2BSDA

Structure of lactococcal bacteriophage p2 receptor binding protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
254
Chain Sequence
TIKNFTFFGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcal Bacteriophage P2 Receptor-Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Enterobacteria phage p2
molecule tags Receptor
molecule keywords RECEPTOR BINDING PROTEIN
total genus 60
structure length 254
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bsdA02
2.60.520.10 Mainly Beta Sandwich Triple-stranded beta-helix Phage fibre proteins 2bsdA01
2F0CA 3HG0A 4RGGA 2BSDA 3D8MA 4IOSA 3EJCA 4HEMA 4L99A 3U6XA 4RGAA 2BSEA 4L92A 2X53A 4L9BA 2WZPA 1ZRUA 4L97A 3DA0A 4HEPA
chains in the Genus database with same CATH superfamily
1ZHNA 2WPGA 4CVUA 4A66A 2ETWA 3T6WA 1WFOA 2F53A 2APVA 5FYJU 1FFOB 1G4MA 1YNTB 1TVHB 3PGFL 4NRYA 5HI4D 4BK5A 1N64L 2YD2A 4BSVA 2Y36H 2B08A 2OSLA 4X80L 3VU2A 4E9TA 3S97C 2BW4A 2GJ6B 3LN5A 1N64H 3KDMB 2P8MA 4H0GA 3RHWF 3LZFH 1OWWA 4YX2H 4X99B 5ITBL 1UWGH 2WXLA 3DX6B 4ZAKA 1NCCH 3HMXL 3U7WH 3KWVA 1X7SA 2HKFH 3S36H 3PIQB 4J2XA 4MD0B 2OR8A 2R2EA 1E2WA 2I07B 2UV3A 1P1VA 3V95A 4G6JL 4V1DB 2DZEA 5G55A 1QPPA 1UJ3C 4IJ3B 1CBVH 2KQNA 3L3HB 4YZFE 1FG9C 2JCCB 1N59B 1VCBC 2VXVH 4DTGH 2WQUA 3EF4A 4LSTH 3GXDA 1RZKL 4WK0B 3SYPA 1PZ5A 1KPRA 4YSQA 1IC4H 4IKNA 3GNML 1FL6B 1A6TA 3H1ZA 1RUMH 1HOCB 3K8KA 3O2DH 4FRWA 3MMEB 1DVFC 3LIZH 4M1GL 1MNNA 2XETA 4S1SH 2EDEA 4PJ7F 3IS0X 4A1RA 4QXTB 1G9NC 3T1FB 5CJ5A 3INUL 2X38A 3L7EB 2BWDA 4ABQA 4L4TA 3ZE1E 5IW1B 2VW6A 1Q9WB 4FNTA 5GGUB 2WLLA 3IJEB 1CICC 4G9FD 4IBTA 4JZOA 2FX8L 2GCYA 2HLAA 4ORGB 2HRHA 4HGKC 2ITDA 2Z35A 4KRPD 3LY6A 5AAMC 1MCOL 2WIMA 3VD3A 1IEAA 3T2NL 5TDNA 4XMUA 1MHCA 2D3VA 1H3WM 5IQ9A 2I69A 2J4WL 3TPUA 1NIBA 2GHWB 2IOIA 5ADOL 3T1FA 2PXYD 1TQBB 1X5XA 3ZT7A 3S48A 3VE0A 3K80A 4UT9L 1XGQB 3A67H 5HHVL 2VLRD 3ZMRA 5FOBB 1L6XA 4ZX4A 4GKZA 1CTNA 4XNZC 5F7EH 1ADQA 3P30H 2BY0A 2Z8VC 5B7FA 2ENPA 3KLLA 3NOIA 1R6VA 1XH3B 1FVDB 1O7VA 5CEZL 2EEAA 1IC7H 2GTWA 2LFEA 5K1NA 2BVYA 1H5BA 2YOAA 3LXCA 4Z23A 5IW6B 5LN4A 4NUPA 1F6AA 1JD9A 4WAFA 3RA7H 1UWEL 4PJFF 1S9XB 1T83A 1KJVA 1YDPA 5AW5B 3SDCB 2KDGA 4A37A 1U8QB 1A9VA 2DM7A 2VDQH 3GSRA 2D73A 4ZD3H 3P4OA 4ODUB 5C0FB 1EMTH 5E99L 2NY2B 3QZWA 3GGWB 3V9FA 1MCPL 3ASWA 4YHZH 2P5WA 1KBKA 1ZK9A 1RIVH 2P4AB 3Q7JA 2ATAA 3OKKA 3G5ZA 5A2AA 3C5ZC 4WY7H 2X53A 5FLUA 5T1MB 1G5AA 4KKBD 1L9OA 3IMTA 2OZNA 3FU0A 3US9A 1OCWL 4X4XA 3AXLA 4HFWB 4RRPG 1JNNL 3I50L 3GI9H 3QDMB 5F7WC 3FRPG 2QGEA 4P48A 3T77B 4H20L 4W4OC 1CXFA 1BVNT 2ZKWA 3I9AA 3ARFA 3LEVH 2DLIA 3E3QC 5CEYA 3MNZB 4DF9A 1BVKA 1HAWA 4P2YA 4UTAL 4ZFFB 1RAMA 3L3KA 3GFUA 3K0WA 4A6YH 2C3HA 3MRHB 3F83A 3VGAB 2DJMA 1EXHA 4N20A 3FL7A 5JUEH 4XC1H 5DK2B 4YWGH 4AEHL 2XPYA 3MOBL 4KK9D 4BH8B 3HBGA 1SHSA 4JG9A 5B8CC 4Y9CA 5DJ0A 4KHTL 2YRPA 3D0VB 3ARDD 3VI4F 3N04A 3OVUB 4OV5B 4BQCA 3KPPB 2LU5A 1JXGA 4PHXA 3RNKB 5IB1B 1G7MA 3WHE0 4B7LA 1FZOA 3UTTE 2ZP0T 1XGRB 4DFHA 4PJAE 1A7QH 1FZJA 4MKMA 3D39D 3I9IA 3KNBA 1R17A 5E1IA 3WAKA 3MLUH 3RL1A 2WXJA 2XN0A 2AKRB 4L3CB 2FBJL 5B38B 2IH1A 1SXCA 5PAZA 4E42A 4DKDC 1S7RA 4JO4L 2WMPA 2UZXA 3VXMA 2WP3O 2CQVA 1CGUA 1JZ6A 3IWVA 3FSOA 1KCLA 4U1GC 3VGGA 15C8H 5IEHA 5DJDA 3WMQA 4M5ZH 2YC1A 1K8DA 3PWVB 1IJNA 3GSWB 2XQYA 4AYID 2FB4L 4HC1L 3L2MA 1UOWA 2V2WB 2NTFB 5DUPL 5HXMA 1FJ1A 2MQ0A 4AQ8A 1MCRA 2J20A 4JZNA 3OZ9H 1NCHA 4XCEB 1KB5A 1L9TA 1URLA 4QHMB 4Y2DD 1QUNA 4WDIB 1HCZA 5EO9A 4Q97A 3NT0A 3CZUB 1E27B 4RNRB 4L3ED 4NZTH 3T2PA 4Z7UF 4KK8C 4AH2B 1GPOL 3QCTL 4G6KL 2CRMA 2ARWA 1MZZA 4GH7B 4WHTB 2FDBP 5EA0H 4WO4D 3QDGD 3QZMA 4XPTH 3SQOH 5I6KA 3ZR5A 1JK8B 1JGIA 2DMCA 3D69B 4F7EB 3GSNH 3ATAA 3CHQA 1E27A 4HPOL 2UWEA 4NUQA 1NCDH 2FBRA 3FFCE 1FE8H 4FA8A 1PLAA 4P57B 5H35A 3E0GA 2W8CA 3SPHA 3DYOA 1NCCL 3HMXH 1U8KA 4R0LB 4WHTA 4FQIH 3CHSA 4KOCA 2P80A 5EN2A 1QASA 3I6LD 4P5KA 3NIFE 3LKNB 1ZHKA 2HT2D 1CLOL 4XVJH 5F1SA 5AVVB 4OZFA 5GS1C 1F4WL 3CMOH 1C5DA 4ODHL 4AI7A 4PB0L 3K91A 3W0WD 3MJ7B 4AYGA 3GBMH 3S3SA 4XX1G 4AE0A 5T3ZL 4AENB 4D9RD 1RZKC 1TTAA 2DQDH 4KQ4H 2PPEA 1DJZA 2HKHL 5LNEA 1P5VA 4Y1AE 2OFQA 2JCCF 1FGNL 4I9WD 4AUUA 2JELL 1LK3H 4FQXC 2IDFA 2N01B 3VXPB 2VW7A 4JR9L 5FR3A 4JN1L 1IM3D 1RVFL 4JFUA 4LQ1A 1RZQA 1DVFB 1OAYL 2NXZD 2OW6A 2RJMA 3OKDA 4Q52A 3B9VA 3KGUA 1IAOA 5FHAL 2Q7YA 1IFHH 2EIZB 3DPDA 4IDLA 4QHPA 1TR7A 2E76C 4EDWH 3QB7C 5DQJA 1T7VA 3L5XH 3T1WA 5HYSB 1SXNA 5F7AA 1YPZF 1Y1UA 3QG7H 3DUSB 2CM5A 2NY2C 4XXCA 3HN8A 1MWAA 1CQYA 4ODSH 4K71B 2RA1A 2X3BA 4LLVB 5BV7H 1IGJB 4U3CA 5EFIA 2XFGB 1BJMA 3D9AL 3GBNL 4G8EB 2ESVA 5KANI 4E9RA 1HHKA 3KXFD 1L0YA 2WTRA 2X4OA 3GMOB 4WWKD 3HG1D 2IIJA 1FBIL 2PXYC 4BQBA 4Y4HD 1FAKT 3PG2A 3C5XA 4IMLA 2EIEA 2GUOA 3QWRA 3FQTA 4OZIA 2IFFL 2WUBL 2FWSA 4YHML 3DGGB 1A3LH 2XC8A 5E8NB 4W70A 3OF6D 1BFSA 4J7RA 4LCWB 1KTLA 5DD0L 2MOVA 2FHBA 4N24A 3FSAA 2IAMA 4R9HA 3QORA 3P4NA 4RGMC 3VFRA 3ZOAA 1C5CH 4Z7IA 4I8DA 4MJ2A 2OA9A 4IRJD 5IVNA 2GBVA 2EYRB 1NGQL 2FTAA 2GBAA 2V8LA 1D7FA 3IJ9A 4N90D 4YEFA 1VIWA 3QPQD 4MMYA 2X4TA 3U4BH 3X12A 5KVGH 2HRPH 2P7TA 2F8VA 3NA4A 2QQKL 3VTAA 5AYTA 3C60D 3ILPA 4U4BA 4R2GD 3U82B 1DQLL 4R7VA 2Y2YA 5AL8A 5B7EA 3Q43A 2FX7L 4WW1A 4P23C 2RGSA 5CSZA 1AAJA 5I2IA 1OOAA 1EFXD 4GSRA 1I7RB 1BZOA 4LBEB 5E08L 3G6DL 3M8OL 4OCMC 4XHJD 2LOEA 5EEUA 4X8XA 2IGFL 3QIWC 1FF5A 4P8QA 1XF5B 3NFSH 1ZJBA 4F7CB 2K8QA 4H8WC 3UG3A 4B5ZA 1WJ3A 4PJGA 2QFRA 4Z7VE 1CD8A 3DMMD 1BZ7B 2C3GA 1MQKH 2WLMA 1JXFA 1RLWA 4PJIA 4NBZB 2OZ4L 2K7PA 2Y7QB 4H4NA 4NQUA 2DDQL 4BFOA 4Z7OB 1EBAA 4L8DA 4HLZG 2GVYA 4PQXA 4UBDC 5K9KB 3CDYA 4B3VA 2X4NB 2E7CA 3OJ2C 3HAEA 3U0WH 5T1KB 1FZOB 2W80C 3GRWH 4XMXA 4LCWD 4ZW5A 1BMGA 1BIHA 3EHBB 1XMEB 3DXAA 3K8LA 3IXTB 3EYOB 3NIDB 4PD4J 1P4LB 3VRJA 3C5ZA 2VMEA 3BI9X 3STZA 4OZIE 1S7WB 4EDWL 3BXNA 1CGYA 4LSRH 3PWUB 1NGXA 3PP3K 2YIHA 1O6VA 4YHIB 3FFCB 3L9BA 5ICZA 2X70A 2DQIL 1EERB 3FB6B 2V3EA 1I3RA 1BLIA 3CHXA 4FLRA 2IADA 4X4ZA 4B0MB 2WQSA 2CDGA 5KN5B 3DROA 1OKEA 3BN9C 3K71A 3STLA 3VXNB 3BAYA 3KYOA 5IBUG 4OJEH 5FYKD 5B1JA 3SBWA 4AV4A 4GRLA 5SWQB 2O5ZL 3DXAB 4RZKA 5D71L 2OAAA 4ACTA 3VYNA 2ZCHH 5AYQA 3MU3A 3RVXD 3H6JA 3GDCA 1CFSB 1Q1JH 3FYEB 4JN2A 4DNLA 2DQUL 3ZTJG 1IBFA 2OL3L 5KZCD 2YPLD 1L9PA 2ADIB 1GGTA 5CP7B 2J21A 2VKXA 4WEMB 5AVRB 2OSWA 2HRGA 2NXYC 1FVEA 1T0NA 3FB6A 4K3EH 3CX5K 5FO8B 1OP4A 5C08E 4M1DL 7TAAA 2FNBA 3IRPX 3GBNH 4X6FA 5EU6D 1HE8A 1ZY9A 3T4AB 4HETA 3M86A 1GHFH 4NLAA 5LKNA 1YLBB 5KOMC 2DL9A 1SJHA 3EOAA 4HS6B 5C0DB 5K39B 2Z4TA 1BD2E 1AMXA 1QSVA 2PR4H 2R23B 2WAHA 4TUJA 3C60A 4APXB 4DPAX 2DI8A 1R75A 3NIFB 1PTZA 2Y25A 4Y1AA 3MXWL 4KKLC 2BSED 1R9FA 1I9IH 4HF5L 2AQNA 1L0XA 4JFZH 4JHUA 3DX1A 4ABVA 1FV1B 1XB8A 1YG9A 1TKWA 5GSVB 3BIKB 4MDJA 1RP8A 4U7SA 4K23L 4HG4K 4NN7B 4BQ6A 2HTLD 3FO9A 3O4LB 3D87B 3HBPA 3VACA 3ZDXB 5DQ9B 1OP3H 3EOAB 4HS6A 5C0DA 1C9SA 1E6OH 4Z5RA 4YHLL 1Q0YL 2D8KA 1BX2B 5HJBA 2VDMB 4MNHA 4LAQL 1A4CA 1QA9A 2RQ8A 1ITBB 1FN4B 1YEIH 3VFSA 5HYEA 4I77H 5IEKB 1RJCA 5CN3A 1BQHB 5IBUB 1X5LA 5F8QC 1W2KT 2H26A 5EIIB 1YHPA 4Y8AA 2OMNA 3V6OA 4BGDA 4Y16C 2VABB 4TNWK 5ADPL 3IDUA 4X0KA 1XXDC 3HNSH 3FTYA 2B4CL 2J73A 3MOQA 3L5JA 4KO6A 1ZTXE 3QFJA 3PQYD 4QF1B 1OGAD 2WNKA 4H8HA 3SBQA 4F37K 3X3FH 4EBQL 4TYUA 5SX4I 5T33H 1CC3A 1FL5B 3NBNA 3EG9A 1BFOB 4NRXA 3CBKB 3FCSB 3EJYC 2A38A 3T4YB 1TJXA 3TO2A 3QDME 1F3DJ 2ED8A 1ZLVH 2VJXA 3LPGA 1MCBA 1QYGL 4YFDB 2AEPL 3J2PA 3QIBD 3NABH 4WV1B 5C08B 1HESA 2XWEA 5T5FL 4ODVH 3A4AA 1P7BA 2EECA 3QZPA 5ERWB 3F01A 1QRNA 2AXFA 5EBMA 4ZZKA 3DPBB 4NC1E 5EWIH 2R0WL 3ARUA 2JNZA 3UIYA 1YUHB 2OMUA 2I25N 3OMIB 5JLZB 2NY4C 2CPUA 4WCYL 1AOZA 3CXHK 5IFAH 5JPNC 4HS3B 2P80D 1UT9A 3NESA 4I1RA 4JPQA 4OY9A 3VFWA 5FO9A 4WK4B 3DO7A 1URIA 3BMWA 3AZUA 4HUXA 1A1OA 3WN5A 4WI7A 2YD8A 3D85D 5ESAA 4W93A 2XA3A 3TNNA 4G8FB 2HVJA 4X9GA 3VXRA 4EPSA 4WZ9A 4X2UA 1GHFL 2FO8A 4EIBA 3GXIA 4ZW7A 1P53A 1UM4H 3PLYA 4NBYB 1NLBL 2ODIA 3SDXA 3MNDA 1R5WB 1GSKA 3PQYB 1X5YA 3O6LH 4DHLA 2PW2B 1OAUL 2J5LB 1RSYA 5F6IB 1TJGL 3SPVB 2BY1A 2VH5L 2ATKB 3CSFA 4JG1L 4RAUA 4WO4B 5D96B 5IMOA 3FONA 4LCWE 5IFJB 4J4PC 1RULL 3DV4A 1MCWW 1ZANH 3W5NA 1AHKA 4GNKB 4X6DB 3P11L 4ELME 3D25B 4FQLL 3L3JB 4DK6A 3DVGA 2GFBB 4FJYA 3OJDA 3R7QA 4AMKH 2ZQKA 1MJ7L 4ZXBD 2G3XA 3LEVL 4AGNA 4YVNA 3TC9A 2JV6A 2WNXA 3GHEL 3ZE2F 1J5CA 3SOBH 2MOGA 4ZZFA 3HUJF 1K4CA 3DSNB 5JUEL 4PN6A 2IQAA 5LCVH 4JLRA 3BEWA 2GTWB 3B4NA 4LARL 5DK0B 4XBPA 2DEYX 5J13C 1AR2A 3GTNA 3WIIL 4NQDD 1PCXA 1BEYL 4WUUE 4HWBL 1NCWH 4GW5B 5K9JH 4MAYB 4HWBH 4N87A 1OT4A 3ZKMC 3HNSL 3QNYB 4JM2A 2VDPH 1T0MA 4V1DE 1JTPA 4ALAH 1ZGLP 5MERA 3Q6FA 4FL4C 4IKIA 1LE9A 3V6BR 3FQXA 4M9PA 2BWQA 3QQXA 3TH3T 3FCGA 1WITA 5HPMB 1E0OB 4PYGA 1UA6L 1YY8A 2NY5L 5B4MD 1MIMH 3FFCA 1JPTH 3FPXA 3OSVA 4FXKC 3MDJA 4GW5A 3ZZSA 1R3JA 1UVQB 4XP1L 3HI5L 3GYRA 1WD8A 3QDAA 5ENWB 3S34H 3T65B 1CDUA 4JKPH 5E6IC 4ZUVA 3SQBA 5IB2B 5HHVH 1MELA 1AHWC 2GKIA 1H9VA 4FEIA 5HYQB 5JW3L 4XP9H 3NJHA 4IKKA 4WI3A 1MAKA 1GJWA 3TCTA 1PZ5B 3D07A 4NIKB 1SLXA 4XO9A 4MS8C 1H6FA 4AJYV 3U9WA 5C8JB 5DYOA 3QUYB 3MLRL 4ZUSA 4IS6A 4A67A 1UD6A 3ZDZE 2XZZA 1U3NA 1P4BL 3BX7C 3PQYE 5DJ0B 3BMVA 1FRGL 3UJIH 5I8KH 2I85A 1VPOH 1D5IL 1W6WA 2BNRA 3CN1A 3KM2A 4PPTA 4QHLB 1KYOK 5HYSG 3FB5A 1O0VA 3NZHH 5F7NC 3C6LB 2O30A 3RNKA 4OI7A 2OS7A 1KTKE 1MI5B 4N2FA 5C0AA 2CBQA 4LRNH 2BRQA 1WO2A 3F00A 4Y2OA 1UGKA 4IRJB 1KEGH 1T7ZA 1GTNA 3G5WA 3ZKNC 1N18A 3IJSB 4JFQA 2WOYA 5ANMB 4QKTA 5D2LB 3GI9L 3CQPA 3Q3GB 4P3DB 5LWYL 1Y18A 2ZOKA 5FYJD 1U58B 1XCQB 4N5UA 1CE1H 5IUSA 3NCMA 1SZNA 2DKUA 5BOZG 4Y2LA 5FYJH 3U7YH 1HZLA 2L8AA 1X3DA 1K8DB 3VXSB 1QEWA 1YYML 4FTVA 1JE6A 5C0JB 3F7YA 3ZT5A 5KAQF 4Z7QB 3MR9A 4GBXB 3CFTA 2N7AA 1M9WA 4I3RL 4UNTA 4XCCL 5HHXH 1S7UA 3W57A 4GRWB 1PSKL 3O4OC 4UB0H 4FNLL 1DYZA 4K71C 3IVKA 1FFQA 3GMNB 4OKVA 5DHDA 1S9XA 3NTCH 2VXVL 4F2FA 1WYJA 1U0QA 4MXVE 4XO5A 1WIUA 4JHWH 4LEOA 2B20A 3P4OB 1T80A 3AUWB 1GIGL 1EJOL 2CO4A 4I0PC 5AW7B 4HJTA 4NUJB 4DP2X 5HGGS 3AG3B 4AYBA 5HHNB 4J23A 4KK5D 2FGZA 5JA9A 4HGMA 2FHFA 2OXHB 5FA3A 3UJJH 4K3DL 5FYJE 3KLAA 3NFNA 4MZ2A 3ZQXA 2CRZA 4J2QA 4J12A 5EB9A 4GQZA 2UXGA 4Y5YA 2DI7A 4ENED 4I0PB 4MMXA 3ISYA 1M42A 4TRPH 4FZEH 4W9HC 5DWPA 3DX9A 5DMKB 4E0RA 3BJLA 4AXWB 2EXYC 3ABKB 4D0CA 2KI6A 3IJHA 4OZ4A 5KSVA 2WZ6A 1Z3GL 3DV6A 1XCTA 3MYJA 4J6RH 3BVDB 5DUML 4P2OA 4F7PA 1LEIB 3KM1A 4WWKC 4ZMLA 2QZ5A 1TLMA 2EZ0C 4DGYL 4ZUWA 1QSZA 5FECB 3BW9A 2C7UA 4WF7A 1P84K 4R84A 4XTRD 3LIZL 1KJ2A 5DD1L 2IALB 4J28A 2Q86A 4D0CB 2Z8WC 4CN6A 1QBMH 2EYSB 1HHJB 4G43B 1XCTB 2Z7WA 3N85L 4G1EB 4P2QB 5EO1A 1AQKH 1Z9PA 2OJZL 3QRBA 5K9OA 3L08A 3J07A 5EZIH 4YHMH 4W81A 3N41F 2P8PA 3DOHA 4XOEA 4PRPB 4JFTA 4PJ8A 1N0LA 2NW3A 1MWAH 3G5VA 2Y07H 4XPAL 3JVGC 2C4XA 4F1ZA 5D4HA 4JQIA 5IHBA 1CGSH 1EAPA 3M7OA 2Z1PA 1E65A 1DBKH 1P7QD 2D7OA 4KUCF 4OLUH 5EBGA 3REWA 3RPIB 3RYMA 2E59A 3S0PA 3ARPA 2YAEA 5CR1A 4Y7OC 3QUXB 3L3GA 4UT7L 2DS4A 4MNQB 3F7LA 2DOCA 5GS3A 4AUJA 3UBHA 1V05A 4YDMA 1DUZA 2HFGL 3P4MB 4MGXA 3TEZA 1X5IA 4LGPB 5DCCA 4EQ3A 5AKSA 1M2OA 3UTSD 1L7TL 3PWLB 1LJMA 3UO1H 1X7QA 1LNUA 2Y5QA 3R18A 4WFEE 2BVQB 4CADB 5E8DH 3BLBA 1AS6A 5KVEE 2ZXDA 1TTBA 5HHME 4CGUB 3AWFA 1I85A 2KYIA 4ODWA 4XC1L 3FU3A 3Q2VA 4GIOA 2BO0A 3U46A 1EO8L 3ABLB 3ZGHA 2YXFA 4N9GB 4DVBA 4RNRA 1WZ1L 1F3DH 4HCFA 1ACYH 2AP2A 4PJEB 5F1NA 5FOJA 5C6TH 2NNAA 3QJFA 3TEWA 1BM7A 2GUOB 4YDKH 1OF2A 3N06B 3MO1B 5DVNA 3DJZA 4B60A 4W9GC 4NXSA 2R69A 3BGAA 1UA3A 3L95B 4XN9A 3QW9A 2ZCLL 2ZJSH 4W68A 2ICWB 1U8NA 4MJJA 1JF1A 1XAKA 4F20A 1NAMB 3M1BB 4Y89A 4RISL 5FUZL 5D7SL 1NC2D 43C9A 2YPVA 4MMYB 5IT2L 4UBDD 5K1JA 2JKIS 1NCBH 3S7GA 2G0LA 1OGAA 2X9WA 3TWCL 2O6DA 4NJ9L 1JWMB 4O2EA 3GUTA 2WQWA 4M8UA 3QIBB 4DO5A 1YEEH 5TH2B 4NN5C 5BUPA 1CK0H 1P4UA 2Q8BH 4XPHL 2F53E 3WLBA 2VUOA 5F89A 1DSFH 4Y2DC 3CDGA 2IAND 5IFHL 43C9B 1NBYB 4HZAA 1B0WA 1ZT4A 3FBKA 5I16A 4PJBA 3ZGIA 5T33L 4ZO8A 3UABA 5IJVA 1GZPA 2DY2A 2E86A 1UWXH 2GJ6E 2V9UA 2BDNH 4PWJA 3UZEA 2AF2A 3GUTB 1TVBB 3BO8B 4DKEH 4FMVA 5E2WH 3SHSA 2OYKA 3TIDB 3V0VA 3HFMH 3KW8A 5B4MC 5DA0B 2NCMA 1FZMB 3LDBC 4NPKA 3MRHA 3F64A 1BWMA 4DIXA 2W38A 4BBWA 1G9ML 2N7BA 2R59A 1IGYB 1AGCA 2N1TE 4FFWC 1ZVHA 3ARGC 1T2JA 2BERA 3D18B 4JO3H 3PDOB 5FIEA 5CUSL 2YKLH 2V2TA 5DFTA 4L4JA 3AQDA 2WQAA 4BZ2A 3WLWC 4XCYB 3U1QA 3AXHA 1U58A 1XCQA 2JCCE 3FOMA 1DQKA 4PRNB 2VZ3A 3DRQB 4M6OH 2P3YA 5I1CH 3FB7A 1ZTXH 4CAGA 2N56A 4GAJL 5AWNH 2FYVA 3LNEA 4OCLC 4PJFB 1P6FA 1FUNA 1UM4L 4JFHE 5I1JL 4DZBB 3MJ8B 2VLKE 3L1GA 2BVOB 4HF5H 5CP7A 2EDFA 5C7ZA 3R4DA 1U2CA 1YECH 4ZRGA 3APDA 4ZMQA 4NZDA 1IM3B 1X6LA 4HHWA 3PWPB 4CJ0A 4Y4FC 4LU5H 5DUBA 1PMYA 2V37A 2EE6A 4TUJB 2XA8L 1CZ8H 1GOGA 4NC2B 3BKJH 5DLLA 4GP5B 2JK5A 1NANI 1WFTA 3BVNA 4WEEA 4MAYD 1M2VB 2VLJE 4FQXD 4XXWC 3LN9A 2X10A 3VXME 5KTEH 3F6JA 4N0CD 5EV7A 1MAMH 4DN3L 1SEBA 4PI0A 2VQ1B 1I3VA 3OPUA 1A6ZA 3CGTA 1OEZW 1J0KA 3SZKC 1IIIA 4JFFA 5H4YA 4Q9QL 1VERA 5LCVA 4DKFH 4QJ5B 4MFHA 1IU1A 1NBZB 5T8IA 1QWHA 4Y1SA 4JGNA 4FQIL 4JM2D 5AYUL 2NQDA 4TSCL 2NQCA 3IJHB 1EGJA 4HSQA 1L9NA 1XO8A 3N1PC 3Q6GL 4NJ9H 4X7DC 3MBXL 5C0BD 1ZLUK 3T0EB 3WHE1 3CZKA 3JYCA 2JKJA 2GJPA 1XD0A 3FULA 2NY6B 2MCMA 2G2RA 4H13C 2WQXA 3QR2A 4ONFL 2PCPB 3CFKB 3QUHA 3QXVA 4IJ3C 4QIRA 3BYTA 3DMMA 3W9EA 3S5LG 3MRGA 1TIUA 3M07A 3O3AB 2VM9A 1GH7A 4GXUM 3ZHKA 1IBHA 4FL4B 5FAAA 3GWJA 4AYDC 4MJIA 1T3FA 3LZNA 2VN4A 4L8DB 3JTTA 4OBRA 1XSKA 3BP5A 4JM2C 5D1XA 3TVMA 2F61A 1JMXA 4KHXH 4LESA 4ZFOA 4E41D 3IEAA 4YSRA 3BCDA 4BFRA 2H41A 1RIHH 2XICA 1U3HD 4Z7QF 1CXEA 2DICA 4FQ1H 4FQHA 2X6UA 4NLHA 4QTHA 4UMSA 1VFAA 5HJGA 4MX7B 2APWA 3FCSA 3QA3B 4JO2L 1AANA 2X05A 4EIZC 3L5XL 1NGQH 5D7IE 3HHMA 1D6VH 4JFDA 5DEFB 4ETQA 4U6VH 3QT2A 2XBZA 1KWKA 4LPTA 3BVUA 3T2LA 1H8OA 4WWKB 1JPSL 5HVHB 3CVHA 5CO1A 3N42F 3PXLA 3X1GA 1YJDC 5HD8D 3BDXA 5CLZA 5CCJA 3O9WB 2QHRH 1FFOA 2GIYA 3D52A 2NY4B 4E2OA 3SN6N 1YNLH 4FCHA 4NERA 4Y2NA 1EA9C 1IC5H 3WYRA 1TCRB 2XRAH 4G11A 4ILDA 2CJSA 4WJKB 3VVWA 1R3LB 3SDAB 3NEOA 1XSIA 3KJ6L 5J3HC 5DD0H 1E4WL 1A1OB 1NEZB 3JWNG 2ZF8A 4RA0C 2GTQA 2RBLA 3G3LA 4MS6A 2IG2L 1TQTA 3BZ5A 5HDRA 3C60B 3AITA 4R8WL 4XWOC 2V6HA 2FT6A 3GJFA 1RULH 4LCYB 2IPUK 3BT2L 4MCMA 1OAXH 2W0LA 3MGOA 3N0AA 5DHVA 3WN5B 4DW2L 3NUKA 3ERXA 4EXKA 4KV5F 3SE9L 5FW8A 1WAAF 1SYSA 3FYIB 4KTEH 1CCZA 1MNUL 3L5IA 5D7LB 5J89A 2H0EA 1IGCH 3MRMA 1Q0EA 1HKLH 4WW2A 5E5LA 2VDLB 2P24B 4OD1H 3I85A 5E8EB 1TEFA 3MCG1 2DQCL 5GISL 2MFNA 3MRLB 4LSPL 4QMEA 3VXTB 3AGWA 1U8OB 2AJSH 3IE4A 1WC7B 5DRZA 4XT1C 2BPBA 2IH3A 2PWEA 2YUZA 4MAZA 1G84A 2LAGB 1OO2A 3LDBB 4DP7X 2ICEA 5D6CA 2V2XA 2Q6WB 2Y7NA 4D0DA 1IZJA 2P8LA 1M7IB 2HLAB 4ORGA 1R46A 2DN7A 3CDGB 3H7LA 5KSUB 4JKLA 3UG5A 1F4YL 4GXUN 5IHZB 1LK3L 4YDVA 2I9LB 1H9DA 3LV3B 1FSKC 2HP4A 4ZMWA 4MS8D 1CS6A 4PJ7E 4EZLA 4DQOH 4NUMA 3RVWC 5F70A 1KLGA 3PS6A 2BC4A 5IROA 2N59A 3TBWA 2VDKL 1OCZB 1Y1DA 4X9FA 3L48A 3C6LC 1NPJA 2XKUA 4KKBC 4APQB 5KBLA 2XVBA 4R7LA 1UXWB 1JF5A 1M7IA 2KS0A 4Y5XB 3WCYA 5F0PB 1YMHB 1TZIB 4PGBA 1FSKB 1FWXA 5IB4A 4OLXH 4WWOA 3OKYA 3VFOA 5LGKA 1ZPUA 4AEFA 1N4XL 1YPZB 2VOTA 3KYMA 4IW4C 1BG1A 2J1KA 1BAGA 1KLGB 4JCWA 2OPCA 5CJXA 3RZCB 2BSSB 3MNVB 4I2XA 2BNQA 4M7LL 4PJ5B 3RDTD 3T6QC 1ODAA 5C2BH 4IOIB 1O7DE 4HUUA 4Y1AD 3ULVE 5FWRA 1MW0A 3LH9A 4MA1C 4ZG1A 3PFQA 3C8KB 4TQEH 1FIGL 2VDRL 3OZ9L 4NM8L 4N8CH 5EU7E 3DHPA 5GGVY 3NSDA 2K4AA 4HJJL 4HW6A 1WHPA 4I2XB 4LMQE 4JE4B 1E4KA 4LRNL 3QCTH 2F19L 4CGTA 4JM2F 4XBEL 1NH6A 1QD0A 2X6BA 3F6LA 3G6JB 1PZBA 4HT1H 5KVEL 2WJ7A 3VXRB 1DVSA 4G9FB 2XV2A 1MLBA 5TE7H 3JVGA 2IWGA 1U3JA 3GKZA 3QUZB 4NI6A 4PJEF 3UTOA 3RVVD 4PRDA 1QUPA 5FX3A 3H9ZA 3MUGB 1EUTA 5J13B 3QUGA 3U79A 2WB1A 5FDWA 1EH9A 1M6UA 3CIQA 3IJSA 4ZFGL 3ULUH 3K72B 3A24A 2CALA 1PAMA 4HIJB 3HUJE 1N7MH 1U8MB 4LLYA 3NH7H 2HKAA 2AQQA 3IFNL 3SKOA 4FA6A 1G7HA 3ATEA 3L4WA 4I3SL 1Q9KA 3ZTDC 1NIAA 3RI5F 1YVLA 3B9KC 4Y4HC 2A77H 1DN0B 3RDTB 2YGPA 5FYLE 3TXAA 5D72H 3HC3H 2ZP8A 3Q1SH 2X3CA 2X6AA 4PV9A 1S9WB 3RJOA 5G5DB 3TM6A 1HKFA 4R0LC 3ZYZA 1S5HA 2JELH 4PB9L 1ZWIB 4FFZH 4X7SH 1YUHA 1RZJC 4KPHH 2FIKB 4NP4H 5AAMA 2JJSC 2BSTA 5TFSL 5DA4A 3BDYL 2HJKA 3QJUB 4X50A 3VFTA 3VXOB 4YSTA 4MJIB 2YD4A 2NY7H 4QRRB 4IRSC 2NY1B 3PPSA 2AQ3A 1KLFB 4R4FH 5FCUH 4JY4A 5C0CB 4N26A 1TETL 3KJ4C 3MV01 1GGCH 4M6ML 4QOKD 3VFNB 1CLZL 4X8JA 1JNHA 1HEJC 1G7QB 2GW5A 4OLVL 4HH8A 4HD5A 4NN5B 4LSVL 2VXUH 1CYXA 3WTVA 3ROLB 5FF6A 3GRGA 3KLAB 4ZOAA 4PJXF 1NTDA 1AKPA 4UTBL 4MHHG 3MBXH 1P7KB 2BFVH 5T5FH 4KO5A 1OAUH 1NC2B 2E8YA 4HIXH 1SN0A 3TP4A 4YHOH 4QXUH 3CD4A 5JPNB 3SGDI 4JMXA 1NM9A 4NNYB 3ZKXC 1GGYA 3ME0A 2WY3B 4PJ9B 1AY1L 4D0BA 1WTGT 2HT2C 4LCUB 3CFCH 1QFHA 3D85B 3GSXA 3EYFB 3HAEG 3DETD 1V7MH 3IJYA 1JWUB 2YQ3A 4PV8B 4YEEA 1SFHA 3ASOB 3MUHL 5KBPA 4OD2B 4PG9B 1JUFB 4NO0A 3MBWB 1GPOH 4IU3B 5IJKC 3NRPA 1O5PA 3R7RA 1YMMA 1AXSA 5I1AA 2B2XL 3N43F 4TXVB 5C1MB 2Z8SA 4GBXC 1R5IB 4L8CB 3BEWB 4M5TA 1BBDL 1UKQA 4ACPA 2NY3C 5DHXB 1JYWA 2X3AA 1J1XL 5CZXC 4WK2B 2AI0H 5I1IL 3QWOA 4IRJA 1D6EA 3LPPA 3VD9A 5G4NA 4UQIM 1NSNH 1XH3A 4RGMB 1XF1A 3WFCL 3BPCB 5F88A 5MEPA 1L9MA 4PRPA 4U6XB 3H0TA 4AZ8A 4D9QD 4KH2A 1SNRA 1C08B 2FHCA 4GW4B 1ZA3A 2ENYA 5E24E 5GGQH 4X7TA 2V9TA 5GGRY 3MTRA 2Q87A 5ALBL 5I9QC 1NCAH 4M5SA 1RIUL 5HI5D 3HR5B 2BSDA 2ERJB 2WIIB 1NMCB 3MR9B 3QHZL 4KKAD 3PHOA 5T5NF 4PRIE 1RUQH 2EKJA 4IIQC 4U3SA 2XV6B 3QCUL 4JKMA 4UTAA 5IIEA 5C0IB 1BZ8A 3GO1L 3BZEA 1CURA 4HV8A 4URTB 3G6AB 4MNGB 4IBVA 2BIQA 1A7PH 4PRHD 5DJDB 2Z91B 4H5SA 4XRCB 3KLDA 2XYCA 4GSXA 4W9IC 4LVHB 2F5AL 4I77L 4WUUD 4Z3FA 1HL9A 2R69H 2XPZA 4H40A 4IIQB 2KH2B 1PZSA 4A38A 2VJ0A 3EBAA 5DJ6A 3QS2A 5JO5B 2MOQA 5BS0E 1S7XB 5HGDB 1CD0A 3ZE1F 3IETA 1PD6A 2IQAB 5C6WH 2EDBA 3O6FC 1RZFH 3X17A 4FNQA 4FZ8H 1PFCA 2C4FT 2VNCA 3HHSB 3LRGA 5D1ZA 3CCHA 5E6ZA 1OGPA 3DX9B 3M1BA 3DX6A 1DVTA 4NKOB 1ZLWH 2OJEB 3FNKA 2XVLA 3QE5A 3ASNB 1E3XA 1CB4A 3O3UN 2LLNA 2VZUA 4HEMA 4LCCB 3X13A 5MENB 1RZIB 3VUAA 4K7PY 4OZGE 2DKSA 3WFEL 2JQZA 3OX8B 1JK8A 3L3HA 1MH5B 5F89B 2KL6A 3ETBF 5J1AA 3RIAF 2E27L 4KXAA 3FOLB 2F5BL 5E7BA 4OM0H 4NJAL 5I1KL 2O6PA 3VH8A 2YLKA 2BY2A 4M7ZC 2ZYHA 3MJ9A 4AJ0A 1ACCA 3F7YB 3M7FB 3PXHA 1EAJA 4GBXA 4OZFG 1MDTA 2A1WH 4TTDD 1TQUA 2JMRA 3VH8G 2BP0B 1AACA 4PD4K 5G4OA 5FWQA 1U8CA 1KZQA 3ML8A 5L2KD 1KB5L 1S8DB 3QHFH 2TSAA 4BZ1H 4WTXA 2B59B 5FM5M 5FO7B 4M7ZB 2YQBA 2GT9B 3L4VA 5K1VA 2P28B 5CEZH 2FJHA 2ZXBA 4HJ0D 3WL9B 3CZFB 4U6TA 3NFSL 3RURA 4BELD 5GZNC 1UXMA 3FT4B 3RGVB 2FEJA 1MPAH 1E43A 1HC1A 4YC2B 4HAFA 3MRBA 3WGUB 3WENA 3M8OH 1ZTXL 3EFDL 4L2YA 1EPFA 2DQMA 3VQMA 1JXDA 1XR9A 3FCTB 4NQSB 3RUGF 4YBHA 3SO5A 2PETA 2DBLL 5DJ2A 4HWZA 3IK2A 1I8IA 3CX5J 1E6JH 4IRJC 3KPOA 2FWLB 4X6CB 1GZHA 1QHPA 3DIDA 3APCA 4GQPH 3B9KB 1FZKA 3HE6D 4X5XA 3X1BA 2WXNA 3Q5OA 3JWNH 1ADWA 2YSSA 3HG1B 1MJ8L 1GC1C 3RX7A 4YPJA 3TO4D 1XTLA 4L4VE 3BOVA 5DURD 2VQ4A 4NT6B 1UFUA 3I6GB 3I50H 1NAMH 5FB8A 4O02A 1F6AB 3LKOB 2DWDB 2BNRE 3MRKB 1IEBA 1WA1X 2XPGB 2VXQH 4XWGL 4CMMA 5FS5A 3CFUA 4ODXB 1I1AB 1SDAB 2XQYG 1JVOA 3BVWA 3JT0A 3VJ6A 3UTQA 4R4FL 4PGDB 5L2KB 4LSTL 3AU1B 1U8LB 5F9JB 1UOKA 3MSPA 5KYYB 4N1HB 1B0RB 4K7PH 4YFLF 5CN1A 3IGUA 5IQOA 4EF3A 3HI6H 5IV2A 3MZGB 4HDIB 1SEBB 2XZCL 3VRIA 3U25A 1S9YB 4FQ2L 3VJ6B 1JHLL 1JMZA 2H6PA 2W94A 2CDFA 3NCYS 5J6GA 2VXTH 3FQRA 4ZS7H 2DLGA 5E5MB 5AVWB 3SEPA 2ZKHL 4K15A 2YBRA 3Q8BA 3QORD 2F5BH 4WCYH 1OB1A 3NSCA 4ZW8A 4AVIA 4DGVL 4XC3L 4Y9FA 1WBZB 1G87A 4JRYD 1MHHB 4Y19D 2ZICA 1XH1A 1J5IA 1UH3A 3WFEH 5JNYA 1J5DA 3TYFB 3HZKA 1N9PA 3ULAB 4F9PC 4LL4A 3O4LA 1L0PA 2ZOLB 4ZO7A 3LS4H 4YK4C 3PDGA 4MCYB 3V79C 1I3GH 4PG9A 4PRID 4DJMA 3S8WA 3MXWH 4WUUA 1I3GL 2K3HA 4TTDC 1FCGA 5CLYA 4Z5RB 4RESB 4IDJL 3WTUA 5EU6E 1E4KC 3B1UA 3BC9A 2P49B 1JYXA 1JBJA 1L9RA 1R3KB 5DVMA 4LZKA 1BF2A 5TK2A 4FG6C 4B9CA 2RB8A 5I24A 3QXAB 2OMBA 2DYPD 3P73B 3FRPA 3II2A 4KTEL 1DN2A 3GLDA 4X7CC 4I7ZC 3RJDA 1A6UL 3GMQB 1LYQA 1JK9A 1Q94A 3OKEB 2V2TB 3FUNA 3U6XS 1MJUH 5GRVK 4EI6B 3WDIA 3BRFA 3MV7E 1NOLA 3LEYL 4O2CA 4WO4C 2I24N 2PO6B 1ROCA 3V9CA 3MI6A 5IJCC 3IGFA 4Z76A 1AG6A 3LEYH 2ICWJ 3NQKA 4AYFB 3IXAA 1H3TA 2PWGA 1GAFH 5CGMA 4LCWA 5GRJL 1JGDA 4WWKA 3O6KL 2WNWA 3CPUA 3QORB 1NGXB 3LKRB 4MAYC 1HHHB 3NFPA 5AZ2L 3MV8E 3CPLB 2V2WA 3FO1A 5JQHC 3NYKA 3IDMB 2APBA 4XOCA 3BWAB 3AADB 2CCWA 2FJUB 5A2CA 4MD4B 1IMHC 5DVPA 1PVHA 4X80H 2ALWA 4EN2A 2XWBA 2CKNA 4LOEA 1JVKA 3GMMB 2B7DT 2WO4A 3PNWA 4NNPH 1FGNH 4PRIB 2X4SA 4QRUA 4KC3B 1RJYB 3MLXL 3VFUB 1JHKL 3QHTC 1EZLA 2XY1A 4B0MM 3GZQA 3L1OL 3MOAL 4UILH 4NSKB 4BH7A 3NDYE 3OAWA 1TQWA 3FCUB 2VISB 3WEMA 5ALBH 3L3IB 3BPOB 2OCFD 4HX1A 2EH7H 1G9MH 2ZAGA 1JDCA 3JV4B 3IETB 2GSMB 2XWBB 3O2DA 1P4IL 4Y9EA 1NFIB 3E8UL 1T7YA 2MQCA 3CCHB 1XT5A 1A1NB 1AZRA 1WBXB 4M1GH 4BUQA 4WJ5B 4YHPA 1GXEA 4RSVA 3AM8C 4KXZH 3ILEA 2UY6B 1QFWH 4NKQB 4LRIC 4GO8A 3UFIA 1LE5A 4ZW6A 1MSPA 4FXKB 4YLCA 4PCTA 4XR8C 4B9ZA 2NY3D 4BWUA 5EBLA 5MI0C 4JBSA 1VEPA 2IANE 2F54E 3ARDC 1U6AL 3KWXA 2OMVB 2WZ0A 5DS8B 1KGXA 3OAYH 1TZAA 2WXQA 3O4LE 4XBMA 3GXPA 3ZDXE 1QP1A 2Y6SC 1FN4A 2A1WL 1V27A 2CIIB 4A39A 3RFRA 4MJID 1EZVX 4RMUA 5HD8C 4QRRD 1WVZA 4X5PA 4MZIA 5AUMA 5GRUL 3X1FA 2WUCH 1SY6A 3KWTA 3AS2A 4FCAA 5CHNB 1JPFA 4L8SC 4TULL 4F92B 3CX2A 4RGNE 5CFHA 2AK1L 4EXPX 2ID5A 3BVNB 4I3RH 1QO3A 2VR6A 3BN9D 3ECBA 3OHXA 4G42A 5D1QB 3RGVA 3V5DA 4XB7A 3VFMB 4A68A 4F7MB 4YSUA 1Z0NA 1YNLL 4N6RB 3LRHA 4JFOB 1CDGA 3K7UA 5LAXA 1IM9D 4K5NA 1T6VN 4HWZB 3CUPB 2X2JA 4OVUA 1RD6A 2XKNB 3MA9L 4Z7QE 4J8RB 4XPTL 3SQOL 5C3LD 3GSUB 4UB0L 1DEDA 2RCSL 3C6SA 4HIHA 3QG6B 4FDWA 1UCTA 3PUUA 1NCIA 3HZVA 7PCYA 5DI8A 3QWQB 1Z3RA 1UYWL 4NN6B 1FO0H 1J18A 4UOW0 2R1WA 2J5LC 1MVFA 1NC4A 1A0QL 3ALXA 3FT0A 4QY8B 1XGUB 5ABZA 1DZBA 1BD2A 2E6PA 3X3GL 1N5YH 4UT7H 1BQLL 2VDPB 1CFTB 1CL7I 3QIUB 3TFKC 4ZFGH 3CDZB 4CMMB 4NIYE 4YLBA 5FKPA 3U7AA 4DOHE 3K0YA 3THMH 4M00A 3B2PA 5CU9A 3KWUA 1U8PB 3F6IA 3R8QA 3KBFA 4JY5L 2AFNA 3VFWB 3APNA 1X9RA 1T7XA 2WLLB 4H8WH 3MLTA 3ZT6A 1N0XL 3STBA 3V7AE 1RUAH 3W81A 5BZDB 2VXUL 5ACMA 3MRLA 4BIKA 4G71B 4YWGL 5C0EA 4NYLB 3KCPA 2NUPB 2AK4E 2NY6D 1F1DA 4YQXH 1CD1B 4MTMA 3VXTA 2WZAA 3N3EA 1TNNA 5EO0B 1COBA 3BKML 4ZYKB 3L9RB 3U0WL 1QBML 1AXTL 2XIBA 2BSRA 4JW3A 2CKBH 1BMWA 3MAWA 4K94H 4XP6H 1ET7A 5E56A 2GJRA 3PP3H 4AGQA 1HEZA 4J3SA 1Z5LA 2PPDA 2UZYA 5FUOH 1F90L 3D39E 3OAYK 4U1HB 2QT6A 2X87A 5D4QA 3KPNB 1ZWIA 1TU2A 3TBVA 2C7FA 3LZPA 4PJHF 4A55A 3KCPB 5E70A 2A4CA 3QEQA 1R5VA 3FT2A 2CMRH 5T1DL 1EHAA 4FABH 3PF2A 5D7LD 3IDXH 4AQEA 5J7CC 1NWPA 2A73A 2BSTB 3LEXA 5BS0D 1MW1A 1MJJB 5L4JA 1KGYE 1N8ZA 2GI0A 3EDJA 2J12B 1CLCA 3JXAA 1XR8A 1J8HB 3TEUA 3WLWD 1NLDL 3BZDA 4GG6E 2M83A 2GABA 2V5TA 1T89C 3UBFA 4TLKA 1KY7A 3BGMA 2CIKA 5CCHE 1UWEH 1I3UA 4UIKL 3FQUA 3P9MA 5F6IC 2AW2A 2AJYH 4DKEL 4A2FA 1AE6L 4RH4A 1XIWD 3BAIA 5I6LA 5E2JA 4KX8A 3VSUA 1U8JB 1RZGA 2VQTA 2Z92B 4JQXA 4LF3B 8CGTA 3OXSA 2DEXX 3B2VH 2WLHA 5DZVA 3FHAA 3U0PB 3ILDA 2Q7NA 4MX7A 5DHYB 4XODA 2HRPL 4PW9A 1WTLA 4M93B 4KDTC 3ZBMA 4B6ZA 3KEHA 3PL6A 1L7IL 1NGYA 2NSQA 1QI3A 2YAOA 1R0AH 4BE5A 2RCSH 5EIIG 1W15A 1KEML 1M53A 3CDCA 1UACH 3W5MA 2J88L 2XG4B 4GSUA 2UZPA 1KGUA 1ORSB 1QFWM 1Z2KA 2AJUH 2KPWA 3G9VA 3PJNA 3I6KB 1MY5A 2YEQA 2WVTA 4KMTH 3AVEA 3GXUB 4WU5B 5DD6A 1T22B 2HKFL 3EDKA 3S36L 4PJ5D 2WJ5A 5J9PA 3PUCA 1RZ7L 1F3RB 3TBWB 1AQDA 2W0FB 3L16A 3GXNA 2VDKB 4Z7WB 4NN7C 3Q0HA 4KTDH 2FJGA 4LRIA 2PNDA 1JERA 3DXAD 4XVSH 3GSQB 5ISZA 5FV1L 5DK0A 3VXSD 1HILA 4NKDA 3ARGA 4LEXL 5DJZB 4L8SB 3V7MA 2P5EA 1MCIA 1IBYA 1KEMH 3H9SA 3JWOC 1UACL 4N28A 4Q74A 1JCKA 4RIRB 4UCFA 1JYVA 1NFKA 3PWNA 5F21B 4RFEB 5T3ZH 4TQIA 4LCIL 2MPAH 1RFDH 3MUUA 3GHBL 4OCXH 1KN2L 1AD9B 4OCWL 2FE0A 4HJ1A 2F2HA 1DFXA 1K2DA 4U6HB 1ZLVK 4FA7B 3ZXAC 4RMVA 4MLSA 1OAYH 4G70B 2JTYA 5FHAH 2QR0B 3HC0A 1PEZA 3BGFB 1KTDB 5EBLB 4J4PA 3MV8A 1T0OA 4OIIL 4JR9H 4NAQA 3SJVE 1HHGB 3K3QA 5AKTA 3ZHLA 3ZKMD 5T1JA 2WXMA 4MB4A 3CZSA 4I18B 3V6FB 5KS9A 2CLZA 3H56A 1NIEA 4TMPA 1G7JA 1SJEA 1LLAA 2BHFA 1NKOA 1U91A 5CUSH 3GKWL 3NAAH 1UM6L 1SY6L 5C0CA 4N0YL 1QBLH 4FADA 2FRGP 3QJOA 3QAZB 3WMPA 1UWXK 1IVTA 1S9VA 4G7RB 3H3KA 1B6UA 2FATH 2P8LB 3K6FA 2Y7MA 3SO3B 1E42A 1NCDL 2MNJB 2Y2TA 5IMKA 3OKLB 4JO1H 1X9UA 4KRPC 1UD2A 1UURA 3C60C 2R29A 4ES8A 3MLZH 3VQLA 1E4XL 4K7PX 4P5RA 1FA4A 2NTSP 4ZO6A 5EC1A 5DLML 1AQMA 1YY9C 5TD4A 5EEWA 4XMKH 4HCGA 1ORQA 2YRLA 1AIFA 2CGRH 4YNYA 5DLMH 4GI6A 1XIWC 2A6KA 1CPUA 1KC5L 2OMZA 2YGVA 2HFEB 1N7ML 5ELIA 1MCCA 6TAAA 1EEZA 1HOEA 3TN0A 1GW6A 1FYTD 2NY0D 4AEIL 2R4RH 1ZHNB 3PGFH 4Z0XB 4NCC1 1RHFA 4OBSA 5D9SA 4J27A 1UEMA 3KDPB 3QJHB 4MZ3A 2WK2A 3B2UD 1IBBA 4OUUB 1UQSB 4CUCA 1JV5B 4OFPA 3RZCA 1RMFH 1DBJH 4XMPL 1GW0A 3VH8B 1ASPA 5JOEA 4B9FA 4NQED 3T0BA 3VX0A 3L5WA 4C59B 1A7QL 3MRJB 9CGTA 4KDTA 4JRWA 2X2IA 3EGSA 5CCKL 5IGXL 4YK4B 5SX5H 5EZOH 1NC4D 3WOVA 1FFNB 3WO3B 4QRRA 2P52A 2A0LC 3QEHA 1ESOA 4DP1X 2HT3D 4JY4B 3KVQA 4MQTB 1HSBA 4K5OA 4ZUTA 1ET8A 1FL6A 5TGBA 3QUXD 2DYPB 1EAQA 1A64A 4GP4B 4S11A 4PP2B 1PKQE 2QPFA 4GAYA 1EVUA 3LNGA 1B0GB 3NJXA 4A7QA 2X7LA 1Z9LA 3QFGA 1AOHA 1ACYL 4K9EH 2IAAC 2Z34A 4TVPD 4HALA 4J4PD 2J6EH 4FF9A 4JG0H 2JKLA 4KTDL 4TNVK 5DJCB 3TBBA 2FZ3B 3P3RA 1A65A 5HHQA 5A6IA 1A0QH 5ACLA 3ARBB 5GZND 3VFVB 3S8GB 5DYFA 5F7FA 4AKQA 4L99A 4YMPA 4HJ0C 3TBTA 3LMJL 2IH8A 4KVNL 2VB5A 2NY1D 1NFDA 5TGBB 5CEYB 4H0IA 3NEXA 4LLVA 5FDWB 4L2LA 1WWBX 4N86A 2GG1A 3BVXA 2K7QA 3I02B 5E5UB 1GL4B 1ID2A 5I0ZA 1NL0L 1F45A 3MLUL 1YSOA 4I1NB 1V7ML 1QSED 2XBDA 2F74B 4HIIB 4F27A 2EC9U 1FPTL 4HFUL 5MP6H 4XP1H 5JPMB 1KCRL 2IOOA 2R39A 1BW8A 2JI1A 3Q8EA 3RRQA 4AWJC 4AQ1A 5KYWA 3QIWB 1D7BA 2BS8A 2YN5A 2ICWI 2XZCH 4BK5C 4OI9A 2BVQA 2K9FB 3JV0A 1QX1A 5H4ZA 4WTZG 1XV8A 1FC1A 4GAFB 3BEVB 5A2FA 1B0RA 3JUZA 4XH2B 4KU1A 2FVNA 4I2XE 2W91A 1U8LA 4LPYA 4LLUB 1X4YA 3F7KA 4DAGH 4KY1H 2JKTM 1R24B 2P1YA 2NX5D 4AW4A 2P5WB 4PLJC 4JFVA 4U6YB 4H8VA 4PJXE 2EXYD 3ARGD 2E7BA 1IM9B 5J8OA 1FH5L 5AD0A 4H8QA 5ADOH 1I1AC 4MVBD 1XDTT 4LVOC 3WTTA 1FAIH 3D5OF 3ZVVA 4TTGA 1HHIB 4QOKA 1A2YB 5T1MA 3LKQB 4PBXA 4XXCC 3FT1A 1VF5C 2NDFA 4GUCA 1MNUH 1T4KB 4NCC2 4KO7A 5AW4B 1A66A 4PWKA 2CHNA 3OMNB 4XCFH 5AEAA 1W72L 4U1SA 3SDCC 3UTSE 3HZKB 1C16B 2APTA 3QXWA 1RUKH 2L7EA 4LK4A 4YHLH 3VD2A 1Q0YH 4QRQA 4W6YB 1NQBA 1E7VA 3QCVH 1BAWA 4MCNA 1FCCA 4ELMB 1JYNA 1KJMB 3EYVB 4OCSL 3EYFA 1JG9A 5GS1A 2W9DH 3RKPA 4X6EB 3HZYB 1NCJA 2AK4B 4HBQA 4F91B 4IGBB 4JANB 1Q9LA 1ONQA 3D2UD 3KWWA 4Y4HB 1U92A 3UMTA 2MCAA 2CM6A 3S2CA 3RGVC 4OLWH 1M6OA 4PBWD 4FULA 2MSPA 2X70B 1FZMA 3N9GH 4FHBD 2R56H 2WKLA 3SGKC 1HILB 1NPNA 2WXGA 4BWWA 3VXNA 3Q8AA 1JN6B 5I8OH 3AWEA 1JPEA 3O2DL 3O81A 4X5WA 1FZJB 1J5OL 1IBZA 5FYLD 4C58B 4H1LH 3QO1B 3JSSA 4KZEH 3UAFA 2XT1B 3H9SD 4YHKL 2XNAA 4E42B 3RPBA 3K2UH 2FEEL 2IDUA 3GTVA 1IZKA 4H2AA 2ZT9C 2ADFH 2CSPA 1E8XA 5D1ZC 5C0RH 3P0YH 3KDMA 4G59C 2ADFL 4ODXA 4E41E 3P9LB 1SMOA 1JWMA 4O2EB 4HIXL 3N40F 3TGXA 2E3VA 4M1CC 4H8UA 5F3BB 2ITFA 1TG8A 1JPGA 1N4XH 1NOAA 4PJHE 3U36B 4WW2F 3T3MB 1HJCA 4FMKA 4OSUL 1JI2A 1QI5A 3FCBA 1OV8A 4LSSL 4KI5F 5AOMA 4FP8H 1LEKB 3QNXB 2V9RA 4MB1A 5HHOD 3WUZA 3P54A 1P7QA 3QK0A 1T21A 4TUOA 1ZLEA 2A9DA 1DVYA 1I1FB 5KVDH 2WLZA 5GJSL 5DRWB 5KSAB 1SVCP 4G6AC 4AQ8C 1DL7H 2GTZA 3BGFC 4ZPVA 4D3CL 2A6JA 3JWNE 4UT6H 5F9AC 2C3XA 4JO8A 1P0SE 1EEUA 5BQ7A 4Z0XA 2H32B 1WIOA 4JREC 4JJOA 1I1AD 4UQ3A 3EIFA 4XMLL 3LXAA 4G7QB 3O41A 4JCMA 4IRSD 4ALAC 1B3IA 4AIXA 3O0RL 5EU4B 2PR9A 4DW2H 4M62H 3RIAK 4XTRC 2WYIA 1TENA 2YPVH 5KG9B 2XZQL 4AV5A 1QVOA 4PVLA 5SWZA 4CNIA 4W9KC 1KCSH 3V10A 4B7IA 3GRWA 4BCYA 5DZ9A 1KMGA 2XX1A 3ETBJ 2DQCH 3DMMB 1MEXL 4JFSA 4WKXA 4GW1B 4A2MA 5KVGE 4RBPH 1KBVA 3B9KD 3ARFD 1O9VA 3QHZH 1EAPB 2NNCA 2H0PA 2ZWNA 4LPVA 3QSKB 2AXGA 1AGDB 4TSAH 1H6TA 5CJBA 4FQHB 4C55A 4NNXA 4FGMA 4OLWL 4U05A 1JZDC 5E7FA 1K5NB 1J87A 3N41B 1TQBC 1XX9C 1I7UA 2HJLA 3V4PA 3WJJA 1IAOB 1SRDA 1FQ9C 4OQTA 3WFCH 4D8PA 4X98A 2AGJL 2BP5M 4U1NB 4OFQA 5IG7B 3D0LA 5E23A 1C7TA 2QPDB 4OAWA 3KPQB 4ERSH 1LO2L 2NY6C 3ARFC 3D4ZA 5F71A 4I0PD 3G9AB 3T3ME 4E36A 3K6OA 3WU1A 1MKFA 2HT4D 4WNSA 1ZS8A 2R1WB 2LVCA 3CHRA 5E1AA 4KZDL 4KKRA 2WGXA 1WD9A 5K9QG 1TOXA 4NZ8A 2J71A 5AKRA 1S3RA 3VRLF 4KHTH 1NGZA 1HN1A 2JCCA 2NYYC 1EEQA 1T03H 3Q9PA 4Y5VC 1BM3L 3NIGE 5D2LE 3JV4A 1DQQA 5D5ME 3TA4D 4AQAA 1BQ5A 4PRHE 2CBPA 2H4EA 3OHMB 4HKJA 1OHQA 2F53D 3CH1B 2BINA 2AMUA 5DZPA 1DSWA 4QHNB 4L5FH 5IVZB 5IGXH 4RLDA 4YH6A 2CJ3A 1KIQB 4KRNA 1VKXB 1U21A 4GB9A 3W1ZA 3L3JA 5HDLA 3AS0A 1O9WA 2FO4A 3LRMA 1OAZL 4PTTA 1ED3B 5E8PA 1BQRA 2WQRA 4AVHA 4UV7L 4XCNB 1P1ZB 5EF2A 1GJUA 3UPRA 2P7TB 2ZUQC 3TPUB 3HPLB 4W9DC 1HHHA 3NFPB 3QQNA 4KRPB 4Y4KA 4GFXA 1H8LA 2D9CA 2CDFB 1LHZA 2UUDK 3FN3A 4JHAL 5FLVA 3SDAC 3L3OC 4BDVA 4MA7L 1QFPA 4Y4FD 5DRXA 4R7NB 2BNQE 1KXQE 2X1OA 3QEQE 2QKIB 3WKYA 5FM8A 3CVHB 3WFZA 4A2EA 3EADA 1WBYA 2PO6D 3QDGE 3IDNA 3SYQA 5ABAA 3UTSB 1EGJH 1IV8A 2CK0H 3QZNA 4GMTH 4L9LA 2OZ4A 4EI5A 4X8GA 3EDFA 1MW3A 4FI7A 2COVD 4XPGL 1TTFA 3PAYA 4BD4A 3GK8H 1GOFA 3ARVA 4HWUA 5IVXF 2XN1A 4ICXA 2HX8A 4RFNC 4G82A 3DVNB 4Y5VA 3V0WH 3MRQB 4FTVE 3HRZA 4PJCB 1WA2X 3GB7A 5DEJA 1F1AA 5KYXB 2VAAB 2BP8A 2H5UA 1OVZA 1WWCA 1WBXA 4K94L 5CEXA 1O5DT 3ZTNL 1TTRA 5FYKU 1NGYB 3DDGA 1FC2D 3L9YA 4PMFA 3RTQC 4HU8A 3RWIB 5C0AD 4YSDA 4WRLA 1ODUA 3MROB 2CMRL 3J27A 3NH7L 1HZHH 5T1DH 1PZDA 4QNPF 1QSFD 1AYOA 1RK0B 2F9BT 1RUAL 3H3BC 1E4XI 2I60H 3QUYA 3T0VA 2G9HB 4D9QE 5KJ7E 2D0HA 3DARA 1DDHB 5AL0A 1HH9B 1IAKA 1N12A 2CUMA 1JWSB 1MY7A 2EIBA 4YFEA 4NKIL 3FH7A 3QIWD 3LPFA 5I18H 1ZXQA 3UL4A 3T8XA 1DLHB 2C1PB 4JHZA 4UQCA 5I2IB 2OMXB 2YD5A 3TX4A 1VACA 3LQZA 5B1JC 5KUKA 3E38A 1QSEA 4LLDA 2FJGB 1ETJA 1OCOB 3S5LA 1H3UA 3DX7B 3E6HB 4XX1E 1NUNB 4U3HA 3CK0H 4YAQB 3B83A 4WUKH 3UO8B 3WJMB 2O5YL 4FQCL 2G3NA 3PAVA 3V5DB 3ARDB 1T66C 1HL8A 1OTUC 5I5JA 1CI5A 2AZUA 1YYCA 1XGTA 3ARBD 4HUWB 4Q89A 2A5UA 4NQCE 2KZWA 2WKOA 1BXXA 2ZXGA 1NCUA 3NSFA 2LLLA 2VW4A 1T20A 3C5ZD 5AQ0A 3KL0A 5GZOA 3CUPA 8PAZA 1HIML 5ACZA 3GZPA 1ZGLM 3NJIA 3FO9B 1QLEB 1V10A 1AC6A 1BEXA 4PS7A 3U1SH 5ID0A 4MA7H 5IQMA 1T04A 1G7JB 3TH4T 2Z4QB 1MFAH 2BSSA 3MNVA 1EO7A 2YO3A 5F7DB 1DJGA 3QDJD 5I76A 1HXMB 1Z5YD 2ZIDA 4P46A 4NUJA 3VXQA 3T4AC 1GS7A 1SJEB 4JFYB 3M17A 4BYHA 4L1SA 4P46C 2IANA 1FNSL 1VFAB 2E4FA 3F62A 4OD1L 3CXDL 3IS1X 4G8FA 4GXVH 3QULA 2BWIA 4JVPA 1S9VB 2IPUG 5E8DL 3DMMC 5SWQA 2WCSA 4HOWA 2MKLC 1QUNB 4WDIA 5EO9B 1U8PA 2VLLA 4UANA 3WUWG 4JN2B 5KEZA 1FDLH 1CZ8L 1S4IA 3T5WA 2ADIA 3HOGA 4LQFH 1KPRB 4EKJA 4YO0B 5KSBA 3GSNL 4QNPE 1TMCB 1MG2C 3NN8A 2HA1A 4BHUA 4OZ4B 5KSVB 3PV6B 5FF6B 5C09D 1OAKH 2XI9A 3ZDYB 1Q9WA 1MI5D 3MYJB 2YPVL 2EDWA 2GSGA 2OTUA 4P2OB 5JORB 1HKLL 2I7SA 3ULVH 2X09A 2EQDA 1CU4H 3HHRB 3MRNB 3W3BA 3HBZA 3MLWL 3ZDXF 1T1WA 2JIXD 3L6FB 5FECA 1IT9L 3DURB 3UYRH 4I9XA 3MLYL 5DWUH 4XXWA 2B5IC 2PP9A 1F58H 4JVUA 4ODTH 1OM3L 1OP9A 1KWGA 5I8OL 4NO3B 3NIFF 1HXKA 3FO2A 3QQ4A 4P23B 1V5JA 4S1QL 1QRNB 3BUIA 4N2AA 2GSIA 4K8RD 1NMBL 4WU5A 3IGKA 25C8H 3QQDB 3Q05A 1ANUA 1VFUA 2FQDA 4G3YL 5IKCA 5D7LA 1AKJA 4FLOA 4JNXA 4PJGB 1DVUA 3BZ4A 3QUMA 3QEQD 1JFHA 2I5YH 2VN6A 4M5YL 4XPBH 1JNLH 5KOVC 1KB3A 1SQMA 3AREB 4QGTA 1LE9B 3MACL 4PM1A 4A2LA 2WUBH 5HHPB 3P0VL 4H25B 3NRQA 3DI2B 3IFOB 4D7PA 1P9MC 4O58H 3U2IA 3ZUCA 3BRDA 1IT9H 3FN9A 3UYRL 2BDNL 3SDXB 4JFDD 4ODBD 4XGZA 3TBYA 4F9LA 2H45A 4FQCH 1H3PL 1MUJB 2CU9A 2VABA 3EZ8A 1RV6X 3G5ZB 3U6RA 2PTTB 1U8JA 3C08L 2DQJH 2TSBA 2YK1L 4Z7UE 1YY9D 2PTUA 3RGHA 3U4KA 1BZQK 2VYRE 2G60L 5DO8A 5GS2H 2JIXB 3FUEA 3L4XA 3DGCR 3L2LA 4IQHA 1HQRB 4ODWB 4Y4KB 2WIIA 2Y3AA 4K2UL 2AJXL 4KK5C 1F5WA 3ZDWA 1XTMA 4JDZB 1G6VK 2IWFA 1TZOA 2Y7SA 4F2ME 3RVWD 5I1CL 4JRXB 1AGBB 1E6OL 4RISH 5FUZH 4ZFFA 1MVUB 4KMTL 1INEH 2ESVB 4TVUA 3HRPA 4HKBB 3C75A 1LO4L 2BIMA 3IB4A 4TUUA 4YDJA 5HVWA 3NCEB 3GMOA 5A2KH 3OLIA 4G7SB 1AE6H 3CFEA 1D9KC 5I1HH 5EC1B 3UADA 3EW3B 1M7XA 2RTTA 5INDB 4GXFA 1FIEA 3Q5TA 2IDQA 1AIFB 1JUFA 2DIBA 3ARED 4JFZL 3D0VA 4TSCH 3BFQG 3CBJB 3BKCL 4O51B 2ZZUT 4HS3A 1OQXA 1PQZB 2IQ9H 1J8SA 4QRFA 1EFXA 1A7OL 1NANH 4HUUB 5ADPH 4KMQA 4GPVA 3MRRB 1SJHB 1SEQL 4NNPL 1GIGH 1KUMA 1XGRA 1FL3A 3EJZD 3RKDD 3QR0A 2EH8H 2ZG1A 4Z8FL 4X8CA 1MAML 4DN3H 4AT6A 3PHQA 3Q6FB 4MJ6A 4FEMA 4ZUUA 3UIZA 1U8QA 1I4FB 4KK9C 5HPMA 2YWZA 5JHDA 1N6UA 5ITFA 4GIPD 4F33B 4QRPE 1EGJL 2EDJA 3ARBC 1ET5A 1KTDA 4G7YL 2OTPA 4TF4A 4A7UA 2A7BA 2G9HA 1IAIM 2Q8BL 4F57H 5C7XL 5ENWA 2VR5A 1QLRA 2ZX8A 5KJ4A 2PP7A 2DQEH 5GS1B 3WKPA 1X5KA 2SODB 4MJ6B 4ZMZA 2EO7A 5D4IA 3K2MC 1I4FA 5I18L 1E5CA 3IU4H 3T3PB 4JFPA 2EIKB 3L9EA 4GUOA 3WIFB 3P0VH 1ZA6B 2DH2A 4KROC 5DUJA 5L7XH 1SHXA 3LOWA 1DJHA 3NZ8A 3QEGH 3KG5A 5HVGB 2OL3A 1G7IA 4I13B 3VTTA 2WWKT 3HFML 2G75A 3HE6B 1OPOA 3S3PA 4X4YB 1TPXC 3OWRA 4R4BA 3MCYA 5BRPA 3F12B 3MGAA 3THML 3P02A 5I1GH 2Z7UA 1J10A 5CFAA 5HI5C 1HL5A 3VXRE 3ZZ1A 4HCRL 4AH2A 3VM7A 5AVXB 2ROXA 1J0JA 3MNWB 3CFQA 2ZPKH 4L0ZA 1REIA 1HWGB 5IHLB 4J3UA 1EO8H 1BVLA 3GSOB 4N85A 3FSVA 32C2A 3ENEA 3KLQA 4CC4C 4P2RB 4UM8A 3MJ8A 2KC0A 5C2BL 3H6AA 3K6SA 2CHDA 3Q06A 5I82A 2VH5H 5I6MA 4DOHB 1XIWA 3B9KA 3MGTB 5J3HD 4KRLB 4B9PA 3V4VL 3KLKA 4GT7A 4I48B 1YRKA 3TONA 4I85A 3X14B 5HDWA 3OB8A 1ZLSL 1L9SA 3MX0A 4FTVB 1N3NB 4W9EC 2ZYIA 4NRYB 3FTGB 3U0TB 3CN0A 4P2RA 2NY2D 5TF1H 4D3CH 5KZCB 1VLXA 1H3VA 4OZGA 5K9QI 4Q6KA 3UYPA 4TUOB 2L04A 5TPWH 1UYWH 3PGDB 3HE6C 1XEDA 3UTQB 3UC2A 1WLHA 3GJFH 5DT1L 5IEHB 1IL1B 4OIFA 1JZJA 2Y3NA 3EJJX 1U4FA 4EIGB 5I1LA 2YC1B 3PWVA 1N3NA 1T6BX 3PREA 3RY4A 3SYOA 1BBJA 4UQBA 1TTCA 3QFJE 3UBXI 3QXDA 4MNQA 4JQVC 5L4IA 2DH3A 4UIMA 4XXDA 2PYEB 2JF1A 2Q76A 3ARBA 4GJTB 2GAZB 1G6RA 2AXJA 2NY1C 2VT0A 4P2RE 4YHNA 3I6SA 3CSYB 5DHVH 4GKLA 1X5JA 2MH4A 1A4KB 5LGJB 5C0AB 2PWHA 3O3AA 2EDDA 2XX0A 2ADJB 3FF7A 4LEBA 3WFDL 2ZOTA 4U2ZA 3VYOA 1GR7A 1C1EL 2OTWB 2OW7A 2GJJA 4P23A 5JNYB 4BUGA 5FEBA 5PCYA 2V9QA 2LQRA 4M3JA 4B53A 2EUZA 3VXUA 4DFIA 2Z35B 4FTVD 3GNMH 3M6DA 5B39B 4XNAA 1N19A 3BSZA 5EIIA 3IAGC 2DQUH 3QAZC 3MLZL 1A7PL 4KVCL 4PFEA 2PCFA 1XWVA 5JIKA 3RB7A 1QSFA 2CK2A 4FNSA 4B9KC 5DSCB 4GKSA 3L8QA 3MHZA 3WFHB 1A9EB 2WYZA 3KLHD 3MRKA 2CJUL 3DIFB 4TVPE 3LNHA 2X4PA 1DANT 1QYGH 1ZOXA 1PG7L 1SLWA 1WEJL 3DBXB 4GSDL 4V2CB 3FUDA 2W59A 5IB5B 1M71B 4UNIA 4WTWA 1VSCA 2DD8H 4WI6A 2PW1A 2GC7C 4JB9H 3D1MC 1JFQL 2NY0C 1ML0A 4FHJA 4JCLA 3FQXB 1BV8A 1KJVB 1OAQH 1T2QH 1YDPB 3HG4A 2BMKA 3TLRA 1X6NA 2ICEC 3SE8H 1CL7L 1IGTA 4G7VL 3X11B 1OT1A 2BJML 3ESMA 1YMME 3VTMA 4M43H 1WZAA 4GUPB 4YN3A 3WSQL 4JO3L 4AX3A 3RVVC 3VI3B 1RFDL 2MPAL 4DK3A 4Y5XC 3ES6B 4PRBA 2ED6A 4LBEA 3BPNC 1CDYA 4N2IA 2ATPB 2CJUH 1CE1L 3Q1EA 2YZ1A 4OGYL 1ROWA 4L3EB 4OCSH 1BOGA 3DTUB 3LSOA 3K2IA 3S37H 4B9IA 4AQAB 5DEGB 1EIBA 3JYBA 2ZCKH 2EEDA 4LKCB 5BVPL 5KVFL 3QDJA 1AGFA 2XN9E 3TEXA 4JB9L 2DWYA 5EU5A 5C8JA 5EG6C 1PEWA 3BQUA 4WFED 2DMBA 3OQRA 3PDOA 1B3JA 4N2KA 4XB8A 3BAKA 1CE6A 2GK0A 3WS6C 4JFFD 1D5RA 4RBPK 3NA9L 4OGXL 5BQ7B 1SEQH 3HE7A 3NIGF 3OKOB 3C09B 1KCSL 3EO9L 4P2QA 4YSOA 1G94A 4NKMA 3C5ZB 3RDTC 3ZYOA 2J88H 2OULB 2NXYB 5D93C 4A6YA 3QP3A 2XOTA 5GPRA 1AJ7L 3BIAX 3RB5A 4D9RE 2Y06L 4PWHA 2BP0A 3B9DA 3LV3A 3RFZC 3PWUA 4F5CA 4RRPM 4ZFZB 1LO0H 1WFNA 3PGCA 5C86A 5I30L 2DQTL 1BSIA 3K71B 2ALAA 1I8UA 2HH0L 1UD3A 4XNYH 3CZLA 4AQ1C 3QARA 1I7ZB 4N5EC 4ZQTA 2OBGA 4WI8A 4YFLI 3AABA 1ZS2A 2YGQA 3VB9A 1RUPL 3SDAD 4YBLB 5MEND 2V0AA 1NA8A 3AT8A 1WF5A 3QI9C 3HMWL 4YOKA 4KPHL 4NP4L 3RVXC 5C3IA 3IMWA 4GEJA 4FXTA 4JHVA 4N8VG 4F3FB 2J8OA 1HK6A 1E5YA 3H2WA 4Y5VB 4NQEA 3HRZB 1I7ZA 4KZEL 4WO0A 1MCEA 2BOCA 1RJZA 3Q13A 4BKTC 3V4LA 4DESA 1TETH 3FBQA 2XBTA 3MRCA 4M4PA 3S36X 1AO7B 1QNZH 2NNAB 2IXQB 4PJCF 3WS3B 3CVHH 4ONHB 5E1HB 4IBZA 3ZL1A 4BZ2L 5TF0A 5LDSA 1FFTB 5LWYH 1CGWA 4LIQH 4XN5A 2Z0BA 2ICWA 3HIZA 3VGDA 1CUOA 1DBKL 4OLUL 3D2TA 4UQEA 3LD8C 1WH0A 4QXUL 3QJVB 5DUPH 5GGVL 3S6CA 2EDHA 4NM8H 5IUCA 2NY4D 5MEQB 3WUWB 2VLRA 4LNRA 3SCMB 4FKKA 1W72A 3FTGA 1A4JB 3WG7B 2XWJB 5EZIL 4W9JC 4P9HH 3QI9B 4WY7L 3L4CA 2H2PC 2VITB 5GGRA 4AL8L 1AFVH 1E9QA 3U9UA 4XMPH 1PGRB 4FQPA 1VKXA 1MCPH 4YHZL 4N9OB 4OZIF 2SEBA 4APQD 3FQWB 4OH2A 3M88A 5A3ID 5AB1A 1J1XH 5EZLB 1L6PA 1TFPA 3OWEA 3H4HA 2VWEC 2W07B 1Q9OB 3GJFK 4L18A 2FSDA 1RXLA 3DRTB 4PJ6A 2P8PB 1IGIL 4K3JH 3GSNA 4RVBA 2W65A 1AO7D 1V7NH 2EDOA 2P43B 3WEAA 3ROOB 3RTQA 2VJ8A 2XTJE 3SE6A 3OHXB 1PLBA 5D1QA 4U1NA 2FH6A 1UZ8B 5EZPA 3OG6B 4LLQA 4APQC 1J8HD 1O6SA 4BFKA 4TRPL 5HHOA 2BOBB 4FZEL 4Y1AB 4OCRL 5HDQL 3RY5A 5H2BA 2P5WE 4J1UA 4PJHA 1AQHA 5F3HB 5F9OH 3UP1A 3T0EC 2J44A 4OIBA 2EH7L 3VXPA 4L9BA 1ZS8B 3DVFA 1A7OH 1AD9A 2J1YA 3MXVH 2EDLA 4OU3A 3EJSA 4H8WL 4UDTB 5FUCE 4IHBA 3VGEA 5F1IB 1A6AA 1ZSDB 3O45B 4N8VB 4TV3A 4UDUB 4AYEC 3U9PH 5CM1A 2EIZA 3GLAA 4GBXD 43CAB 5HYJE 3UJJL 4AKPA 2B9BA 3GBML 1KTBA 3MCKB 2HJFB 1KULA 4KFZC 3JWDL 4JG0L 2HFFB 1HU8A 3BUYB 3BXNB 4YX2L 5ITBH 2ZKYA 3II1A 4Z7NE 2PCFB 2DKMA 2H2SD 4YHIA 2H8PB 3D39B 4NO2A 1SOQA 2CO2A 2IADB 1AZVA 2XZAH 2VAAA 5KSAC 3SBRA 3ULSB 3OR7B 3ULVC 3D50A 2VAJA 5T3XD 3L81A 2W9LA 1ADQH 2ZXQA 3F04A 5EUKB 1PG7H 1WEJH 4PJ7B 4Q6IA 3WELA 1OPGH 1HI6B 4XBGA 4Y4FB 1RZKH 3T2OA 1Q1JL 4PIBA 5IMOB 4HCIA 4EOWL 3UAEA 4KZDH 2ADGA 2E75C 1J9QA 5BQDA 3HW7A 4RA3A 1VFBA 2QBWA 3GMLA 2FATL 3I2CH 5HBBA 4JEGB 2W95A 5AW0B 1KPUB 3ARZA 3D2UA 4UWQB 4JQIL 1JV2B 4NM4L 3BISA 3MKGA 3PL6B 3BZFB 2WTOA 2DWEA 3NGBC 2BCKB 3VWKA 1SQ2N 1QKZL 2H32H 2YPKA 3MREA 4P4KA 1T1ZB 3GM0A 4PS4L 1X5HA 3X1NA 4HXBL 4S2SA 4KKPA 1ES0A 3D30A 4FXGC 4K5PA 3PHAA 4NQDE 4S0SD 4ABWA 1TZIA 3S37L 2VSCA 3KJ6H 1KC5H 1KV7A 2IDSA 1A47A 5FA4A 3BFOA 2JLLA 1U95A 5TDNB 5D7LE 4OD3L 5E6ID 4HULB 1LP9E 5F0JB 1XF3A 3FHEA 5I15H 3N5AA 3VDBA 5LBVA 5F1OB 1TVBA 3BO8A 3H9HB 3CSGA 5F7MC 3ZLQC 1J9RA 5T1LA 2D2CC 1Z9NA 3TFBA 4DGIH 3MREB 3QUZD 2FR4B 3S4SB 2BJMH 2HUHA 3D3VE 4LVNC 1ES0B 1VFMA 2D0GA 4K8RH 4MSWA 1OCWH 1TPXB 5TE7L 3V2AR 4E9LA 2DF3A 1OP5K 4WGVB 1OTSD 4HKJB 5CINH 1RUKL 3QDGA 5DFVD 5C9KA 4KGJA 4CRPA 2R69L 4LLWA 4P59L 1RQ5A 2IGFH 4IBSA 2GYSA 1UZ6F 3JTBA 2JVUA 3NCYP 1MIML 1EMTL 1JPTL 4WW2C 2WBWB 1OE3A 4WNJA 4Z7AA 4B5EA 4MJ5A 3MROA 5LO7A 5KSBE 3LKSA 4FN0A 4MNQD 2JB6B 4IEFB 3VI4B 4I18C 1NFDB 2A83A 4HJEA 1KBPA 5J6HB 1KB9J 1RSFA 3T65A 2EDQA 3WNPA 4NDMA 2H9GA 1AP2A 4BQ8A 3SE4A 4IIZA 5B3JF 1EZUA 3ZK0A 4RCAA 1NGWA 3AS3A 4N2EA 1U91B 3I74A 4IKLA 4QKXB 3KGTA 5JHLL 3BUBA 1JVLA 3GBDA 1CU4L 4LEXH 2WBJA 4XWGH 3OXRB 3R06B 4ZTEA 4Y1TA 4IMKA 3BH4A 2E6JA 3CFCL 1RZ8B 4WV1A 4FJZA 1XD1A 2CJTA 4RMQA 4LLYB 4OFYD 3N1MC 5B8CB 2AQRA 3FUIA 3WIHH 1RK1B 2AV7B 1FVEB 1F2QA 2I27N 1L3NA 3K46A 2XN9B 4PJGE 1C12B 4ZFQA 5ITFB 5IK3B 2XVKA 1NKGA 1KG0A 3GIVB 4M4RB 3ZZLA 4NUGH 3OAUL 1BQSA 2Q2LA 4HSAC 3UH8A 3LVEA 1EEZB 3TN0B 3QIUA 3L4ZA 4EOWH 4WIQA 1CVSC 3RFZA 4UAOC 5ANMA 1RUPH 2DL2A 2I07A 2XQYK 3RKDC 3UJTL 3ZZQA 2RAMA 4J3OG 1F4HA 2X4RB 4QRRE 4LASH 2G5UA 2ZF9A 4JREB 2Z31A 1JGEB 1SDYA 1K8IA 4U0RB 5E9DD 3SGJC 1WDAA 2IANB 3S3DB 4HAGA 3SGJA 2J3SA 4TVPH 5DD5H 5GS2D 3WNLA 1ZE3H 3BWUF 1X5FA 1VADA 4P05A 3T6XA 5E6SB 3RUGE 3ZDYE 2HPOA 3FONB 1TYEB 3F84A 1WGOA 2WLNA 3BPLB 3FCTA 4G2AA 5IF0A 1YC7A 4KUZH 4KX9A 4YVUA 3LTVA 3ZSTA 2IEPA 1FHGA 1TEYA 1AZNA 2A3TA 4ZDHB 3HUJB 5A6LA 5I0DA 1XBDA 3EJUA 3UBXA 3B3BA 3F8UB 5J11B 4RETB 2Q3ZA 4P23D 1HEHC 1CIDA 4LCUA 2HUEA 4JKNA 4OF7A 5CAYB 1A14L 4YXKL 4AZUA 2AJUL 3D33A 4HWBA 4JZNB 3QORC 4QRAA 3PJSB 5DTFA 5T3XE 2YXWA 2AEWA 1YNTA 4Y5XA 4N2HA 1HQRA 2CA4A 3IN2A 4ES9A 1GY1A 2BHZA 3TTSA 5I1JH 2YD9A 4GRWH 4NO0B 5HGBB 3RWEA 3FOMB 3PWJA 4AY0A 1F8TH 4UZUA 1Q8MA 1QZNA 1SUHA 2VL5A 1MI5A 3QDJE 1MRCH 1J88A 2D4DA 2EDRA 5CZVL 2EUXA 2J72A 4NQDB 4FFZL 4JZJB 4L1LA 3CE1A 4HIIA 2DJSA 1KNOB 2OMYA 4ADJA 7CGTA 5F9JA 4I5BB 2C7UB 4U1GB 43CAA 4XP4L 5HGAA 3HG3A 5BRZE 3O6FB 3KVPA 4OQ1A 3H55A 3LZOA 4PP1D 4XP4H 4E9SA 3BZ4B 3QUMB 3RHWK 5E9NA 3EGDA 4MJ4A 4RX4D 2AXFB 5EBMB 1AVAA 3MRRA 2FECI 4N2OA 1G7QA 2XFXA 4BFIA 1NGPL 2Z65C 2R2HB 4MKTA 2OP4L 3BE1H 2AMGA 4NC0B 5HSFA 1K85A 5LGHH 3SGEH 2PTVA 4K7PL 4EZMA 1KENL 5IB2A 4CN4A 1F8TL 1WG3A 2VR7A 2P5EE 3CSYA 3WO4C 4R90L 3TV8A 1IEHA 1HSBB 1U8HA 5ISZE 2DLFH 2PYEA 1F4WH 3BUQA 5I1EH 5L8JB 1FNEB 3LH2H 4JPVH 1JS4A 3ELAT 2FBOJ 1MG3C 1P84J 2LTQB 2ADJA 3IPEA 4U31A 1OAQL 1T2QL 4LL1A 4OSUH 5IIEB 2IDTA 2VE6B 2BCMA 3QVAA 1DQLH 4NX0A 1MLCB 1QSFE 2OXGB 3WXWL 4BZ1A 5LQBH 4Q0XL 3UXFA 1IVLA 2QGCA 3IU3B 4WFHD 2IJ0C 5JORA 3BQUD 3QGVA 4KI5D 1B2WL 1E8WA 1OP3K 1OQOA 4GLRH 2Y4SA 5IQ7L 2VR8A 2Y1AA 4PRHA 5AOZA 3P0YL 4RSYA 3DOSB 4UV7H 3RUGA 5IOKA 5ID1B 2ITCB 2VRAA 4XVUD 1JGVL 1INQB 4N9GA 4EVNB 3ZE2E 2UY7A 4MLIA 1CBJA 2R0KL 2F18A 2Y7LA 3RP1A 1XF3B 4JG1H 1CGSL 1WZLA 5FYLH 3PXJA 3QWOB 4ZJ9A 1QW8A 3CC5B 3MLPA 3O6LL 2WLJA 3G6JF 3O4LD 5C0FA 4LLMA 4BRJA 4DERA 4IRZA 3KPSB 2O6FA 1FL3B 1FNFA 4E9WA 2WB7A 4RRPA 5CJ8A 3LNDA 4Q6IC 3W11C 1J1OL 5EO1B 4QXVA 5IVXE 3ZKND 3KBHE 2IV8A 4MASA 1XIWB 3L1OH 1XB3A 3MOAH 4UILL 4XZUA 3NDZE 2BNQB 3DGGA 1DJYA 3D4YA 1NJ9A 1BZEA 2NYZA 5FK9A 3G5VB 1D2PA 3MTXA 1OTUD 1NBVL 4Z95L 2UX7A 2XWTB 5MEOB 4L3EA 5DD3L 3QJTB 5BUAA 3RWFA 4WKZB 3I3EA 4XNUH 4CSZA 1ZAGA 4YE4H 1CQKA 3MRFB 3Q6GH 5JOPE 3O0RH 2Z31C 4PY8I 1VHPA 2OKMA 1YYLH 1QBBA 5SX5K 1XQ4A 1EANA 1YEFH 4MNGA 3UTTA 1KFAH 4HWEH 1I85C 2BX5A 4H5SB 4E68A 5EU3A 1HNFA 3WN5C 4E0RB 1Q0XL 5DJ6B 2VTFA 2D3NA 4O5LH 1J86A 1QFUL 3KEDA 3LQAC 5IW1A 2FT7A 1L5GB 4KHXL 1P5UA 5HY9B 1OGSA 3MPCA 5GHWL 4A2GA 3NK4A 3D4CA 4JZOB 2GBUA 3ZL4L 5A7EA 1IAIH 5EUOB 3VWJA 5C08D 4OV6F 1SF5A 2AK4A 4JRYE 1MWOA 1CVRA 1CYWA 4NKMB 4Z3IA 4P4RA 4HQQL 5HJ3B 5I6NA 1KJ2H 1QG3A 1QOKA 1TXKA 3OLGA 5CEZE