLMA 5IROA 3KPPA 4ETQB 3NJMA 2MQCA 1PAMA 3D5OF 3NIDB 3F58H 3TN0C 2NNFA 4WO4A 3B2VL 1K8IB 1VESA 1QLEL 2YD4A 4GW1A 4MXVF 1M7DA 4PJXE 4YE4H 2AXHA 1XF3B 4P5TD 4B9IA 4BSWB 3HJEA 4HK3N 4MBOA 1THCA 2GK2A 3KVDD 2WM0A 2Q86B 4G42B 1TTGA 3WFEH 3JZ7A 4L9DA 2NY1C 4LSUL 1AGDB 3U9WA 2CGRL 3DA0A 4YDIH 2V3DA 3TJHC 2J8UA 3F3HA 4NQCE 5JW3L 2X7LA 2I7SA 4FXKB 4EI5B 1VERA 3WL9B 5B4MD 4M9OA 2R27A 4F15B 3RB7A 1DDTA 1CFVH 1ZD6A 1GW0A 1VFAB 1AHKA 5ICYA 1MDAA 3AZUA 1A1MA 2R69H 5G4OA 3HB3C 1XTMA 1EEYA 4Q6YA 3IDNA 3K2MC 4WIQA 4C58B 1FYTD 2WQXA 1OLLA 3MFGB 3GM0A 2J12B 3IPFA 4DOHE 2XFXB 4KAQL 4OF6A 5FYKD 3P0VL 2UZXB 4Q74A 1SHMA 5C0BE 1F0LA 4OIIL 2A99A 1R47A 4IS6B 1IIKA 1KCVL 4KK5D 2QV4A 5ESVB 2HCZX 4BCZA 4G7YH 4OF8A 1AO7A 3LZFL 4HJUA 2B1AL 2OX5B 4J3OG 3EOAA 5AYUL 2XA8L 3UC0L 1A6UL 2B20A 2E7BA 4LVOC 4R96A 4P5MB 3GZOA 3EFFA 3W81A 2OS7A 3BKCH 4BK4A 3LKRB 2WD0A 5I1EH 4K5MA 3CXDH 5CHNA 4KROB 1MLBA 4ESKA 1WFNA 1GJUA 5C0CE 4PYGA 2Y22A 4J6RH 4XBGA 3KPLB 1ETZB 5ADPL 2JE8A 4LHUB 1JZJA 2W65B 4GAGL 5TH2A 5DD5H 5AB2A 3UBXG 1IZKA 3PL6B 2ODHA 4X8GA 4UQ2B 3HZ3A 4WO4B 4MXQC 3GDBA 1O0VA 5CBAB 5DUML 1F4AA 1MWAB 1QSEB 5BOZG 5HGHB 1CO1A 3L4VA 4JPWL 3KPOB 3G04A 3FZUC 3PNWB 4W4OA 4YL9A 3ULUC 5TPWL 1ECZA 3P4NA 4NQEE 2ZOLB 4GRWF 1AC0A 3AMKA 4BFIA 1BBJA 2RACA 4OI8A 5IFHL 1PZ5A 1IGJA 2J73A 2YEVB 4HHWA 4I2XE 3O3DA 5F3HB 3SE3C 2X6VA 4W4OC 1IAKA 4FC3E 4TULL 3O9WC 5EBMA 3RKPA 3IWVA 1MFEH 3OMAB 4J6RL 4G6FB 1E67A 4F93B 1EHLL 4AIZB 2IH3B 2ZD0A 1U8JB 2H7WA 2P7TA 5GGRA 1FE8H 1KIUB 1S46A 4L5FE 5CEZL 3M07A 2UUDK 5KYYA 5IIEB 1QO3B 4K3EH 3ZDYF 5IB4B 2Y1ZA 1PZUB 5CZVH 2Y72A 4L9LC 3FT2B 3AT9A 5G5DB 2G2RA 5BS0D 4YDLC 3I9PA 4N2KA 1ZSDA 3P2DA 2VLLA 3HZKB 4JFOB 4KZ0A 4G6JL 4L9LA 5DFTA 3GF8A 5DHVH 3ME0A 1OP4A 1PG7H 4M8QB 4PRBA 5CEZD 1VDGA 4UV4H 2APXA 3QA3A 3KPSD 3V8OA 4DETA 1XGRB 5HHOA 2QQKL 4JRXD 3MRHB 4A7SA 1P5VB 2G9HB 3FT0A 1C5DA 2VIRA 2OCFD 3VUAA 1U2CA 4PGDA 1QSFA 3LS4H 3TL5A 3VXSE 1NCNA 3EOYG 5EBWA 4POYA 1N5AB 3MJ8B 3KWVA 3ZYIA 2KZBA 4HIHA 3RNQA 4NM8L 5J6SA 4YSCA 1WBZA 2EDQA 2OTUA 3DV4B 3OM3B 4JW3A 5F9DC 5GJTH 3J27A 2VDKB 5SX5K 3MRMB 3N9GH 4I9WD 1WFJA 3MLYL 2DLFH 3PL6C 4G43A 5D5MB 3LRLA 5DTFB 1KCKA 1ZANL 3WSQH 1KELL 1YA5A 2UYLB 1PDKB 1LK3L 2H41A 3IS0X 2DOCA 2YJQA 1LEGA 3GMPB 4N68A 3OKMB 4XP5H 4ADGA 2ZP8A 3G6JF 2VDQB 3P0VH 25C8H 2QKIA 4HH9A 2P26A 2RR3A 4QUOA 4WSGA 5TQ2L 1CDUA 4ZS7L 5C6TH 3SBQA 4L0PB 3KE0A 4OSUL 4B53A 4JUTA 1MJ8H 1INDL 3Q2VA 3T4YA 5MEPA 1JWUB 4NNXB 4ZUVA 2O5NA 5J06A 3Q8EA 4G9DA 2CR6A 2ZNXA 3CZFA 1P9MA 3DX1A 3O9WB 4KITB 1I1FB 2ZG1A 3CG8A 3G04B 5HHPB 4WWPA 2D7OA 3DDFA 3FTZA 3O2DL 3ZSSA 1UXWA 4JZOB 3ELAT 3Q9QA 4NIKB 4Q4IA 5J5EA 4L8SA 4Z7NE 5DD6A 4KKLC 2H2PC 1XR9A 3CH8A 1IC4L 2PW1A 4YDVA 4WI6A 5E8OA 3IMSA 4Y19A 4DP5X 2F74B 2R0KH 5FHBH 3RWHB 4IBVA 3ARPA 1T66C 1WZKA 2ZP0T 1YRKA 2XYBA 3GMMA 2D0GA 5IW1B 1I7TB 4NPYA 4MWFB 2WYHA 3DVGA 1DL7H 3R18A 4JHBA 5D1QD 5FOBA 5GRUH 4OV5A 4IOSD 4LHUD 5F7DB 4Y9GA 3WIFA 4JCWA 2AC0A 1I8KB 4N0UE 2XZZA 4PYHA 4TYUA 4X9BA 4JO5A 1W0WA 4NPJA 5E8OB 4HIXH 3GXDA 2TSAA 3SYPA 1XZWA 2FJGA 2GJ6D 1RUKH 4OZIF 1TCRB 2HFEB 4Y2DC 2BDNL 2HLEB 2Q1EA 2W81C 4LEBA 2XICA 3VXUA 4X6DE 3GPSA 1QRNE 1XF4B 5I8CB 4FDWA 1ZHKB 1J1OL 3CPLB 1RUAH 1GY1A 1ZE3C 2GITA 4ZUWA 1ED3A 2E9JA 2FO1A 5CJOH 2JJTA 1IAKB 1D5ZA 5E9DD 3WS6C 1UWYA 2J44A 5AD0B 1QFWL 3MJGX 3FCBA 1JZDC 1OAUH 1AIFA 3UCRA 3NFPA 4LLDB 1DVSA 4XXCA 2QLVB 4RMVA 2WLLA 4LMQI 2EDDA 4YDJA 5DWPA 1U3JA 2NUTA 4Q6KA 3L9YA 5E1AB 2V8MA 2C3VA 5ALCL 4AEEA 2D0FA 1J7VR 5B3JE 2YMXH 4F20A 4FYRA 3F7RA 4JHAH 1SLXA 3IETA 4G42A 4OZGF 5BVPL 3PP4H 5HHOD 4BFOA 4OJFL 3GRGA 3KL5A 1CURA 2JTDA 4ZX6A 3CQPA 4FNRA 4ZMAT 1TZAA 3QWNA 4NCC1 1HINL 4NX0A 4PY7B 2BOCA 4LP8A 4LCWB 2WANA 2YRZA 1P5VA 2G9HA 4N0FA 3FO1A 3GUTA 1GZHA 5L7XH 2P8PB 4K8RC 4PRNA 5I6XC 3KLHC 4ZW6A 4MA7H 4F5CA 4ZQKB 5KBMA 2ADGA 2ZSWA 1X6LA 2H6PA 4MCYA 5CLXA 2JQMA 3ZYOA 1BFSA 4UB0L 4QTFA 3Q8BA 1GGIL 1RSYA 3DV6A 2BPBA 2X4TA 3U4BH 3ECBA 4HXBL 3B2VH 3EDKA 4I77L 3FQRB 5CCHE 5DJDB 1I1AC 3JVGC 5KS9A 2Y1VA 4XP4H 2NY0C 2CO1A 4MYPA 4K5PA 2DQFB 5DLML 4LSPL 5F88A 5LBGA 1MCKA 3H85A 4GUOA 4IGBD 4M56A 3LS5L 5ITFA 1AXIB 3TN0A 3P73B 3M88A 4FQCL 2OSLA 4KHTL 1S5IL 1VKXA 1L4IA 4KO5A 5JA9A 5GS1B 3BOVA 2X10A 5C0CA 5DSCA 3IDJB 5F72S 1WIUA 2OKMA 1FN4A 5KS9B 3QUYB 4NC0B 3ZE2F 2PLTA 2WMPA 4DNLA 4P0DA 2VLJD 4NZJA 3PWPD 2YD2A 3P9MA 4ZG1A 5D4IA 1BFVH 3T0DA 1A1NB 5EDXA 3OHXB 4I18A 1A3RH 2FEEI 2MCG1 4Q2ZA 1LHZA 2F19H 5D6DA 1X4ZA 4FFWC 1UOLA 3IJSA 4Q58C 5FDYA 1DQQA 1KYFA 1ORQB 3HCVA 4Y16A 2ILLA 5E5MA 3ISWA 2X38A 1S9YA 2E9GA 2ESVA 1JRHL 4GRWH 3RVVC 4WU7A 4M93C 5HHNB 2IAMD 2E27H 4X83A 2NUTB 1R5WB 1PZ5B 2NZ1A 3K46A 3SDXE 1BDYA 1HWWA 3HZYB 3T9WA 3FFCD 1FHNA 4JN1L 1NMAH 2CM5A 1KB5H 4HKBB 3C6SA 1P4IH 4N1EA 1NKOA 3KLAA 4UTBL 1O9WA 5CILL 3WY2A 3X3FL 1CT8A 4AKOA 2XWBA 2PABA 4D9RE 3NBNA 1G6RA 3SKMB 4L2YA 1FC1A 2VGLM 3O6FC 4GAFB 4HJIA 4KK5C 3ARDC 1OAJA 2BX5A 2FO4A 3H6JA 3VXPB 4TVPE 3HS0A 3HZVB 1YPZF 1DZ0A 3QQDA 3ZIMA 4ZFOL 4RLDA 2GITB 4MJ5B 4Z7VF 3O2DA 3QB7C 1T2XA 3HS0C 4NJ9L 4UT6A 3KXFA 4ERSH 2EE9A 1M56B 4JGJA 3A6BL 5SWSB 2J2ZA 2Y69B 1D5XB 3HE6B 3GSVA 1QFHA 3RGVD 3ARRA 2R15A 5DQ9A 4DP8X 4PY8I 5HVHC 2NT1A 2PCPA 2X88A 3DX6A 4G1MA 4H8VA 4YN3A 1O7VA 2DY2A 1IAIL 5SWZA 1ZA6B 1AP2B 4G8EA 3BP6B 2MOQA 4JQVC 5KBNC 1BXAA 2C8NA 4PJFE 3TA3C 2Y9RT 1NAKH 3OZ9H 4JHAL 1HQRB 2AQ2A 4U31A 3AFLA 1F6AB 1ASPA 3MREA 2B5IB 4BE5A 4Y2DB 4BWUA 4TSBH 3E6FB 5JHLA 2V5MA 1RUQL 5FYKU 1AQKH 3F7PC 4QRQB 2N1TE 2R2HA 1GC1C 4F7CA 5LO7A 3DX3A 4NAMA 1TKWA 4GBXB 3EYVA 3L7EB 4LSRH 1I4FA 4MFHA 5I71C 1A7NH 5HD8C 3LKQA 3MRFB 3K6SA 1SZNA 3TH2T 4B96A 1PEZA 4IRSB 2HTLC 2VDNB 3O9WA 3IDXH 1MUJB 1VFMA 3ESNA 4Q89A 3FN9A 3PYCA 5KVGE 3EJQA 3HS8A 3UPRB 4L8SB 3VFUB 1YNTB 3JT2A 4Y4FD 3AVEA 4PAZA 5I8EB 2WSKA 3VXQA 5IMOB 1MF2L 3HOGA 3HZMB 4B7IA 3EADA 4WWOA 1LNUA 3VI3E 4L3AA 5C7ZA 3B37A 1LO2L 2KS0A 3MUY1 4L05A 2IAMB 3DMMB 3VFOB 4Z3FA 1YMMD 4WW2F 5L0QC 4P8QA 4OCWL 5EIQA 4Y19E 5E24E 1PIFA 4OIFA 1SVZA 5C6PB 4WEUD 4ZXBB 4JN2B 5D7JA 3EYFA 3SE6A 2E7LC 5KBKA 5BQ7B 3V4PA 4WI0B 2V9QA 1E28B 1GR7A 1MDTA 1NCBL 3E2HC 4OGXL 5C09B 3CUPB 4ZS7H 5T1MA 5C6TL 3BUYA 2AKRB 1KGWA 1AJ7L 1MCOH 4CBPA 1HK6A 2FQDA 4JR9H 3IMRA 3DUSA 1U8HA 2OL3H 3TFKC 5I19L 1EMTH 2VDLL 3NACH 1KCBA 2QPUA 3US1A 3ES6A 3FQ1A 5CGYC 4F58H 1FL6B 5K39B 1QRNA 5EOCL 5IVXB 1T7ZA 3ZUNC 3I74A 4WW1B 2Y5TA 4MNQA 3PWVB 1UC6A 5TE4H 4FNUA 4KDWA 1I3GH 4N4YB 3WAKA 3GXFA 4IKIA 5MHSD 2ZF9A 5GRXG 2NLJB 2GI0A 1FL3A 4FP8L 4C4KT 1UD5A 4GRWE 1NMCC 3RFRA 3ULUF 3FTSA 3V4VH 4BA8A 1NANH 5GS3A 1IBDA 4P5KA 2VMDA 4WUUB 5BS0E 2XY1A 3W11C 1PLBA 1IGCL 4ZS6C 4N28A 2X05A 1J1XH 3HHSA 1E8WA 3SEPA 2FJSA 4PJ5A 4TLUA 1IGML 3EKCA 1UXSA 5J13C 3C75A 4QHNA 3RFZB 1KGCD 2XQ0A 2X9YA 4PSPA 1XR8A 5FB8B 1CGUA 5DHDA 2E47A 5H35A 5KN5B 3CFQA 1MHCB 2A6KA 1YEIL 4L0YA 3QR0A 4OF5A 1G9EA 2DZEA 1SUJA 2P48B 5GS0L 1NEZG 2R7EA 2NY1D 3QXUA 1P1ZA 5J56B 3SBPA 3GPEA 4PCSA 5DDHB 5A16A 3FO1B 1EEUA 4XVSH 3FO2B 3Q8CA 4PJBB 3QUMB 3D3VE 3KEDA 3ALWA 5T3ZE 1KBKA 3DTUB 5C0NC 2FJFA 3NSYA 3C09C 2OSWA 3HNSL 5CZVL 2B0SL 3WLBB 1IQWH 4TL5A 1JWSA 5FCUH 3RTQB 4HC1H 5KS9E 3SZ6A 4GUCA 4N5ED 3UG4A 3MLXL 3PQYE 4NHCH 3MYZA 4QRPB 4QTIL 2FWLB 1BQLH 1B3IA 1F11A 3L08A 3RBGA 3IS1X 4PRPB 1IUZA 4PBWD 4CSZA 2IALA 4UZGA 4MD5A 5CSZB 5IV2B 4J3UA 3PAYA 2HLFC 2DQJL 4PLJD 1J48A 1NGWA 3QFGA 5EN2A 4GAJL 4R90L 5GS1C 4FAAB 2EC9T 3BVVA 4FLOA 3UXFA 4P5MA 2CIIA 4X9YA 4L4VA 2EE2A 3AUVA 2K6YA 4GSXA 2XFXA 5C9KA 3LD8B 1AC6A 2MTAA 4PS4L 4H8WL 3V4UL 1A6AA 5F21B 4H20L 4FFZA 4JPQA 1NIDA 1QTSA 3KNBB 5AOKA 1CC3A 1BZ9A 1CGVA 4ILDA 2Q0ZX 4P48A 1IZJA 4PTUA 5T3ZH 2YD6A 1AAJA 3JBG7 3D34A 3PWJA 4UOJA 5D2NE 2ZYHA 1ZEAL 3ET9F 2WV3A 4Z9KB 2YUVA 5AKVA 4I4WB 3NIGE 1XX9C 3M17B 3HG2A 4PS8A 4UZUA 3FTGB 1QLEH 4IHBA 2CLZA 4J4PA 1J5CA 2BCMA 1A7QL 1UXWB 2J20A 3NJVA 1IBZA 1VCAA 3OPZL 1TETL 4RFEA 4K7PX 4LVHB 4ANKA 1H5BC 4LSQL 2VDQL 4I2XB 3MXWH 4OF3A 2ZCHL 4R5XA 3APDA 4NCC2 5F8QC 5IMKB 4QXTB 3IJEB 1ZLSH 3IAPA 4NRYB 1R5WA 4TQEH 2ICWB 3N43F 2GC7C 2CM6A 4WKZA 2HWZL 4WU7B 1GZQB 5L2KA 3H0TA 4Z78A 1LEIB 4ONHA 2BSDA 3STZB 3BQUD 4LRIA 3WENA 4NI6A 4ELDA 3RL1B 5C0RH 3WN6A 2YUZA 2FT6A 3X11B 1HOCA 2XTJD 1NSNH 5FIEA 2A77L 2AV1B 3PGCB 5DMYA 4S2SA 1DDHB 2CJTA 4YHYB 4M3KB 1CT8B 1YEHH 2R9HC 2WBJD 2NY0D 3AY2A 1FFRA 3N55A 1CLVA 4U6YB 2HYMA 2ATKB 3QDJD 5I18L 3RVTD 3CFBA 4Z7NB 4PD4K 5GXBB 3VSUA 3GK8L 1OB1A 5J1TC 3GBNL 1R3LB 2FECI 1XGQB 2VXVL 2Y6SC 3SGDH 3SKUD 4HK3J 4DGWC 2H0FA 4RMWA 1DE4A 2NXYD 1UH2A 2L4OA 2VDMH 1JVLA 1MCJA 3AABA 5AG9A 3KYMB 3DRQA 3QWQB 3I6GB 1KGCE 2C9UA 4E9YA 4OF0A 3GMRA 2LU4A 3UCQA 4Z23A 6FABH 1HH6A 3HZKA 3N0PB 2CZNA 1PZAA 1GH7A 2WTRB 4IDJL 1LE5B 2D2CC 5AZEH 1ROCA 3IXAA 2AEPH 4XN5A 5F7EL 2R2BB 2YD1A 3LEVL 4G7SB 4JFYA 3WY3A 1T7VA 3B5HA 2JCCF 2C3HA 2BY3A 5E7BA 3LKPA 3OKYA 3IFPA 4WZ9A 5ENWA 1ZLWH 5D1ZA 3SJVB 5HYQB 4Y16C 1CYWA 2WW8A 3RVUD 4BZ1H 1QSFD 4NJAH 4ZNCD 2X4PA 1KIRB 5B7FA 3IJYB 4RAVB 2DW5A 2QPFA 1K6QH 3MRHA 1SRDA 4ZMZA 1MJJA 2EVJA 3B6SB 3SD5A 4KUZL 3E9TA 4MS8D 4F2MA 5E00A 2NPLX 1DEEB 4ZNEA 2FLBT 4HC1L 5KEZA 1IAOB 2MNWA 3FQXB 2KMWA 4HQQL 3QIUA 4AIEA 2JNZA 3DHMA 4UILH 5D96B 3BYYA 3K8MA 3VFSA 3ZR5A 3AQXA 1HXKA 2QPDB 2KC0A 4NQDD 1FVCB 4Y2LA 4XPGH 1RJLB 1QOKA 3BJLA 3WTSA 1CD0A 1B3JA 2NZ9C 2XOTA 5EN3A 4GKNA 5IK3B 1NPJA 1YEKL 1RQ5A 2DYRB 3K4AA 2QVIA 1DBBL 1RJYA 3CLFH 5F7FA 2NW3A 3VX1A 2AJSL 4K7PL 4EI6B 4PJAF 4QO1B 2N1KA 4F91B 4NP4H 2DLEA 1N7ML 1A9BA 7FABL 3MX0A 5JZ7C 5DURD 4HUWB 1UENA 4QPEA 5AKTA 2P8PA 1PVHA 1I9EA 3V52L 3G5ZA 3H9YA 1QLFA 4KK8D 3QEUB 1UWXK 5D2LB 4PJEA 1S7RA 2P8MB 1QI5A 1M05B 1GS6X 4LCUB 5GSRB 4NC2B 2NX5A 2PCXA 3DO3A 3QORC 4B60A 5JHDE 4JDEA 4LGRB 1ZPUA 4GQ9H 4Q8BA 4GI9A 4GIAA 3QZWG 1OPGH 1BJ1H 5CJQL 2VR3A 2WYZA 1OZTG 3TYGL 3B9KA 1SQMA 3VXOA 3F7YA 2HFFB 2DYPB 2BS9A 5DD6B 1M1XB 2R0KL 5FHBL 4MNQE 1H3PH 3ZHKA 1Y6KR 4L1TA 5GZNC 3KVPA 1M9WA 3I75A 3ZKND 5IQ9A 4HMDA 3UOAB 2MNJB 2IJ0C 4NN6C 4PJXA 5JXAH 3NK3A 4RZCA 4AH2A 5E6YA 4M43H 2YMOA 1QFWI 1R6VA 3PHAA 5HHXL 2ZOOA 3AW5A 1CU4L 3HB3B 3IGFA 3LZQA 2R29A 4YHNA 3K2IA 4DAGL 4ZAKD 4P3DB 4E0RB 5BRZA 3FULA 1J1XL 4ONHB 3VX0A 3CPLA 3SPVA 1DHKA 1TF4A 1W8NA 5IVXE 3WOVA 1A6TA 1IBBA 2QBWA 2XX0A 5D1ZB 4Z3IA 1IGIH 3WEOA 5H4ZA 2AW2A 1BF8A 4QWWD 2NSQA 1FI8C 4QHMB 2OZ4A 1QP1A 4G5ZH 1TEGA 3RWCB 4RCAA 4H8WH 3V4UH 4FP8H 3S98A 1N68A 4JB9L 3QARA 4X5PA 4APQC 1M6OA 2EVGA 4F37K 2CH8A 3M8OH 2EO7A 3QIUB 1PAZA 4K07A 4HIEB 4XVOA 3L4ZA 3L2LA 2ATPA 1F3RB 4ZFZA 1YG9A 1LO4L 3DHPA 4M5YH 3T8XB 3ATAA 2GUYA 4MCZA 4ENZA 2GTZA 1TVHB 2NQCA 2DJMA 2WUCL 4PHXA 1T03H 2IFGA 3N1PC 1CK0H 1TXKA 2NY4B 5PCYA 4NHCL 4QTIH 1FO0H 3GSOA 3F7KA 4MQSB 2OTWA 4YHOL 1AQDA 1AACA 3CK0L 4KJYA 3GHPA 3HE6C 3VFGL 2LVCA 1IT9L 1HJCA 3KHQA 3PQYA 1O9ZA 1PKOA 1UD8A 1SYVB 4X4MA 2BVYA 4AKPA 4JM4L 2FD6L 4HS6B 5E99H 2ZONA 3BVDB 5EO1A 2YHGA 1S8DB 3QZWA 4AYMC 5KVEE 1BLNB 2OP4H 1WSST 3IFNL 4MAYB 5GHWH 4ELMB 1W0VA 4OFKA 4XWGH 5KYYB 2VXSH 5D1XD 3CZKA 1ZGLM 5EC2B 4ZUUB 2FT8A 3TCTA 3U36B 4J1UB 1VENA 3TURA 3RUGA 1A7OL 4I0PA 3PJSB 4L4VE 1CICB 3UTZB 2AJZB 1FZJB 3W0WD 4PJ9B 3A67L 1JE6A 3UAEA 2VMJA 3WG7B 2GCYB 3GJFB 3K3QA 3P4MA 5K33A 4XTRC 4JFOA 4IW4C 5I82A 2Z35B 5F44A 4GSUA 3WNJA 2F53D 1YHPA 1NA8A 1OGAE 2VQTA 4R9HA 1JOIA 1DQKA 1HOEA 2CO6B 3GXMA 3SSGA 3KJ4C 3FT4A 4XCNB 3FU7B 1R3JB 5EOQH 4Z77A 4O2FA 2OJZH 3TCXA 4D9QD 4LLQB 2GBUA 3VGFA 4LLYB 3BKMH 3AS1A 4L3FA 4ODXA 4BWTA 3H9ZA 3OHMB 2OJZL 4D7BA 1T20B 1KSRA 3NH7L 5LXGH 1QFUH 2BOBA 3SDXB 3CXFA 3MJWA 4PCKA 4Z7NF 2NY6B 1OGSA 4JUSA 1JGUL 5F0JB 1ZLWK 5C0AD 2DWSA 3WIAA 3BD4A 3UJIL 5I1GL 3LN4A 3QUXB 4M5TA 3C60D 3ZQXA 3MRPB 4XOCA 2RH0A 4HC1A 3ROLB 4NZTL 3N85H 3FSAA 3HPJB 1QX1A 5FK9A 3T6XA 1N6VA 2C26A 2WB1A 3KXFD 2IOMA 3CGTA 3MBEA 1YYMH 2BSSA 3PWPB 4UTAA 4XHJD 4G2AA 4JCLA 1TZ8A 1X5LA 3O6FB 4ZMLA 3L13A 3OKDA 1S4IA 2Z0UA 2K4WA 3VWKA 2B1OA 1WFOA 3D87B 3KD4A 5J12C 2R0ZL 2KZWA 4P3CL 3MV9E 3VD5A 1G6RB 4I1PA 3L5JA 4A37A 4MJ5A 1JYNA 3X17A 1BEYL 3WEBA 3K71B 2EYRB 1L9SA 2YFOA 1CVSC 3FFOA 2PKDA 4HMEA 1BLNA 1MEXL 1D5XA 1MFMA 4HDIB 4GSDH 3VW3L 3O45B 3WKPA 2HFGL 3ZR6A 1V7NL 2VLKA 5FO8B 4NDMB 5CD3B 4FHBD 2FX9L 4JHUA 4IU2A 3QJFA 4MJ4A 4KI5D 4EUPB 4PGCB 5FHAH 4A04A 2YGVA 2BY2A 3P30L 3KM1A 4PJ9D 1KB5L 1CXLA 1NCIA 1QG3A 2EDKA 2ZUXA 2A6JB 4NO5A 4AEHL 1XCQB 2IO5A 2VDNL 4UT6H 2WAHA 3IDUA 3ML8A 2C7UA 4M4PA 2MJWA 5C07E 4LF3B 4PRHB 5CZXC 5D1XA 1FA4A 3V0AC 2HB0A 4GFXA 2OTWB 2BRRH 2OR9L 5HHVH 1E5BA 5HJ3B 5KAQF 4HALA 2X7LB 4L3EA 5FYLH 4XI5D 3B6SA 2DLHA 4NP9A 3S5LG 3BH9B 3T3PF 2BJMH 1KB5A 3THMH 4JFSA 1HFUA 2Y06L 3V9FA 2FQGA 1KN4H 1MXDA 2WNXA 5B3SB 2QMJA 4AV4A 2XN2A 3CMOH 1LO3L 3L3KA 5KVMC 1KB9J 5EU3B 4G8GD 1KN4L 3NCYP 3BRDA 4PJEE 4CILA 5L2JB 1HH9B 1SN2A 3EBIA 4UUJB 3W0WB 2NX5E 4LCCC 5H4YA 2VQ4A 3UYOD 2Q87A 1TEFA 1FJ1B 1Z9NA 5JHDA 5JHDD 1N6QH 1SUHA 2XQYK 3EGSA 3KL3A 4G7VL 3L3JB 5JOEA 1U8CA 1YEFH 4OCNC 3JWNC 4ZD3L 4AJVA 4LSDA 5BQ7A 2P80D 2N0MA 5GRJL 2BNUA 3AS0A 5EIIA 1E4JA 2EO1A 5LNDA 2BOCB 4RWYL 5DMGD 1CLOH 5DC0A 2ZPKL 1WFTA 4GRMA 4NGHL 3I9GL 3TBTA 2WLMA 5DYFA 4B5EA 2IDTA 4PWEA 2ZE0A 4O58H 4ZQKA 2P4AB 1NMAL 3PWJB 2CHZA 1K8DB 4BIKA 1SMAA 2VDRB 1Q9KA 3QFJB 1J8HA 1JGUH 1JHKL 3RL2B 3HC4H 4HZLB 1HZLA 3KDPB 2XG5A 4NZRH 4LHUA 4DN4L 1OP9A 4W9KC 2APVA 1FG9C 3EDEA 4LVNB 3WE6B 3KPRD 2XJKA 3E6HA 3WDHA 3BUYB 5HJGA 4R3SB 5FW8A 3CVHA 4OZHF 4PTTA 1C08B 3ULAB 5ETUB 2W94A 1CTOA 2EEAA 3VW3H 4GSDL 4X5LA 2P5ED 3S35L 4Y5VC 5SWZD 1SNRA 5GRVL 4BELD 1D6VL 4H2CA 5IBLC 3PS6A 5C8JA 5CR8A 3QUXC 3CWGA 1TSHA 4UNTA 2OV0A 4A38A 3FCUB 3O6LH 3U7AA 4DCQA 3MOBH 1OHQA 1UXMA 4DEUA 3L6FA 5IHWA 3RL1A 3VDBA 1T3FB 2R0ZH 3AAZA 3K8KA 4JFQB 4EIBA 1XTLA 3N1MC 4PG2C 3HBQA 5EZLA 1LD9B 1R75A 1U41A 2A6DB 4OD3L 1FV1A 5EUKB 2VLKD 3VXUD 2QV2A 3Q1EA 3MBED 4UQIM 3TBWA 5J3HC 1T7YA 5IJVA 5KVFL 1CLZL 5CP7B 1A1NA 4AQ8A 3C6EA 4PV9B 4UIMB 3OAYK 1D5MA 1R33A 3NCCB 4Y2OB 2G3XA 3K71A 1RPQA 4P4RA 2X4QA 3ROOB 2PR4L 1DVUA 3PP4L 1UD2A 1ZKAA 5F0PB 2YEZA 3BESR 1XB8A 3BQVA 1YECH 4DVBB 2UZIH 2BJML 1B0RB 2AK4D 5T5NF 4Q56A 5ADOH 5I6OA 3V6FA 8CGTA 3JV0A 4DP6X 1G87A 5IHUH 4GW4A 1JN6B 1LP9B 3B1UA 4HWBL 1UB6B 3VGEA 4ODWA 4HF5L 1DVQA 1WBYB 2OZ4H 2UWEA 4WUUD 3JT0A 1GMEA 3EXJA 2XIDA 5AKSA 3HZVA 2YLKA 3ARBA 3BWAB 2EO9A 5I2IA 1KLGA 3VNYA 2J8OA 3IVKB 1HYSC 1KXVA 5FYJH 3O0RH 1NH6A 2YXMA 5I6LA 1E5ZA 3FRUA 2H32B 4M02A 5LBVA 2F58L 4YGVB 3RWIB 1CICC 1HKFA 4F57H 3AWFA 4BFKA 1H0DB 1W2KT 4X5XA 2HVJA 3WJMA 1T89C 2QMKA 3SHSA 2CO6A 3PJSA 1ZY9A 3C08L 3EH2A 4HZLA 4WHYG 5C7XL 5EEYA 1MXGA 2NDFA 3QFJD 2Z35A 4JKNA 3VQMA 2VR6A 2O6EA 4U6XA 4B50A 4WFHD 5IFJA 2R83A 1YY9C 3G6AA 2IWKA 1XB6A 4Q7DA 4BZYA 3VNZA 1R3JA 5EOCJ 2VISA 1KLUA 1MHHB 1XCTA 3W3BA 1BIIA 3OX8A 3CZSA 3LVEA 3ETBJ 1EFXB 4H0LC 3EUUA 4R7DB 4V1DE 4ZYKA 5C0CD 3AT0A 2VERA 3VDAA 1JZ7A 1ZTXH 2L0DA 1U8NB 1Z9SA 4U2YA 4IGBA 4AENA 4HUXB 4PWJA 1OP5H 2WPGA 4WHTA 1RIVH 3Q44A 4H0IA 5GISL 4ZFFA 2JIXB 1GAFL 2OSLB 4OGAD 2K6ZA 3MODH 1IAII 3DV4A 3SPJA 1DBML 2BNQE 2CKBL 2X12A 1LJMA 4UI2A 2ZWYA 2J4WL 5CBEB 1KTKE 1UVQB 2F0CA 5CJQH 3GBMH 1NIEA 3B2UD 4GLRH 4PN6A 4WK2B 5HTSA 4PJ7F 3MUZ1 1XH3A 2NXZD 2OSXA 4P9HH 3VSQA 4HMCA 5F0LB 5JPNA 4I3SL 2FO8A 2FJUB 1QUPA 2QPEB 3KBHE 5HI5D 3GJEA 3UTSD 3ZBMA 4HOMA 2H1XA 5FX3A 2VZTA 4N0YL 4DN3L 4F9LA 5SWZE 1IC0A 3MV9A 3MV9D 2BNRD 3T0WA 4ABUA 5LXGL 3AM8C 4QRRA 3OAZH 4L37A 4PJ7A 2B0SH 3OMIB 4KNQA 1UVQA 2QLYA 3G6JA 3RWGA 3EDFA 3IGAA 4ABVA 2OULB 2VZVA 3BT2H 4G6JH 4JRYA 1RZQA 1X7QB 2H0EA 2VW7A 4Z0XB 3VRIB 3WD5L 4NM4L 2HRGA 3ME0B 4XMPH 2XXGA 4LAJH 1P7BA 4G8IB 2DV6A 5C09A 3CQQA 3BDXA 4PJXB 4NDMA 1YDPB 1Z32X 2O6DA 4HUVA 3V7AG 5B38B 3TYFA 1NLBL 3CHXA 2MOVA 1WWCA 1B6UA 4WW2B 3QIBA 2NW2A 3OR7B 1CXIA 4PBVC 4WI9A 5DHVA 4IJ3B 4TPRL 3ZT7A 1QA9B 4FTVD 5DR5L 1G1CA 4BFJA 4Z5RB 2P44B 5TE7L 3RPKA 1CXHA 5H37G 4EF3A 4F7TA 4TMPA 1N67A 2IV9A 2R23A 5B1JC 3UJTH 2HT3C 4NUMA 3F7VB 4U0RB 3CZNA 1DJHA 2M8XA 2GJRA 3K2UL 3QQ3B 1ASOA 3MCYA 3MV8A 2A83A 4FLQA 5I8CA 1NM9A 4JDTL 1PZSA 5BV7L 2UYLA 4NZRL 1U93A 2YUWA 5GSVA 5DD5L 5LG1A 3WNMA 2EDTA 1OTSD 2J6WA 2NNRA 1L0QA 1S7SB 4EN3A 4CNIA 1X44A 5JOPE 4WUUA 2BMKB 3RGVC 2WQ8A 2ARWA 4KKBC 2KBGA 5LBSL 3UC0H 3MA9L 4YZFE 4HCRL 1G7QA 3S36X 4BQCA 1DFBH 2VSCA 2YGQA 2CPCA 1PQZA 1MG2C 4GBXA 3TIDA 4OZGB 1FVDB 4LESA 1NBVH 1DJSA 1Q9OA 1JF5A 4NQUA 1E9QA 1CLYL 2XBTA 2Y3NA 3LRGA 1YEHL 4J8RB 3FUKA 4KK6D 2DQIL 3QJRB 2F7IA 1I8LA 1CDGA 3DUUA 3H9HA 32C2A 4L4TE 4N20A 1DO6A 2ZWKA 1FVCA 12E8H 1A9BB 3UEZA 4O9HH 1ZPLA 1SLWA 4A7TA 1M2OA 2VDKL 4BSVB 2OW7A 2UVEA 1BREA 3EHBC 1OSZA 4U3SA 1L9PA 2VLJE 5DZPA 3VFRA 4Y4HB 4ZMYA 3FONA 4B9YA 2DQEL 1QHOA 2KZKA 3OLIA 2WCSA 4ONOA 3QI9B 4DP2X 1ITBB 3V6OA 5CEXA 3ECQA 1XGTA 1B4LA 4WHTB 2DKMA 2ZKHL 4GPVA 4E9RA 5C7XH 5IFAL 4K0OA 1P2CA 4MNGA 5CD5D 3VRLF 1UURA 2LGNA 3V55A 4U2ZA 1USZA 5TE6H 4KVNH 4IKJA 4I1NB 4PJ5E 2QR0B 2EDMA 3CC5A 4DVRL 4J3OC 5TFSL 4Y9EA 2XPGA 4FYQA 5EU7E 3BHBB 4FS0A 1E8YA 4AGMA 3FB7A 3KJ6L 3JUYA 5IQ7H 4D0DB 1PZ3A 1CLCA 4I88A 1WUZA 3N40F 3NZHL 2AQSA 3JYCA 4ONFH 4ORGB 1OL0A 4R0LB 1PZBA 1QBMH 4G8AC 4W9HC 2XKSA 3QXTA 2IPKB 3DJRA 3KPQA 4OCYL 3F7VA 4AL8L 4B5ZA 3DIFA 2IF7A 5ES4B 1ZRUA 3GSXA 3KPSB 4LEOA 2RALA 3D1MC 3QDME 3WGVB 1A8ZA 3QG6B 3R1GL 3QO0B 5FFGA 5INDB 3GINA 3UERA 2E75C 4GW1B 3CLFL 2XYCA 1CE6A 2DAVA 1HSBB 4NQCB 3EO9L 4Q2ZB 1BM7A 2JV6A 4XHQA 2HH0H 1NUFA 3IGKA 1YEFL 2JKJA 2UWEE 3CD4A 4KY2A 3HPLB 4ZTOH 4GW4B 2BSRB 3FT3A 1MCIA 3KZ8A 5ANMB 3B2PA 5CMAB 1QKZL 5HGAA 1WWWX 4R6UA 3RKDD 2G75B 3C12A 3OLEA 4ANWA 4OD2A 5C9JB 2VC2H 5IIEA 1FL5A 5DHYB 5CLTA 5G2NA 3Q8AA 3CN4A 4MAUH 4HWZB 1WZAA 5CCKH 5DLLA 1V3LA 4G70B 4AC4A 2JXMB 2V0AA 5CR1A 3FHQA 2A6JA 3MLUH 4PRBB 4LK4A 2Y1YA 3A5VA 1KDJA 3ML9A 4KO6A 1AKJD 4DP1X 2VT0A 3L81A 5DJDA 4AXWB 3MLWL 1TOXA 2P80A 2OFQA 4NQED 3UMNA 3BI9X 3SOBL 4MS6A 2YA2A 1HN1A 2VUYA 3D48R 2B59A 3PHOB 5I1IL 5HDRA 2Z1KA 2XTLA 5FYLE 4N85A 4EN3B 4I4WA 1HWGB 4UAOB 5E0FA 2B3IA 5I73B 2DH2A 1HXYA 4A2GA 2V2TA 3OR6A 2OL3A 3X14B 1IVTA 1AD9B 4JFDB 4ZUSA 1AO7D 3SDAC 1SDYA 2K6WA 4TNVF 3ZE0F 5FO9B 3Q05A 1OAXH 1D5IL 1LK2B 2WWKO 4CVXA 4L18A 1E0OB 5TDNA 2ZOWA 3WHXA 4CC4C 3P77A 1QPKA 1MJUL 2GSGA 2PWDA 1IKOP 4C4KO 2OM5A 1F8TL 1BPLB 1CUOA 4JFXA 4FQLH 4OZFH 4J5VA 4PRHE 3CFMA 4GNKB 4N8VA 3TWCH 1TTBA 3LKNA 3WTWA 3UTPE 3U4KA 2ZG2A 2GJ6B 5EU6D 1PLAA 1IBGH 2HWZH 3D25B 5ABDE 1YC8A 4F9LC 4J2QA 3RYMA 1WEJH 1UCTA 5FFLA 1FG2A 4Z95L 3VXSA 4JY5L 3VA2C 2AJUH 4PRAB 1WUNT 5JIHA 1OGAB 3G7TA 4QRRE 5L6YH 2NY2B 4PJ7E 3VD0A 2BP0A 4QHUA 2OQJA 1EXUA 4FQIL 1DN0B 1AANA 4HJSA 1EEYB 1PY9A 2BW4A 1K5NB 3IMWA 3MACH 4GEJA 1NTDA 1DQJA 5DQJB 3EFOA 3UAJA 3Q2NA 5F0MB 2DM3A 5D1QB 3BP5A 2NY6D 3EO0B 5CJ5A 2VO8A 1PGRB 2D7TH 3ELQA 1LO4H 1S9VB 3SGEH 5C0BD 5SWZB 1FAIL 1RU9L 3UJJH 4F7EA 3U2IA 3FUIA 5EA0H 4MSWA 1Q0YH 5JHAA 2CLVA 4Z7QE 4NOFA 1RKRA 1UG9A 3RGBA 1FAIH 1RU9H 3UJJL 3CN0A 1J9QA 1FFOA 1OTUC 2BP8A 1H15B 1O6SB 1OCCB 2R23B 2HFGH 2ZOUA 1AKJB 1KN2H 1FV1B 1SVCP 1SHXA 2AK1H 1T4WA 3KGTA 3MZGB 2OBGA 1E6JL 1XGRA 4KI5C 2ZSVA 4L3ED 2W9EH 1Z1WA 4NQCD 1XGQA 4ADIA 4PGCA 4HA1A 4JQVA 4P23D 2P3YA 3RQ3A 1B0IA 1WWAX 1BJ8A 4ZZFA 2D4DA 1KZQA 5FO8A 4WW1A 3G6DL 5CJ8A 4G5AA 1R3IH 1Q0YL 3UBXA 1A0QL 4G7RB 3QHFL 4QXGH 3P77B 4PLOB 2PTUA 5HVGB 3QWOA 5AG8A 1BJMA 3V0VB 3CX2A 3V6ZB 2WQRA 2HMID 5ICZB 1DQVA 2BDNH 3U7YH 1RHHA 4GBXC 4ORZC 1LO2H 3N0AA 1XF3A 1I1AD 5AYTA 1NCDH 1QABA 4YHKL 4KJQC 2VN4A 2XWJB 3DMMA 2GYSA 4IRSC 1CTMA 2VR5A 4XPTL 3KL0A 1U9KA 3ATFA 3RWIA 3H3PH 1ZDSA 4PMFA 4TNWK 4YZFF 2Y7QA 2EVIA 1B9KA 3T8XA 2OJEA 5HI3C 4HHAB 1Y0LB 4JHVA 4JY5H 3PJNA 3EH4B 1KLGB 4N8CH 2QDVA 5BO1H 3IVKA 4Y4KD 3IN0A 1MPAL 4U6XB 2E76C 3FRUB 1FFQA 4F33A 3EFOB 3ECUA 4DK3A 3SCMD 1RK1B 4M7ZB 3SCMA 5MI0C 5K1VA 3AG4B 4LIQL 1LILA 2XWDA 3N5AA 4OLUH 4FXGA 4AG4L 3QEQD 3Q13A 5LQBL 3MLWH 4ODTH 4O00A 3WO4B 3U2SA 2IAND 3O2VH 2MCMA 4Y7OC 3BZ4A 1LVEA 3QI9A 1B9ZA 3FQNB 3HG5A 3T71A 3VXRB 4F7EB 1R3HB 3Q1SH 1FUNA 2JI2A 4HJGB 3V5HA 4NWUL 1G84A 4Z3TA 4ICXA 5DJ0A 1FLRH 2Q10A 5E1GA 2DL9A 2GJ6A 2AJUL 4PR5A 3V5DA 3L16A 3TM6A 5K1NA 4AMWA 2XWZA 1F6LL 3F85A 4U05A 3AWEA 4FQIH 5C0JB 3X1NA 3FB6B 1CL7L 1J8SA 1RFDH 3AY4A 3HAEA 3TO4B 3QG6A 3WNIA 1MFCH 4KMTH 1ETZA 5LGKA 3QQ4A 4X8JB 4A63A 4F37F 4A7UA 3AB0C 2CIIB 4FQLL 2FEJA 1WJ3A 2WXJA 5D7LD 5FEBA 3MJ6A 1H8NA 1U95A 1TJHL 1BMGA 4QOKE 2XWCA 2A0LD 3BAJA 3QAZC 5IB5A 3BUBA 5GGQH 3F65A 4UBDD 4QRBA 5FV2A 5DT1L 1YSOA 5C8JB 1ID2A 1A5FL 3BWZA 3A6CH 4M48H 4OGYH 3JUZA 3BUIA 1BAWA 1J0IA 4I89A 3WMQA 4G6KL 4HSQA 3RZCA 2WLJA 1WC7A 1S2EA 2H1LM 3C5SA 4TN9A 4ZO8A 3WJJC 2XT1B 5KYNA 2JVUA 4U1MA 4Z3JA 1X7SA 4G5ZL 1L7IH 1MCCA 3HE7D 3EO9H 2XWTB 2Z4TA 1V05A 4XPHL 4Z7VE 1FDLL 4YUEH 4APXA 3BXNB 3SN6N 4L8DB 2DDQH 3MBEB 5E2UH 2DQDL 4LBAA 5HDQL 3L4YA 4PJ8C 5I1IH 3EAKA 4CGTA 1QEXA 4XP9L 1HHJB 1CDIA 1RZ8A 2I07A 4QWWC 2AHIA 4D8PA 2QGEA 5MP6H 2GTZB 4NXSA 4QKXB 1D7CA 2ZIDA 1YPZB 4LNRA 3VTAA 5IEHA 2XWXA 1P7QA 1G6VK 4FYTA 4K94L 1NCAL 3QA3B 5TPWH 1NOLA 3P54A 3ILEA 4OY9A 1OAXL 3VXUB 4YK4C 1DSYA 3C6LC 3LHPL 3NESA 1MVYA 4PJCA 5IWLA 3G9VA 3T1FA 4LLVB 2YAPA 2OK0L 3UG5A 1CR9L 4YVNA 3H7BA 1XO8A 1T0PB 1TR7A 2HT2D 5EO0B 3FU6A 2ZYSA 3CHPA 4DJMA 4OB5H 1PBYA 4S0HA 4U1LB 3AG3B 3ESOA 1L7TL 4CMMA 4NUGH 3D09A 1CCZA 2E8YA 4KUCF 2XWRA 4NJ9H 5ID0B 1ACXA 2AF2A 2AEPL 2YS4A 4CUCA 4ZTPH 4QT5B 3B3IA 3FN0L 2YQ3A 3Q48A 2GVYA 5GS1A 4JZJA 2WWMC 1GGIH 3B7YA 5BW7A 4PRHA 3OZKA 3WGUB 3WMSA 4M7JH 5E6ZA 1W15A 1ZSHA 4RAUA 1LO0L 1INEL 2H4EA 3H7BB 1KFGA 4IKNA 2N56A 4H8QA 1OSPH 1PZ2A 3DROA 3GFUA 3LRSA 5BW7C 4OCMC 1OCRB 1INEH 5M94B 2PF6A 3VVWA 4EZMA 2A9DA 5D7HA 3ZTJG 2BHYA 3BFOA 3QYCA 4GS7B 4ODVL 3IETB 3IM1A 4KC3B 1AG0A 3LX9A 4M00A 1TNNA 3STZA 4PJFA 3HW7A 3DGDA 2JQZA 1BF2A 2WKOF 4B3VA 2VZUA 1EDYA 3EDJA 3PXLA 2WXOA 1EK3A 1F13A 5TF0A 4Z3EA 4WUKL 4TSAH 3HC3H 3MXVH 2CK2A 4MX7A 4MRCA 4OT1L 4X7EC 2PPDA 5K9KA 4WK4B 4W68A 5JUEH 1U91B 4KKZA 2I9LA 4D0CA 1HHHB 3GSWB 4XNUH 3ZTNL 2AEQH 1KIPA 4PI0A 3QK0A 5DMIL 2L7UA 4H1LH 2YAFA 2K7QA 4OZFA 1IMHC 4AKQA 4FI8A 2FEDC 5DJ6A 3FO0L 5MERB 4XCEB 3U30B 3WY1A 1OAZH 3KEHA 2O61A 5AVRB 4WV1A 4UDUA 1IGYB 4JG9A 1XDTT 4HUWA 1MREH 4NKIH 1H3TA 1I53A 4WY7H 1M3JA 4EUPG 5I1JL 1BQKA 4QOKD 4YFEA 1IRAY 3MJ7A 4YDNA 5C07A 3FQ4A 4BINA 4E9VA 3ESPA 3T8MA 3ZDZB 4XN9A 3DHUA 3K2KA 4H26B 4JJ5A 3GZQA 3KG5A 4ZMWA 3WKQA 4L3EE 1WBXB 4NM4H 1UA6L 1YYLH 4M6NH 3WJLC 4DK5A 5T8IA 4NN5B 1EZUA 4B9PA 3DECA 2ZAGA 3EBAA 5A2KH 3IFPB 4OVVA 5HYQA 4XNBA 5FOBB 1T0MA 4LO9A 1D6EA 4DH2A 3C2AH 3L1FA 1Z66A 4KHXH 3ZRFC 4G8FA 3WN5A 5JPMA 1QO3A 5KBDA 1ZVYA 4FZ8L 1C12B 1LO5A 3IJYA 2A9NH 1ZVSB 4YDKL 5JXEC 1G7PB 4HAKA 1RULL 3MFFA 2Q86A 4KWUA 1XVSA 3LXCA 1YNKH 5ESAB 2Q7NA 2XDHA 1X5IA 4NRXA 4F7TB 2R4RL 1FNEA 1IC4H 2HT2C 2YD7A 3BP6A 4KQ3L 4C83B 5FM5M 3SE3A 3C8HA 1XF2A 1NFDF 3MI6A 3SPVB 1ETB1 2J4WH 1BQHB 1JGVL 2K9FB 3SDYL 4NQSA 3O2DH 3RJQB 1CL7H 1RFDL 2UVFA 1OSEA 4UIMA 4AMKH 5CM1A 1BIHA 2ZYIA 3ARGC 3O8XB 2VSDA 1C5BL 1OM3H 4JK0D 1JCKA 4KRNA 1INQA 1QLRB 1MIEL 4YHYC 4PJFB 4GAYB 1NKGA 1G7HA 4JKPH 2ENJA 4K3EL 4UM8A 1IFHL 3HTLX 2ZNWA 3MGAA 4NWUH 1TJMA 5A2LH 4DQOL 1RL1A 1XL4A 3G5YA 4TNEA 1UB5B 5F7HA 2FNWA 2V2WA 4PV8A 5L0QB 4G43B 5MEND 3UBFA 1RMFH 4FNTA 5EU4A 5ANHA 5BS0A 2K45A 3DUHA 3WV0A 5E6ID 1AQHA 1A6ZA 3GMLA 1HE8A 1G5AA 1I7ZA 4URKA 3OXRA 4NHUB 2IXQB 1NCCL 4Z8FH 1VAHA 1KJ2A 3MRQB 3QE5A 3ARBB 5FA3A 5FKAA 5FGSA 1H3PL 1F97A 4U3HA 5L2JA 5CKAA 3CVHH 3LH2L 2FVNA 1XCWA 2YJLA 4N2AA 4N2FA 4JDZB 5F70A 4ZAKC 3ARGD 5LCVL 3VM5A 5E5UB 1ROWA 1NDMA 1IIIA 1OCWH 2GJ6E 2GK0A 4ODXB 4MNHB 4CVUA 4QOKB 3MV01 3S9DB 3GZPA 2BVEA 1SBSH 3RIKA 3DIVA 2WLNA 5F1NB 1N19A 4NKDA 4M8UA 4N2BA 3FUMA 1GOGA 4PTUB 5F71A 4GP5B 2BNUB 2EQDA 4RFEB 1TSRA 2J8HA 1A4JA 2AJVL 2JKLA 4HIHB 3RNQB 2ITEA 1S7XA 5FKAB 1EXHA 4OCRH 1UASA 4YSPA 3RDJA 3V0EA 3M17A 1BG9A 5CXPA 1UZGA 4MXWL 4QRRD 1OIOA 5AVZB 1UCBL 5IJVB 3QH3A 3QUYD 4QOKA 3K81A 2ZZUT 3WAJA 3TV3H 3CFDA 5JHBA 1VKXB 2DMKA 1E27B 1Z3RA 5DI8B 3FHAA 1BIIB 1SQ2N 3HMXL 4R7DA 2Z92B 1FE8L 3FN3A 2G60H 2WZAA 4R7LA 4YPGA 2GBTA 3NDZE 4AYGA 1S7UA 1NMCB 3LVTA 4L8SC 5HXMA 4DEPB 1YNKL 4HQQH 1NJ9A 3ZE2E 2EH7L 1A1OA 4D3CL 1SVBA 4P2OD 4K9EC 3P0YL 1QQDB 4FQ1H 2CD0A 4XVTL 5CIPH 3CVCA 4ZSOE 2J56A 5FUOH 4Z7QF 1JK9A 4YAQB 1GOHA 3L95B 1USQA 4M4RA 4LB8A 1WLHA 1FBIH 1RK0B 3PGDB 4NQTA 3I50L 1WQVT 1QD0A 3JQOB 4K2UL 3ZYZA 1AZBA 1HAWA 2HKFH 4OCSH 3QUMA 3DOSA 2NXYB 4U7SA 5F1OB 1ONQA 1E8ZA 1IQDB 1DFXA 1JXGA 2JFCA 5CLZA 1HX0A 5F93C 3C5XA 2GHWB 2QGDA 2PTTB 2BSED 3O3BB 4MB4A 1Q1PA 1AS7A 3MTXA 4XMXA 4K8RD 3T4AC 3CSTA 4JVWA 4LP5A 4QYOA 4HUNB 4OLYL 2XRAL 3MROA 1NFIA 3P2TA 4WI5A 4HKXA 1OAZL 3ARBD 3S4SG 3U25A 3TT3L 1B0GB 4GXFA 4V11A 4EEEA 1KGXA 2GQHA 3TLRA 4P2RB 1JS4A 4JZJC 3RIAK 3L3HA 2X4NA 2DQTL 3T77B 2AXWA 3I02B 1ZLVK 3WKMH 2CGYA 3WU1A 2XVGA 4LXFA 2QSQA 1IAOA 1U58B 4YHMH 3S5LB 4A6YB 4MDJA 1N2RA 3BMVA 4QRQA 2R8SL 4QAWA 5D6DC 3NA9L 3QQ9C 3EYSH 5IVOA 4BSJA 4M1CC 1HXYB 4OLWL 2PP8A 3VQ1C 4E68A 2N3JA 2W07B 5I1JH 3FQXA 4LLAA 1ZGLP 2WC7A 4Y5VB 4KKQA 2CRYA 2MPVA 5HJDA 3WL9A 3K4ZA 1OK8A 3UTQA 4F2MB 3OC8A 3O9WD 4FHKA 1CDCA 4GP4B 3ULSA 1IGFH 3MNWA 2L3BA 3BDBA 5A6LA 2XVKA 3E0GA 3HMWH 4WK0B 2DMBA 3G6JE 5F6HI 2C7UB 1U91A 4M93B 1DQLH 2HTKD 2FBJL 3MGTB 2CIKA 4RVBA 1CWVA 1KACB 5KTEL 4ONGL 1BP3B 5GSRA 3QIWD 1H5BA 3FBQA 1L0XA 2FGWH 2RCSL 4IMKC 1FGNH 4FQQB 4CSSA 1GS7A 2X4UB 1CFTA 3IF1B 1ACZA 4WV1B 1GGCL 1MVFA 2JLPA 3AG1B 1AH1A 4NC1E 5GGTH 1A14H 2AI0H 2AJ3A 3R4RA 3IBEA 4LHJB 4UT6L 1F3JB 4RGGA 1P4IL 5LGHL 5T3ZD 4GS7C 1CGSL 3RZWA 3EOTL 4QRPA 1LEKB 2EEBA 3BSZH 3D3VB 4R26H 4ZNEE 1N59B 1L3NA 2Z34A 3S37H 4X6DF 1P6FA 5ETUA 2R0WL 5DFWH 1QEWA 2P43B 3CHOA 1J9SA 2Y07H 5KSUB 5C2BH 2IAMA 3VFOA 5H37H 1KF9B 3QNYA 1FJ1A 1U8KB 3CFBB 3VH8A 4J2XA 3VWKC 1G7IA 1M7IA 2WK2A 1JP5A 1E27A 5DI8A 3SY0A 5JW5A 1QKZH 1NWPA 1U3HD 1Y6NR 4X7DC 3OLGA 2E74C 4HSAC 3FSVA 4NO0A 2JKTM 4Q9BA 4WO4D 5IZ7A 3F5WB 2AQRA 2CLVB 3OQRA 2BC4B 4NYLB 1Q9LA 4UOQA 4CKQA 5DSCB 5KSAC 2JJVA 4WUUE 2IQAB 1KCWA 4OT1H 1XGPB 3V8CA 3MVSA 5FWRA 2VLJB 4HLZG 1SY6A 1JHTB 2Y4SA 2R56L 4XOAA 5TGBB 4C4BA 1IKNC 3B5GA 3OG6B 5CJXC 3SDAD 2V4LA 4BEIA 3FL7A 2NY5L 4LHUG 5D1XB 3V9CA 1XIWB 1KWGA 4XO4A 1AZCA 1DVXA 4JX0A 1YJDL 4L4TA 3BVWA 3OHXC 4NKOA 4QHPA 1E2VA 2MPAL 1KEGH 2BLFA 4DUVA 5KSBE 1PQZB 3KJ6H 1AYOA 5IQ7L 5F8RC 1NGXB 4EMZA 5D1XC 3ZL4L 2OMXB 2ZG3A 2DMHA 2XI9A 2AFNA 4DKFL 4UU9B 5KYUB 1JF1B 5G5DA 2VTFA 4LT7A 4R4FL 5EU4B 3C5ZA 2I07B 4O02L 5CIPA 4WV1C 1NUNB 2PPEA 3IDYC 2NCEA 4WFGE 4KXAA 2HMIC 1A6WL 4ZOEA 3RI5F 1T1ZB 4XMLL 2VZ1A 1CR9H 4UM8B 4MNGE 2EC8A 5KTEH 2X4UA 1N0LA 3LZNA 3RIAF 2J88H 4N2EA 1A4KA 2FBRA 3D69A 3EF4A 2BHFA 4DP0X 5I1DB 4AY0A 1FNSH 4X6FB 3FOMA 1RZKL 3QBTB 4L4JA 4NHUA 4XN2A 5TE4L 3HUJA 4CSTA 5MP6L 5EO1B 3NSFA 5DDHA 1PPIA 5CEYB 5FR3A 4QRSB 2Y6SD 1SJXA 3QORA 3OX8B 1U33A 4UDTA 2IALB 3EFFB 3SGKC 4R4FH 4S1DD 1J9TA 1EFQA 1Q9WA 1HCYA 5F96L 3SDCD 1T2QL 3QUML 4JR9L 5E4EB 4ZTOL 3DTDA 2YUXA 4N0RA 5JXEA 4E9TA 5EO9A 3RTQA 3N1GC 3D50A 3ETTA 5G4MA 3V5HB 5I15H 2OMTA 4IIQC 2VR4A 4JM4H 2IDCA 2H0JA 3KPLA 1A6AB 3HMXH 3RWJB 4YSDA 2YD9A 3B3BA 4N6QA 2KYIA 1YEEH 4L4VB 3KR3L 4F7CB 2OMZA 3IWUA 3A6CL 4OLYH 4TOYL 4X4ME 3ZQWA 3SY6A 4OF7A 1PSKL 3VXSD 4K3HA 1AGFA 2RQEA 1CBJA 4PPTA 3MRFA 2VAAA 3WY4A 3QH3B 1A7OH 1JDCA 4G8FB 3DTXB 1P4LB 5EPMB 3OB8A 1EBPA 3S37L 2AJVH 1R0AL 1SFDA 4PUBH 4HIIA 3U7YL 2BOBB 5JIIA 1JBJA 2GC4C 1ET8A 4EBQH 3LN4B 3QUXA 1SJVA 4HKJA 3J07A 3I3EA 2HZHA 3IU3A 2Q76B 3KYKL 4RSVA 1F56A 4G71B 1FBIL 1RH8A 1YQVL 3G5VB 5BRZB 3HR5B 1JWMB 4GG8A 4W9EC 1DQML 1VZGA 2Q9OA 3MUGB 3OJDA 1I7TA 4G6ML 1BV8A 2R1XA 2J25A 2G5BB 4NPYB 2W0LA 1DBKH 4ZFQA 4BM7A 2AK4E 4HXAH 4FTVE 1OGAA 1NC4B 1KBGL 4HEPA 5D2NB 4GH7B 3JZYA 2B16A 1SLUA 3FQWA 4TTDC 4MBRA 3T2NH 2W91A 1BCIA 2VLRE 2BP3A 3LKOB 2YK1H 2C4FU 3FU0A 4XNZB 4M5ZH 4CAGA 4PGJA 5SWQB 4R26L 2AMUA 4KPHH 1BPVA 4WW2A 2ATKA 4K55A 5DZJA 4HEMA 5EH1A 3D0LA 3FT1A 3V0IA 1Q0XH 4LPCA 1IBFA 1IC7H 2YQGA 4OLUL 3WFHA 1EZLA 4AG4H 4XN7A 4N3TA 1EJ8A 5C08E 3HNTH 2PYEA 1QTYT 3P3TA 5CGBA 3OL2A 4AYFA 1FVEB 2YQBA 4HWNA 4TUJB 5BRQA 1MN4A 2XWBB 3B9KC 4ALAC 5LDSA 1UWGH 3WSQL 3ZZLA 2A9MH 1AD9A 3KJ4B 4CRPA 4OCRL 2YZ8A 1M7UA 3CFNA 1BSIA 3SDYH 3KXFE 4N2HA 3MACL 3FZUD 2WO3B 1E42A 1KGYE 2ITCB 2A1WH 5EU7C 1DTUA 2XNAB 3CFJA 3KYNA 1W16A 5KSVA 1C5DB 3TT1H 3LDBB 2EIMB 3LEXA 2CJUL 1VACB 1RP9A 4ABWA 1AKJA 3S8WA 5FKPB 2WVUA 4YHKH 3QEHB 3VYPA 1N5AA 3B3IB 1AKPA 3CPUA 1JCVA 4XB7A 4O02B 3WHE1 1HL4A 4LMQE 1F4XL 3WXWL 2VXSL 5HDWA 3HZMA 5JW4N 2RFXA 2CMRH 4U33A 4AYDC 1FAKT 3OPUA 5AB1A 3TWCL 1QVOB 1YEKH 2J72A 4FXTA 3V0WL 4LFHG 5EF1A 2W95A 2G5RA 4KZEH 2VLME 2EXSA 4IRZA 1O75A 1T1WA 3L1GA 3MGTA 1WZLA 1GYCA 2BP0B 2VLKE 1R34A 3RGVB 3S3DB 3A23A 3TEXA 1V8HA 4HKJB 3NSCA 4WI0A 1RD6A 2F19L 3OKOB 1IFHH 4Y4HA 4FNPA 5HHXH 3L7EA 4IBWA 5EBLB 3U9PH 3DIDA 5D1QA 4BA0A 4ZZKA 2PO6B 3O0LA 1RZJL 3E1F1 1PZDA 3GRWH 3N2JA 3ARGB 3O8XC 5FYJD 1F4WL 2XACC 1V3KA 4HIJA 4HUUB 2Q8AL 4GY4A 3NK4A 5I8EA 2FATH 3VXQB 1IJ9A 4GKZB 3DX8A 3VI3A 4KVPA 4XB3A 5GZOD 4LOEA 3Q2WA 5E70A 4UILL 5HI4D 3E8UL 5FDWA 1BAFL 4BKSC 1OF2B 4R2GB 3E7JA 1AOZA 1PKQA 1SEQL 2JQAA 3QS3A 4HVBA 3MBXL 3WFCH 2ZXBA 5J3HD 4N0YH 1XSKA 4FLHA 3FU5A 1D5BA 1HE7A 3F2LA 4YEFA 1M6UA 1WTGT 3ARFA 4KGJA 5A7EA 1WITA 2QEJA 2XETA 3T0BA 1HOCB 3F6LA 4R84A 2ALWA 4MMZC 2Z91B 4UB0H 4KDTA 4AYEC 2UZIL 3TVMC 3VWJA 3WTXA 2HN7A 2Y2TA 3CU7A 1JGVH 1MW1A 3GYRA 2F61A 1OT2A 2WGXA 4NN6B 2C5DC 4WU5A 1DBMH 5L7XL 2L7JA 1MLBB 2R0LL 3R8QA 3VRJB 3LN5B 2H6OA 1V3JA 3B9KD 3DX9B 1N7MH 3FFCB 4FMVA 1MCHA 3TO4A 1NGPH 4PJHB 4HKBA 3MLZH 3T08A 4P4RB 1CE1L 2AZAA 5C92A 3HG3A 5SWSD 2XU9A 2LAGB 4PLJC 4JG0L 3BJ91 5CP7A 2MIZA 2ZX7A 5IHHA 3C5ZB 3C5JB 4DZ8A 3OGOE 4G59C 4L97A 3JTSA 3MFFB 4L4TB 3PWLB 4WEEA 5FF6A 2X4SA 4CVZB 5EF3A 4M62L 2BSBA 3MRJB 5LLIC 5D7SH 1NGXA 1VFUA 3GSQA 2K0RA 4PVBA 1A7RH 4G6AD 4XMKH 4QRTB 1OW0A 5JUEL 3ATEA 3H42H 3HRZB 4X99A 3QO1B 1YMHA 4HPOH 2FJHB 4GMSH 3SODB 2VKWA 4AIZA 1SHSA 1TVBA 2WNWA 4F33B 1YY9D 2DMCA 2E4FA 4FFYA 4G9FE 4J3SA 1WA2X 2D7NA 4X5WA 1KGIA 3O6ML 5JDSA 5BMFL 1WS8A 1FSKB 3STBA 3ZT6A 4BFRA 4OKDA 4KVNL 2EUXA 4FXKA 3AROA 4EI5A 4XHJC 4M61B 3P3YA 5B7EA 1NFDA 3VI3F 5BVJB 4EE2A 1GA2A 5E51A 4L8DA 1JNNL 2NTFB 2PO6D 1V7MH 2CAKA 4ZXBA 1MVUA 3DV6B 4N0CC 3UTPD 5HP5A 2EZ0C 3QDAA 5EV7A 3T3MB 3K6IA 1NAMA 5KSAA 4RMRA 5GRJH 2TSBA 2DKSA 1XSOA 5CCKL 3RDTB 2EABA 1JUFA 1EHKB 2DWEA 3FHEA 4KZCA 4D9LH 4YE4L 4J3VA 1T6VN 3RU8H 2FGZA 5J6GB 1K4CB 2Y25A 3G08A 2DQUL 1RZKC 4GRLA 2NTFA 4MJIB 4CGUB 2B08A 4DUWA 3EGSB 4XAWH 5LUMA 3FUJA 3OWRA 3OXRB 4HUXA 4CMHC 4RETB 5JIQA 5E95B 1J11A 4AM0Q 2Q5BA 4DO4A 2QR0A 3CC5B 4ZX3A 1J05B 2EDFA 2EUZA 3GHEL 4JO2H 2H0PA 3VI4B 5C09D 3VA6A 4H2AA 1H5BB 4JY4A 4XAKD 5ICXA 5LBSH 4XNQA 4NRYA 3KPRA 2KKQA 1EGJL 2XN9B 4JEGB 1WIPA 4ISVA 3LQAL 1JTTA 3G5VA 5DJZA 2PPFA 5CZKA 3C5ZC 9CGTA 2AGJH 3EH5B 2EYSB 1AI1L 2Q8BL 4Z7VA 4ODSH 1TQCB 4ZO9A 5AUMA 3WE1A 4PRDA 1TETH 1SGKA 4OZ4A 3V10A 5KVEL 1EJOH 1ACCA 1SEBA 3QJUB 3RKDC 4F9PC 3QXVA 1KBWA 2BXYA 3VYOA 1KLFB 3AXIA 4YIQA 5B8CC 3LNGA 2VLRA 1F4HA 3ZSTA 4N5EC 3GM8A 3O81A 4MA8H 3FTGA 1IC7L 3KDMA 3V0WH 4WI3A 3IT8D 4HJ0D 1X4YA 4LCYA 1U92A 1QI3A 5EZLB 35C8H 2C3XA 1ZV5A 1K5WA 5IFAH 1WD9A 2BSSB 3P0GB 5KVGH 1ZIBA 4ZMOA 4F7PB 3RLSA 1YEDB 2FIKB 4TQ8A 2C1PA 4KVCL 5DMIH 5GZNA 1URLA 2N7BA 3AXHA 3L5XH 3RTQC 1WP6A 1PD1A 5IOPA 3HFMH 1B4JH 4MCNA 3L4CA 3M7FB 3MOAH 4DP4X 3KWXA 2BNQA 3K1DA 4YAQA 5D1ZI 1ANUA 2JKWA 1ONQB 3W5NA 1A3ZA 2NT0A 3VH8G 5EZIH 5FAAA 3FPYA 5HYJE 3IU4L 4GQPH 3MHZA 3NTCH 3KH3A 1E43A 1MFUA 4AYBA 2F18A 5DC4B 5FYLD 3O3BA 1LO3H 3PHQB 1GYAA 5F7NC 4GSRA 4D9LL 1MCFA 3V4VA 5CAYB 3RTLA 3Q06A 3IRCA 5DYOB 3WHXB 4QXUH 2AVFA 4Q14A 1G4MA 3TPKA 1WFIA 2DQJH 3CDYA 2XTJE 3MRGA 4WFED 1P69B 6PAZA 3IDMA 4I3RH 2GG1A 2UX6A 2P5WA 5C6WH 2YSTA 3DURB 3QHTC 5DMKB 2Y7MA 1XHHA 3QUZA 4FG0A 4U1HB 1TJXA 4KTYA 1ZAGA 1QW9A 1VRSA 4D2NA 1TT6A 2OL3L 4QO1A 5EEWA 4W9ZA 1T1WB 4K23H 2D7MA 5IB3A 2OZNA 1OPOA 2Y7NA 3RZCD 3DPDA 4FNLH 3CX5J 4NZ8A 4WWKC 4HS8L 5EU6E 5LAPA 4DPAX 3ILDA 5GIRB 3QYNA 4H4NA 3EJYC 1KIQA 4KXZI 1PDKA 2B77A 2F54D 2VXQL 5D1QE 4UTAL 5TE7H 5J11B 3RDTD 1KBVA 4WAFA 2YWYA 1WHPA 1M2VA 2ESVD 3PJLA 1FQ9C 4GFTB 1U36A 1WAAF 5L88H 1IM3D 4N25A 2QHRH 4N9GA 4BZ2L 4A2LA 4ODTL 1F86A 1KLFA 43CAA 1LMKA 1ACYH 1N8OE 4UQBA 4PJ8B 5DUBB 3E2HB 3QIWA 3ASNB 3NRFA 4RA3A 1W72H 1ACYL 4ES9A 3FH8A 5D7IB 1MF2H 2HXAA 1RK7A 4H8WC 1HKLL 4WLCA 3QIWC 4CN1A 5CGTA 3KR3H 4B95C 3V4PB 2HJLA 1FZMB 3BEWA 5DRNA 2H3NA 4NO2B 2ZCZA 3S4SA 5EC2A 1K72A 1IAIH 1DLFL 2VB5A 1U8KA 3PUCA 1M71B 1SDAB 2A1WL 3QR1A 2X2HA 4WQOA 4XN4A 3WFHB 3ZKSD 1QWHA 3KPSE 2O5YH 4JRFA 2X42A 2WYIA 3BEVA 4ZFOB 3BKJH 5ACZA 1T80A 2JKIS 4FI6A 2WQSA 6CGTA 4MS8C 1C08A 1OO2A 1JYXA 3BHBA 5FM4A 1G0DA 3LEYL 4U3XA 4KX7A 4TOYH 2V5YA 4MMXA 3QIBC 3LEYH 1WA1X 3QHFH 4C83A 1E4WH 5AVUB 4F58L 4KY1H 3TH4T 4UYPA 4FKEA 4JL2A 1BQHG 2ZXEB 3H2PA 2A73B 3QQ9D 3EYQC 3TZVB 1A25A 5IR1A 5JOFA 5FYJL 1OZUA 1IKFL 1G0XA 1JGIA 5TH2B 1Q1JH 3N04A 2OR7A 4FFZL 5AOIA 5ECJE 3V6OE 2G30A 5E2JA 5FF6B 2XQBL 4YXKH 2VLKB 3ZL1A 3FCTA 4IM8A 1ZK5A 3JTSB 3U46A 3Q1SL 4WSJA 2W9DL 4HXAL 3PL6A 2GSIB 2WINB 3NFPB 4LLDA 3GQFA 3DOIA 4UU9A 2APTA 5KYUA 3TPUA 3T2LA 2MMXA 4N2LA 1A65A 4LSVH 4P59H 4Y8AA 1Q4NX 4OZHA 5JQHC 5LQBH 1X5GA 4RFNC 5SX4H 3V6FB 1IM9B 1QUNA 2XZQL 1WWBX 1P7KB 4Z95H 5HI5C 5T1KB 1M2VB 3QULA 1MRCL 2VRKA 3IAQA 2V3FA 3QZMA 1LGVA 2ICWI 1A6WH 1TDQA 5JTWA 2EILB 1V3MA 3SQBB 1JN6A 3HUJF 3I2CH 3MUHL 3GHBL 1AZNA 1FL5B 5DHYA 5HHMD 3F05A 3VE0B 5C71A 4GKLA 1I1RA 2VR7A 5GS2D 3UYRH 5MENB 3BRGC 3HRPA 1ILUA 5IBTH 3SDCB 2H6PB 4MCYB 1MHPL 4KFZC 3TJEH 3MOBL 2PTTA 4OLVH 2V17H 3V0DA 4O51A 3QUZB 2WUBL 2WXIA 1TTFA 4X6EA 5AVVB 5FXCH 1IQDA 2N01B 4LCWA 3U2SB 3MROB 1HJBC 5C08B 1PTZA 3ILQD 1ZCRA 4PRPA 3DBXA 3BGFB 3NJFA 4HAGA 5MEOB 4NCDA 1NGQL 2QGCA 3SDDD 4BD4A 1QVOA 3LQAH 1YYCA 3KPNA 3RHWF 5KVDL 4PREA 1UOVA 4K7PH 5K93A 4QMEA 2GJZB 5D72H 3ULVF 1F90H 1OALA 3ZUCA 3KPRE 2EVFA 5T3XL 2ZWZA 5FYJE 4GJTB 1BVLA 3DETC 2QADB 3B2DC 1A66A 2I32A 1CZ8H 1R3KB 1AD0B 3PABB 4RIRA 4XXDB 1GPOL 4H40A 4W81A 5DK2B 3BZ5A 1VB9A 3C6LD 5E8NA 5JQ6L 5ESVA 3THML 4W6YB 4F1SA 2C3WA 2ZPKH 3GGWB 1OT1A 2COVD 3KWTA 2VE6B 2PWEA 3H4HA 4JFUA 4C47A 5GGTA 1GHFH 2PYFA 3LJ3A 3ZVVA 1CBVL 5BOJA 3DRTB 5AENA 2DIAA 2H6UA 1K85A 3BEWB 5DRNB 4F27A 1AZVA 1OE3A 3L95A 1ZHLB 3BGMA 3O4LD 2WMPB 2HX8A 5FYKE 5D71H 1E5YA 1DQLL 3QXAB 3F6JA 3HLAA 3CDGB 4HZAA 4FQPA 2X2YA 4QF1A 3B43A 2VUKA 4MCMA 4DTGL 1EQWA 2F53B 1TJGL 2X3CA 2Z65C 4FA6A 4XNXL 2MPAH 2XV2A 1Z0NA 4CC0A 5K9OA 2GKIA 3EBHA 2AV1A 2EDHA 3PGCA 5J57B 4CL7A 5SWSE 1E5UI 1OWWA 3UAAA 3NA9H 3D9AL 4MD0B 4X80L 3DRQB 4X4YB 4K5OA 1E90A 4OBRA 5HHOB 1A3RL 4GKSA 1GW6A 4YDVB 3MV7D 1KCRL 4NI3A 1C8PA 1IGJB 5E5LA 5F9OH 3QNXB 1J0ZA 5DRZB 5F3FA 1HINH 4JPIB 3BWUC 2FSEB 3Q9PA 5IBTL 4KOBA 3I6KB 5IB1A 1SYSB 1TZIB 3FB7B 1Q9LB 4MQXD 4P2QE 4ZJ9A 1KJ3H 4FULA 3TJHD 3EJPA 4A6YH 4JQXC 1YUHB 5KYWB 5JORA 2Z4QA 1OD7A 1DJXA 3QCTH 3ZDYB 1SY6H 1WIOA 1GYUA 3MLVL 1KJ2L 4N3UA 4Y16D 3UX9B 5KW9L 4E9XA 4HIXL 4JQXA 1EEZA 1KG0A 5BZWB 3ULUE 2W60B 2C34A 1I9RH 2Y36H 2UXFA 4ZMVA 3NZ8A 3DX7B 4HWEL 1FWXA 4HJTA 3CVIH 3TT3H 3BIAX 1PF3A 3CLEL 4X5XB 5LHDA 3BYTA 3NMEA 3Q2CA 4M9PA 4HJ0C 3CBKB 3MCG1 4J28A 4CW1A 3ISYA 2ROYA 1SOSA 4NBYB 2CDFB 2NY2C 2Z64C 2HJKA 4UAHA 3QISA 1C9SA 3VG0L 1F3DH 5EIIG 3L48A 4G72B 3OKNB 4XNYH 5KN5A 1HILA 2WJ7A 1E8XA 1J8KA 3GIVA 1VGEL 1WZMA 2IH8A 1QBBA 1CXEA 1JWSB 2WNKA 5JMOC 5J1SC 9PCYA 2A74B 3LCYA 1JERA 2IGTA 3AQDA 3LKQB 4XVUD 2HT4D 3VFUA 3MOQA 3RP1A 3UJIH 5I1GH 3QCUH 1S7RB 2P8MA 1LL1A 3QJTB 3UO1L 1R3HA 4POZD 2K1MA 3CIQA 4AT6B 1MFDL 1VFOA 2ADFL 5DGQA 4U1JB 1L5GB 3D6GA 3HBGA 4KKCC 4Z77B 5AL0A 5B39G 4POUB 3SE9L 2BSTA 1N5YL 2XIBA 4F7PA 1NPUA 4UDTB 4N8UA 3UTSA 4MXQD 1WBXA 5CINH 3LZOA