2BSEA

Structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
SIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR BINDING PROTEIN
publication title Lactococcal Bacteriophage P2 Receptor Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Lactococcus virus p2
molecule tags Receptor
total genus 20
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bseA00
2X53A 1ZRUA 3EJCA 4IOSA 2BSEA 3U6XA 2BSDA 4HEPA 2F0CA 2WZPA 3D8MA 4HEMA 3DA0A 3HG0A
chains in the Genus database with same CATH superfamily
1G7MB 3BT2L 4MMXA 4JFEA 2FBOJ 4HU2A 3IGFA 5EZIL 5FF6B 4B9CA 4HKXA 3EO1B 1AD9A 2C4XA 3PWUA 4HJIA 1NFIB 3MSPA 3EZJB 4HWBA 4LSQH 5J1AB 5DUPH 2ERJC 3GSNA 1A7RH 2X2JA 1RERA 1M7DB 2NY7L 4MRBA 3DK0A 4L2LA 2R29L 3L2MA 4K7PY 3B3BA 3GZKA 1JF1B 3ULVL 1J10A 1GYUA 1UD4A 2AI0L 5IVOA 1TQUA 4XOEA 4EUPH 5EBWA 3ZN6A 4NUMA 4Y1SA 3LNDA 5FWQA 3MV7E 1PG7L 2C9UA 3THML 4DGIL 1AOHA 1Z3RA 1OWWA 2A74A 5JXED 1S9YB 1NFDA 1KC5H 4O4YL 4H8UA 3KH4A 5SWZA 2WW8A 3KCPB 2IALB 3F7YB 4PVBA 4JL1A 3B2PA 1FVEB 2FE0A 4DEPB 2RMNA 5JLZB 3BH4A 2P48B 4AYSA 4S1DC 2GB2A 1FNGA 3UZEC 4DPAX 3TPUA 2KH2B 3ILQD 3ZTCC 5BVPH 3BUBA 4E9TA 1JWMA 2VR6A 1PZSA 3B9AA 3SQBA 3GXUB 5DJAA 1GYWA 3FUHA 5CXPA 3P2BA 4PMFA 3TV3H 3CSBA 4N8CH 4DP4X 5FYJL 1PDKA 1HCVA 1XH1A 5CBEA 1AOZA 3BSHA 2KL6A 2BVYA 2EE2A 2BSDA 4LSSH 4XCEA 2EYSB 4WDIA 3ZT6A 2DLFH 3U0PB 1VJSA 2R39A 1VFMA 4EIUA 4LLWA 2V8LA 2XUWA 4PJ6A 1FNAA 4GYBA 1J1XH 1YEGL 3B1UA 4H25A 1TJHH 3QORB 2YJQA 4GUQA 2BNQB 4XBGA 5KSVB 3JZ7A 3R18A 1L0YA 5E8OB 4N0RA 1XT5A 3L5XH 4N0UE 3VRJB 4FI6A 3LEYL 3F3HA 4MNQD 1K8IA 3E2HB 2X4RA 1FNSL 1UG9A 4OR1A 1WA2X 4H13C 2P7TB 1G7HA 3LKQA 2NCMA 4Z7AA 5MHSE 5I6XC 3II1A 2DQFB 1U4FA 3II2A 1KY6A 4GQ9H 3T6XA 5J89A 2Q0ZX 4YHOL 1VDGA 1QBBA 1RAMA 1KIUB 3BW9A 2WLMA 3HPJB 2ZWZA 1ZTXH 3IMUA 1T3FB 1MAKA 3O9WC 3BEVB 1CS6A 3K74B 4YGAB 5HGAA 2HT2C 1NBZA 2NY6D 3BH8B 4U7SA 3LKRB 4DN4H 4E68A 2ZP0T 4F3FA 3K80A 3WUWA 5EF1A 2N4IA 2DBJA 3TBTB 1QLEH 3VTTA 3BXNB 5E94A 3S36L 3ZE0F 2K6YA 1CBVL 3RY5A 1YNTF 1WT5A 1CFSB 1AHMA 5AOIA 2D4DA 2CA3A 4PJFE 4JFXA 3S36X 3E0GA 4MJ6B 1L0QA 2PPFA 4XPGL 2EE9A 4N8VB 4JHBA 4IRSD 4QKXB 2OMUB 2QSCH 2DH2A 2WWNA 4X5WB 3RZCC 1YUHB 4DF9A 2RQEA 3MJWA 2DEXX 1SY6L 2QKIB 1NEUA 2H3XC 4YPGA 5E6IC 3FB7B 4X0NA 3TT1L 5AWNL 3EW3B 3ZGIA 4FTVE 4P4KA 3FTGB 4P23A 4POUB 5DK2A 3WELA 1QA9B 2VMDA 5FOBB 2EH7H 5H35B 3VM5A 4NUPA 4OKVB 2PWFA 2K4WA 5CU5A 2XKUA 1HS6A 4PY7A 2A0LD 2LABA 1EIBA 2X70A 1BZ8A 3MBEC 4KJPC 5C8JA 3U2SB 3K8LA 3QR0A 2YPLD 1FVDB 5TF0A 1DBAL 4KV5F 5ITFB 2OJZH 2JJVA 1SOKA 2JSFA 5HTSA 3RWFB 4QIRA 1JF6A 4AZ8B 1SUJA 1JK8A 1TZHA 3DSFL 5I8CB 4LF3A 3WNOA 1FZJA 2DQUH 2EDLA 1NCNA 3UPRB 4BQ8A 1W0VA 2DJUA 5HDWA 4U0RB 3BO8A 4LSSL 5B8CA 4MMYB 4DQOH 1MFUA 2PCYA 4FXLA 5A16B 3TBWA 2EDQA 4ZUSB 1Z9MA 2UZYA 4GAAA 1GR7A 3H0TB 5F89A 5SWSE 4MD0A 1ACZA 1XL4A 3BZDA 5CR8A 3HZKA 4QUOA 1ZLUK 5T1LA 5IKCA 2H2SC 1RP8A 1U8LA 2EACA 3RGBA 3GNMH 2EUXA 1E4KC 2PTUA 3B6SA 4FL4C 4CILA 5HPMA 1YDPA 1QEXA 4JM2A 1J18A 3ES6A 4WTZG 3ZE1F 2WNGA 2OZNA 5C0AE 1SBSH 1D6VL 2YEZB 4OI8A 4HUKB 2Z7YA 3ATDA 2HH0H 2ID5A 4FXKB 2ZPKH 1AD0B 3F7LA 4G7VH 3V0DA 4YSUA 2DTMH 2F15A 4HIJB 5ICYA 1A3QA 2IBZX 4GS7B 3RPBA 1EJOL 4JRXD 3D18B 7PAZA 3TYFB 3GRGA 1NICA 4JO4L 3RWGA 3T8MA 1WCQA 4DCQB 3EYVB 4YE0A 3IXAB 2ADJA 2JQZA 1FG2B 2LHAA 4CVXA 5L6YL 3X14B 3QNXA 4OGYH 3MLUH 3N50A 3V5HA 2ZUSA 2P4AB 2ZCLH 3ZDYF 2DI9A 1E3ZA 3WTWA 3MROA 4J3VA 3NSDA 2NY6B 4YZFF 5G5DB 5KJRL 1LM8V 3QR2A 3NT0A 3B2XA 4IEFB 1SEBA 2P80A 2D7NA 1EGJL 4EIZC 1F02I 5E8EB 3WFDH 3MNZB 2ATKB 4PRHD 4X8JB 3L3GA 3L45A 4ORGA 3IDXH 4FZEL 5FGBC 1EXUA 2KZWA 3MNMA 4PR5B 4ONGH 3ULSB 2GTQA 1MCBA 4AOFA 1F3DH 4IBUA 4DP8X 4JO2L 2VW6A 1EZVY 2QSCL 2F7QA 2XTJD 1MI5D 3NABH 1HJCA 3P3SA 3U9UA 5BMFH 5CEYB 5I82A 5IP4A 4ABQA 4XWGH 5FYKE 5CJXC 2H3KA 3UAAA 4EDWH 3Q1SL 2QGDA 4OUOA 1IGYA 3HBPA 3WS6A 3T3ME 2EH7L 1IARB 1IGJA 2IWFA 2X9WA 4UV7H 2BOLA 2GSMB 4JJHA 4J3UA 3GINA 5T3ZH 4OM1H 4X4ME 1XF2A 1VPOL 4UDTA 4CW1A 4AW7A 1TJGL 4GQPH 5E7BA 1T0OA 2UZXA 4LLDA 2VDKH 5DFAA 3U6XA 1T21B 4NBZB 5GS2H 2MCMA 4ELDA 3FMGL 3GHPA 3GDBA 3NJGA 4MAYA 3QO1A 3B9VA 4QHPA 5EB9A 3FAXA 2QQQA 2YPLB 2NYKA 5LGHH 2C1PB 2DQUL 3ULUC 1HILB 4R2GC 1RHHA 4XZUB 4LCUB 2K9FB 1DBJL 4DUVA 1Y6NR 2FLBT 2GYSA 1IM9A 4BM7A 1JZ6A 1YJDH 1S9VA 4MQSB 5H2BB 3QRGH 3SE3A 3TVMA 4BZYA 5I1AA 1WD8A 3L3HA 2XZQL 3G5XB 3GZQA 1DQJB 3DUUA 2D7PA 1NCHA 1OIOA 4V11A 5CWSA 5JA9A 2VN4A 3C08L 5D2NB 2AJXH 2QFPA 1J5CA 3QAZB 2PWEA 3AQXA 2UWEE 3OSVA 4LLMA 1WHOA 3OZ9H 1BQHG 4O2CB 1OY3B 1UB6A 3GUFA 2VERN 3T3PE 4HAFA 1ZHBA 1OKEA 3ET9F 1XTMA 3R1GH 2UX7A 3TZVA 5JPMB 4UMSA 2ZCZA 4UNVA 2ATAA 1MCHA 2XU9A 5DS2A 3WHE1 1JHKL 2GJPA 2W9DH 3I75A 4P46C 1TVBA 3DX3A 5I9QC 1MLCB 5MI0B 3O3DA 3SBRA 3BLBA 4IRJA 1F11A 1GZHA 1RUKH 1LE9A 3ROOB 1NBYB 2BNRA 2APFA 4BZ2A 1OAKH 4JRXB 3UX9B 5GSVA 2CMRL 2VQ1B 4KJQD 4YHIA 5D1XA 3FAWA 3WL9B 3DJTA 5T3XL 4MD4B 4H5SB 1H5BA 1TR7A 3SE9L 2A4CA 2XQ0A 2XWZA 5C92A 2ENJA 4PJ5D 2HPOA 3CDCA 2WWOA 3V5KA 3PY9A 3US1A 2PWDA 1A6AA 1RUAH 4XP6H 4YX2H 1MW1A 2J6EH 4QHMA 4JGNA 3MREB 1U95A 5C0BA 3O3AB 4AXWB 1AIFB 3OX8A 2JLLA 3PJSA 4PRHB 3VAEA 1ZT1A 4W9ZA 4GSDH 3V2AR 2UY6B 3EJUA 3SDXE 2BX5A 4MSWA 1T1YA 2QLVB 4XI5D 3KPNB 4PJCB 2H1PL 2XTJB 5E9DE 2GI7A 1MI5B 2VRQA 1K3IA 3WUZA 3JWNC 1BQSA 3VD2A 4X6CB 3NCXA 2BOCA 4BELD 2B59A 1L9TA 1PZ5A 4AH2A 2R0KH 4M5YH 3SPVA 5EUKB 4BWWA 2PLTA 2VIRA 4BKLA 5FA4B 2ZX6A 3VI3A 5CP3A 5TQ2L 4PV8B 3S5YA 1J8HA 1DE4A 1FFNB 2O6FA 1MRCL 1GOGA 3A21A 1DCLA 2VR3A 4IBVA 1LGVA 2VDPL 3TASA 4JDVA 1D3CA 3CDFA 5I66B 4DUXA 3LNFA 1P84J 3OKMB 4X5QA 1QD0A 4LL4A 2IXQB 4J3OF 4IDJL 1N10A 2VC2B 4AK2A 2VZOA 1SJHA 4JFWA 1QW9A 1P2CB 1X7SA 3HB3C 4MXVF 3CLFH 4HPYL 3CFEB 5F9JA 3U0TB 1K8DA 2DQGL 1N4XL 3QUMB 2AGJH 1EHKB 2CGRH 4EI5A 5K9KB 1KPUB 2OFQA 3FUKA 2AJXL 2E86A 3WE6A 3BD3A 1N64H 2YSTA 5J7CC 4HUVB 5DC9B 1MXDA 4BSVA 3QYNA 4N8UA 1L9NA 4URKA 4MCNA 4X0KA 1G6RL 1QNZH 2NCEA 4LRIC 3QHTC 2XI9A 1ED3A 1TPXC 3MLXH 1G7IA 3OKOA 1TYEB 4N2HA 3DUSA 2XZZA 1IZJA 35C8L 3NZUA 3IFNH 5JR1L 1RURH 5HYSA 3QXVA 4G8FA 5JPNB 4JO1H 2AJUH 2ICWI 1CG9B 4HPOL 5LGYA 4WAFA 1OAKL 3KWXA 4UIKL 3VX0A 1RZIA 4KDTC 4QGTA 3KMDA 1GKOA 1K6QL 1P0SE 1AR1B 1R46A 2I5YH 3FT4A 4NRZA 1I7RA 4PW3A 5IK3B 3CH1B 5C07A 5DYFA 3OF6D 2ZKMX 3HG1B 5E4EC 3TJPA 2XXFA 3FYIB 2R9HD 3G5YB 3O3UN 3L3OA 2H7WA 4FQJH 4F7EA 1TTAA 4HPHA 5ESAB 1CF1A 3QQXA 1RIUH 1RUAL 4LPYA 1I4FA 3AU1B 4PJ5B 1YEHL 2J6EL 2PXYC 2LFGA 4JKPH 5EU7C 1R5IB 3MRFB 5AUMB 2IG2H 3RPIA 1VB9A 1MCPH 2VDQB 1IAIL 4HA1A 2QT6A 4HOXA 1X5AA 2VERA 3BAXA 1BW8A 1E2ZA 4AYFB 4WNQA 2XG5A 2YRPA 4BRVA 1XXFC 2EEBA 3JYCA 4ZFOA 1JVKA 3PDOA 2A5UA 3EJQA 3C5JA 3QRBA 5JO5B 4M1GL 5DQ9A 5EA0L 3R8BB 4F57H 2Y2YA 3V4PA 4F2MA 1N5AB 2Z31C 3AQDA 1RPKA 3HA0A 3VJ6B 3MR9A 1CYXA 2DZEA 4LIQL 1IVLA 1TQWA 4MMXB 2AV1A 1KFAH 1WYJA 2CR3A 1A2YB 4RMTA 3BVDB 4A55A 1KIQA 3C75A 2XTLA 1S7SA 3L4VA 2YZ1A 4QY8B 4F15C 3MRJA 4U7KA 5E95B 2NT1A 1SM3L 3FO9B 1B0RA 3FB6A 2H0PA 4XPTH 3KL0A 1N6QH 2G3XA 5T1MA 1NFKA 3OJVC 3FSWA 3VXQA 4QOKA 2FECI 5ES4B 2X87A 1WIPA 4KJWD 2BSTB 5A2BA 4G5ZH 3V5DA 2J6WA 2APBA 4WK4B 4F8TA 3LDBC 4G8EB 4ZO7A 2OTPA 3FQRA 2ICES 5EBWB 4K7PH 2OJEA 3UABA 3SCMC 1QFHA 2NY3D 3NCBB 4NUGL 3NJVA 3L1FA 1YUKB 4N0YH 2R69A 2G0LA 5H37G 1NLDL 2Q86A 2RGSA 4P23D 4P4KD 3O4LB 3PU7A 2A74B 4XNZC 5J8OA 1NFDB 1MJUH 4M1DL 2DDQH 3LNEA 1UATA 4WU5A 4KX7A 3ZOAA 1XB6A 2RALA 4JO1L 2NZIA 4A2HA 3ZBMA 5CJQL 1JDCA 4YC2C 1QLFA 2J20A 1E9OA 1KN4H 4HUNB 4OUUB 2E59A 1A1MB 3OKDA 3C60C 2W0KA 1T7ZA 2BIIA 3TPUB 1S78D 1WZKA 4FLQA 3EXJA 1DANT 1D5XB 2NR6C 1P6WA 1JWMB 1UYWL 3ECVA 2DIEA 4ETYA 2ZZUT 3KGTA 3QT2A 3DMMA 1T0PB 4XTRD 4FI8A 4FERA 2R0LL 3W9DA 3G3LA 3QUYA 2FO4B 2QJDA 3SO3B 1PDKB 2AFNA 1KBKA 5CBEB 5DR5H 4QXUL 3T0EA 4U1KB 4XCEB 4XNYL 3UBFA 5I1JL 4WDIB 3AU0A 2DJSA 4UTAA 3JV6B 1RZFH 4K3GA 2NPLX 5T1LD 3K81A 4FA7B 3K1DA 4H25B 5DHDA 3ESVF 3D34A 4XBGB 4JM2D 4OM0H 1MRFH 1QQDA 3VFGH 4HWUA 4EF3A 3ECUA 3ABZA 5B1BB 1KTRL 3BEWA 1ILUA 2JKLA 1K8IB 4XC1H 5GGSA 2Q7YB 3WN5A 4JNXA 1JNLL 3F00A 5BS0A 2FQGA 2W80C 5D5MA 1OPOA 3LKQB 3WIAA 2I24N 2CQVA 1NCTA 3CZFB 3BUYA 3M17B 4OFQA 3LH8A 5IR1B 4N20A 1O0VA 4LRNH 1F4YH 3JV5A 2VABB 1FBIL 2YC1A 3BD5A 4N9OB 3UCRA 1P69B 4WEUD 5DJYA 3BW9B 1WBZA 3FRUA 2VAAA 4KY1H 2EIKB 3A5VA 3JWDL 3RA7H 4S11A 4WUUA 4P9HH 4DTGL 2CHNA 3MRIA 3GB7B 5HGAB 1EAQA 3S9DB 2V37A 4DKFH 1NBZB 4P2RA 1B9KA 3PWLA 5DA0B 5DLML 5ALBH 5A2JH 1S7QA 3WUWB 3QB7C 1BEYL 2P80D 4KK6D 4MNQE 4F3FB 1ZS2A 2E4FA 3EDJA 3OL2A 3X1GA 3WIIH 4IMKA 2FWOA 3OQ3B 1P5UB 5IROC 3F6JA 1G9ML 3RU8L 4X7CC 5E94B 3T0AA 3GSWA 4XMVA 4JB9L 5JIPA 1E90A 3VWJA 4JFXB 4K94H 3U9PH 1MWAL 1SVZA 4UIMA 3SQOL 3AG4B 3MC0A 4L3EE 1EA9C 3GFUA 4U1JA 3S3BB 5DT1H 2FIKA 1WBXB 4TRPH 2NX5A 3NN8A 3D48R 1MG2C 1XD1A 2NY3B 3C9NA 4LMQI 4X7EC 5DZOA 4UM9A 2AXWA 3U6RA 3AM8A 4X5XA 1V3KA 3LRSA 2BSBA 4P4KB 4P23B 3NMEA 3Q48A 1RJLA 1R17A 4MASA 4M1CC 2VSCA 2WLIA 3RX9A 4C57C 3LRHA 1I3UA 5I1LA 2YXMA 4FP8L 4UUJA 4PY7B 2YS4A 4WJ5A 2X70B 1E65A 4GO8A 3F7VA 4MAYD 2E8ZA 4NQEE 5C8JB 2O4EA 4HJSA 6FABH 2GIXA 1ZPLA 3IDMA 5EZPA 5I75B 3IKKA 4F9LA 3C6LA 1BREA 2Y6TE 3QQ3B 4HETA 1JK8B 3UGEA 4FA6A 1BFVH 1IM9D 1FZJB 3F83A 5FAAA 1PD6A 2YZ8A 3JWNE 2G60L 4JFFA 5KUMA 3TVMD 1N0XH 5I0DA 2EYRA 3WI9A 4HIEB 4CNIB 3BO8B 4K3EL 4MDIA 4R4BA 2FX8H 2V9TA 3TBWB 2Y22A 3V95A 1FWXA 2VDNB 5DJ6B 4ZMAT 1WFMA 5KW9L 1RZFL 3WMPA 3OHMB 5F89B 5B39G 2WWKT 4C59B 1LE5B 4LLUB 3BKJL 4BUQA 4LDCA 5ANMA 4W4OA 2ICWB 5ELIA 3HZKB 1N70A 5EF0A 5T1LB 4IS6A 3TZVD 5KVDH 3BJLA 1U8LB 2NOYA 2ZWNA 3B6SB 2EKJA 1D9KB 5HPMB 2PYEE 3ES6B 3KYOA 4ZOBA 4N2FA 1FDLH 2BINA 3BC9A 5I6NA 4KZEL 1TQBC 5FHBH 4IRJD 1THAA 4UOW1 2Q76B 1UASA 3CLEH 5GZNA 4EIGB 3FKUS 5HSFA 5DS8A 2R15A 2G5BA 1UJ3A 5SX5H 1VGEL 2BJML 4AYMC 3H2QA 1Z3GL 5B4MD 1LDPL 3RWGB 5D1XD 3U1PA 4HHAA 5DJ2A 5D6DA 4YHKL 4CVXB 4H20H 3KXFD 4C8XA 3KR3L 4LSDA 3QNXB 1S9XA 3V5HB 1ZVSB 1QTSA 1YC7A 4G7RB 3U83A 3SZ6A 3MROB 1SN2A 3Q8EA 5GGRA 5T33H 3OKKB 2WLJA 2ENQA 4YSPA 4YS4A 3MACL 4R4FH 4U1IA 3QAQA 4GAJH 3H9ZA 1L9QA 5IJBC 5C0BD 2YD7A 3GXNA 5CEZE 4D0DA 4XE5B 5AB2A 3L3GB 3ERXA 3O4OC 1IX2A 1W72L 4RGOL 3P0YL 1S7VA 1CE1H 3FOMA 4F37K 4LSVL 1NIDA 1Z7JA 2GTWB 2Y0SA 3P1VA 4GI6A 4JFHD 4P5MA 5KOVC 5GS1A 4OZIE 3U9UB 3UG4A 4E0RA 4BQCA 4AEEA 3BKCH 4CJ1A 4AT6A 3WNMA 1NMBL 3EHBC 3NJJA 4M93B 1IGYB 2PWHA 5ICZB 1IGJB 4R90L 2LAAA 4MS6A 1OK0A 1A22B 2YIHA 4KKZA 1YEJH 2BVPA 4RH4A 4FNQA 3GC3A 1ZJBA 3MLPA 4YHYB 1OW0C 1J8HD 1IFRA 4Y2DA 4XOCA 2UZXB 4YLBA 3LIZH 3ALPA 3HRZC 4LLDB 3SSGA 5J1SC 4R7NB 4CSPA 1NAKL 2C3VB 4MAYB 2VMJA 3I85A 4UAOB 3KLLA 4KWUA 5E6YA 5CGYC 1PL3A 5ISZA 3AREA 2VDML 4K9EC 1IVTA 4OVUA 4LEOA 4RDQG 3RDTC 1I8AA 1RHHB 4U1GB 4O58H 9CGTA 2NZ9D 5AW9B 1L7IL 3FUEA 5KAQF 3Q9PA 1RUPH 1S5HA 1S9VB 3TVMB 3O6LL 4EI5D 1HSBA 3L3HB 3GT6A 3O6FC 5GS0L 1H9VA 3K2IA 1TEFA 2F54A 3MLZH 5DD6A 4X5RA 5CWSB 1FPTH 2W65B 4M62L 4DIXA 5J12C 3ZSSA 3L9RA 2E0PA 1PAMA 4MMZC 4Z7QF 2X0WA 5KVDL 3RVVC 4RVBA 4NN6B 3QEQE 1QUNA 5I30L 1UB6B 1V3JA 1A3LL 1I3VA 1J0JA 1ZHBB 3LH9A 2GQHA 4IRZH 4DOHB 1JMZA 4LEEA 2AJVL 3L5WA 5GJSL 1G7PA 2CGYA 1VGKA 1VEPA 4D0BA 3J2PA 4MNHB 3I75B 1TVBB 3B2DC 5KSBA 3HRPA 3QXWA 2O5NA 1ANUA 3KW8A 3O3DB 4POZD 3TN0A 3GRBA 4IRJB 1F11B 3IJSA 1BQ5A 8FABA 4L0YA 4YQXL 5G55A 5CCHE 2L8AA 5CLYA 5FGRA 2AEWA 4QR7A 4XPHL 5GSVB 4YHIB 3OXRA 1AH1A 2EXSA 3TT3L 2YUWA 2N7AA 1OM3L 1H5BB 3KXFB 4AMKL 3KJ4C 4RAUA 4FNPA 1DJGA 4HV8A 2DMBA 2R2EB 4EE2A 3BHBA 3CK0H 4YXHL 1A6AB 3DARA 5JZ7D 2DI7A 4QHMB 3WSQH 3MQIA 1KTDB 1U95B 4H1LA 2QADB 2EDRA 5C0BB 1GTFA 3JV4A 3PJSB 1TIUA 4WWKC 1ZT1B 2YKKA 4HUUA 2EEAA 4NGHL 5AAWC 5KYWA 4GIOA 4MSWB 1NBVH 1T1YB 2OSYA 3MLWH 4I0PC 4ZOCA 1WE5A 1TCRA 3F7RA 4M8UA 3AABA 2VXQH 4P3CH 5DRWB 2VNCA 3ZKSD 4DK5A 6TAAA 2AJYL 4A2LA 2BOCB 4QXGL 3NCFB 3PYCA 3CSYA 4HQQL 1MZYA 1PZ5B 4AH2B 5IMLA 4OFIA 5C7XL 3SPVB 3QARA 4UANA 5IREA 5E08H 4N2DA 1X3DA 3PWVA 4XCFL 1TTUA 3VI3B 2KHAA 3QNYB 4MTMA 3HC2A 4CRPA 3PL6A 3NPSB 1J8HB 4PPTA 1LO2L 1TTFA 5GGQH 1JTTA 5D1QC 4JFZH 5D4QA 5DZJA 1XCXA 2WB7A 2GY7B 5EZJA 1JMXA 1A1NA 2OYMA 4G3YL 4QOKD 3UIYA 4ZMNA 5JQ6L 5BJTA 2R4RL 2BH0A 2F7PA 1WC7A 4WU7A 4MAUL 5EF2A 1SJHB 3FO2B 4ZS7H 1ETJA 1CDGA 1M3IA 1I75A 4FQXB 4WSGA 3IVKA 2CM5A 1K8DB 4PH8A 3AT8A 2D7TH 3GTTA 4JFEE 4EI5B 2A9MH 3CLWA 5E2UL 2R23B 1JDDA 1RHFA 1M6OA 1NGWA 3UFIA 3WE6B 2HT3D 1OTTD 4NJ9L 2VKWA 1NAML 4MQ7A 4ODTL 1O9WA 1UXWB 3EUUA 3CFBA 4JHZA 4BSVB 3ZL4L 2X1WL 4PS7A 3HAEH 4X0KB 1FH2A 2L0DA 4O02L 3VFRA 2X53A 2DM2A 1ET8A 5AZUA 2B4CL 4EAEA 1G7IB 3DUSB 4PREA 2EE3A 4F33A 2NY4D 3BIBX 4JCWA 1XSOA 4G8FB 3GIVA 1GZHC 4ELME 1F8TL 4J6RH 3BP5A 3CFDA 4JUTA 4L9LC 2VH5H 4BINA 3HG5A 2OA9A 1RZIB 4OLUH 3MBXH 1FORL 5BZWA 4LVOC 1MCWW 3HS0B 2BIHA 2W95A 2EDWA 4OF5A 4NRZB 2H26A 1GPOH 1I7RB 2Q20A 3DMMD 1R3IH 2H32H 3O45A 4JHVA 3T65A 4ELKA 3GXDA 1BAFH 1BVZA 2EH8L 3EFOA 3F5WB 3OD3A 2OTWA 4UT6A 2EUZA 3QUYD 1KOAA 3OM3B 4OIIH 5SWZE 1CL7L 3L3OB 3T0ED 4BFOA 2ITCA 3G04A 4XR8C 4F58L 3N41F 5ACZA 3UZVA 3HVNA 1ECYA 1A9VA 4LKCA 1FC2D 4HKJA 2YPKA 3MUGA 4GEJA 3B7YA 4AJWA 5FCSH 1G7QA 2BOBA 3NIFE 1SF5A 4R8WH 3RJQB 3B2VH 1Q0YL 4WNQB 4FMVA 2XG5B 1AG0A 3GMNA 4GNKB 4W6XB 4A68A 4CMHB 4ZX4A 1I1YA 4WI3A 1QABA 4LASH 4G9FA 3PDOB 3SKNB 1W8EA 3C5JB 2LU3A 4G8IB 3BUDA 3HTLX 3ZZ1A 4HK0A 1HCZA 3O41A 4TV3A 2NLJA 2WZAA 5DQ9B 5BS0D 1EUUA 2QQNL 4HBCL 5EIQA 4YAQA 3V4PB 1GMIA 5KVGE 1DYZA 5IOKA 2VM4A 5SV3A 2AABL 3N42F 4PJXA 5AQ0A 3K4ZA 4N86A 5C2BH 1PIFA 2X4OA 2AV1B 5BW7A 1LWRA 2J2ZA 1C5DB 3IXTB 1KIQB 1XIWA 2YA2A 4WUUD 1S7SB 4Z7NE 5E4AA 5LB1A 1HEZA 3IN0A 3MRJB 1UUNA 4P2RD 4P06A 5AZ2L 1HT6A 3MCKA 1YAZA 2PP7A 3G6JB 5FLUA 5KG9A 3VXQB 1GVIA 2OI9B 5D1ZA 4NQCE 4QOKB 4ZUVA 3WIFA 5A7EA 2FQFA 1MJ7L 3IDYC 1CLOL 5C1MB 1R3LA 1A6ZA 4O2FA 2DM7A 4Z7UF 3N0PB 1U3HC 3VWJD 1AMYA 1BP3B 5F9DC 2ESVE 2G4EA 3UADA 3VGEA 4MGXA 3AUWB 5CIPA 4GUCA 2ZOLA 4AENB 3FQRB 2NX5D 2OJEB 4UT9H 3MCG1 3QEUA 2OR8A 1JZ2A 2YQ3A 3PFUA 4I1RA 2LLGA 3RX8A 4OGXL 4UM9D 2DKMA 2Q86B 3WY1A 1I9RL 2A77H 4BDVA 1E9PA 2EDKA 3QWOB 4WU5B 1VADA 1IBYA 2IDQA 4NLAA 1LO0L 1FZMA 3BZ4A 1FL5A 2H5UA 2OYLA 2ZKYA 1E40A 2NY4B 2VH5L 1SJEB 1QLFB 4PWIA 4X2UA 3C6LD 3OKDB 4ALAL 5IFAL 3SKMB 4M5ZL 3WDJA 3WIHH 2WJ5A 1MY7A 1W6LA 4NSKA 4JFFD 2D73A 1DUZB 3BVVA 1HKFA 5F72S 3NJMA 2WLLB 3X3GH 4NN5C 1HINH 5AKRA 3MGOA 1PEWA 2WXFA 3W9DB 5CD3A 3KLHC 3CHPA 1FO0H 5D72H 4K3JL 1A25A 4K71C 5IHBA 1DQML 3T0EB 4YDLC 3F01A 5HJDA 3A22A 5TH2B 4Q14A 4G82A 1DJXA 4ODSL 4GSRA 8PAZA 1MAMH 5PCYA 1WIUA 4JY6B 1CGWA 5F6IB 2DTSA 1GH7A 1M2VA 4BQ9A 4ZAKA 4BRJA 4AYGA 2ZUQC 5IG7B 2ZXQA 1QQDB 4F24A 3QVAA 3DIDA 2RQ8A 3U1SL 2M8XA 5EIIB 5GZND 3BEWB 3WN5B 1Q8MA 5BS0B 4MVBC 5D5MB 5CCJA 1KELH 3GMLA 5LWYL 2PW1B 4HP5A 5DGQA 1I1AA 1V3MA 4JVWA 4FOMA 4PJHA 1X5FA 3IMWA 4ANKA 2VXSL 3MGTA 1SDDA 4YBQD 3FSOA 3EBAA 1NUGA 4K2UL 4M5SA 5FUCC 1WBZB 3FRUB 3SN6N 4OT1H 2Y1YA 1G7JB 4WUUB 3V9CA 2Y06L 2R7EA 4WHTA 2F08A 3TNNA 3QQ4B 4P2RB 4QO1A 3PWLB 4QWWC 3TA3A 1S7QB 3GRWL 3WXVL 3OXSA 4MA3A 3EF4A 3CQFA 5JIMA 4ICXA 5KS9F 5I0VA 3HNTH 5E99H 2YPVA 5TDPA 4L29A 4FG6D 4LPXA 1QFOA 2A83A 3L5JA 2IQ9H 5IMKA 1TNNA 3VWJB 5KSAA 5HHMB 2WJ7A 4UIMB 3E8UL 5E56A 4BQBA 4PW4A 2IGLA 3O6KL 4U1JB 2FIKB 4MXWL 5D2LB 1G1YA 1KN2L 3HUJF 2D8KA 3C9NB 1L0PA 4WKXA 4UM9B 3S3JA 3ARDC 4X5XB 4L37B 3LRSB 4CJ0A 4EDXA 2HKHL 1JE6A 2HUEA 1RJLB 5J9PB 4Y2DD 2WLIB 5I8KL 1UURA 5I1LB 4PYGA 4UUJB 4WJ5B 5I6XB 3F7VB 2CHXA 3D4YA 1ZGLM 5B38A 2E9WA 5ISZD 2GITA 1AQKH 2JI3A 3ARED 3E6HA 5CCKL 3C6LB 4L5FL 4GKNB 4KITB 1IE5A 1JRHI 1C1EH 1UM6L 1OHQA 4JFFB 4GMSL 4ICWA 4N87A 2EYRB 1O7DC 5HVHB 1A66A 1LO3H 2F54D 4JZOB 4MDIB 4R4BB 2JTYA 1KPRA 1PNDA 1DVTA 1ESOA 2F0CA 3DRQB 4JDTH 1BPLB 1DTUA 1KJ3H 4ONHA 2RIKA 3VA6A 3ZE2B 4EQ2A 5IB2B 3JT0A 2A6KA 1JPTH 5IJVA 5EN2A 5JOFA 5EV7A 2ZF9A 5IIEA 1ZIBA 3NCEB 1A65A 2CBTA 5DJDB 5ANMB 3GWJA 4JGUA 2XIIA 3S0PA 1C7SA 4I3SL 5EU3A 4LLVA 5F97E 1NQBA 4PCKA 1EWHA 2GT9A 2QGCA 2CNZA 1BD2A 3KYOB 1ZV5A 4WO4A 3RZCB 5IBUG 5TDOA 4JPWL 3TN0D 3AY4A 1WWAX 1N59A 2FK9A 4GRWH 4M6MH 5DS8B 1XF3A 2G5BB 2F18A 4QJ5B 1NJ9B 4JFDA 4YN3A 3EDKA 4HHAB 5DJ2B 5HDQL 2XNAA 4XP1L 2JIXD 3ARBC 1J0HA 1FCCA 1SGKA 5JIKA 3GBMH 1HEJC 1YEKL 1S9XB 3IMBA 2X4TA 2CKBH 4A7SA 2CCLA 4HF5L 4NHCL 2CUAA 3EFDH 2YK1H 3RUGE 2V5YA 2ENSA 3WKML 4U1IB 3DX6B 5GRXG 3HE7A 1YJDC 1NOFA 2BP8A 3S2CA 2BNRE 1CMOA 4XMKL 3KPOB 1AS7A 1UWYA 2VQTA 2V4LA 3ZW3A 5I1GH 2C9QA 3D1MC 3FOMB 5D1XE 5IB1A 3H3PL 4LNVA 5D1ZI 3MNDA 1A9EA 2Q2LA 4P5MB 1DFBL 3HBQA 2X4UA 3V8OA 1RZKL 1WCBA 3AQZA 2W9EL 3FN3A 1A3ZA 1FV1A 3UJIL 5JW4Q 3CSGA 3K4DA 4QCIA 4BE5A 1DJIA 1RMFL 2OP4H 4XVTH 4Y5YA 3RY6A 5IVNA 1DQDH 4D8PA 1MUJB 2BVPB 4K9JA 2J8UB 1T03H 3P0GB 2W91A 4BK5A 3GXPA 5C0BE 3PL6D 4O5LL 3VDBA 4Y2DB 1QHOA 1T83C 2W9LA 2XWEA 5F0PB 3N40F 4G9DA 5C0GB 1IFGA 1MCLA 2F58L 5EC2A 2DQTL 2XZCH 1T4KB 5ISZB 3FONA 5DC4B 4J6IA 1ES0A 5D7LA 1HHIA 4LEOB 4OKDA 3VTMA 5CJ5A 4OLZL 4OSUL 5CLZA 1A7NH 1LO3L 5JHMA 4I9XA 3VD0A 4GSXA 3ZYZA 5DEJA 1JL8A 4I9WD 4ZX3A 5IESH 4LCCA 2D7OA 3V0WH 2F54B 3NPZB 5DD6B 2HTKD 1E6JH 1RZQA 4FFVD 2WWMC 5LXGH 3MV8A 3L9RB 2AEQH 4JHAH 2FYYA 5IWLC 4X6FA 3NEXA 5AAMC 4PTTA 4JRLA 2Q8BL 5D71H 4YLCA 2B2XL 3GXIA 4KC3B 1WVZA 1Q0EA 3CG8A 3C12A 4YDJA 1DJHA 1E5UI 2Z35A 1JPEA 2DQIH 2VN7A 1A7PH 4P48A 3L5WB 4Z0BH 4LMQE 3VGDA 1G7PB 2W8CA 4AUUA 1VGKB 4E9SA 1PY4A 2ILLA 1HQ4A 4D0BB 3UYPA 3RNKB 3AACA 2DD8H 5KSBB 2DQDL 1NCBH 1Z9SA 2X2YA 3TN0B 5AZEL 3RGHA 4KAQL 2ZNWA 1EFXA 4YR6B 2APTA 4YFEA 1ZIAA 3VXRA 5JIQA 5FCUL 3OXRB 1NC2A 3D9AH 2X41A 1B4JH 3EGSB 2JIXB 1CQYA 3KH3A 1HI6A 3VGFA 3W11C 2YMTA 1ZD6A 1ETA1 1ACXA 1MVUA 1NGPL 3GI9H 5D7IA 1OARH 3ZKNC 2WINA 3VI4F 2Z7WA 4R97C 3HPLB 2ZYHA 3BHBB 3UERA 2IADA 3ARFC 5FV2A 3MRLA 4KKLD 4BKSC 1U6AH 4H40A 4H1LB 1UA6L 3OKYA 4CADA 1J12A 3JV4B 5C07E 2WBXA 3ELQA 3FPXA 3L4XA 3GJFA 2Y5EA 4G9FD 4KKPA 4ZBJA 5GS1C 2VGLM 5KYWB 2E7MA 3MV11 3MJ9L 3F58H 4Q2ZA 3B9KC 3V4LA 3P11H 2DQMA 4UM8A 1E6OH 1A6WL 4B9YA 5GXBB 2BXYA 5IMLB 4G8GD 4Y7MA 2M1KA 1XIWD 3PWVB 3ZTNH 4P46B 5DZNA 1N0LA 1QBLL 4PB0L 5CU9A 2OK0L 3SDCC 5CLWA 3BN9C 1V7MH 3PL6B 2CLZB 2F1BA 4P04A 2AZUA 4MNGB 1A5FL 4OCSL 3EGXB 4X7TA 4KH9A 2QPSA 2QHLA 1KB5B 1LD9A 1MZZA 2VM9A 3ARGA 3LRLA 1CURA 3W0WA 5EIIG 5D1ZD 4ESKA 3I02A 5BJTB 4HCFA 1U3JA 4ZFZA 1XQ4A 3NA4A 1CI5A 4F2ME 2P44B 4WU7B 1ASOA 4PG2A 4XH2A 4L4TE 5D7JA 3RX7A 4XVOA 3IVKB 4XHJD 1OAXH 1VA9A 3WCYA 3US0A 2CZNA 2EC8A 3RVXC 4N8PA 3FUDA 4N5UA 1X5ZA 1AACA 3GLAA 3US9A 3BAWA 3IGAA 3K0YA 3TFKC 5GJTH 3U1QA 1RIVH 5I5JA 2KZKA 2F9BT 1BSIA 3D5OF 2Y24A 5FO2A 3D0VA 1T7YA 2R29A 3CPLB 5AW1B 4OH2A 3VFRB 2HN7A 2HRPL 5EWIL 1JXFA 1TQSA 3CH8A 3GMOA 3I3EA 1NDMA 4J1UA 4PVNA 3Q43A 4IOFC 4PREB 4QNPF 5AOMA 4F33B 3DO3A 4D7BA 3S4SA 3GIVB 3BKYL 5KJ4A 4XP4L 1WEJH 2NNXA 3GMRA 3N44B 1P53A 2HJFA 3CFDB 1UWEH 1UZGA 3SHSA 5KVEL 4HLJA 4I18A 2APVA 4TSAH 4OD1L 1XR8B 5FYLD 5BZWB 3ME0B 1XBDA 4TVSa 1J5IA 1ACCA 1FNFA 4OD3L 3NSJA 3CBKB 1IT9H 2O30A 3O45B 5AYTA 1GW6A 4UU9A 4G42A 4YSCA 3EFOB 3HEIB 5FUOH 4ETQA 2CLVA 2NSXA 1RZ8A 1S9WA 3S98A 4D2NA 3P02A 3SEPA 3D08A 2E4TA 2BP5M 2IV8A 4NP4L 3G04B 5ACZB 1EO5A 1RZJH 4MS8D 4NM8H 2ALWA 2EEFA 2ZTBA 3WOVA 1CXKA 4KGLA 4LKCB 1QVOB 1T1XA 2XPGA 3GSXA 3MUGB 4B60A 4APQD 2BOBB 5BV7H 1OZTG 1CB4A 2C4FU 3R06A 1G0DA 4XNXL 3PJNA 2VITB 4ZAKD 3GMNB 3EOAB 1P5VA 4NXKA 1G5AA 1MRDH 5IVXA 1I1YB 3VWKA 1SXSA 4TOYL 4AE1A 4NZRL 1S7UA 4UF7C 3VYNA 1I7ZB 3PQYE 1PAZA 3RYMA 4HK0B 2OLDA 2NLJB 2Y1ZA 3FB5A 3I6LD 5TPWH 1O7DE 2NXYC 4CBPA 3AQYA 4ZSOA 1UM4H 4CL7A 3HJ0A 1I1AD 1J88A 1IAOA 3OGCA 4PJXB 4G80A 3FSVA 3MDJA 4PV1C 1XZWA 3DWTA 4G8GB 2AAAA 4Z7UA 2X4OB 4FHKA 1UZ8A 5F7KC 3IGLA 2ZCKL 2BS71 1JGEA 4R7XA 1XH0A 4FNLH 4PBWD 4ZXBA 3ARRA 1HEZB 1A7BA 4JHUA 4DKDC 3K6OA 2XXMB 3D06A 2OR9H 3MCKB 4M02A 1MQKL 3TA3D 3N04A 2WN2A 5KG9B 5E4EB 3SJVA 5D1ZB 1CYWA 1LP9B 3WIFB 4TUKH 4Y9EA 4D9QD 2R4SL 4ZMLA 5B21A 1WAAF 2AK1H 1OZUA 1R3LB 1A6ZB 3ZE0E 4O2FB 1D5RA 4TQEL 4I2XA 1BZQK 4X8XA 3H9HA 1KCRL 4PB9H 4R4NC 2ROXA 1JF5A 5EBGA 5KSAD 2F53E 3OLGA 1RCYA 1RIVL 3GSRB 4MZ3A 4ODWA 1U8PB 2NYYC 2ZOLB 1KIRA 1CD8A 2MIZA 4FABH 4UMGA 4DVBB 1EUTA 4UQ2A 4OVVA 2VDQL 2WY3B 3VFUA 1A21A 2K3HA 4AM0A 4OLVL 4RMUA 4HH9A 1ZT7A 4ABUA 1HNYA 4BDVB 1GAFL 7FABH 1KXVA 1E9PB 1MPAH 1PTZA 4KHXL 2Q8AH 1VADB 1W0YT 2FJFA 3MV9E 3FU8A 1CGVA 3BZ4B 3MFFA 2P52A 3LS5L 1SY6A 1XMEB 3QS3A 3P73B 1UHVA 3A67H 2Z31B 3MUJA 2FL5A 1I8IA 4ZO8A 2BWDA 5HDBB 4JG1H 1OPGH 3E3QC 1G1KA 3L4ZA 1X5XA 5MP6L 2XVBA 5I8OH 2MHAB 3FL7A 4TS6A 2NX5E 3UTSA 4NSKB 4LEXL 3QDGE 2H1LM 1H6FA 3U7AA 1OLZA 4P9HC 1I85A 2JNZA 3OAWA 3TJEL 3IEAA 3MGOB 2O5ZL 2PKDA 5HI4D 5CD3B 4ODUB 2ZOWA 4EZJA 4DHLA 2WM0A 3FHQA 1PF3A 2L3BA 3N1FC 4YDVB 4L1DA 4MA1B 3TM6A 1XGUB 3GO1L 4RFOH 1U21A 4NM4L 3A6BH 4PJ7A 3O11B 3VFVA 3W5NA 4YHLH 3KWVA 1RSYA 2CDEB 3MX0B 4FFYH 3IFLH 5DHVB 2RR3A 4FJZA 1CDBA 5EBLA 4APQB 3LDBB 5K9QG 4OZ4A 1M2VB 2CHDA 4Y1AA 1IUZA 4K94C 4ZAKB 3HBZA 4N4YB 1CZ8H 1HCYA 1BD2D 4NQVA 1ZKAA 3MRHA 4WO4D 5C9KA 5LXVA 4TTDC 1FNLA 2G5RA 3NA9L 4FDWA 2WXGA 2EVJA 1KYOK 1X7TA 1K5NA 1WFOA 3FCSA 4BIKA 4BHUI 1DQQA 4Y19A 1QBMH 2E5EA 3AT0A 3EZ8A 4WEBL 3QISA 3GMLB 2NY2D 4JFDD 1MFCH 4JRFA 1I1AB 2VZ3A 4PJHB 4RZCA 4APXA 1SDDB 3APDA 2QV2A 3MPCA 3ROLB 3U4BL 1DQLH 5FYJU 4AM0Q 3P69A 4WWOA 4ANUA 1JXGA 4WHTB 2MOVA 4TMPA 2GBAA 3ZDYE 4QO1B 4JPQA 5IMMB 3CIQA 3CU7A 2HB0A 1DQIA 1WP6A 2BZCA 4IBYA 4JPVL 4YZFE 4YGVA 3TA3B 5E00A 1E42A 4MA3B 2WTPA 4KZ0A 3ZYOA 4U4IA 1XEUA 1OSPL 5TDPB 4M8QA 3DX9A 4HJ0C 3P54A 3RVTC 3CFMA 4TNGA 2FWSA 1P7KA 1TMCB 4KKCD 2DKSA 2PW2A 3V7MA 3FQUA 2YARA 2XWTB 5DUJA 3S88L 4NN7C 3RWDA 5KWYC 4F8OA 5IMKB 5KSAB 4FABL 3LY6A 3EBGA 1JS4A 2B77A 2WSDA 4KXBA 2KDGA 2GJ6E 1EGJA 4ODVL 4WI8A 3V6OA 5FECA 5CSZA 1UOLA 4DGVH 3TEUA 1NDGA 1M53A 3UEQA 1FLRL 1DN2A 3LVTA 4HCRH 4R7VA 3LXBA 4LDLB 2H47C 5EPMB 3LMJL 4B3EA 1JHLL 4EDXB 2CXGA 1AFVL 1AGDA 3BAEH 3EYUH 3PG2A 4HGKC 1HXKA 2V9RA 1TTCA 5F7HA 1J9CT 2J71A 1MDTA 3OAUH 5DFVD 3PGDB 4H88L 2XZAH 1GA2A 4WI9A 1O6SA 5B38B 1SUHA 4OAWA 2GITB 4Q6KA 2G9HA 2YAEA 5D7LD 3WD5L 4LSPH 4GW5B 1T5XA 2GIMA 1TYJA 3VG0H 1ZGLA 1YPZF 4MZRA 2F74A 3D30A 3KHOA 1GGIL 4NFCA 4LL9A 2QSTA 4F5CE 3VQ1C 1WZ1H 1AHWA 5ICXA 4YFLI 2NY5L 3A6BL 1N67A 1X7QB 4PRIB 4QRFA 1IEAB 3TJHD 1LEIB 3MV8D 3RDJA 2A6KB 2WTOA 3FUJA 2FX7H 2XN0A 5IJVB 2DLTA 1XFPA 2R8SH 5IIEB 1AR2A 4NCDA 4WWID 5AW5B 3P4MA 4GBXC 4S1SH 3BPNB 3NYKA 4PN6A 5LBGA 5EU3B 4LLVB 2APWA 1CICA 1UA7A 2R1WA 1JPST 4FQIL 3MRQA 4XWOC 1RK1A 1KNOB 1QSEA 2OSLA 3HNVL 2RBLA 4LSTH 4FLRA 4DGWC 1BD2B 3PPEA 4JO3L 3C6SA 3H2WA 3Q5OA 4TSCL 1IGTA 2JF1A 5B1JC 5JHLL 3N1MC 5JTWA 1B3IA 4WW2F 1EFXD 2MOGA 3BUQA 1A3RH 1XF3B 2G2RA 4H2CA 3ZKQD 2CIKA 3VXRD 4L1LA 3S8GB 2R1YA 4U1HA 2NY2B 2ZJSL 3GHBH 4JFDB 4BJLA 1CXLA 3GIZL 3VX1A 4FLOA 2MMXA 1NC2D 2XQBH 2ZX5A 3UTZA 1A9BA 3OJMB 4FRWA 4FQQA 2IEPA 1D7FA 2XNAB 5MEOA 1JPSH 1ZJAA 3B7RL 4LP4A 3ZQXA 1MLBA 2X4TB 4DJMA 1J8KA 4RWYL 1H3PH 4FQ1H 1ZPUA 2CO4A 3JWNG 4LCIH 5AKSA 4N2OA 5KVFE 3O8XC 1EJ8A 5EBMB 1UXSB 4B97A 3RE0A 5KSBE 2NRDA 3LRMA 3Q1EA 3Q7JA 1CWVA 2HX9A 1SDAB 3S3PA 1CF8L 2BP8B 5IHUH 4NX0A 3F12A 5E1AA 2HG5A 3Q6GH 4XB7A 4ZD3H 2MQCA 4H8WH 3HG2A 1RZGA 2DWDA 2YR3A 1MAJA 5IB1B 4GG6A 1NLBL 1MCJA 4M48L 3SDYL 1A9EB 3MA9H 4KXZI 5JYLA 3MJ7A 3KPRA 2VDNL 1A6VH 3CC5A 3JWOL 4UILL 5DA4A 3STZA 3VSTA 2HVJB 5B7MA 3C2AL 5JDSB 2X4PA 1PLBA 5HHVL 1WCBB 1XF4A 2OULB 3NH7L 1FV1B 2OCFD 3EO9L 3NZSA 3IETA 4QCIB 4XC3L 2ZWYA 2NW2A 5K5YA 4Y4KC 1QFWH 2AP2A 4D8PB 1YYMH 2BRRL 4NAJA 2WZPA 1TQBB 1RFDH 3QIBA 3BGFB 2ARJQ 4AQ1C 1RK7A 3K46A 1R0AL 2ZKHL 3ARGD 4NPJA 4DK6A 4G9DB 3W0WD 3C6EA 1MCQA 4S0SD 4EJ1C 2DS4A 5EC2B 3MNVA 2VLJA 3FONB 2AXJA 3FU7B 1ES0B 1NMAH 1HHIB 1HH6A 4PLKC 1KXTB 1F41A 5D7LB 4YWGL 1ADQL 1PKOA 4LAQH 4XNBA 1OAZL 4IBZA 4X42A 2BVQB 3TNMA 1R3KA 1DSFH 4J8RB 4QF1A 4MXVE 4TN9A 4AYID 4LCCB 3LB6C 2DQHL 3T1FB 1UACL 4FQCL 5J3HD 4GT7A 2F5BL 4U6XA 3QZLA 4FNTA 1SMDA 2WUCH 2OQJB 1JV2A 4M29A 3CXDH 5FXCH 1XCTA 4L1BA 2FYYB 1Z32X 4X6FB 1L6PA 4PTTB 4AMXA 5D9SB 3UPAA 3IDIA 4DK3A 1ZLVH 3ULVD 1JGDB 4P57A 4YDJB 1PW3A 3ZDXF 1M71B 2Z35B 4UB0L 2JKJA 3DJ9A 3G6DL 2HRLA 1EERB 1E5YA 2GI0A 4X5LA 4X4KA 2GEEA 3WHXA 4AIZA 3PNWB 5JA8B 2ZYRA 1NZRA 3UYPB 4I9WE 2C9RA 5T5NG 1G6RA 2PPAA 4HS8H 3F65A 4AGPA 1YN7A 1U4EA 3DURA 3GHBL 1RZ7L 2EABA 4AC4A 3K0WA 6PAZA 2YD0A 3VXRB 2VDRH 2DIBA 1L9RA 3HRZB 2WLZA 1NC2B 1F13A 2Q1EA 1QR1B 3PAUA 2FECL 1L9SA 4ZW6A 2F68X 2LVCA 4EO5A 4EBQL 5AW0B 1YEFL 1HI6B 2MQ0A 4ORZC 4GW1B 3GYRA 1DEDA 4UNIA 3D39A 1MVUB 1EX0A 3RDTB 5D7IB 2WINB 3HE7C 4YL4A 5AVYB 1OL0A 2OZ4H 4KXCA 4Y1TA 2IADB 1AKJB 1OE2A 3HG0A 3U2JA 3MRLB 5FYJD 32C2A 3SE6A 4NNXA 2Y6SC 4OCMC 1IC1A 4EOWL 5EU6E 4KPHL 4LLQB 3VWKD 4Y2NA 2ZXGA 2J6EA 1SLUA 4UINL 5J12B 3PDDA 4KQ3H 3J27A 4MMZB 4LL1A 4Q2ZB 2F1AA 4GKSB 4FFZL 4Q4EA 1HZHL 2FLMA 2XWXA 5FUZH 1D5ZB 4PSRA 3WTXA 4JQXA 1GKEA 4UM8B 1FYHB 1XGZA 1HHGA 1BBDH 4G5AA 3MXVH 4LCWE 5CMAA 5IT2L 4TTGA 5F7LB 1D5BA 1HKLL 5E2TH 4M7JH 4MCYA 1KEGH 1DLFH 1SXBA 1N0LB 1F4XL 3PJLA 5LNEA 4J3TA 2D03H 4TSBL 1YNLH 1TKWA 2HLEB 2KUTA 4MA7H 4ZXBD 2OMYA 3K5SA 4NZDA 3NTCH 4G9FE 1F4HA 2X05A 4N28A 3BPCA 4X7TB 4M43L 4OGQC 4PIRF 2YUZA 3ARGB 3H42L 3M8OH 3SJVD 2DM4A 1Y18A 3FTWA 3I02B 3T2NL 1HH9B 3DV6A 3FU3A 5FGCB 1T0MA 2H45A 3TWYA 4BSJA 5L9DL 1INDL 3L1EA 2V9QA 3SDDC 4R26H 3P4NA 4XH2B 2WYIA 2J4WH 4DP0X 3PP4L 2NY1C 1NEZA 1RJYA 5SV4A 3D0AA 3MCLH 4PRAB 4MZ2A 5IY5B 3GQFA 2EICA 2HP4A 4X4YB 2DL2A 4WGKA 3IGAB 3RJDA 3H4HA 3RILA 1TVHA 4I3RL 1ORQB 1JZJA 2GCYA 2H41A 3AXLB 4TKWA 5CINL 2B0SL 4OBRA 4WWKB 4LQFH 5FKAA 3SKJH 2WHVA 1SQ2N 2GC7C 4Y5XC 3HMWL 2MQGA 2HN7B 2WNXA 4AGNA 3BE1L 3DHMA 4X9IA 3D33A 1NDMB 4J1UB 4F8NA 2PP8A 4QRQA 4U05A 5AOKA 3A24A 4RCAA 1TDQA 3S4SB 1SXNA 2WGXA 4FQLH 4M6OL 2HJFB 2AVFA 3TBYA 1WWBX 3Q2WA 4TVPE 2TSAA 1XSJA 3T8XA 3UTSD 1PLAA 2MJWA 4NUQA 2Z4TA 2OYKA 2CIIA 4IBQA 3GBNH 4WHYH 3FW6A 3HLAA 2R2BB 3NEOA 1E2WA 4G42B 5D1QB 2YSSA 1KYAA 2Q6WA 4ETQB 2CLVB 3VRLF 1BZDA 3GLZA 4I0CC 4PWKA 5JHDA 1RZ8B 5J6GA 2VQ4A 4PRNA 3ESOA 4Q0XH 4L05A 3H2PA 3W57A 5HHOB 5EZLA 4PLJD 3OKNA 3CXFA 1JERA 1XZ0A 1ZLEA 1RH8A 2DH3A 2Q3XA 1U3HD 5CZVL 1MEXL 1T1XB 4OB5H 4NIYE 4JY5L 1U8IA 1VHPA 3P0VH 2UY7A 2V2WA 3R06B 4UCFA 4Y1AD 3V0IA 1OD7A 4U6HA 1P5VB 1GCYA 5IVXB 1CO1A 3VWKB 4BZ1H 1N26A 1TJXA 3BPLB 1EBPA 5T5FH 1G0XA 1FLTX 3L4UA 4BUHA 4Y19D 1NMCC 3LNHA 5EH1A 4ZSOB 2BS8A 2WIIB 4R96B 5M94B 1DL7H 1Q72L 3S35L 3IMSA 5I6KA 1H15B 2YAQA 3GD1C 3O2DH 3EOTH 2ZT9C 3QPXH 4MA7L 3WFEH 1IU1A 4ZMPA 5D7SL 1JGEB 3LKSB 2VR7A 1S7RA 3V0VB 3CVIL 3DRTB 4ZXBB 1FN4A 1E8WA 1IKOP 4LSRH 2J5WA 2WXOA 2Q7NA 3QZWB 2YQ2A 4RSVA 2GBUA 4DNLA 3AROA 2AXGA 3G5WA 1YA5A 2W60A 5GRJL 3UXFA 4OF3A 3I6LE 4LESA 4Y8AA 1DSWA 5GPRA 4XP5L 1PMYA 4GQZA 2X4SB 1QKZL 4JM4L 1QR4A 4ZNCD 2JCCB 4I2XB 3NCWA 1AXIB 3KG5A 3C8KB 4OFPA 1HZLA 1CR9H 2WBJA 2ZOUA 1CVRA 3D69A 1BOYA 1QRNA 3BSGA 3B7SA 3I50H 4ODWB 4OFKA 4XMUA 2YWZA 2EDDA 1KIRB 3VNYA 4L8BA 5CHNA 2DIJA 4UQ2B 1AXTL 3QQNA 3KHQA 1NFAA 1HWWA 4LSUH 1M3JA 4NXSA 5HVFB 1UZ6F 3RFZA 4EUPB 3F6LA 1ZT7B 1KF9B 1MWAA 2FJFB 1MFBH 2XACC 1DBKL 4S1RH 4GAGL 1AQMA 3X12A 1M4KA 1DLHB 2IDCA 2JE8A 3VMPA 4Z7WA 4M61A 1EJFA 1T1ZB 1FFOA 2FNWA 2H6OA 3IKCA 3L1OL 4U1LB 1EHXA 1JJUA 3CFUA 3O6ML 4I18C 4XNMB 4MYWB 3HR5A 3WFHA 4L4VA 1I8IB 4X6DB 4PMEA 3TS8A 2DV6A 2R0WH 4JR9H 5I74C 5HD8C 1BPVA 3CZSA 1U8HA 1KTKE 1L7TH 4NEHB 4OJEH 1ZK9A 3CBJB 3WFZA 4L23A 3VDAA 3ISYA 5L88H 4NERA 1CFBA 5GIRB 2KBGA 2XN9A 1CLZH 3TH3T 5HI5D 1G94A 3A6OA 4K8RH 1DVXA 2AV7A 3ZTEA 5AW2B 2J73A 4R0LA 1GRWA 4FZ8L 3OC8A 1MCKA 1ZLUH 3HN5A 3VFVB 1FH5L 4HJ1A 5FYKL 1U3HB 2Y1VA 3FT2B 2VZVA 1A7OL 5CUSL 3TURA 3VSQA 1CICD 3BOVA 2Y07L 1NOAA 3MOAH 1FSKB 4OZ4B 4Y5VC 2G0KA 4Y1AB 1QSED 3IM1A 4Z0XA 1ZEAH 4NQVB 4H0GA 3MRHB 2X6BA 2H4EA 1Z6JT 4YL9A 3B5HA 1LO4L 1K5NB 1FG9C 3QC6X 4ACPA 2UVEA 3MRCA 2VW4A 5AVQB 1XF5B 2HJKA 3O3EB 3FSAA 4RZCB 1TQCC 4APXB 1HSAA 2Y7LA 1CDHA 4GLRH 4CKVX 4YHPA 2EVFA 2E74C 1CU4H 1H3XA 3ZX1A 5IBTL 4YO0B 4G6KH 4N2BA 3ZGHA 2PR4L 3QS2A 3UTTA 3BVNA 4YHMH 3SGKA 1UWXH 3LZLA 2J21A 4HKZB 3UGUA 2HWZH 4B9JA 2BFGA 1S5IL 2LOEA 2MH4A 1VZHA 3QCUH 1KLFB 5T3XD 4GXVH 2KKQA 3PWPA 4G1MA 4KI5C 3V4VL 1MSPA 1ETZB 1BFSA 4QXTA 3EJSA 1P1VA 3UP1A 4JFDE 5E2WH 1XCQA 1CR9L 1P7KB 1IC7L 1M1XA 4YDLB 4FXGC 1OTUC 4TM9A 3KPRD 4LU5L 1U3ZA 4KUZL 1T89A 3DVGA 1JPFB 4OLEA 4QLRA 3FUNA 5D7KE 2A2QT 2X1XR 4XNUL 5FECB 5F6HJ 3PHOB 5BPPA 1IFHH 1NDGB 4KO7A 5J6HB 2EDEA 2Z7UA 3VB8A 3KPSB 1W72A 4FXTA 1Q90A 1YPZA 4HAKA 3BPOC 2Y23A 4S1RL 2WZPD 4PJDA 4W81A 2WMPB 5C97A 1TZOA 1AGDB 2Y5TA 4H4NA 4DO6A 5TFSL 4OCWH 3QIBD 1JWUA 3UTPD 3DTXA 5I1EH 1IIIA 1BJMA 2OTUA 5GGUA 4QTHA 1K3ZA 1TYRA 4L4JA 2DL9A 2MTPA 4FNUA 1T2QL 5KYXA 5LQBH 2MWCA 1Q1PA 2VLJD 3LNGA 2G9HB 5AVUB 4AC2A 4WRLA 4GIPD 4JZJA 2VSMB 1T5XB 5EULV 5L88L 1QW8A 3T0DA 4GQRA 4WI0A 2EDFA 4YXKH 1ZGLB 3BFQG 5IGXL 2HA1A 2F74B 3RGVA 2IV9A 2A6IA 4FQHB 4DZ8A 4LBEB 3U6XS 1L9MA 3BFOA 1AHWB 2XOTA 4UBDC 5ICXB 2F2HA 3HI6L 4TLTA 3AS0A 2WIMA 4KFMA 1WFNA 4CBZA 4XNQA 2ZCHL 3M7OA 2YOAA 3QQ9D 2AW2A 1CGSH 1UWGL 1FAIH 1UKTA 4FQ2L 4M03A 5DWPA 3GXFA 4KNUA 5D7LE 3QIWC 5DU7A 2WYTA 1BM3H 2R1WB 2QZ5A 1C12A 3RIFF 3S5LG 3MRQB 1RK1B 2OSLB 3EKCA 3TO4C 5EOQH 1LK2A 2WGNB 2QEJA 2QV4A 1EO7A 2DJ4A 3G5VB 2JJTC 4P59H 1HOCA 2I60H 5GGTH 3C6SB 5C3TA 3D87B 2E7CA 4PI0A 1IGTB 4XBMA 2VXVH 1QYGL 2YUVA 3SQRA 1V10A 3QUKA 4E36A 1BXUA 4UQBA 2AS5M 1F90H 3DX8A 2G2RB 5DK0A 5F7UA 2CIKB 3MLRH 3MV8E 2R1YB 3QI9A 4U1HB 4EI6A 2YBRA 3MXWH 3V52H 5FA3B 3NG5A 2MRYA 3UTZB 3NJLA 5MEOB 4C56A 1WPCA 3U0WH 3OZKA 1BJ1H 2E75C 4NWUL 3LV3B 1MLBB 1JTOA 3D39D 3H56A 1VKXA 2XPYA 3QCUL 4AQ8C 4YPJA 1QO3A 2BIOA 1WFJA 3K6SA 1DANU 3T9WA 1CXFA 4NZUL 1CDCA 1JCKA 3D0LB 3LJ3A 1J86A 2JV6A 5E5LA 2AC0A 1WS7A 1URZA 4WSKA 5ECGA 5F8RC 1D7DA 5GRZA 4H0HB 4ZT1A 2HG5B 4HS6B 3CFJA 4IU3A 4WI7A 1ZXKA 3RTQA 4PJAA 4A7GA 3V6OC 4AG4H 4BFBD 1EAPA 2BC4B 5D96B 4KTEH 3VXPA 4GG6B 4I0KA 1KBVA 3EF7A 1INQA 3EOYG 4HWZB 1OP5H 3BWSA 3CD4A 3KPRB 3MJ7B 4PUBL 1SHWA 4J2XA 1XGRA 2DPKA 2VR4A 3K2KA 3QIUA 1YZZA 3VXSA 1KG0A 1IQWL 5ADPL 1E4WL 3IETB 1KMGA 2P5WD 4GRLC 2GW5A 3IRPX 4OJFH 3SE8L 3QXDA 1HHJB 2ZE0A 4L8SC 1C5BH 2R2HA 3JTBA 2GSIA 4N2GA 3QIBB 3MRNA 1KJMA 1EDHA 4YXKL 5LNDA 2VLJB 4LGSB 1UKSA 4MJHA 3WAJA 5GGVY 2WQWA 3ZTJG 1S3KL 2DWYA 1JFQL 4DPCX 2ZXWB 3W11D 4ONFL 1PX8A 3QC5X 1A4JA 1R3KB 5AAPA 3ZKND 2VDPB 5FDWA 4QF1B 3U30B 3WEMA 3A0OA 3MKKA 5DMIL 4UDUB 3TFBA 2YMXL 3ZSTA 1GJUA 3K72A 4NHUB 5DRZA 3OWEA 4HJJL 4U6XB 1R24A 5DDHA 2X9ZA 4U1MA 2UVFA 1G9HA 1RULL 3AWFA 1JV2B 2IDSA 2Y7SA 1XCTB 2V7HA 5GHWH 3PFQA 5HGDA 4OJCA 3ZT5A 3HE6C 3UAJC 4M6NL 3W0WE 2DY2A 3UZQA 3IDIB 1Q0XL 1FL3B 2AKRA 5C70A 3B83A 3UJTL 3UBHA 1KCWA 2I07A 4N25A 5J11C 4JQIH 4BSWA 4AIZB 1NAMA 4W6WB 3SGDH 2A9CA 4AQZA 2R59A 4IU2A 4JN1H 3Q6FA 2HT4D 2QBWA 3LKPA 3QZMA 1G6RB 1KT2A 2Y36L 4O02A 1YN7B 2GPZA 3DURB 2ED7A 1TJIL 1PNCA 2N1TE 2QTVA 2VAJA 4P2OC 3CVHL 1PJWA 1UD6A 3ESMA 3RB7A 2V3FA 1OGAA 2V17L 3FZUC 3Q3GA 3SE4A 2O6CA 5JHDD 4EUPG 3ULVE 2G30A 3LOWA 1OO2A 1DQKA 3FN0L 2PO6C 5C08A 4DEUA 3D39B 2XYCA 4Q9QH 3ZE1B 3QCVL 1L0XA 5AOLA 1MFAL 5K9JL 4JM0A 2O5XH 5HGHA 4B50A 1D5IL 3LPGA 5TE4L 3ZUNC 4LARH 1JK9B 3SPCA 32C2B 4NNXB 4AG4L 5JUEH 1KENL 4PJCF 2V33A 4QYOB 1MCDA 4G70B 2X40A 3KNBA 2X6UA 3TWCH 1IO4C 2GJJA 4F2EA 3QNZA 4K3DH 4X6CF 3D8MA 4NZTL 2IOMA 2VB5A 1WBYA 4WO0A 5DVOA 3LEVL 4I8DA 5H94A 5HDLA 1CYGA 3ZKMD 3A47A 1JGLH 4NPYA 3K71A 1HHGB 4AE0A 1FYTA 1JGVH 3VFWA 1D5BB 2P5WB 3CDYA 3AGWA 3L5IA 5TK2A 4MCYB 4PS8A 3NRQA 2NW3A 5K59F 1QOKA 1NIEA 2NY0D 4XAWH 3OSKA 4XMLH 1TKWB 1SLWA 3LSOA 1TU2A 3ARQA 3MZGB 5E8PA 5LG1A 3WJMA 2F19H 4M7KH 3H8NA 4UQAA 4A6YL 3AVEA 5ID0A 5BZDA 2ALAA 1Y18B 5I1IL 2V7NB 3DV6B 4ANWA 4YSAA 3NACH 1KCUH 4BFGA 4X99B 5HYSG 1CCZA 2VXTH 4NJAL 4YE4H 3VXMA 1Q1JH 5JW3L 2V2XA 3HZMA 1RJYB 2XYBA 4Z7UE 2IIJA 2X7LA 1F4WH 2VDLL 2WBJD 2ORBL 1RZJC 4R97B 4Y9FA 1QRND 3AG2B 3ULUL 1ND0A 3QGVA 4XVUD 2WQVA 4OCXL 5HGBB 4XPFH 1TVHB 2EO9A 1SNRA 2GCYB 2W5PA 3E6FB 3UC0L 4QHUB 4X6BB 5BV7C 5B7EA 1HWGB 5FKAB 2FO8A 4WWNA 4QHNB 1F6LL 4IDLA 4JVUA 3SJVE 3M1OA 2AJSH 1SYVB 3B9KB 3RVWD 1A8ZA 2CA4A 3K8MA 1S9KC 3IMVA 4QRQB 1J1OL 4TUUA 3DV4A 4JCMA 1BIIA 4NENA 1CJYA 1CGTA 3ZK0A 2ZG3A 4ERSL 4L4VD 2ADGA 3GI8L 1NGQH 3TBYB 3U82B 2DMHA 2UX6A 1AZUA 4JKMA 4F8QA 4XXWC 4Z7IA 2VKXA 4OZFG 4OIBA 4PHZA 4WV1C 3HLAB 5IQ7L 3AS2A 5FM5M 3AGVA 3PREA 2XRAH 2PCFA 3FHAA 1FF5A 2XN9D 4KY2A 5IQLA 5IJCC 4YNYB 4IGBC 5AKVA 3BSZL 5GS3A 3NCMA 3FN9A 1ROCA 2XDHA 2H32A 3MRDA 4PRNB 2BCKA 5B22A 5C0NC 1KB5L 1A7QH 2YD6A 1WF5A 5EZLB 5EEVA 3OKNB 2FNBA 1XZ0B 1HNGA 2FX9H 3CZKA 1NCAH 2MEJB 4RMQA 2P8LB 1IKNA 2UY7B 3KJ6H 3KL5A 3VD4A 3CAFA 1A6TB 1ZK5A 3MOBH 3RWJB 3UTSE 1M7IA 1AIZA 1NL0L 5J1AA 1BQHA 5DMGC 1J0ZA 4YK4C 3I3BA 3LHPH 3POCA 9PCYA 3D85A 3GJEB 3SPIA 3CHRA 1JGIA 1SMAA 2CJTA 1V3LA 3PGFL 4YSDA 4DKAA 1JGVL 4RGND 4GP5B 5IHLB 1ZSHA 1C8QA 3AAZA 3ARUA 3ESPA 5D8JL 4PJ7E 1PVHA 1MFEL 1MXGA 2VXUL 3MHZA 15C8L 2VMEA 3BDYL 5I16A 5DUML 4PHXA 5HI3C 25C8H 1JRHL 3PABA 2NY0B 4XAKD 3UTTD 1S7RB 2EXYD 4KVNL 3WNJA 3OHXC 2QHRH 3X1FA 3EYQC 2D9CA 3W2DH 1S9YA 4DKEH 4ZW5A 4N9GB 3SDAC 4BH8B 2AXGB 2KZ1B 3QCTL 4IJ3C 5IBLC 3M1CA 2ZYSA 5LCVH 3WFCL 3PWPD 4BCYA 2IALA 4Y19E 4WTQA 3JTSA 4I77H 3L4TA 5TQ0L 1DJYA 1FNEA 2QDWA 5I15H 5KS9E 3ZO9A 5IEKB 3T4AA 5DQDH 3DO7A 1QG3A 5JLZA 5I0WA 1T66D 1UCBH 5DUBA 4JFUA 2YN5A 3GRWA 1AQHA 2WBJB 3D69B 1QRNB 2VC2H 2ITDA 5E6UB 2EJ1A 3H6AA 5FX3A 5LAXB 5CHNB 5GRYA 3DX1A 1NFDF 4EZKA 2VLLA 4ZG1A 3QUMH 3HUJE 3RFZB 2O5YH 2OW6A 4TTDD 4XPAL 4POYA 1KBGL 5L0QC 1MWAB 1KB3A 1NBQA 1KJ2L 3U0PA 3X12B 1UGKA 1L3WA 5HYJB 1NGQL 4Z7WB 4M61B 4LP5A 1D2PA 1FFOB 3IKCB 3L81A 4HC1H 2B5IC 3VVVA 4XCCH 3WFHB 3HR5B 2VDOL 3QORA 4L4VB 4QRPA 3X17A 4QPEA 4KK9C 3J7HA 2BNQA 5KSVA 1G4MA 1IC4L 3HFFA 3V6OE 43CAA 3UG3A 5TE6L 1NWPA 5E8OA 4U6VL 4HOMA 1U8HB 4FI7A 2XRAL 4NQDE 5IUSA 4XVSH 1BGXL 3RGVD 4IYKA 2DKUA 1XGTB 5LBSL 5CEZL 3QZPA 3IWVA 4RFNC 5CILH 2OL3H 2P7TA 2XN9B 1WS8A 3MLVH 5I76A 5L2KE 1PSKL 3Q8BA 4UV4L 4S2SA 2E27L 4WSJA 4D3CH 3UO1H 3MRRA 1MJ8H 3I9IA 4O9HH 4R0LB 4TULL 1KDJA 3X1BA 1EHLL 2VM3A 3G6AA 4N1CA 5GS0D 3BEVA 4OLXL 2ADFH 3QDJA 5ITBL 3VXUD 3C2SA 1MHPH 3BH8A 5J57B 3GDCA 4Z0XB 3LKRA 3IDJA 1S8DA 1LMKA 1OAUH 3DHUA 1YECH 2YAPA 5EZOH 1ZRUA 3GHEL 5CF3A 2NXZC 4AJ0A 4UOZA 1HE7A 3QI9D 4RGNB 2Q87A 4F80A 1BG1A 3PV6A 4HJUA 4E9QA 4HWEH 5F70A 2EIZA 4MJ6A 5DQJB 3WS3A 1HSAB 5BO1L 4C4UA 1MIEH 5E8NB 5FM8A 4OQTL 4XMPL 4HEME 4YHPB 4K5LA 4YDKH 1B0IA 1EMTL 2BO0A 2QKIA 4AGMA 3UTTB 3BVNB 1EZUA 1QSEE 3DO4A 4W9JC 5KTEH 2P49B 1AGBA 4PQXA 1QA9A 5H35A 4I77L 3OB8A 4Y4FC 4PJ8C 5FYLL 1UCTA 2X1PA 3HN8A 4G1MB 5BO0D 4ZO6A 4FNSA 2IPTL 2V3DA 5K33A 1ITCA 1OV8A 4AJYV 3RTQD 1QATA 5BVJB 3V9FA 1P4BH 2N0KA 5ITFA 3RY4A 4PP1D 1WFIA 4C83A 3DVGB 3GSNH 2D3JA 5CGMA 5I8CA 3QIUD 3VXSD 5ICUA 5BOJA 2HLFC 4GH7B 4AV0A 2O5YL 5F9OH 1W72B 2AVGA 1RL1A 2FH6A 4WENB 3V7AE 1TETL 2F8VA 4HFUL 1DBMH 5LLIC 2IWGA 5A16A 4PJEA 5T3XE 1BVOA 1I3GH 3S34H 2Y5TB 3C09B 2DWSA 1KUMA 4ZUSA 3S5ZA 3H0TA 3LKNA 1BQLL 4TNEA 4XCCL 3DHPA 2OTUB 5GGUB 1TFPA 4KOCA 4QTHB 1KLUB 2WANA 5DD3H 4GAYB 5KYXB 1ZMYA 1FFPA 2P5PA 3F85A 2BIMA 5DSCB 3TESA 3QWRA 4QTIL 2ZONA 4JZJB 3RWHB 3LKOA 2QQKH 3EYSL 2ED8A 4NO0A 5AYUL 4ZFGL 2YEZA 2OL3L 4HT1L 3D50A 4J4PC 3RGVB 4ENZA 3IE4A 1FZKB 4FXKA 1WO2A 1FUNA 2A6IB 4IK6A 3S97C 4DZ8B 3QPQC 1YYLH 3CX5J 3L4YA 2CRMA 1GL4B 3QUHA 4NNPH 5IV2B 4JRYE 1KCSH 1CK0L 4WFGE 5I0XA 3I9GL 1OF2B 4HG4K 4FLSA 4DCQA 3EYVA 3LZOA 3IXAA 1NC4A 1FG2A 2IQAA 3FULA 1FGNH 2YLKA 4Z7OB 3RKPA 1Z9PA 4JM2F 2VLJE 2CJUL 3B43A 4H8WC 4MZIA 4ENED 3WKQA 4IBWA 3BD4A 5D4JA 2WVVB 5L8LB 3VXUB 3E9TA 5KVGH 3DETC 3QUZC 5H37A 1C12B 1MCIA 5G5DA 3H53A 5CJOL 4HMEA 4GOSA 3E1F1 5I1CL 1LK2B 4MA8H 3TOPA 1HOCB 1T5WA 3MNZA 2ATKA 4WY7H 4X8JA 3F04A 2RCSL 3IF1B 5E2VL 3FT1A 4A63A 2KPNA 4G7QB 3FFCB 3DX8B 5DK0B 4Z76B 1EO8L 5FM4A 3QI9B 1IBGL 2KDYA 1OGAD 2LTQC 2VE6B 4EI6B 1MIMH 2YBRB 3LTVA 4MWFA 3QZOA 5CEYA 2CO1A 2QQLL 2L04A 5KBPA 1JI2A 2QPDB 4PLKD 2EDMA 2GHWB 3KYKL 3KL3A 4NAMA 1OB0A 1VKXB 1MHEB 3HI5L 2B14A 3QQDA 2BZ7A 4MLSA 3VI4E 4X4XA 3BZFA 4KRPD 4A2MA 3VGHA 1E5CA 1P4BL 4PRDB 3T4YB 3VM7A 2JLPA 4K23L 1T5KA 3RTQB 4PJAB 3VU2A 4DZBA 1C9SA 5EF3A 3VXPB 3I6SA 3ML9A 5I71B 4UNUA 1INQB 1HILA 3WN6A 5F9OL 4CN6A 3RX5A 3LNIA 4GBXB 1XGRB 4FN0A 2D9QB 3VXSB 2ICEA 2D0HA 3MNWB 1KG0B 5H2BA 4M7ZC 1FYTD 1CFVH 2WTRA 5C0IA 1ACYH 1GMEA 1XAKA 2NQDA 4XN8A 2CCWA 3MJ9A 5FO9B 4LXFA 2XX1A 3QXDB 4AEIH 5F1NB 5D2NA 1G84A 3EJZD 2FRGP 2B08A 2GSIB 3WAKA 4BE6A 5BRZE 3MRNB 2HFGL 1KJMB 1GHFH 4O2CA 3WLWC 3MRMB 5JPMA 2DBLL 5GISH 2PTVA 5TJWK 2P47B 3HFMH 1ZVYA 2O6EA 3OPZH 1DVYA 3OTTA 3VXMD 2UYLA 3JUYA 3QBTB 1JVOA 1MLCA 5GGVH 4HJGA 4PJBA 5FDWB 3APNA 3HMXL 3L13A 4FQPA 1YYCA 5MEPB 3ROOA 2FJHB 3ATFA 4WW2C 3VO0A 2D31B 1IEHA 5HHXH 3K72B 2VUKA 2EE6A 5DRZB 5IJDC 3ALWA 5DDHB 3UDWA 1R24B 3AG1B 4JRXA 4U1MB 5C0EB 4PS4H 3NDYE 4K9EH 2VQ1A 1I53A 4XO4A 3WL9A 2V7HB 4OZGA 5HGDB 3OAYH 4W9IC 1F58H 4B5EA 4ZMYA 3MU3A 4XPBH 2AKRB 3NESA 1J9QA 3V0FA 3I9PA 1WA0X 1BXXA 4LHJB 4BSWB 1GGBH 5E6SB 1NAMB 1K72A 4QNPE 1V5JA 2B3IA 4IU2B 7CGTA 3MBWA 3DPBA 3LN5A 3LKPB 3Q6FB 1JP5A 4Y4KB 1QWHA 2YXWA 3GK8H 2IFGA 3ZYJA 3KPLA 1PU0A 4OGAC 4D9RD 3KBPA 2VL4A 2CRZA 3V6BR 5K1VA 3TEWA 4PJCA 1TITA 1OGAB 1A6UH 4AQ1B 1N12A 1J0KA 4WCYL 5IUCA 1BX2A 3ZR5A 2HLAB 4BFIA 1C5CL 3I2CL 1JZ8A 4ZX6A 2JKNA 4N0CC 1OAQL 3LCYA 2E6JA 2OMZA 4OCNC 2FWLB 4NQXB 2ZXCA 2ZYIA 5HGHB 1LYQA 5GGRY 4PV8A 3ISWA 4YDIH 2X1OA 4KRPB 1DQVA 1M57B 3N40P 3VFSA 5I66A 3KNBB 1GIGL 3OKMA 2HSIA 3D85D 1PKQA 3QNZB 4HLZH 4DGYL 5BUAA 2IXQA 5JHDE 1WBYB 4K4KA 4TPRH 5JXAH 3JV0A 5H94B 1Y1UA 3QG6A 4J2QA 5INCA 4ZQKA 4IMLA 1P2CA 3BQUA 4OLWL 4V2CB 3K71B 3CFEA 5BOPA 3VI3F 1DVFC 3V8CA 3QHZL 1KPUA 3N1PC 4WHCA 1WHPA 3ZMRA 5I2IA 2OV0A 4Q6IC 2NW3B 3K2UL 3MLTB 3WG7B 5I19H 4EIBA 4Y9GA 3VXNA 1CI3M 1CXIA 3O2WH 3LSOB 1KPVA 5E8PB 3K6NA 3OWRA 3WJMB 2BRQA 2XVLA 1AYRA 2Y72A 3SOBL 1FIGH 3U7YL 3DROB 4QT5A 3UAEA 5ID0B 1F00I 5BZDB 1K4DA 4P5TA 2C5DC 2CHWA 1ZLVK 2SODB 4UTBL 2HPTA 4DPRA 3HHSA 2WUBH 2EDTA 4ZTOL 1BZEA 4XXCC 4XVJL 2MCAA 3WO4B 1SHXA 1OCOB 1CG9A 3VXMB 1QFUH 4LVNC 3HZMB 1N5YH 1XO8A 2EDOA 3NJFA 4MD5A 1A14L 4GMTL 1ND0B 1U0QA 3ZHLA 1VENA 5CD5C 3HG1A 3QULB 4YXLH 3NFNB 2EO7A 4D9LL 2OPCA 2NMSA 4NRXA 4ZUUA 4WEMB 1DBBH 3O2VH 2Y1AA 3INOA 1ZANL 2Q7AA 1GGBL 3ARZA 4OZHA 3SGJA 4KZDH 3D3VA 4HXBH 5JIIA 3DV4B 1R5IA 5AUMA 4NENB 2ZX8A 1KZYA 4HKBA 4HUXB 1NINA 4QRPD 2ADGB 2BNQD 1NPJA 3Q5YA 1YLBB 2H2PC 2ZXBA 3NIGB 4DERA 2JTDA 2IGFH 1HYSC 5F7EH 3ZTJH 3BQVA 2WB1A 2Y4SA 3RZWA 3T1WA 1Z1WA 3AMKA 1BHGA 3I74A 1BM7A 1X5MA 2HUHA 2F5AL 3IYLW 2PCFB 5D70L 3VYOA 4GAFB 2EXWD 5HJBA 5B3JF 5I6OA 4IW4C 1QTYT 2AJZA 1N5AA 4ZRGA 2H32B 3MRDB 2BCKB 4BZ2H 2YBGA 4KROD 4IKKA 3SDDB 1A2YA 2J12B 3UJJL 1HWHB 2BMKA 2OMTB 3MRKA 1BVKA 3QDJD 4W4NA 5E8DH 1Y7VA 4QY8A 4KGJA 2PF6A 3EFFA 2X4QA 3FO9A 4OCYL 2CHZA 1M7IB 3ZZSA 3IT8D 3UYRL 1BQHB 2AF2A 5SX4I 3QUXC 3D85B 2ZX7A 1V7NL 5ESVB 3EJYD 4ZZFA 4Z95L 3C8DA 1EHNA 1PGRB 2JI2A 5CAYB 1V05A 2XFXB 2BSTA 4DW2L 4PGJA 1NDTA 4K07A 3AAZB 3BCFA 2AEPH 2DYRB 4DP7X 1FJ1A 4G8EA 4NKDA 5I16B 1UVQA 2DAVA 4IIQC 2MCG1 1NCCL 2RJMA 5PAZA 2COVD 3G6JF 3PABB 3INUL 5DWUH 4HIIA 1IBHA 1JNNL 3NJHA 3QJFA 2FBJL 1G6VK 3O4LA 2J1XA 1BYNA 3HBGA 4P2CG 4Z6AT 5E4OA 4YH6A 5CP3H 3BAJA 2HKFH 3QG7H 1KGYE 3IU4L 1FE8H 3JTSB 5IB4A 3RVUD 1FNEB 4ZOAA 4A2EA 3QJHA 3OJDA 2HMID 4IBLT 3T4AB 1DVZA 4K8RC 3DO7B 4OUUA 3VMNA 1A1MA 2O61A 4PVLA 5DUBB 3T09A 1OHZA 3H3KA 1D5XA 3DGGA 4FF9A 2ITDB 4KKNA 5DGRA 4XAKE 1BOGB 5I1KL 1HHHA 2V5RA 3OF6A 2VLLB 5A2FA 5DHMC 1T1WA 2LE9A 4RA0C 2FO4A 1WZAA 1JYWA 2JK5A 3PWPE 4G7YL 2XV2A 1QLRA 4U1KA 4N26A 1NMCB 2JJWA 3JV6A 2BY3A 2IBGA 3GS4A 1R47A 3T0BA 1NPUA 1AI1L 1MCOH 4FG0A 1XR9A 4QRPB 4AZUA 1BVLA 1IC5L 1P9MA 1RUQH 3NFSH 3QWRD 4ZTPL 4KQ4L 43CAB 2HX7A 2GBVA 1I31A 4XP9H 4OJAA 4NO0D 5C3IA 4NCC1 5HDRA 2VLRE 1XGQA 1YPZE 1ILSA 2Q7YA 4XN9A 2JJSA 5HYQB 3BP6B 3ECWA 3LH2L 4PJDE 4N90E 2JKIS 4BWUA 1IV8A 5I76B 4LHUG 3RKDC 4IHBA 3CZFA 3M17A 4OF8A 3TH4T 5IR1A 5C0FB 3B56A 4KI5D 4S2SB 4AIOA 3DK2A 4KRNA 3MRRB 2VABA 4KROB 3QFJA 1DJSA 1NC4D 1PY9A 3CHOA 5FK9A 2QPFA 3FO0H 3NJXA 3G6AB 3WJJC 2R56H 5AVZB 1I1FB 1W16A 3GB7A 3QDJB 3BLPX 4LSQL 3CJJA 3PUUA 1WUNT 5DUPL 1JPGB 4B9ZA 2Z92B 5CGTA 4IBSA 1YSOA 3IDJB 2W0FB 4FKKA 3PLYA 1S8DB 4Y4HC 2GAZB 1GGCH 1A7RL 2AQ3A 2RAMA 5D5MF 3QJVB 4LPWA 3WNKA 1PX4A 1KTLA 1P5UA 2V5TA 4G6AC 5IFHL 1J9SA 4XE0A 2WZ6A 4P5KA 1JXKA 3MTXA 4OZFH 3PV6B 2XHNA 4YBLB 1ZDQA 2YOCA 3P9LA 2EIZB 3WS3B 4GUOA 3U79A 2C7UA 2VJ8A 4XHQA 3P3UA 4KTDH 5JHLA 1FFTB 1WBXA 3LPPA 3V4PH 2C1OA 1KC5L 5I0ZA 4B9PA 2XKNB 4RMVA 2XWJA 1AGBB 1YNKH 1S3RA 4NO5A 4LLYA 2IAMA 2YD2A 3DVNB 3WTSA 1ADWA 1EK3A 3NP4A 4YSSA 2FEDD 2DN7A 4DEPC 1CQKA 5AOZA 2YKLH 4PM1A 4P2QB 2WLHA 1OSEA 2J88H 3C8HA 3C5ZC 5DVNA 5BVPL 2OR7A 3QQ3A 2JMRA 5D2LF 4C83B 4C56E 2H3NA 3WKPA 5KBKA 1CD9B 2EXTA 1EANA 3TV3L 3HC3H 1IGFH 1MHHA 1NCDH 3FQ2A 4N8CL 4PWHA 4Y5VB 1Q38A 1A0QH 4HIEA 4CNIA 2D4FA 2H6PB 4HU8A 4CC4A 2DLFL 4WTXA 1NA8A 3NAAH 2VR5A 4PRPE 4PJEB 2ZQKA 5DJ6A 1B2WH 2AQPA 1J1XL 4U6TA 2DW5A 3LKNB 1TJHL 4KU1A 2E46A 2R69H 3DX7A 1LE5A 4LLUA 1QSFB 4MQXD 1SEQH 2ICWA 5IM7A 4PGBA 3T2QA 1A4KA 1FFPB 3L5XL 3OG6B 5IW6A 2DOCA 2BFVH 1D9KA