2BSEA

Structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
b'SIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR BINDING PROTEIN
publication title Lactococcal Bacteriophage P2 Receptor Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Lactococcus virus p2
molecule tags Receptor
total genus 20
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bseA00
3DA0A 3EJCA 2WZPA 3HG0A 4IOSA 2X53A 3D8MA 4HEMA 3U6XA 2F0CA 1ZRUA 2BSEA 2BSDA 4HEPA
chains in the Genus database with same CATH superfamily
1CK0H 1XTLA 4OLWL 2ITDA 4KHTL 1CLOL 3B1TA 2VE6A 4IMKA 3KLHC 1PZDA 1BX2B 2VW4A 4LPXA 4XPAL 1L9NA 3FSVA 1MFAH 3U30C 5I6MA 4G9FD 4KXBA 2CUMA 3HMWL 4LHQB 3SO3B 4LLYA 1OCZB 1A4JB 1EFXD 2CAKA 5AW3B 4PGCB 4TOYH 4GRLA 1M7DB 1RUAH 3BUTA 2GBAA 1KYAA 4Q9RH 4HMDA 2Q3AA 2HVBA 4NO0D 2FD6H 2GJ6A 4NERA 1KNOA 1TZGH 3WNKA 1YY9D 4GP8B 3Q8FA 1VERA 3D06A 1JPFA 4LGSB 5AW5B 1O6SA 3OAUH 3X12B 5GS0D 1E9OB 1W8NA 5AYUH 2N1KA 3RWFB 5FA3B 4PJAE 5JIMA 2ATPA 4NO5A 1YNTF 2FWSA 5CF3A 2A6DA 2FUQA 4NAMA 2AXHA 3FPYA 5EN2A 4A7UA 4W9JC 1OT1A 4OF6A 3RGVD 1E43A 5T1LA 4M7JH 1AC0A 3R8BB 3KW8A 1SLUA 4WU5B 4NQXB 5ABZA 1F45A 4YSUA 1OSZA 3DUHA 4RMRA 1KIPA 4ZQKA 4MJ2A 3VXRA 5IV2B 2QBWA 2VDML 1SXNA 2F53D 3UYOD 2MWCA 5ITBH 4YXKL 3RDTA 2JFCA 3FZUD 4XCEB 4AYFB 4IBSA 3TBWA 4U31A 4X5PA 2WLIA 5AD0A 2H1PH 1EO8H 2X88A 4NB7A 4Y5VB 4DO4A 3KDMB 4KI5C 3QORB 1YA5A 1B2WH 3P2DA 3CDGA 4MQ7A 4AEFA 4JAMB 1CYWA 2VJXA 1SYSB 1YN7B 3FO0H 3HAEB 3K91A 3FRPA 2I25N 3PGDB 5FV1L 2IC2A 1GYUA 3BWZA 4A2LA 2AF2A 1TSHA 4FFYL 4S11A 3U7AA 4DP6X 1NFDE 2PTVA 4OIAA 4O51A 2CR6A 4KDWA 4JQVA 5CCKL 3AMLA 4L5FE 3HUJB 2D3VA 3V4UL 5ISZD 2NR6D 1E7UA 2R56H 3TA3B 2WUCH 3CH1B 3LKNA 4PJ8C 5DCCA 1FYTB 4WCYH 2R2HA 5JZ7C 1IGIL 3IRZA 1R34A 2FBOJ 5KSBB 5KZCD 2CO2A 2QQNH 2GBVA 4YSRA 2NY6D 1E6OL 4OR1A 2Y24A 4OCSL 2WIIB 3WO4C 4YBLC 1G1OA 1W2KT 4J8RB 4P05A 5CSZA 2FECI 3U4EB 5DMGD 2VDPL 4ANKA 4KDTA 2ZOLA 4MMYA 3TH4T 3M8OH 1LMIA 3VTMA 3GTNA 3L5JA 3QPQD 3GWJA 4JO4H 5IZ7A 5GRYA 3WFHA 4Q56A 2CA3A 5EHFA 2CLRB 4PJBA 1NGPH 4HCGA 5C3TA 3IKCA 3UTSB 1H8SA 4WIQA 3DO3A 2NY3D 4B41A 3QDMA 3EJYC 2ICEB 3BIKB 1X7TA 2DEWX 5DZNA 4FXGB 4HJ0D 3R0MA 3QNZA 3TC9A 1NFAA 2Z1PA 3OKDA 4LHUA 2QZQA 3V7MA 5LVEA 2OZ4L 1WTLA 2G9KA 15C8H 4FTVE 3H55A 1RP8A 1NGZB 3CN3A 3IU4H 5DR5L 5SX5H 4ZO6A 1O5PA 1AZUA 3WELA 3BFQG 1FGNH 5MEOB 2BY1A 2PNDA 1VSCA 3THMH 3BLPX 3GI8L 2C3WA 3KYKL 4LCIL 3LXCA 1FJ1B 1UACH 1RZKH 3V6ZB 5A3ID 5FB8A 2OK0L 3B7YA 1IM9D 3NFNB 1PTZA 2VJ8A 1SZNA 3AITA 3FL7A 2GSGA 5CP3A 1MI5B 3G7TA 3LMJH 3P9WB 4KKQA 4MQXC 2ZSWA 2NYZA 2GFBA 3B34A 5LGJB 1T66C 2WQWA 4KZCA 4XP4H 1NCGA 2DBLL 4E5XG 1RU9H 4X7TB 2IDCA 4U1NB 5AUMA 2OL3H 5T3XD 1X7QA 2CQVA 2EIZB 2DQHL 4JFSA 4MAYC 1J0HA 3CUPB 4PMFA 4XPTH 4XVOA 4O02H 4M5ZL 4IGBC 2W9EL 2ZUUA 1G6RL 2DQIH 2J21A 3VD5A 4ADGA 3VFVA 2DMCA 2NZIA 1ASQA 1CGTA 1XIWB 2R9HC 2N1TE 5HHMB 1E9PB 2F15A 4IJTA 3MLTB 1NICA 3ENEA 3K46A 1DQQB 5HGGS 1JS4A 1QBML 1T5WB 1V3JA 5AWNL 3GIZL 3IRPX 4HGWB 4JFWA 4FFWC 4PJ7F 4WHDA 4ERSL 3HN3A 2BM3A 5CWSA 3U0WL 2NX5A 2F74A 2DMHA 4R83A 5JIHA 2BSRB 5FYLD 1BQLL 4QRPB 4R96A 3V5DB 1CDGA 3SPHA 3VFUA 5EZOH 3JWDH 4G7VL 1YNKH 5IKCA 4QCIB 3FTYA 1ZSDB 1Q0XL 5DHVA 1O6VA 2ZG1A 4NGHL 4G6FB 2ZKHH 5PCYA 2OYPA 4CSTA 3LJ3A 4XPBL 5DTFB 4ZNEA 5FAAA 3PWNB 2XTJE 4WO4D 5F88B 1PDKA 4X5XA 3CVHA 1MCSA 1NC2A 1CGSL 5D71H 1D5IH 4WQOA 4NQUA 3PNRB 3NCJH 1PG7H 1XHHA 1LK2A 1FNHA 2EE2A 4QRRE 3VXME 3S35X 4TSCL 2VLKB 3DX7B 1TTUA 1DCLA 4FFZH 3TIDA 2JJVA 1G7JB 4WEEA 4TTDD 4MNQA 3QDHA 1N9PA 3SGJC 3MRPB 3MJ9L 1A1NA 1NCDH 4J8QA 2VZSA 2NY7L 2DKSA 1U95B 3NESA 3IDIB 4V33A 2MQ0A 2HFFA 3QXWA 2LFGA 1MNUL 2B4CH 4OLYL 1INDL 1RHHA 3V0WL 3ZHLA 1LQBC 4PVNA 3W5MA 4K9EH 1ET8A 1I9IH 3S5YA 2P5EE 1S9WB 7PCYA 4MXVE 2WWMD 1LTXA 4V1DE 2BH0A 4RBPH 2BCKA 3MRMA 3IYLW 4K9JA 5F7LB 4DW2L 2P28B 4ZUUB 3RNKB 4FCAA 4WW2C 1YPZE 4JFFE 5TE4L 4O2EB 5EN3A 5EBLA 1KCVL 2C3VB 3DGCR 3GZKA 5SX4H 4WTZG 2MHAA 2QJDA 3D05A 5KUMA 2PF6A 2QTEA 2J6WA 2QLYA 4WFFD 1BOGB 3K6SA 4JZOB 5K1JA 4HEME 4XBPB 2HXAA 4PJIB 2Y5EA 5IB3A 5C0BD 1RUML 1T1YA 2VR9A 3UP6A 1UCTA 2VSKB 4OGYL 1VACB 1JP5A 4MMXB 4XBEH 1AS7A 1LMKA 4NRXB 3U46B 1MREH 2FWLB 4DVRH 5AKTA 4EQ3A 3FU7A 1GKOA 3BW9B 3ZY7A 4D9RE 1HYSD 3ARDD 2AKRA 5CN3A 3B5HA 1PZCA 3BD4A 3PV7A 43CAA 2V2TA 3AU1A 2Y36L 1JHLH 4LCCB 1Z5YD 2OULB 4YXHL 3RWJA 2HKFL 2MNWA 3Q5OA 1TYEB 4WAFA 4DPBX 2HRHA 4KRMB 2BSSA 2P80D 3LKQB 4PV9B 1TO4A 2APFA 3VFWB 3MV8B 3BT0A 1VADB 3IJHB 5D1ZD 1KPUA 4E36A 4H1LA 4JFXA 2VLME 5IFHH 1SJXA 4UQ3A 3MNDA 3BWAA 3O8XC 3CDZA 3U1QA 3DX4A 1I1AC 5IBLC 3RVWD 1NIAA 2MSPA 2CJUH 3UTTE 5A1AA 1DQVA 5D5MA 1YEEH 1M2VA 1TJIL 4I18A 3X2QB 4RISH 3EOAA 4LE8A 3GSXA 4KC3B 5LBGA 1OHQA 1UD5A 1U3HD 2GB2A 4L0YA 2SEBA 1MAKA 1XF5A 2BMKA 2OV0A 4YPJA 2YC1B 2EO1A 2JELL 1YEFH 1S7TB 2LU7A 5GIRB 1E5BA 3C60A 4ONFL 1F4XH 2X05A 5J12B 2ADIB 5J9PA 2XV6B 3C5JB 3Q8AA 5E4IA 4ZPTA 4G11A 4KK5C 3CHOA 3FFCA 3D9AL 4C59B 2E74C 4G6JH 3AU0A 3AB0B 4JRXE 3OKMB 1NCCL 2WQRA 4P59L 3QYCA 5CUSH 5ALBH 4O9HL 2DQCH 4Q6IC 3RYMA 5IGXL 4GUQA 2IXQB 4UF7C 2YWYA 3ILEA 2WO4A 3W9DA 3TYFA 4R4ND 4JZJC 3CSYB 1KGJA 5CCGE 4AV5A 1KGYE 3WO3B 5FO8B 1XMEB 3H6AA 5D2LB 5ID0A 4MSWA 5T1KA 43C9A 1B4JL 2VISA 4FP8H 1GZPA 4G6MH 3E6FB 5IVXF 1UWYA 2C9VA 1OF0A 4Q4EA 1DQDL 4HUCA 3H2WA 5I26A 3ULAB 3DROB 2VLLA 2NNRA 1PZ5B 1FNGB 3P4LA 1F56A 5JHDE 4QO1A 5LN8A 4PIRF 1I9JH 2MKWA 3N1PC 4MD5A 1KN4L 5C0AE 1KZYA 3A6BH 3QYNA 4UYQA 3S5LA 1ETB1 4NN5B 5EMYA 3L3IB 4FAAB 1HE8A 1WGOA 2ITFA 2B1AL 1OGAB 2OP4L 4HFWA 4QXUH 2D9QB 4ZD3H 4F9LC 5CEZL 5IUCA 4Z8FH 4XAWH 4IBUA 3SYPA 4F7PA 1S8DB 2K7PA 3Q8BA 4EJ1C 3L9YA 1DLHA 4HW6A 2AMUA 3T3MB 1UWFA 2X9WA 5GISL 2OTUA 2BY2A 4M5TA 4M6AA 4KRNA 3QFGA 4KROC 2VXUL 4XOEA 1KXQE 3KBPA 3P0YH 4APQB 4UTAL 1R0AL 4KXZH 2HN7B 5IEKB 2WBKA 4JN1L 1KJVA 2E4FA 5AKSA 3EO9H 1JXJA 4XP9L 5D9SA 3BZ4B 2F1AA 3VI4B 5EZIH 5EZJB 2I9LA 2P48B 3ARFB 3L1GA 4OIBA 3VXQA 5L0QB 1K5WA 2CSPA 3V6FA 5FXCH 3H0TB 2DM2A 2FYYB 3PLYA 4QTFA 4DP2X 5T3ZH 5IOKA 3QIBD 1BREA 1W16A 3F05A 1MAJA 2ZXGA 3AADB 4JX0A 3NZUA 5KBLA 1QYGL 4MD0A 5B38A 5C3LD 1AS6A 3F7VB 5J3HD 1MCBA 1MJUH 3KS0H 3L3KB 2RIKA 3ZN6A 3FS9A 3HRZC 3HLAB 1KELL 3OZKA 4BFGA 3KYMA 4WI2A 3UABA 5KSUB 1NC4D 5ECGA 1R3KA 5FKAA 1AMXA 3T1FB 1HI6A 4UOJA 2YAFA 4RFEB 5DT1H 4LSRL 5IQ7H 4PP1D 1JGLH 3G6JF 4X9YA 1ONQA 1WBXA 3JUYA 3OQ3B 3I02B 1EEZB 1FNFA 4HISA 2YPLE 5F7KC 1HHKA 1QWHA 1IGJB 2H3NA 2ZWYA 2CJSA 3WE6A 3VWJB 4OFQA 3RTQB 5A2CA 1I31A 3FT2B 2EDJA 3PG2A 1N8ZB 4OSUH 4JQIH 2V3DA 4K94C 1YQVH 1HDMA 1XQ4A 2ADGB 3CD4A 4QDGA 4PSRA 1MQ8A 2J8HA 4LVOB 5EOCJ 2WZ5A 3EOYG 4M7ZB 1RIUH 5AVWB 2VR3A 1DBMH 5EBGA 3WY3A 3FB5B 5C86A 4UB0L 5DVMA 5DZOA 4PJXF 4C56E 4HPYH 1AI1L 5A6MA 3HZYB 4EI5D 4PY8J 2IMMA 2Y5TA 1LLAA 3SCMC 5TD4A 5DRZA 2UVEA 1HEHC 4XN5A 5ITFB 4AQZA 4BZYA 2Y22A 4JL1A 2HWZH 3VCLA 4WHTB 1AJ7L 2CKBB 1Z66A 2FT7A 3S98A 4MVBD 2VSDA 2H32B 3NABL 3A23A 3W39B 2WLZA 1FBIH 3SE4C 4JPVL 1YEIL 1TJHH 3LHPL 1EUUA 3PHSA 1CDUA 4K94L 4XMZA 4JN2A 3PL6A 1IO4C 3RVTD 2WWNA 4P4RA 4N9GA 3MTRA 1QHPA 3O11B 5H37G 4IBVA 4FHJA 1DJHA 1QBLH 1YAZA 3PFQA 2JLLA 3S3PA 1KXVA 2HKHH 2F54D 4FXTA 4N26A 3RWDA 1D5MB 2WAQA 5E94B 3RAJL 3RWCA 4F7CB 5CKAA 2P52A 3T65A 1IFRA 2Q76B 2CK2A 2X40A 2HH0L 4JY4B 3RBGA 2JKRM 4J2XA 2H7WA 1UWGL 2H8PA 2XIBA 2AXGB 4OQTA 3SDYL 2ZXEB 4JO3H 1ZD6A 4G1EB 4DESA 3MUUA 3D39E 1GJWA 4K7PX 4X4XB 4PRIA 2WXLA 2WYIA 1GZQB 3CBKB 4UDTA 2PYFA 4JFUA 3AW5A 4X5RA 4UQIM 1N0XL 3VQLA 5CLWA 4WNQB 2EDTA 1ZVHA 1MCEA 3VH8G 5BV7B 2PCYA 5BUAA 1ZHLB 1JNJA 4OD2A 3ZTNH 1U8JA 1Y7VA 3NJVA 5K9JL 4BBWA 2ORBL 5C7ZA 3ETTA 2VRAA 4DP5X 3A4EA 3UMNA 3QQ3B 4GT7A 1HILB 5CJ8A 4LEXH 2IG2H 1T4KB 2ZX6A 4D7PA 4O2FB 4K4KA 3WKYA 3E6HB 3R0NA 2YQGA 3MRQB 3CFDB 5EOQH 5KJRL 4PR5B 4YK4B 5KYUB 5D96B 4QHNA 5JOPE 5BVJA 4HEPA 4P06A 3ZKQD 2AJXL 1BAWA 4NNYB 1ZANL 5FM8A 1J1PH 4I3SL 3CVHL 3LSOB 4PJFB 4GKOA 4KH2A 2DWSA 3TXAA 1H3TA 3CWGA 2D3JA 3ROLA 3WIHA 2JB5H 4HWNA 4ONHA 1EHLH 4P2OC 4YDKL 2PYEA 3FT0A 3G04B 5AVUB 2BNRB 4L4TD 4NZDA 1T22A 3NPZB 2Q7AA 1IAOB 1D9KD 1RXLA 2J8UA 3A6CL 4B53A 2AXJA 2BS9A 3K72B 5AYQA 3QEQD 4HCFA 3RUGE 3KJ6H 4HDIA 4C47A 4BH7A 5J06A 2NLJA 4Z7WF 3QWOB 2GCYB 4Z0XA 3O2VL 3MKGA 1V3LA 2E7MA 3QSKB 5CGBA 4BQ6A 2MIZA 4X6DB 4DGIL 4TVPL 3ZT5A 3G5XA 1JK9B 3VFNB 1FSKC 3PHAA 4IHBA 3RVUC 4CC4C 1JTOA 5JMRA 1M57B 2DJSA 4OV5A 1DYZA 5E08H 5SV4A 2NY1C 2ZG3A 3CFBA 2K4WA 1F8TH 3F7LA 4LLQA 1COBA 1CL7H 3EHBD 4HKZB 5EU6D 3QYMA 2VXTH 3K8MA 1I7RA 2Z9TA 1AZVA 4U1SB 5F7EL 1T2QL 5CZXD 4DCQB 3GDBA 4BINA 4O4YH 5D6CA 4X7SL 3ILPB 3MDJA 4LLDB 5IJKA 3ARYA 1H3PL 3CX5J 3EOBB 3V10A 3X1EA 3CGTA 4D9LL 5E00B 1MFUA 4UUJA 3KXFB 2DQTH 4OZGE 5DUPH 5CJXA 4CADA 3R4RA 4FYTA 4ZUVB 5JA9A 2D7NA 2ZOOA 4RA0C 4N68A 3WS6A 3TN0B 4PN6A 3V4PH 1AZZC 4KOCA 2ITCB 1GGYA 3TBTA 1MFDH 3FQ1A 3FK3A 1A3RH 5IB5A 1UT1A 2A6KA 1B3IA 2H0EA 1TZIA 4YHIA 5E70A 3SIKA 3VX0A 4ABQA 4G9DB 3OHXB 3AABA 3D07A 3OG4B 4XNXL 1QLEB 2WGXA 1NIFA 5HGHA 3PJSB 3JV0A 1T7XA 3FCSA 5EOCL 1TQBC 4EBQH 3N43B 1J12A 1I9RH 1D5XB 1KENH 4PLNC 2XPGA 4KU1A 2OSLA 3GXUB 3LNHA 4NC1E 4ZAKB 3WBDA 3V0HA 5KBMA 3C6LB 3UJJL 3US9A 2RFXA 4F57H 3FYEB 3INUL 3RFZA 2PUQT 5JPMC 4HS3B 3OX8B 5ETUB 2CZNA 3V4VH 1CFSA 2B9AA 5ANME 4F33A 3BAJA 5I66A 4XI5D 2YPVL 4EVNB 4L8DA 2F7RA 4FZEH 1XH0A 1U41A 1M9SA 3IFLH 1BQHA 2IADB 5F3FA 1HC1A 2ZTBA 1EHXA 1N5YH 1U8IA 4FQXC 2YQBA 1AY1L 2CIIA 4MYWB 2BP0A 2X6UA 3KR3H 1OGTA 2KDYA 1T3FA 2ZNXA 3QZOA 4NC0B 3DMMB 2NW2B 4P46B 4P2QA 5HYSB 3MACH 2B16A 4HKJA 4MNHB 4MXWL 1E40A 2CGZA 5BS0B 4L3EA 5DRNB 5JHAA 3QAZC 3EJUA 3NZHL 4MS8D 5C08A 3MO1A 5J5EA 2LHAA 1JZ2A 4B0MM 1D7DA 3FT1A 4YDVA 1BEYH 5D1XD 4XMWA 2XZAL 5IMMB 1G7HB 2B0SL 3UFIA 1ID5I 4MAUL 2E75C 3ALWA 1PG7W 4ELME 2J5WA 1ZDSA 4ZQKB 3VXRB 1KIPB 1KB5H 1A7OL 1Y18B 2JJTA 5BO1L 2WTRA 3AS1A 3QORD 3D4CA 2Q9OA 3RDTB 1JDCA 4ZO7A 3NBNA 5C92A 3EDJA 4X4KA 1D6EA 2X4PA 3KLAA 3P0VL 5I5JA 1A7NH 4X8JA 5IVOA 1R46A 3GMQA 2BP5M 3EJQA 1H6TA 4HWEL 3L3OA 5IMKA 1I1FA 3C08H 5ANHA 5KBPA 1JCKA 2XKSA 2J12B 1VGEL 3TP4A 2WLHA 2FDBP 2BVQA 3TA3D 3FYIB 1GAFL 4F93B 3QEHB 5DMKB 4OLUL 4O51B 4PJ9C 1FYTD 2Y3NA 2DLIA 4O5LL 4AJWA 1PYWB 1RK0B 4NM8L 4CKQA 1JXFA 5I0XA 1Q38A 1N10A 1RUPH 5C0DB 4AENB 4M4RA 4NUMA 5AAMC 1CYGA 2FJSA 3B9KB 4PJDB 4LEEA 3ZL4H 3IMWA 5DJCA 3EYFA 4BJLA 2VSMB 2FNBA 4MA1B 1WAAF 5JW4R 2BNUB 2M1KA 1YUHB 4A7GF 2FJFB 2Y6SD 3QUGA 1PBYA 4GG6F 4NPJA 3CU7A 4PJEF 3CG8A 3TEUA 3Q8EA 2F7OA 1P69B 1JHKH 3CFIC 3ARSA 5CSZB 4U49A 5C0RH 1TNMA 4PMEA 3B7TA 1FPTH 3QDJA 4AXWA 1MWAA 2ZOLB 2WPGA 3FCUB 4IDJH 4MMYB 4NI6A 3UTSD 3L5WA 2Z34A 1M1SA 2FX9H 2AZAA 3D34A 5I71B 5E6RB 3C12A 1ZWIB 4KK6D 4E41B 4K71C 4L3CA 1U8HA 2DTSA 1AMYA 2W91A 1UZGA 2YAQA 3GSNA 2NDGA 1GVIA 1WBYB 2V5SA 4GBXA 4N4YB 3IWVA 5C0IA 3MOAH 2E7LA 4K3JL 4DOHE 3CFJB 1HXKA 1T1XA 4U1LA 2OMYA 2XVLA 3PWPB 4LHUB 5F7NC 2CBPA 3TVMB 1OTTD 4KGJA 3M7FB 4Y7OC 2AJZA 3DARA 3EH3B 1GMIA 1DLFL 4NKMA 4OVVA 3V6OE 1NM4A 4UNVA 1UGNA 2X12A 2P47B 4Y5XB 1KEMH 3FU8A 1RIVH 2OMZA 1QHQA 5EU4B 2HCZX 4G5ZL 4CGUB 3GHBH 3L3HB 3W56A 1MI5D 1UOVA 2HSIA 2IANA 2VLJA 3EF7A 3F12A 1SBBA 3H9YA 4XNUL 4K23H 1U58A 3C9NB 1ASOA 1TPXC 3DYMA 2AJ3A 2GSGB 3WE1A 4QHUB 4MAZA 4PLJC 5IB1B 2CDFA 5KW9H 2ZSWB 1GS6X 3BWSA 3EOTH 4LFHG 3WTXA 5ESVA 5DRXB 2DKUA 4WI4A 2P45B 3ZDXB 2LVEA 1FZJB 32C2B 1BQUA 1I3RA 4XVJH 2G60L 4Y19B 5AUMB 1X7QB 3GKWL 3QQ9D 4BKTC 1XIWD 5HHMD 1CC3A 2PMZA 4HD9A 1CXKA 5B7FA 4NIKB 1VZGA 1XCQA 2YOAA 3BHBB 3MSPA 3VFVB 5LJYH 1GHFH 2X1XR 3DTXA 4ANUA 4DUXA 4X9HA 3BVNA 1DUZA 4NRYA 4LLVA 4J3TA 4KJYA 4QJ5B 3VMOA 1R3JA 3EO1A 3IN2A 3QG7L 2ARWA 5GJSH 4OQTL 3KPRB 4QMEA 3VTAA 2NX5B 4MJIB 4Q8BA 5HGAA 3ULUH 2J1ZA 2EE9A 2WXIA 4K8RD 5FFLA 5JXEA 4N22A 1S9VA 2IBGA 4G6FD 2OYKA 1NCNA 4R96B 1TTBA 4MD4B 3UPAA 1VDGA 2Q7YA 5EBWA 2Z8WC 2CHZA 4NKQB 4XBGA 5DHVB 5A6IA 3C2AL 4GIPD 4HGKC 2Z93B 1O7VA 3L4TA 1UXSA 3MPCA 4J3OC 5M95B 3QHZH 5DEGA 4P49A 4HLZH 1MCDA 2XTSA 5CIPA 1J5OH 1E0OB 1WC7A 2WKOA 3VG9B 5IFAH 1I82A 2VLKD 1WD8A 1DL7L 2KBGA 3NJIA 3P30H 5FX3A 3WCYA 1X7SA 5F2FA 4X99B 2GTZB 1CBJA 4A1RA 3FB6A 1V3KA 2F5BL 5DVPA 4NI3A 3TIDB 1P5UC 1RJZA 4EPSA 4ZO8A 1UQSA 3EH2A 3GRBA 4PRNB 5HY9A 3ZUNC 3S36X 3BIAX 4PJ7E 2JJSA 4QXTB 1MJJB 4R0LA 1NPUA 1XR9A 3C6EA 4HMCA 5CGTA 3WIHL 3TBCA 4XPHL 5J0BA 3WJMA 4FQLH 3I6LD 4IHOB 1M7UA 4M02A 2CBOA 2OMWA 2DYRB 4IKLA 1XCXA 2BCKB 4M6NH 5DJ2A 5FFGA 5D7IF 3WMSA 1E4WL 3CZGA 5D7LA 4ZXBD 1BFVH 5EBLB 4L8BA 3TS8A 4KJQC 5EF3A 2EKJA 4PB0L 1S7QA 2F58H 2VL4A 4NHUB 1OP3K 3HBQA 4WSGA 3TT3H 3ZZ1A 5C0FB 2PR4H 1CICD 2MHAB 1HESA 5ENWB 4G1MA 2Q8AH 4DZ8A 3HG1E 4L9DA 5CJXC 1MCWW 3ZL2A 4DGUA 3ZLQC 4HC1A 1ET7A 1T1YB 1WA0X 3F6JA 3QH3A 1FH5H 4HX1A 5K39A 4YL4A 2CHWA 1FUNA 4IOIB 4J6IA 1U2YA 3S48A 4IEFA 4LCVA 4P5TA 1FL6A 2HFGH 2X09A 3JYBA 1WO2A 3H3PL 3NFPA 1P9MC 2I24N 1JERA 2AKRB 3MRJB 5FK9B 5EIVA 2ZE0A 3HA0A 3OKEA 2V2TB 4L4VB 3AU1B 5CMAA 5BNXD 3LKRA 1KBGH 2MPAH 3P3SA 2JKNA 3MV8D 1XVSA 3QJFA 3BP5A 4GP4B 4LGRB 1LQSR 1LO0L 2BK8A 1P84J 3ZXAC 4BXSV 1IGCH 2BSSB 4MJ6A 4ALAH 3ZKXB 1UATA 1YMHA 4FZ8H 3I9GH 3D33A 1WITA 1IKNC 1KPUB 3MCKB 1BIHA 3CH8A 3MRCB 5IVNA 3HE6B 1PY0A 4OZHF 1JWMA 4M3JA 1CXHA 5LO7A 1IBBA 3V5HB 5GSRA 1P7QA 1X9LA 3BSZL 3FFOA 2K4AA 2VDOH 2IH3B 3EIFA 4XX1E 4YLCA 4I18B 1M2VB 2MTAA 2AP2A 3D0AA 2DQFA 3EOAB 3FTXA 1A0QH 3GSXB 1CD8A 5E2VH 2LAGB 2PTTA 3RB5A 4CMHC 2XA8L 1XF5B 2H1LM 2ZONA 2ZX7A 3QS3A 1OY3B 3MHZA 4HIXL 4D8OA 5ESQA 2FH6A 1E65A 3BKMH 4LDOB 2C1PA 2YXWA 3ESOA 3OZ9H 5HHQA 4QAWA 1HH9A 1USZA 2DOCA 3NTCH 2UYLA 3MRRB 3S9DB 3F6LA 5KBNC 3AREC 4QHMB 1WVZA 1P4BH 3W9DB 2VXVH 3TYFB 1PSKL 4M8UA 5E1QA 2M2DA 5DK0B 4R4FL 2MNUA 3ARTA 5ID0B 4MSWB 43C9B 5L2KB 2FWUA 4IRSB 4A6YH 1I8MB 2VISB 1T2XA 3QDGE 3VXSE 3US0A 3AFLA 4ZSOE 2XG4A 1BZDA 3VFPA 5FW7A 2R69A 5K59F 3QDAA 4QO1B 4UQ2A 3CN2A 2VN7A 2JJTC 4YHOL 1RY7B 4MD5B 4KRPC 4PJAA 3B6SB 5A6LA 3JUZA 3ABGA 2HX7A 4S1DD 4GUPB 1OT2A 2J88H 3QEGH 3RWEA 4HFWB 3LS4H 2G30A 4JPKH 1HINL 5EEUA 1DBKH 4F7MA 2GHZA 2Q7NA 3JTTA 3TGXA 1X5MA 5T33L 2PW2A 2P5WA 2QFRA 4APQD 3K2UL 1EMTH 4NQCB 4IOSA 4FF9A 2OTUB 4XNAA 1S6NA 2VO5A 4BFIA 4DQOH 1J10A 3EYUL 1E3FA 1M7IA 1QEWA 4ORGA 1AOZA 1KJVB 2WINA 4M3KB 5I1DA 2F08A 5IVXE 3UG5A 1KMGA 1KJMB 4LARH 1BBDH 4GKNA 4XP5L 2I9LB 2VOTA 2X1PA 4XMPH 5DC2A 2WY3B 2BVYA 4F2FA 1T21A 3VFSB 1A22B 4LSUL 4WI9A 2NMSA 1MHEB 4F8TA 1LDSA 3BC9A 2R2CA 2WZAA 1KB3A 5F44A 4MD0B 1MCNA 2AEPH 4NNPH 3R4DA 2XN9B 1NBYA 1OE3A 1RP9A 3MBEA 2YUVA 5D1QE 3VXPB 4NJ9H 3SDDA 2VLRA 4KTDH 2XWDA 3KYMB 3QZWA 4M7LH 3MBXH 1R3KB 4ZMQA 1CQKA 5FKAB 3VSQA 1HI6B 4ICWA 3UTPD 3QFDB 4HPOH 4F2MA 2BDNH 3KL0A 2DWYA 5C8JB 4TOYL 3UGUA 1U8QB 1SHMA 1RUAL 4HWBL 3VWJD 3RTQD 4Q9RL 3HC4H 3DUSA 3IWUA 5BOZG 4QOKA 4AEEA 5I75C 5EA0H 3WXWH 2E8ZA 4V2CB 1TZGL 2BVOA 2X44D 1GXEA 1CXIA 4LSTL 5IEHB 2H3NB 2B2XL 4OAWA 1GC1L 2Z31B 3WE6B 5I19H 4UBDC 5J57B 1VB9A 3KZ8A 2N01B 1N68A 3ZX1A 3HEIB 5L6YL 2ZKMX 1MWAL 3I50L 1HDMB 5AENA 1F58H 5JPNA 1EAJA 4XX5A 2A4CA 1A47A 4HLJA 2DIBA 3L2LA 2QKIB 1JZIA 4LAQH 5C9KA 3GSNL 1FFOA 3L17A 4NUGL 4WWID 1HXMB 1QFPA 1ZHBB 5B22A 1BAGA 4JMNA 3GBLA 3T6WA 3QUYA 5ITBL 2VR7A 1KTRL 5F7AA 2XY1A 2W92A 4AEHL 2H1PL 1EO8L 2VDLH 3DVNA 3RY6A 1GH7A 2N4IA 4JR9H 1G5GA 5I1AB 1BMZA 3OSKA 1B2WL 1VCAA 1JAEA 5FDWA 4OI8A 5T5FL 3G6JE 5BOPA 3FO0L 2DD8H 5TK2A 1LDPH 1TJXA 4PUBL 3JV4B 2YJQA 1ZJBA 3WNNA 4AZ8B 1GSMA 3TWYA 3PL6B 2DWEA 4N9GB 1ZVNA 3I9IA 4QRUB 3SBWC 1BP3B 3SQBA 2BS71 1A7PH 5GS1B 5DI8A 2V8LA 5E4EB 3KBHE 1U8KB 4QF1A 3FTVA 3RWDB 1QA9A 2R56L 4K3EH 2WP3T 4U3CA 2L7UA 2WUCL 3RWCB 4BRVA 2K9FB 3K4DA 3BN9C 3T65B 2C1OA 1ZT4A 2P5PA 1FIGH 2NY0C 3DOSA 3UPRB 1OF2A 2FWOB 3FMGH 1FFPA 5AL0A 3D51A 1KCUL 4HIHB 5BRZA 1I75A 3E0GA 4PJXE 2YD4A 5EZLA 4MASA 3K71A 1BM3L 1FZOB 4PRIB 2V5RA 2OXGB 4HLEA 4JJ5B 2FGZA 2PYFB 2E7BA 3P69A 4E5XB 5JXAH 2GIXA 3LYRA 4GXVH 3F00A 4PGBA 4UAOC 1NGPL 3PUCA 2VO8A 4OD2B 2A74B 1PAMA 1U3ZA 5AOJA 5DS2A 3SQOH 2QGDA 5DUML 1Q90A 3E9UA 3QR2A 5H35A 4G59C 4KXAA 3OKLA 2OTWB 4N0YH 1YEGH 3BPNB 3D2UA 5DFVD 2DB8A 1TZAA 3GXDA 4PJCF 4QRRA 4YHYB 1X6LA 4ODXA 2NUPB 3IU4L 3W0WD 1KIRA 3HS8A 4NKDA 2ZYSA 3RA7H 1MH5A 2WXQA 4D0CB 5BVJB 4XTRD 2YAOA 3WIIL 5ALCH 2R29H 3BOVA 1IEBA 3E3QE 4GQ9H 2XZQH 3VI3F 1XH1A 3U2IA 5FOJA 1THAA 1ACYL 3FUMA 2NTFA 1CT8B 3WLBA 2ENYA 2GI7A 3PCYA 2AQ3A 3VXOA 2P5EA 3QUXC 3SD2A 5LBSL 1QR4A 5GGTA 3AQDA 3I74A 4V1DA 4XP4L 5F1IA 4GT0A 5HHOB 1RU9L 3BMVA 4FQHA 2DMKA 2OL3L 3EJPA 4M43H 3GBNL 3L16A 1IFHL 4JFFA 4JDTL 2KMWA 4OCRH 1A8ZA 1T5XA 4WFED 3MRGA 1UHVA 5HYIA 5D1XE 3U0TA 4LQFH 4LKCA 4YSQA 1R3LB 3MJ7A 2PN5A 3NJXA 3T0BA 3FQRA 4HEMA 4E9WA 4KK9C 4MA3A 3WS3A 4AM0A 2ICWA 5GRZA 2LE9A 3BVDB 3X13A 1YMMB 3I3EA 4WWOA 1N3NB 1UXWA 3QC5X 2LTQB 4NO3A 3G08B 2N7BA 5EH1A 1CLVA 2XETA 4A38A 1I3GL 2WMPA 3ROOA 2V7NB 1RK1A 2GT9B 1UM4H 4N8CH 3NGBB 4WUKH 4ILDA 3WTYA 3IF1A 1SXAA 1NAMA 3IMRA 2O6PA 4K9EC 5T3ZE 1MJ8H 5D6CB 4NJAH 1NEZG 3HS9A 3LN4A 4FFVC 2H0JA 1Z2KA 1MLCA 4LCWA 4JGMA 4XN4A 4Z7WE 3TN0D 3ZO0A 4EN3C 4RMTA 3S8FB 1PG7L 2AERT 2AXFA 3SYCA 4I2XE 3QJOA 4FLSA 5E8NB 3O4LE 1UD2A 4WUUB 2C3HA 2ZZUT 3OLGA 3PGCA 3DRQA 4XOBA 4XN2A 3ARVA 1MCOH 3GMPB 4C4KT 2R23A 3TBTB 5E2TL 3BZFB 1NCDL 1BJ1H 2NTSP 5DYOB 3L9BA 3VE0A 3IXTB 1TZIB 1BV8A 4YHIB 2CK0H 2Y2YA 3P9LA 3UZQB 1JYVA 3H6JA 4Y4FC 1YEJH 3GTVA 4EO5A 2X4SA 1X9QA 4PG2A 5GZNA 1MFCH 3UBXG 5MP6H 4MMZC 4WFHD 4W6XB 5CLYA 1A6AA 3PXJA 5HI4C 2OBGA 4BFBD 3AC0A 4ZAKD 4J3OG 3C6LD 5KTEH 3GLEA 3UG3A 1H3XA 2FLRT 5J6HB 2R7EA 4GI9A 4NOBA 3BVWA 1A9BA 3O41B 3MAWA 1WFUA 3M07A 2XWTB 2YKKA 4Z1PA 3O3EB 2RFXB 3G6AB 2VDQB 3IJEB 3LEXA 2D7TL 2WXOA 3ZRCC 5I5MA 3RL2B 1CFSB 1INEL 1UJTA 4BRJA 5I66B 4R8WH 1BQSA 4Y16A 3N91A 3LXUX 4L8DB 2BP8A 1PNCA 1QWNA 2AMGA 4GEJA 3MUY1 1M1XB 5JHDA 1AP2A 1BQHB 3C5XA 3DMMD 1UEYA 3DNKA 4P46D 3U7WH 2J20A 4Y4HC 1PZ3A 3CX5K 2HRPL 5B4MD 1I53A 2G0LA 3O3AA 5BS0D 3HNSH 1NLDH 2XFXA 1OGTB 3MLPA 2YAPA 4FN0A 4HS8H 4P2QB 3P54A 2QGBA 1AXSB 4L9LC 4BSVB 3F7PC 4PQXA 1R5VA 4OLVH 1G0XA 4RX4D 4Z7QF 4HKJB 5E99H 1E4JA 4ANXA 4L3EB 4NNXB 4PJGF 5F96L 4M1DH 3MO1B 1INQA 4JRYA 3L4XA 1SJEB 1KGCE 5DVOA 1LP9A 3PXLA 5AW9B 3SZKC 1HWHB 2RCSL 5L9DH 4M62L 3IAQA 1FHNA 2R0KH 1G94A 1C08A 3QXDB 3I2CH 5HI3C 2E9BA 1BMWA 2WOYA 2X7LA 3SE9L 4E42B 1NJ9B 3KAAA 5JO5A 2ZX8A 1DN0A 5FHBH 2MOVA 1YEDA 1AHWA 5J8OA 1KYUA 3AT8A 3RIAK 1YEEL 1ZA3A 3EO0A 5HJDA 2GJPA 4F58H 3FJTA 3H9HA 2ZJSL 2LABA 1D6EB 2CD0A 1F4YH 3W3BA 3BAEH 3DIFA 5HYQA 4X8JB 4ADIA 4LP4A 4NZUH 1UFUA 4KI1A 2A99A 3IVKB 5ADPH 3MREA 4WU7B 1F4WL 3L3OB 2ICWJ 2ZUSA 5B1BB 1AKPA 1R5IB 2Z4TA 2DKMA 3ZTCC 3CZLA 1X6NA 2DM3A 5CEYA 4A7TA 3QXTA 4H13C 5KAQF 3SZ6A 4WFGE 3SPJA 3GPEA 3X3FH 1RPQA 3LXAA 4MXQC 3UAEA 3KPSD 2ZUWA 4BDVB 3C2SA 3TFKD 2LLNA 3QUMB 4CVUA 3DX6A 3B9KD 5CUSL 5JR1H 1KFAH 4H0IA 5DO2C 1EDQA 1LL1A 3HI1A 1JZ4A 1SRDA 4JDZA 4X5WB 5CD5D 4CNIA 4NIYE 2FQEA 3RIFK 3B5TA 1RUQH 2W65B 5TQ2L 4KO6A 4NRZA 3ZW3A 2WXHA 4G6ML 4FG2A 4XAKD 2V8MA 1DE4B 4Y1AE 3EJRA 1UADC 2YPLA 2IWEA 3CZFA 5EIIA 2DF3A 5KEZA 3DV6A 2WO2B 4JANB 4E41D 1EK3A 4LVNC 2ZYIA 3J7HA 4AXWB 3A6BL 3SDXB 2W95A 2DY2A 4BZ2H 1B88A 4OFYD 2R27A 2GW5A 2YA0A 3RY6C 2EYSB 4L3CB 1U8HB 1ZT1A 1A8JH 2EDHA 3F58L 4J1UB 4XAWL 4AY0A 5FOBA 4W4OA 3PWPD 4A2DA 2X3BA 3L7FB 5C0IB 3TVMD 4S2SA 2EINB 3QEUA 4JFEA 4PRHD 4JFHD 1AD0A 3RGBA 1T1XB 4AUJA 4XE0A 2H3XC 2OMYB 3FSWA 5MENA 4X4YA 4E0RB 4JHZA 1MW1A 1EFQA 3MYJA 1T4WA 2KLRA 2XCMC 4NKMB 1CFMA 5I0YA 3P0YL 3C5ZB 4DERA 3NN8A 2IALB 2OMZB 4Z7UF 2O6CA 1XCTA 4KV5F 3VMPA 4G2AA 1F6LL 2PTUA 5AW2B 2AI0L 2VLJB 5L8KB 1BVNP 4A68A 3RVVC 1WAAE 5F0LB 5JYLA 4HQQH 3RVXD 4TQIA 4GG6E 5JORB 4H0LC 4PJEE 1HSBA 2AJ3B 3BZDA 5TGBB 3ETBF 4Y19D 4Y2DB 1PZBA 2CDFB 4KH9A 4ODTH 1OARH 5ESVB 5T3ZL 2D03H 5KS9B 3UAJD 3GSUB 4ENZA 4GMTH 4A04A 2CHDA 2H2PC 2I32A 3U6XA 5CU5A 5HHPB 3K6FA 5CBAA 2VDMB 3N2JA 4XNQA 3SGKC 5ADOH 1G6VK 1O75A 3J07A 5I8KH 3WGVB 1XH3A 3BWUF 3DTXB 5DT1L 3QGVA 3BVNB 1NGXA 4JKLA 4J3WA 3KPRD 4NN7C 4YHZL 5JQIB 2YUZA 2D9CA 4MJID 2BFVL 1A7RH 1JGLL 4LLVB 5I1KH 3IDMB 3JV6B 4KJYB 4OM1H 1FC2D 2CO4A 3CC5A 3MLSH 1HEZA 3RRQA 2BVPB 2E9GA 4CSPA 5IUSA 2AK4B 4AITA 5SWQA 5KSAD 2JKJA 1UGKA 2E5EA 1W72H 5HSFA 2NUTA 2F7IA 4J4PD 2C26A 5JLZA 5D7JB 4OSUL 1MHCB 1BFOB 4I3GA 3HAEH 1YQVL 5EBWB 2Q7YB 1IILE 1YYLH 5TTRA 1AQ8A 4XBGB 1DBAL 1EEQA 2Y3AA 1Q72H 3IBEA 4L0PB 3CSPA 1RIUL 4N6QA 1UXSB 1DBJH 1DBML 3OKNA 5DEGB 4YSEA 3GRWH 4H0GA 3DXAE 3VXNA 4JBSA 5C09B 3HJ0A 3TESA 5AW1B 1T7VA 3BEVA 1WAEA 4NXKA 1C1EH 4UYPA 4BD4A 3U7YH 5JOFA 1B90A 4TPRL 4G9FA 3VH8B 3QJXA 5I74C 2JWYA 2HWZL 2FL5A 1EFXA 1JWSB 2BOCA 3BUDA 3LNDA 1NGYA 4PJHA 4UM8A 3D69A 1T0OA 3HBZA 1FBIL 1RJZB 1S7RB 5JUEH 2W38A 2ZX9A 4NO0A 2NXZC 4K2UH 1XBRA 5E6IC 2DEYX 1RL1A 2MH4A 3TEYA 1XR9B 4TLUA 4L1HA 2BY0A 1DUYA 1I8KB 3FUHA 3KNBA 5DFAA 5FCUH 3RPIB 3UPCA 4Y1SA 2KH2B 3WEAA 3WJMB 1QBLL 4PJ8B 3OMZA 4KUZH 5TJWK 3PV6A 1FAKT 1UB6A 1T20A 2BCMA 4NUQA 5GGTL 3VFTA 2FEJA 4I0PD 4AIXA 5DJ2B 2G3ZA 2WK2A 4E9YA 2DQDH 4PVMA 3FPXA 2VM3A 1QUNB 4ONGH 2GK2A 5A7BA 1CLYH 5D7LB 3OLDA 3FTGB 2F53A 2EJ1A 4L1SA 4AIOA 4F7EA 2X70A 2B1OA 3BCFA 4A55A 1NDGB 2A1WH 4PGDA 1X5YA 5L4MA 1IAKA 1KWKA 3MBWA 4G1MB 5C0CB 1HKFA 2DH3A 2OMUB 4DZ8B 1PX8A 5DZ9A 2UWEB 5E8DL 5DLLA 3L9RA 1PEZA 4WK4B 3WLWD 4TRPH 4XX1G 5K39B 3K3QA 3DO7B 4YDZA 5IQNA 4TKWA 4L4VD 4PV8A 2W0FA 1KLUA 3IM1A 3LH2L 1IGYA 4P5TB 4XVSH 5G5DA 1Z9NA 3RJDA 1TMQA 1WTGT 3NFPB 3PDOA 5JW3L 4OZGA 1XZWA 1XMWA 4PGJA 5DEZA 5ISZA 1P4UA 2NR6A 3BH4A 3EBIA 4LP5A 5EOQL 4X7FC 1NAML 4OGXL 3H9SB 1FRGH 2NYYD 3LKRB 4KPHH 5CMAB 4NHCH 5HGBA 4DVBA 3BP5B 3DETD 4MDRA 4OCWH 4D3CL 2XQBH 2IGLA 3HE6D 3LQZA 4FMKA 2X89D 3CZNA 5D7IE 3Q7JA 3LZLA 4JGJA 1E3ZA 1YMHB 2LV4A 3SODB 3N6YA 2LU3A 1U8OA 1ACZA 3WIFB 5INCA 1XL6A 3OV6A 4E9VA 5GZOD 2EEFA 5C6TH 5FWQA 2XPZA 1KJ2H 1P7QB 4YGAB 2P8LA 4IS6A 5CEZE 5I1GL 1VRSA 4KKZA 3QULA 4GAAA 3ZQXA 2V7HB 4MAYB 3ZDYB 1JV5B 2DQFB 5I30L 1MF2H 4GYBA 3RE0A 5IESH 5D72L 4OKVB 2PTTB 3FN0L 2VDRH 4GO8A 1EDYA 4PTUA 2WYHA 5AVQB 1Q8MA 3ZRFC 4JRWA 1JFHA 1DSFH 4LCUA 2MRYA 1G87A 1U8NA 2C1PB 2Z7ZA 2HVJB 5ANMA 3TX4A 5HHQB 3TEXA 2FB4H 2YD9A 1T6VN 2AEWA 4YXLL 3PWJA 4U1GC 2AQNA 1BZQK 4P9MH 4U6HA 4H44C 3QIWD 1RD6A 4A63A 5L2KD 4IRSD 2CHNA 4XO8A 1IM9A 3D0VA 3D5OF 1SEBA 2WVSA 2WZ6A 3UIZA 1QLRB 2OMBA 1XGRB 4N5EC 3MLZL 5JQHC 1KLFA 3OC5A 5I73B 1QFUL 3CFCL 3FB7A 4MB4A 1AXTH 3BD3A 3DJ9A 2XG4B 1DFBH 4BHUA 2WNWA 3FUKA 4J7RA 2L0DA 4ODHH 1JN6B 4BCXA 4GUCA 2QADB 2OI9B 1NOLA 1P84K 4PJAB 2X2YA 3VFOA 4W9GC 4ZX5A 3K8LA 5IROD 2DQTL 3W82A 4H2CA 4F7MB 2R39A 4NQCD 4QR7A 2WC7A 3JTTB 1AR1C 3O3UN 1N8OE 3HZMA 2F1EA 3UBXI 3V4PL 4MZ2A 2EADA 1DQJB 1V10A 1Y0LA 4QAMB 1ZGLA 2HUEA 2APSA 1QVOB 3CMOH 1K3ZA 2OXHA 5KG9A 4Q0XH 3AGWA 4ZO9A 2WVVB 4X7DC 4KQ4L 1GW6A 3EW3B 3SPCA 3PWLB 5JDSA 1T83C 1JYWA 1HH6B 3EZ8A 3NA4A 3AY4A 4JRFA 5I16A 1VFUA 3GPSA 2D7OA 2G3XA 3KH4A 3O81A 4WW2B 5HXMA 2VM9A 2WQAA 1DQIA 3MRBA 4AW4A 1LE9A 1B2YA 4QT5B 1OM3H 4WO4A 2OX5A 1NFDB 1OGPA 5K59E 4GKNB 1KJ3H 1QKZL 3I75A 2WYZA 4R90L 2ZWZA 4E68A 2AEOA 3UGEA 2I07B 3QWRA 2XN9D 3VGFA 4OCNC 5JOEA 1KLGB 5FLUA 4P3CL 3V4VL 3GZPA 1R5WA 3W0WE 4ZTEA 2J72A 4LOUC 1IEAB 3AXHA 1CU4H 5LCVA 3S37X 5C2BH 3IFLL 4OLZL 5AQ0A 3UEZA 3V52H 1U0QA 5A16A 1N5YL 1HL8A 1NANH 1W80A 1I9EA 2ERJB 4NPYA 1AE6H 3K81A 3S96B 4JPWH 3C6SA 4KHXL 3KR3L 1G9NL 4AH2A 4OTXH 2Z31D 1G43A 4G6AD 1EPFA 1IGML 1VEOA 3U2SB 1Z9LA 5KVGE 4JFDE 2BVOB 5ERWA 4YUEH 4JG1L 3GHEH 5IY5B 4KVCH 5IHWA 4DKEH 3C75A 2FT6A 3KWWA 5DHEA 1JZ8A 3KPPA 1OOAA 3ABLB 5MI0C 3HR6A 4J6RL 1BEYL 2BP3A 3MRNB 4X98B 3TJEL 4JM0A 3O8XB 4WFEE 1SOKA 4FTVB 4JFZL 1I1AB 2ALAA 3VD3A 3VRLF 3V6OA 5TFSL 1CLOH 1NGQL 2DWDB 3SY0A 3VB9A 3O9WD 4XPAH 3U6RA 3JTBA 4OLXL 4Y88A 1J05A 1KB5L 4Q9CA 2Y1YA 3HMWH 4FG6C 5D7KD 5K9OB 3S6CA 4N3UA 1YVLA 1FO0H 1JNHA 3FT4B 1DN2A 5C0BA 1MCLA 3LNIA 2ZUTA 2E6QA 4PGEA 3FQ2A 4F8LA 5F7FA 4IBTA 1GZHA 5I6OA 2FAUA 5FDWB 4B9FA 2E7HA 2WXKA 3ARDA 3C08L 2X6CA 4AJYV 3FTZA 2C5DC 3S88L 3KD4A 4PWEA 3J8F7 4IIQA 4WKZA 3P4NB 2DWEB 2V37A 2DI8A 5LKNA 3BH9B 2D2CC 3ESMA 1KN2H 2EIEA 2P80A 2V9RA 1ND0A 5DI8B 4LLMA 3UAAA 4KZEH 3PDGA 4QF1B 1QA9B 5D1ZA 4AGMA 4UTCA 8PAZA 3OXRA 4FQPA 4LSPH 2C1OB 3OR7B 1UJ3C 3ZL4L 1OF2B 5D4HA 4KKLC 1L9OA 1W6LA 3BP4A 2E47A 1YC7A 3KLKA 5GQBA 3W11C 4I1PA 4RSYA 4U3SA 3F65A 4UNIA 6PAZA 3K71B 1N18A 1JHKL 3A4DA 2FNWA 1TCRA 2WQSA 5C0RL 1C12A 1U3HA 4JFOB 3WD5L 2X4TA 4IDJL 1L6PA 2YS4A 3TOPA 1RKRA 2TSBA 4GAJL 2RH0A 4N87A 3T8MA 4FFYH 2ZF9A 4M93B 1NFKA 3NJMA 3RZCC 2XTJB 3APFA 3JZ7A 3S7GA 5CCKH 5F7DA 3S4SA 3V4UH 4WTQA 3GINA 3ETSA 4YSSA 3DX1A 1IQDA 4UMSA 1X5HA 2A9MH 2GSIB 4MQTB 2EE3A 4YL9A 4KROB 2HT2C 4YAQA 4QRRB 3VXMB 4P99A 4F24A 2H2SC 4DK5A 1E6OH 1G4RA 1GGUA 1NL0H 2V2WA 2XWRA 4XXWC 3TZVA 3TLRA 3MJGX 3QUZC 4G8GD 4OCSH 5I6NA 1MH5B 3B1UA 3IFOB 2XRAL 3LN5A 2EKSA 5E24E 1AD9A 5EU3A 1R6VA 2VDPH 3GHBL 2Z8SA 1IEBB 3DI2B 4JG9A 4MQSB 1AXIB 4XO3A 4PJ7A 1KOAA 3RGVC 3WUZA 1HL5A 3T9WA 2X4RB 2VW6A 3WLBB 3DWTA 5HHOD 4EQ2A 4XHJC 3BRGC 1AYRA 3CZUB 1LWRA 2P5EB 3ULUC 4HIPA 3KPLB 2EVFA 3GSOA 4V1DB 3HS0C 2MEJB 4UMGA 5F1IB 5AB9A 1KY6A 2OCFD 4Y2NA 5DD0L 4AK1A 3GB7A 3HRZB 5L4FA 3AQXA 1YPZB 3WFDH 2X6AA 4JFFB 4DT2A 4ZW8A 4BA8A 4M1CD 1T5XB 1DR9A 3MRGB 1NFIB 1JF5A 1CS6A 1WRFA 4RAVA 1MCJA 8CGTA 1E9QA 4OT1L 3U0TB 1OPGL 3O6FC 3D85B 5DJ0B 2RACA 1BIIA 1T89C 5AL8A 2VUOA 1YMMD 2GEQA 4Y5YC 3KYKH 4PJCE 1WBZB 3WTWA 2WXRA 3FQRB 1MHHA 4D94A 1T1WB 3HG1A 4JGUA 4NT6A 1Q9LA 3L7EA 4TLSA 3KM1A 5D2NE 3WS3B 1Z3RA 3BUYA 4XPFL 1UXWB 5GJSL 5B1JA 5LNDA 1C5CL 4NO3B 1KPRA 3ULUL 1H8OA 1B9KA 1LEGB 1VGKA 3VI3E 2WBJC 1OZTG 3LN9A 2DBLH 3T2QA 4UIMB 2WMPB 3T6ZA 1RK1B 4HP5A 1WWAX 1XSKA 2Y7MA 1FYHB 4PRDB 3IF1B 2DQHH 3L48A 5E8OA 5CZRA 4M5ZH 4NQSA 3ELQA 3LCYA 3GHPA 3QIBA 4YE4L 2Z3FA 1G6RH 3I6SA 1P5VA 4NO2A 3O3BA 3FFDA 3LN4B 3HHRB 4OH2A 3QPQC 2X3AA 3KPSE 3ZHKA 2VC2L 4WUUD 3LRKA 5IFAL 4QHPA 1JVKA 3ME0B 3OAYK 3LEVL 3N41B 4KBPA 1NC4A 4R7NA 5EBMA 2CU9A 5K69A 5AWNH 3GIZH 5ACMA 5EO0B 2EDNA 4NZTL 4RMVA 3STZB 4F3FA 4HJ0C 3DRQB 1TNNA 3UTTB 4HIEA 5D8JH 3UTZA 4IJ3C 1BQLH 2EH7H 4A39A 2R23B 3MA7A 2XVKA 4IK7A 4EI6B 5CLZA 1HFUA 1WV7T 4HBCL 2BIPA 1Q0XH 3RHWK 2J1XA 3AS2A 4NGHH 4Z3TA 2IPUK 3LIZL 4XPBH 2X4SB 5A3IC 2R59A 3HNTL 1CGSH 2VZ1A 4IM8A 4R7DA 3MV9E 3EFOA 3NDYE 3L3JA 3OMNB 5AW7B 5KYWB 3MLWH 4JRXB 3SDCD 2R7EB 3L3DA 1A9BB 1OT4A 1W6WA 1BFVL 3MROA 3VGDA 2RALA 1R3HA 2DAVA 4K73A 4TSCH 4PRHE 3SOBL 5EUOF 4EI5A 1DANT 4AQOA 1A6ZB 5TK4A 5LXVA 4AL8H 1JI1A 3TT3L 2F58L 2IPKB 3OSVA 4ALAC 2YD3A 3V0DA 3JT2A 2FJGB 3MJ9H 2OLDA 4N0UE 4N2HA 2GHWB 2Y25A 2NY7H 3M1CA 1A6TB 2J4WH 2Q8AL 1QMUA 2J7LA 3CFUA 1INDH 1FORH 4S1QL 3OKYA 2EXTA 5JHDB 2KERA 2VXQH 3IGKA 2DQJH 1GMEA 1SY6A 1PLCA 1FH5L 5CGYC 5F3HA 5C0AB 5IG7A 3O3AB 3NSXA 4O02A 2IIJA 4W6WB 2XFXB 1DVFC 2HFGL 2GABA 3OR6B 4IRZL 1Z9SB 3WGUB 1BG9A 3WJLC 1R5VB 1ZVSB 2ROXA 2F54A 5DVNA 4BZ1L 4HJGA 4B96A 4KI5F 1IC4L 5TE4H 3FQWB 5E8PB 2CLVA 3EDKA 1KBGL 2MPAL 4F27A 5I1JL 2A77L 3L4WA 2UUDH 2YXMA 1URIA 3QNYA 3ERXA 5F0MB 5HYJD 2X2UA 4ALAL 2ZOTA 1T1ZB 3QP3A 3SKJL 3I9GL 1C08B 1XB8A 1IZKA 2B1HH 1E7VA 5DK2A 4ZW7A 5IJBC 2B59A 2X7LB 3P73A 5JO5B 2YN5A 1YEWA 3N1FC 5I6XC 1RUMH 3U48A 3SKOA 3HG5A 2YMXL 1YEDB 1AHWB 4OGYH 2FK9A 4UT9A 4JM2F 3HPJB 1JZFA 1P4LA 5IVXA 1ZA3B 3OB0K 2R4RL 1TTRA 3H9HB 1HT6A 5E2VL 3ZR5A 5EU7E 1UKTA 4I3RL 3PUUA 5IR1A 5HYQB 4N2BA 1OPOA 2GY5A 4TTDC 1U8CB 5FA4A 2HKFH 4NQDE 5IW3A 1ZTXL 2CIKB 2D0GA 1UG9A 4JG0L 3BKML 5CEYB 3DX0A 3T0XA 3AMKA 1BZ7A 3L4VA 4L37A 2HLAA 1LEKA 4WEUD 3JWOC 4Z7QE 2R8SL 3B2UC 4U6YA 1KIQB 1R47A 4YC2B 4FFZA 5IMOA 3N1QC 4PJGE 2PWFA 3MRLB 1U42A 2KQMA 3FT9A 5F1NA 3ZHNA 3BT2L 4GW1A 2UWEF 3HI1B 4PLOB 2GUOB 4JFPA 4KTYA 3H3BC 2VR5A 2GAZA 4CNIB 4EDWH 3QXVA 4A6YL 4L4TA 1MHPL 2P24B 3EGSA 3UOAB 4S0TD 2OR9H 2YPLB 5D2NC 1D9KA 1LXMA 2YSSB 3CFEA 5F89B 2GSMB 3CDYA 3DV6B 2EXYD 3O6LL 4FXKA 4ONFH 3QEQA 4PP2A 2E9JA 3ASWA 3A6OA 1QBBA 4B95C 4N1EA 5BQDA 2BIOA 3JWOL 2CRMA 3WUWA 1AANA 2J88L 4EUPH 1RVFH 3RTLA 1TQUA 4PWKA 4P59H 1D5BA 1XFPA 1DBKL 1G9EA 1CO1A 4IRJC 4N9OB 1TXKA 2CRYA 1WZLA 2VRQA 4Z3IA 4ZMXA 4TNFA 3DKHA 4C56B 2N3JA 1PLAA 2R4SL 5FO7B 2WJ7A 3VWKB 1A02N 3WNMA 3E7JA 3VGAC 2YD2A 3C5ZD 5EUKB 1EMTL 3LDBC 2NW3A 2PW1A 1B4JH 3G5VA 3C09B 2EEXA 3CHQA 3BGFC 1DBBL 1DQDH 2VLJD 4NUPA 2H6PA 4OD1L 4OGQC 2KS0A 4LAJH 4MBRA 4QYOB 5JNYA 4PWFA 4R2GC 1MCQA 2APVA 4YEEA 4CVZA 2JCCA 3MMEB 5DGRA 3AT0A 1BVKA 1OWWA 1EEYB 1XCTB 1TQBB 2OQJA 1KN4H 3R1GH 3A22A 1EQWA 2XPYA 4Y2DD 1E28B 3ATBA 1AOHA 3DO4A 2JI2A 2WVUA 1HXYA 4MB3A 5CP7A 3EG9B 5BZXA 2B1AH 5SX4I 3HFMH 2WLJA 1QSEE 2GUYA 4B9CA 5JPMB 3AXLA 5EOTA 3KLHD 2BOBA 3HE7C 1H3VA 4BFOA 1X5IA 5DO8A 1EAPB 2WUBL 3VDBA 5M94B 2HTKC 1J18A 5IK3A 3APMA 4JUSA 5GGUB 5I9QC 4YHPB 4G71B 2VN5A 3BISA 4I88A 5DS1A 5GISH 4ZMYA 4MDIB 3FTWA 1WDAA 3WNIA 1HJCA 4XNQB 25C8H 1EZUA 3D39B 4PJ5E 3DIVA 1AVAA 1R0AH 1YSOA 1OP3H 4M7LL 3MBXL 4ZX4A 2DH2A 4I48B 2XOTA 3TPUB 2AJYL 2AK4D 4HPOL 3MLUL 1J8HD 2YRPA 4QHKJ 2BDNL 5KVFL 2HJKA 1OCWH 3K6DA 2Y7QA 3F7RA 2ATKA 1FZKA 3HC4L 3VSVA 1HEZB 3JWNH 4FQQB 5D7JD 4ZMPA 4YPGA 3WXWL 4Z7UE 4IBQA 4KV5E 4YVNA 3BUIA 3L2MA 3GGWA 4AQAA 5I19L 4OF0A 4AQEA 5LDSA 1JTTA 1PJ9A 1TZHA 1WS7A 3DX9A 3QUKA 3SKMA 5JLZB 2ITEA 2V4LA 3C5SB 2ZT9C 3JBG7 4Y8DC 5F7WC 1F58L 2QQQA 4AGPA 5C09D 2ZAHA 3CCHB 4CU6A 1JPTL 3D30A 5SWZD 1KELH 4KI5D 1CGXA 4LAQL 1M05A 4EKJA 3D12B 5GRVL 5DURB 3VXNB 1TEGA 4XNDA 3EH5B 4LSRH 4XO4A 4LL1A 3WTVA 1A4JA 4XE5B 1ZLDA 4LKXB 1M7DA 4N28A 2O5ZL 5JOFB 3UCRA 1T0MA 3WN5C 2EVJA 1SN0A 3RBSA 4JR9L 4YH6A 3CDFA 5AG8A 4OBSA 1BD2E 1J9CT 1I7ZA 1WFMA 5CHNB 2FL5B 5KYNA 1NGYB 4UM8B 3D69B 2C9PA 2OSXA 3R19A 2KYIA 4JQXC 3HW7A 3FHAA 3SKNB 1ZEAL 2F1BA 5CZVL 5DHMC 3RUGB 4PJ8D 4PJ9B 1FLRH 2GKIA 3JVGC 3KWTA 1JOIA 2GEEA 5JZ7D 3OTTA 3FHQA 4MNGE 1DUYB 5H2BA 3KNBB 2IDUA 1A7PL 4WU5A 5D1XA 5B1JC 4NQXA 1EZVX 3TASA 5C3IA 5IV2A 3RI5F 2WN3A 4L48A 1KCRH 3PV6B 1UB6B 3GXTA 4K3EL 1AI1H 5FF6B 3U83A 1A1MB 2ESVE 4H8UA 4ZTOL 5I0DA 4AYFA 4NFDA 2ILLA 1FIGL 3G5YB 1CXEA 2AANA 2JQMA 3FMGL 2HMIC 4Y5VA 3KDMA 4NDMB 3Q2NA 3QORA 4HAKA 1TFPA 3KVPA 1F2XK 1AJ7H 3IMTA 5C0CD 4JAMA 3ISYA 1W8EA 3NABH 3IDGB 1NAKL 4QTIH 3QCUH 1YN7A 4PGDB 5DMIH 2ZXWB 3CBJB 3EJYD 4JPVH 4Y9EA 5D93C 5J3HC 2UX6A 3LHPH 3MBWB 4K71B 4K94H 2NDFA 1MFMA 2ZUQC 3AG3B 4DK6A 3TV3L 5CP3H 3HUJA 3DX8A 4JJHA 1R9FA 3VDAA 3CXFA 4OJCA 2NCEA 2C9XA 3RAJH 3TA3A 2OA9A 3RWIB 3H9SD 5F71A 5G5DB 5T1MA 4N0YL 5HDOA 1F3RB 4Z7WA 4KXZI 3HKZA 4OZGB 2BINA 1T0NB 2EDBA 2OTPA 1UWGH 2WNKA 4I2XA 5GJTL 1BM7A 1UWEH 4FRWA 3SDYH 5KSBA 1H5BC 4R97B 4U1JA 2QPFA 3PHOB 3CVCA 4BUGA 2P8PB 4GSUA 4DEWA 4TULL 2WIIA 3RA7L 4MQXD 5EU5A 4DVBB 3KVDD 1Z1WA 3D8MA 4J8RA 1MCIA 3OLEA 4I9XA 4UT6A 4V11A 5KZCB 2B8OT 3N04A 5ALCL 3SGDI 3QCVH 1T66D 3QISA 1U93B 1YAIA 1TPXB 1P7QD 5DA0B 4JFQB 5K93A 1N0XH 2DJMA 5A2JH 4PCSA 3M45A 4MAYD 4B7LA 1I7TB 2ADJB 3II3A 4KKCC 5JYMA 2P8LB 4EI5C 3ZTDC 2BC4B 1Q9KB 4N8UA 1AQMA 3WKQA 4YDLB 5FEBA 2ICEA 1NEZB 3EBGA 3B37A 2NXYC 3Q9PA 5E9NA 2JK5B 3AUVA 4EI0A 4NM4L 2NY3B 4GINA 1ZMYA 4Q74A 4ZYKB 5FGBA 2XN1A 5KJRH 3PAVA 4X6BA 4FFWD 1NGZA 3LZPA 1ZS8B 4J3UA 2PO6C 4DAGL 4LQFL 1MW3A 2AJXH 3K4ZA 1ZANH 2XKNB 4I3SH 2YAEA 3CVHH 4NCC1 4QXWA 1NLBL 5ANMB 1ZY9A 5FECA 1FJ1A 1IARB 2CE6A 3VG0L 3NFNA 1K6QL 5CLXA 1Z6JT 1L7IL 2VH5L 3ARGC 2APTA 3QJSB 1AHMA 5DD3L 2IAMC 4YDKH 1MI5A 2VXSL 3BPCA 3ZZLA 4BFEA 2N59A 5DHYB 1IM9B 2XQYG 3FONA 3BKJL 3D0VB 1SEBB 2WHVA 4P5SA 3UBXB 4X8GA 3X3GH 1FQ9C 1MCPL 3A6CH 4X7TA 4H88L 4N8CL 4U1NA 1KLFB 4WUKL 2EIZA 4FA8A 3M46A 3EYQC 4FI7A 5BZWA 1E4KC 2R15A 2VDKB 1GRWA 5LAXB 2AQTA 2VM4A 4F37F 4X6FA 1ZRUA 2JJUA 1XIWA 1DEDA 1VZIA 2AJUH 4JFYB 5B7EA 4DGIH 2XZCL 4TVPH 2QVTA 2IDSA 4HLZG 1DQQA 4K7PY 1T5WA 4IOFC 4GRWH 3IDJB 4HGWA 4N2NA 1CGYA 1F11B 4ELMB 1FL3B 4KMQA 3QXAB 1LGVA 3HZMB 5AYTA 2J8OA 2XTLA 1Y0LB 4LZKA 2WD0A 1I1CA 3V5DA 2GIYA 4PHXA 4MWFA 3V5KA 5CN1A 1IAIM 1UUSA 3DJSA 1ZSDA 4L3FA 3TO4C 1T2QH 4FX5A 5JDSB 4PJBF 3L5IA 5DTFA 1BF2A 4PG9B 5J11B 4X7SH 1CFNB 5F88A 1MFCL 3APDA 1H3PH 3BWUC 1HKLL 5MP6L 4JO2L 1EHKB 1BXUA 1EJ8A 1UD4A 1USQA 3MRBB 4D9LH 3EYVA 2DJ4A 4WNSA 5TDNA 4GEIA 1XEDA 4UQCA 3ARWA 4AYID 4AYBA 3DX7A 1KF9B 3T2OA 1YNTB 2R2EB 5A2AA 3LRSA 3LPPA 3MJWA 4UU9B 4XXCA 5EO1A 5CLTA 1U95A 1ZLVK 3IDIA 4XNYH 1KCWA 4DO6A 4AYMC 1OSEA 3QRFM 3Q2VA 2NY5H 2YO3A 4H1LH 4YQXH 2C9AA 4Z7OF 1S9WA 3J27A 2QSQA 3BO8A 2BHZA 4HA1A 4CMMB 3II2A 1NLDL 4TNWK 1RULL 5EOCH 4AEIL 4L8CA 1ADQL 4HUVB 4ZUUA 4XMXA 3RNKA 4OLVL 2G4EA 3ILQD 1FH2A 2J3SA 4KFZC 3IMBA 1EWHA 2IH1B 4N0CC 5ERWB 3WNOA 3O8XD 2CCVA 3GRGA 3UJJH 1NKRA 2VDNB 4FTVD 3KWWB 4LOFA 1I1AD 3KPPB 2C3VA 1MIEH 3INUH 3MUGB 4FNTA 4DOHB 5IBLD 2XWXA 4ZXBA 1RHFA 1TTFA 4LNVA 5L9DL 1G5AA 3NAAH 5HJGA 4NZRH 3PRZA 1BOGA 1AZNA 4JZOA 3S2CA 4PJIA 1CICA 3LPOA 3W5NA 3U6RB 1FG2B 5DD5L 1QRKA 4A66A 1VACA 4MMXA 1B9ZA 1B4RA 2JB6B 4CMHB 4NRXA 1ODAA 1WAAA 4B9IA 3HHMA 1CIDA 4A7GA 3BW9A 4KK5D 4PJEA 4WZ9A 2PWEA 1J7VR 4MXWH 2AABL 2YLKA 4GSQA 4NZUL 1XO8A 5CEZD 3ARBC 4N2OA 4BK5A 1MFNA 2MOQA 4YO0B 3NZHH 4HCRA 5ADPL 2CO6B 4ZFZB 2V2XA 5IQMA 4WTWA 4LRIA 2YEQA 2E3VA 2F19L 5G55A 3LKQA 4LPUA 2XZAH 3VFWA 2ROYA 3AREB 3MV8A 4IIQB 1VADA 2W60B 4MAUH 2ZD0A 1PU0A 2QVKA 3AWFA 4I77L 1KFAL 2X6MA 3GXIA 1ND0B 3SYQA 4LLMB 1NM9A 1NUNB 4BXVA 1A7OH 4XH2A 2AV7A 2DW5A 4JHAL 1GJIA 3HZKA 4HIJA 3VRJA 2WKGA 1N4XL 5IQ9B 3T2NH 4B27A 3VRLE 4LFHD 3QFJE 4LOEA 4OFDA 3WNJA 3P0VH 4S1SH 2MCAA 2CLZA 2YQ2A 3MRHA 1DQLL 5FLVA 2O5XH 4KRPB 5C07D 2YFNA 1ITBB 4HWEH 1S7TA 3O0RL 4UOW1 5GIRA 1G7PA 5SV3A 2VQUA 1C12B 2DMGA 1U6AL 1U3HB 2N7AA 3AACA 4P4KC 4UANA 1EANA 2XTJD 3SO3C 1YJDL 3V7AE 4YHNB 1A6PA 2UZYB 4WI3A 3QRLA 4GRWF 4XPGL 1X9UA 1GAFH 3NOIA 3L81A 5IJDC 1UVQB 4OLUH 5AAWA 3F85A 2DLEA 4GOSA 4O5LH 4OM0L 4KROD 2H9GA 1MAML 2IXQA 4LSVH 4DTGH 3DXAA 3VXMD 2VKXA 4QWWD 2W81C 4DZBB 1IQDB 2BHYA 1WP6A 5FO8A 5D2LA 2PKDA 1VHPA 3E6FA 3U4BL 2W8CA 3WFCL 2V2WB 1ZV5A 3POCA 3TZVB 1YN6A 3DROA 4I87A 1PZ5A 2EE6A 3H53A 2Y7NA 3II1A 3LN5B 1L5GA 2WBXA 1TKWA 3GT6A 3F64A 2DL9A 4HK3J 2QR0B 4PJ7B 1ZA6A 1X5LA 3E2HB 1KGWA 1GYAA 2QHRH 1P6AB 4HQQL 4PH8A 2X10A 5BRPA 3L3IA 4V1DD 5FUOL 4Y5VC 3PWUB 1Z5LB 5DC4B 3NEOA 5INDB 3OPZL 5DEFB 4ODTL 2EVHA 5FO9B 5IIEB 4MZIA 1KG0B 4XNMA 4JFFD 5DMJB 4MZRA 2D03L 1P53A 4K3JH 3F3HA 4GMTL 1PX4A 3ORJA 3D85D 3WENA 1BA9A 1X5XA 4GLRH 5FUZH 1DLFH 3VFRA 4J5VA 4W81A 4APQA 3KPQB 4RAVB 5HYJE 3MI6A 1OK0A 1SEQL 3WXVL 1BIIB 4G5ZH 1CR9L 1OP4A 5D5MF 4TUKL 3ULSA 4YR6A 1A7RL 1MY7A 3HG1B 4OM1L 4NT6B 4YFEA 3R06A 1U36A 4WWKC 1CD0A 1TT6A 2EDLA 3BUYB 4DWHA 4HHAA 3H4FA 5EZJA 1Q4NX 2EC8A 2EUZA 4JPSA 2L7JA 4BFFA 4Q9BA 1KPRB 3H0TA 2G2RA 2FYYA 4YJZL 5DJ8A 3VFMB 2HT4D 1CE6A 2G60H 4W9HC 2Y6SC 2IDTA 3GKWH 3QJZA 5HDBF 4WGWB 1Q72L 3L3KA 1LO3L 3KLSA 3QIBB 4PY7B 3SCMD 3VD7A 3GLDA 3OB8A 3HLAA 1DBJL 5KSUA 3FFDB 1JRHL 4BELD 5CR8A 3ULVC 2VLMD 1WZAA 3IXAA 3LZQA 1F97A 2DI9A 2ICEC 2GPZA 2ZOUA 3BAWA 5D7IA 3WFBL 2KKQA 1ET5A 3WEMA 4KK6C 1J0JA 2QSTA 3MGTB 4FXGC 1L3WA 3UTTD 1NC4B 2K78A 4R7NB 3U7YL 1EEZA 2WW8A 3PXHA 5FWRA 3F7KA 2IF7A 3B2VH 4OQTH 2ZQKA 4LIQL 4HIEB 4F92B 4Z7NF 3UTZB 1PFOA 3VWJA 3KEHA 3RTQA 3FT2A 2K70A 3MA7B 1OAQH 1N8ZA 3FQUB 4UT6L 1JV2A 4B50A 1WCQA 1OW0C 2AW2A 5E5RB 2ZYRA 2ADGA 3FH8A 3PYCA 5TDPB 1BFSA 4XVTH 3IFNL 1RZ7L 5MERA 5FCUL 3N40P 1RERA 4AQ1A 1K2DB 2KT6A 3FB5A 4JRXD 1E30A 3ULVL 4KUZL 1OQXA 3F2LA 4Z0BL 4XHQA 4R7DB 5HHXL 1MXDA 1UD8A 3B7UX 1DL7H 4X83A 1I7UA 2V9QA 3HZVB 3ATDA 1GS8A 1H8NA 4ONGL 1YQ2A 7TAAA 2XWZA 1CLYL 2COQA 4KKPA 4L1DA 1QZNA 4W9DC 5IHZA 1NMCB 1R3HB 1UUNA 1XEUA 2ZKYA 5JIPA 1LK3L 3DC0A 4WHTA 3ESVF 2F5BH 4FKHA 4NAJA 1MZYA 2H32A 4ZOEA 3QQNA 4RMSA 3W39A 2IQ9L 1EXUA 1DQTA 1WT5A 5DU7A 1XIWC 4JCMA 1JGEB 3B5GA 2G2PA 4OZHA 3QDGB 4N24A 1FVDA 5C0AD 3VXSB 4CU8A 3NIFF 4ZSOB 4OKDA 3RKPA 4Y9GA 2WO3B 3HI6L 5B1CA 5HVGB 1CDJA 1EAQA 2WTOA 4WKXA 3WIHH 3ZL1A 4ACTA 2BXZA 5BUGA 4XPHH 2EVIA 3N1MC 4OZ4A 2WLYA 4TRPL 1F90L 1K8DA 5F3HB 5IG7B 4RRPG 2OL3B 2IQAA 1D5MA 3PU7A 5E94A 4F7CA 3DDGA 4O02B 1PY9A 1SMOA 1ETJA 1ECYA 4TVPD 5E2UH 4DEPB 3TF4A 2FBJL 2Q76A 1LD9B 2IEPA 4JY4A 3WDIA 4Q14A 1IKOP 1JXGA 2OJ1A 5IREA 2P9RA 1UH4A 3FSAA 2AXGA 5EEWA 2CLVB 2GJJA 4KPHL 4P2OD 2BO0A 4K3HA 1S5HA 4X4XA 4PB0H 1GZQA 2KDGA 1IAIL 3H7LA 4KZDH 5I5IA 1UA3A 4IW4C 2YKLH 5D4QA 2XUWA 5J1SC 1J0ZA 4YLQT 3QUXB 5LBVA 3VU1A 5EUOE 1ZHLA 5DK2B 2B59B 3RJQB 3P73B 1C8QA 1QPKA 1J8HE 1FAIL 4EKXA 4XMLL 1UOKA 3GUFA 1XF4B 1P4LB 4FULA 5IVXB 5GGSB 1T4KA 5FYKD 1AZBA 4BFJA 4O2FA 1LEIA 3E6HA 3GXFA 1M2OA 5E1HB 3CU1A 4ZFOA 3NSDA 5IR1B 2VABB 1PZAA 3MRQA 2APBA 3CFDA 4K8RL 3E8VA 1NBVH 4PR5A 3FO1B 4A2HA 5KYUA 5DC9B 2QPEB 1CDIA 3T0EE 1NEUA 4JS7A 2C3GA 1BZ7B 2Q8BL 3LSOA 1T5KA 2NY1D 3GZQA 4ODWB 1ZLEA 3HJEA 5KOMC 3UJTH 3W0WA 3VYNA 4U6YB 2FB4L 4KI5E 1RZPA 4JREB 5SWZE 4PI0A 4G83A 4TNVK 3PWVB 5D1QB 2DLGA 4D9QD 5KAQG 1WFNA 3G04A 5F1NB 3BSZH 4FQJL 1WYJA 4JDEA 4JFPB 4EAEA 2GAZB 1JHTB 4Z3JA 3DGDA 3GK8L 3K72A 1ECZA 5DA4A 3BSGA 2AC0A 4L4TB 5B8CB 2XA8H 4ZMZA 2C3XA 3FQNB 1N6UA 2VAAB 6CGTA 1D9KB 3QWOA 2OJEA 3HVDA 2GCYA 2H1XA 4HIXH 2IGTA 4PP2B 2FHFA 2MKLC 2Q5BA 3WFEL 4MMXC 1QEXA 4EN3B 2GG1A 2BSTB 1K5NB 2KLSA 2Z6FA 4MCMA 5E4AA 5KVDL 4C56D 1JK9A 2ENJA 1A3QA 3VFNA 3MC0A 3N85H 3VWKD 2DN7A 1OM9A 5KN5A 3PREA 2H5UA 3DTDA 1YEHL 2A6IB 3X14A 5IWLA 3CZSA 3RIAF 2Z91B 4LCCC 2VB5A 2IGFH 3OGCA 2P49B 2Y07L 1PSKH 1QFWM 5HJ3B 5L88L 1AGBB 1ZCRA 3N42F 3WI9A 1QFOA 4HKZA 2PW1B 2WTPA 1U30A 4Y4FB 3I3DA 3REWB 4WV1C 1FCCA 2JKIS 2H6PB 5DJ6B 5D6DA 4DCQA 1CF1A 4MMZB 2X6VA 5AVVB 3UYPA 4CVZB 1LO4H 1A6VH 3ILPA 3LRGA 4LLDA 1BVKB 3G6JB 3HNVL 1A3LL 4YHOH 4G43B 4X4MA 3DHPA 1JF6A 4Y9BA 4GJTB 5E00A 1MRDL 5CP7B 3Q2WA 2R1XB 1HINH 3IAGC 4BH8B 4H7VA 4RIRA 1KJ3L 4JKPL 2ED6A 4ZUVA 5J6SA 1XF2A 1G84A 1FV1B 1XGPB 3AXLB 3N3EA 4PRAB 3TN0A 2OMNA 3L5HA 5T33H 3RIFF 3UROR 2ITCA 3D39D 3QJQB 2YGQA 4HHGA 3D3VE 4IYKA 2JKLA 3EYUH 5I1HL 1YYML 4PJXB 1EEUA 2VYRE 1ICTA 1CU4L 4GNKB 4KWUA 4DEUA 1GR7A 1IM3B 2QMKA 3IKKA 4B5EA 3HPLA 2WJ5A 4L9LB 1A6UH 1AE6L 5CJBA 3PJSA 4DGYL 1ODUA 2HJKB 2J8UF 2BNQE 1E2ZA 1KXTA 2Y7QB 4OTXL 1ZGLP 4FTDA 3GMNA 1D5XA 1HAUA 1NGWB 4TM9A 4YPGB 1ZLUK 3TT1L 5E6ZA 1B3JA 3GHEL 4KVCL 3C6LA 4DKEL 4M1GL 3NSFA 9PCYA 3DX9B 1TZHB 3QUKB 4HJUA 4LSUH 2FJUB 3OX8A 4HS3A 5ETUA 2KQNA 4XZUB 3SE6A 5JOPD 4PW3A 3WY4A 1WQVT 3RU8L 4MJHA 4ZG1A 3EJJX 1CGUA 1XH2A 4EVNA 1IB5A 1HU8A 5DURD 4NN5C 1L9RA 3DK0A 2LU4A 1XGZA 4UZUA 2Z4QB 4PIBA 2XYCA 2YFOA 1M05B 3WJJC 2IADA 5GGVY 4S1DC 3S35L 4K5PA 3BP6A 5HVHB 2H26B 4NUJB 5J7CC 1FO0L 4GH7B 4PRPE 1U91B 2NW2A 2CDGA 3DMMA 4HWBH 2JLPA 4P46A 4RGNE 4AUYA 5HYSA 1T0MB 3TH3T 2DYPB 4MNHA 5DUBB 5BS0A 1I7ZB 1G7MA 3U6XS 4DP1X 5BO0D 3BAXA 4PJ9D 5DRNA 1WWCA 4LSTH 2B2XH 1GC1H 3ZTJH 5MEPA 1MNNA 2YIHA 1UURA 4RX4A 3BUPA 4PW9A 3BVVA 5L6YH 1MWAH 3I50H 4IKKA 1H19A 5IMMA 1G7HA 2FGWH 1MPAH 3SDAA 3V0EA 2YBRB 3GMRB 5CZKA 5H2BB 1P7KB 3ARFC 4OJEH 5D1XB 1H9VA 1CTNA 1KN2L 2PXYC 3GSNH 4NUGH 4R5TA 2E56A 1RFDH 4KZEL 1Y18A 4P48A 3FDWA 3T0EC 3SYOA 2DM7A 4LSPL 4AEHH 4LQ1A 1A9EA 1CMOA 3NMEA 3BAIA 4N1CA 2J57A 5DVLA 1SLVA 1ACXA 5HDLA 3QT2A 5E5LA 5SWSE 5L4IA 3ZZSA 4LVNB 3VI3A 3COOA 2EYRB 2RQEA 4JY6A 4OI9A 1HCFX 3ZSTA 1DEEB 3KDPB 5T5FH 2IV8A 3DTUB 4TQPA 1FZMB 4YDNA 4PUBH 3B9EA 3MCG1 5C2UB 3L54A 4OUUB 3QNXA 3HI5L 3P9MB 3QEHA 5DMKA 4P23C 2KZWA 1S9YB 3CC1A 4LRNL 4J3BA 3BUBA 1N2RB 4JVPA 1PYWA 1RK0A 3DX8B 3T8VA 4B5ZA 4XO5A 2X41A 4TQEL 5C0DA 3KPSA 4AENA 4JM2C 2AV1A 2HG5A 4I9WD 3EUDA 3PAUA 5ABAA 2A9ML 3B9KA 4PJDA 5DQ9B 5T1MB 4CDGC 1WS8A 4Z7WB 3KXFE 1Y07A 1I85A 4I2XB 5ELIA 3O4LB 2YRBA 2BNUA 1KCUH 5DRWB 1YUHA 5JW4Q 1NL0L 2FJFA 5IP4A 4U1JB 3EKCA 2Y9RT 3PAZA 4PLJD 1BM3H 5EU5B 1JVOA 1MVUA 1YO4A 4WDIB 4M5YL 5DHDA 3FT3A 5F6HJ 3SJVE 1ZWIA 4E41A 5AG9A 4TQ8A 2WCGA 3LKPB 2C9QA 3HOGA 4HV8A 1WBYA 4EE2A 3X11A 5DUMH 2AJSL 4OFYA 4N8VG 1AGEB 2BFGA 3CFJA 3NIDF 4JKMA 1KGXA 4RBPK 3WN6A 5J89A 1WUZA 2YJLA 2O93L 3K7UA 3PWPA 2FHCA 4OUOA 1Q94B 3TVMA 5F9JA 3WFDL 3KPOB 3WKNA 2IJ0C 4X6BB 4PRHA 2DMBA 4AM0Q 1XGUB 4Y5XA 5EDXA 4FCHA 4NN7B 2AZUA 1JPGA 3IPBA 3WIIH 4AZUA 5CIPH 5EU4A 4AMKH 4N2CA 3CVIH 2NZ9D 3JSSA 3L3HA 1BWMA 4KX7A 4N0UA 5FECB 1TQCB 1QW8A 2KLTA 1DQML 1U8PB 1ACYH 4B9ZA 3M17B 5HD8C 3MLXL 2ZKWA 3C9NA 3HMXA 3O4OB 4ACPA 4QHUA 4HD5A 5IB1A 3BPCB 4FJZA 2AXWA 3N9GL 4PWJA 5LBSH 3RWHA 5MHSE 1IRAY 3FONB 1HHHA 2CKBL 4J3OD 5DRXA 4L0ZA 4E2OA 1FZJA 32C2A 5J13C 3DYPA 2J1YA 4Y19A 1P1ZB 2AEQH 3GBNH 4IIZA 3KH3A 1IFHH 4G7YL 5BV7C 2GJ6E 5BZWB 1JPSL 1I8LC 2PWGA 4JDTH 3P11L 3UAJA 3HAEG 3ZTEA 4S1RL 3BHBA 3KM2A 4X6FB 2XXGA 1DP0A 3KHQA 1UEMA 3WDJA 1QSZA 4ETQB 5LQBH 4DFHA 2VR8A 4Z3FA 2VZOA 2HX8A 4R7XA 3KYNA 3MLRL 3Q5YA 4JO8A 3KPRA 4MJIA 2VIRB 3EGXA 4PD4J 3ZE0F 4AL8C 3MLYL 2NXZB 5D8JL 3UDWA 3T1WA 3WU1A 2EH7L 1I3GH 4Y1TA 5E6IB 4MD4A 4MWFB 4Y7MA 3LD8B 3V5KB 3JWNE 5HI5D 4Y8AA 1WF5A 5KSAA 3DHUA 5F6IC 2EUXA 5C07E 2DQUH 5E2JA 2JKXA 4XTRC 5TH2A 5BV7L 4RGNC 4J4PA 1SXZA 4Z7VF 2Z93A 5FKPA 5GGRA 4HC1H 4LPYA 1FNSL 4NENB 3T4AC 5IMLB 3U0PA 3EYVB 1A4AA 3QWRD 3MLWL 4L8SA 1JDAA 5TDNB 2LFEA 1ZPUA 1OXYA 2X9XA 4X99A 2OJZH 2GTZA 1GGTA 5CN2A 5HPOA 1A1OA 3BQUC 3MV01 4UZSA 1IJNA 2K8MA 3GJFH 4AL8L 1SDYA 4WWPA 3LRSB 1I8IA 4PRNA 5E2TH 3KHOA 5EO1B 4B9YA 4H2AA 2J4WL 4Y1AB 4QXTA 1MJJA 5BW7A 1FORL 2JQZA 3SBPA 1KTBA 1JG9A 2X6BA 3U82B 2VXQL 2RR3A 4PGZA 2DQJL 5HYFA 1W91A 4IHOA 2ENPA