2BSED

Structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
VQLQESGGGLVQAGGSLRLSCTASRRTGSNWCMGWFRQLAGKEPELVVALNFDYDMTYYADSVKGRFTVSRDSGKNTVYLQMNSLKPEDTAIYYCAARSGGFSSNRELYDGWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcal Bacteriophage P2 Receptor Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Lactococcus virus p2
molecule tags Receptor
molecule keywords RECEPTOR BINDING PROTEIN
total genus 26
structure length 122
sequence length 122
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bseD00
4WNQB 1E0OB 2P42B 1INDL 5JHLL 1R3JB 4FA8A 4U1NA 1A4KB 1J1PL 3SJVE 4O4YL 3MJ6A 4EOWL 4KJYA 2Z8RA 1HSBA 1MFCL 5EC2B 1FNHA 4XP5L 4XPTH 3S7GA 1KB5B 2N1KA 3UTTB 4HHAB 1ZA3B 4MDIA 4WHTA 3VFRA 1S9KC 1EUTA 2W65A 4XVTH 2FJGA 4RIRB 3H9SB 1MCJA 5KAQF 3RL2A 1SMAA 3HZYB 2AQ2A 3HPLB 3QCVH 4U1LA 4P2YA 5DJZA 3V6OE 5D5MF 3CVHL 4G7VH 1LP9A 3VRIB 1N5AA 1NGPL 3TJHD 3QFJE 4IRSC 1FLTX 2MWCA 3JXAA 4JFYB 2ED7A 4JPIB 4L3CB 3WKML 2VABB 4DGIL 3BYTA 1I8LC 5KSUB 1QFUL 4NQDB 3W9DB 1VERA 2E9IA 2J88H 3Q0HA 2C3XA 4K55A 4N5EC 1NC4A 3V6ZB 3UZEA 2BK8A 1HQ4B 3NFNA 3HZKA 5KW9H 4PJDB 3BPOC 2NY7L 1RK1A 4IBLT 4I18B 3REVB 1QSFA 25C8H 4NWTL 3VJ6A 4O2EA 1WZ1H 1IM3A 5D7JD 4YK4B 3B4NA 5DRWB 2AK1L 2BSED 4F9LC 5F7YC 2Q7YB 2D7MA 4OB5L 4NRZA 5FIEA 2GJ6A 3K1KC 4J4PD 3MRHB 3LS5H 3F5WB 4JKWA 4X7TA 4JJHA 3SJVD 3E1F1 1CGWA 3WFCH 2JELL 1JF1B 1MQ8A 1QACA 1HWHB 5GS1A 5MEOB 3X13A 2KPNA 3GKWL 3IFOB 3IGAA 1E28A 2BVUA 4ZUVB 4AK1A 1I1FB 2NY1C 2CUMA 4LKXA 3VH8A 2XFXB 3TLRA 4ELME 4GSDH 1S7VA 1XF3B 3BDYH 4RDQF 2PYED 4IRJD 1LK2B 4MNGA 4OCRL 3W0WB 4UQ3A 3N85H 3IU3B 1VEPA 1CDUA 4KK6C 3VXQA 2PYEA 2JJUA 5I8EB 1OSPH 2CLRA 2EKJA 1AQDA 1P4LB 1S8DB 4NYLA 5ANMA 2BVPA 1KEMH 1BLNA 5IBLC 1S7QB 4O00A 4AT6B 4U6YA 4HWNA 4UNVA 5BJTB 4K71B 4FXGB 1SEQH 1A1MB 5I1AA 1X5KA 1HINL 3BWAA 4XRCB 1KULA 3LHPH 1IZKA 1HDMB 3ME0A 5CMAA 2VR4A 4HX1B 2HT3D 4A2LA 3KYOA 1FJ1A 5DO2C 4O2CB 1CI5A 3VXNB 2I26N 2X4TB 1JE6A 1YYMH 2DI9A 4HPOL 4JDVB 5MENA 4OGAD 3IB4A 3KDMA 2AEQL 2VXSL 4ZQKA 1T04B 2CR3A 1DP0A 1DQTA 2HFFA 2JJWA 4XP1L 5E8OB 5IM7B 3ZSSA 1AIFB 3GSNH 1NMBH 2FJHB 4LASH 1N64L 4P59L 4B53A 1J05B 3FB8B 1D6EA 5J0BA 2BHYA 1RZKH 2BVYA 3MLRL 1P6FA 4ZG1A 4WW2B 2E7CA 4RX4D 1F4WL 2X9YA 1KCRH 4EI6A 3NCYS 5IHZB 1FIEA 2P5WA 5CBEB 4F7PB 1NAKH 4NBXB 5E99H 2ZNXA 3MREA 5GHWH 3PF2A 3SOBH 3IDIA 4HKJA 3ZDXF 1NSNL 5SX4I 3C60A 1KTLA 3MA7B 1B9ZA 3PNWA 4EBQL 1A1OA 2DQJL 5CD3B 5J12B 3V6OA 1IEBA 1YUHB 1TZGL 3L6FB 1FCCA 1MIMH 3VFTA 1J0IA 2AQ3A 5C0BD 4Z77B 3FQRB 2Y23A 1IARB 3QCUL 4MA1B 1YQVH 1FFPA 4KVNH 5ICZA 1IBGL 2OXGA 3LN9A 3QEGL 5JOFB 3SQBA 1JTPA 4JFPA 4OLYH 3OMZA 5F72S 3FQTA 3RHWK 4HEME 3W39A 2LTQC 2FBJL 5I15H 3GJFK 1B4JL 3DMMD 3BEWA 2DIAA 5JHLH 2IALB 3SE8L 3MQIA 5EB9A 4O4YH 1U8OA 1KYOJ 4H25B 4N9GA 4L3ED 1A3RH 4LVEA 4JO3H 4HC1A 4WU7A 4XPTL 3V0AC 4EIZC 1BIIB 1TJIL 3QNXB 4PJAE 4PTTA 4CVWA 5DK2B 1F13A 3S8WA 3C6LD 5TDNB 3IDGB 2OJEB 4XVTL 3WS3A 3QWOB 4P2QD 4NKOB 3MRGA 2NXYC 1KACB 4XXCA 4F9PA 5FUOH 4LPTA 4YWGH 1I9RL 4DW2H 3GDBA 4LCYA 2NNAB 2VL4A 3GB7B 1NBVH 4KI5E 4U33A 3QHFH 3Q6FA 3QULB 4POZD 4BFBD 3PWVA 4YIQB 3I84A 5L8LB 4LEOA 4GRWB 3WMSA 4PP2B 1J0HA 3JBG7 3JWOC 2CK0L 3QXTA 2J88L 4X9FA 5D2NB 2HMIC 4TNVF 2WUCH 1XCTA 2MPAH 4W4OA 1B4RA 3QDGE 5KW9L 3SKJH 2IAMB 5IW3A 2APVA 1Z9LA 1A6UH 2E27L 2R2CA 2F54A 3O2WL 5IMLA 1MFEL 1S7WB 4NNYB 5A43C 4X4ME 1X6NA 1BBDH 4Z7QF 4BZ1H 4FRWA 2GCYA 4Z7VE 3E6HA 3L3HA 4HK0A 3KPSD 3ARFC 3DV4A 4MLSA 1HNFA 1HKFA 2V5MA 4J8RB 4R3SA 5I1LB 4YX2L 4LLWA 3CMOL 2QR0B 5D4QA 3VMNA 5BO1H 2UZXB 2AEWA 4XBGA 4LBEA 3VXSA 1BOGA 1G0YR 4PJIB 5C09A 2EIZA 4NC1E 3ROOA 4LLAA 3P2TA 3SDXB 2GIYA 2CMRL 3JV4B 5HYQA 1EFXD 4M00A 2CGRL 3QEUB 4U1GC 4FXKB 3VI4F 1F3DH 4OZFG 1HQRB 4H8WC 1NCCH 4WUUB 3T0ED 4PTUA 5FUCC 1RUQH 2AXHA 4NO0D 2OP4H 5C0EB 5IROA 1KNOA 2L7JA 3VXPA 2JLLA 4U1MA 3LMJH 3ZHDA 5GRXG 3VRJA 5IHUL 4FG6D 4XNUL 3BN9D 2VZOA 4XWGL 1F97A 5T1LB 2VLJE 5E8PA 4BYHA 3BRFA 1DQMH 4H20L 3O9WB 2QSVA 1R5WB 1KIQB 3O45A 2IBBA 5CIPB 3QDGA 1RJZA 3RVVC 1D9KC 1U93B 2VDPL 5EOCH 2OSLA 3G6JB 1U2CA 4EDXB 4HPOH 3OZ9L 2ICWB 2OTUB 1CL7L 2PTVA 1T22B 5EOCJ 5KS9A 3MGTB 5LG1A 3D85B 3HNVL 4M6OH 2A1WH 1JZ8A 5HDQL 1EGJA 3MACH 2RR3A 3NPSC 4JM2F 4MQSB 2HJLB 1UEYA 1NMBL 4LASL 5F9DC 2HT2D 3PJSA 3BO8A 4UMGA 3QIWC 3OGCA 3D0LB 2Q8AL 1YC7A 2AK4A 4FQLL 1I7RB 3HUJE 5CSZB 3G9AB 4PJBB 4MA1C 3DTXA 2JTDA 2WM0A 5BS0E 2WINB 2DJ4A 3GJEA 3MLRH 4OF6A 4LMQI 4HKBA 2ICCA 3KXFD 2OQJA 4OGZA 1CLZL 4MJ4A 5HGDA 5D2LA 4YHYB 5IKCA 4CJ1A 4U1SB 2AEPL 3R06A 4FQ1H 3VA2C 2YWYA 4GKZB 3ULUL 3NBNA 4HLZG 2OTWB 2IBGA 4S11A 1FPTH 2P8MB 4PJ7E 1NAKL 2NQCA 3VGHA 3RWIA 5IFAH 1D5MA 2ZSWB 3RP1A 1Y18A 1S78C 4H1LB 4OLZL 2ATPA 3VXMB 3GGWA 5DQJB 3MGAA 1IL1B 2O5YL 4OLVH 3JZ7A 1N8ZB 3O2DL 4YHYC 1MIML 1F4HA 1L6XA 1XGPB 2OR8A 1KXQE 2ZOLB 2K1MA 4GG6B 1YQVL 5F3HA 4FABL 5TDOB 2VXVH 4HK3N 3IVKB 2XWBA 4ZXBC 5JORA 3QQ9C 5ESVB 5GGUA 2FEEL 1CYGA 3D39A 3WSQL 4D8PB 3I75A 4IOIB 2UUDH 4I3GA 2FBJH 4GAJL 1B4JH 1HNGA 4Y4HD 4RZCA 3BSZL 4CNIA 2XT1B 4RMVA 1IGMH 3KPPB 2DTMH 1JYNA 3BH8B 2DLTA 3I3BA 4LQFL 4OAWA 4NZRL 2VNCA 3OJDB 3TA3C 4MDJB 4RCAA 3AUVA 4KK5C 4EVNB 2WWMD 4OSUL 5L2KA 1LP9F 5DWUL 3RKDC 4L8DB 3IFLL 2AV1A 4LHQB 1IM9B 2H2SD 3KXFE 4YNYA 5F88B 2YHGA 4BUHA 2JJVA 3B8YA 3ET9F 4QOKB 5A3IC 1ZT4B 4PRPB 1T03L 1IFHL 1LEGB 1I9RH 3GSRA 4M1CD 3VGBA 4DW2L 1NUFA 3UTPD 3HG1D 2PW1B 4YH6A 2ADFL 5GRUH 1JJUA 4QY8B 4Z7OE 5D8JL 3MLSL 3DI2B 5DHXB 1SYVA 3IDXL 4LNRA 4XCFH 5DJDA 4LPWA 3Q1SH 3UDWA 4DKAA 2CK0H 4KJPD 3ZKXB 3CSYB 4WI6A 2VXTL 4HUUA 2HTKD 1AFVH 4JR9H 1UWXH 4KHXH 1S7SA 4NFDA 4JQVA 4JFXB 5JZ7C 1CD1A 4NOFA 4EQ2A 4JKLA 3O2VL 3IKCA 1MIEL 5D1QC 3MV11 3RRQA 2BNRD 1H5BC 4D0DB 4M1DH 5EO9A 2VLME 2IPTL 5A1AA 4IMKA 4Y4HB 1TMCB 3GBML 4PS4H 4F37F 3CMOH 5FV1L 2R0KL 4Y4FC 1KTDA 4FS0A 4JO4H 5DR5H 3H9SE 4JJ5A 5DEFA 3MUY1 4QHLB 4HF5H 4XHQA 4E41B 3QPXH 5DZNA 3QNYB 3HG1E 2WQ8A 4H88L 4OBSA 1J5OH 3ES6A 4QRRD 4Y19B 3VXMD 3K0WA 3O11B 3UJJL 1N26A 3O0RH 4X8JB 4OLXL 3U48A 4ALAL 1K8DB 4PG2A 2EDEA 2R9HD 5DUML 3BT2H 1NMAL 3OB8A 1DE4A 2AJVL 3BZ4A 5D71H 1AC6A 3VFVB 3WUWA 3MRBA 4LCUB 3IKKA 5E2JA 5C08E 2OZ4H 1HK6A 5GISL 3AREC 2DM3A 3C87A 4NQXB 4PRHE 1DQML 4H20H 1EO7A 1MJ7H 4JQXA 1ZHBA 2PXYA 1RUML 3AU1A 2YD4A 4PREB 1T83C 3CXDH 4HW6A 3HNVH 1OWWA 2GQHA 4WO4C 2DICA 4ZXBA 1I3UA 3I6KB 2W9EH 2A77L 5L8JB 1JWUB 2VO5A 4DGYL 4BJLA 5GZND 4JKPL 5KSVB 4UZGA 4BH7B 4DVBB 1N5YL 3KPRD 2R69L 4OV5B 3ZYZA 4M4PA 1F58L 3MRQA 3SBWA 3MV8D 2DQUH 4PJ7A 4I3RL 1T2XA 3RY4A 4UB0L 4ZAKC 3OQ3B 3ARDB 1C1EH 1FPTL 3S35X 1NEZG 1IC4H 1RJYA 5BS0A 8FABA 3HZMA 2FD6H 3BGAA 3DHMA 1I3GL 3TO2A 1EUUA 3TT3H 4ZPTA 1EJOH 5DJ0B 4TTDC 4Z0XA 3O2DH 3GK8L 2C4FU 1PSKL 4ZUTB 4WFED 4OZHB 1AD0B 5F44A 5GGRA 4ZO6A 3V5KA 2FCBA 4LLQA 4S2SA 3VWJA 3BGMB 5IMOB 4HKZB 4PRHD 2AJZA 3V7MA 32C2A 1J8HD 1DR9A 5GS2D 5T3XD 5EUKA 3TWCL 5IB5A 2XN9E 3WUZA 2DQDH 4ZFZB 4NRYB 2IGFH 43CAA 3RFZC 3ULVC 3LKSB 2IPUG 2YOCA 5DRZA 1OAUH 4YEFA 3GEWB 3MRPA 1JHTA 4GAJH 4MD4A 2DOCA 5JA8B 2WZPD 5FECB 3X11A 3HRPA 1MI5B 3E3QC 4OCWL 2DTML 2F54E 3OAZH 3S3PA 5J13B 4L4VE 3TPKA 1CICB 3T0EA 4QHMB 3VXUA 1MAJA 1ZT1B 4QRQB 3SDCB 1U91B 1K2DB 4MAYA 4K2UH 4P2RA 1VFOA 5F93C 5DWUH 4F57H 3UMTA 2DYPD 2A9NL 5EU6B 5FB8A 5ICYB 4ZOBA 5EIIA 2DJUA 2XACC 3S9DB 1NBZB 4Y4FA 4N90D 1ODAA 2EO9A 3QPQD 3MLXL 4RFNB 5HGGS 5JHDE 3EDEA 4P57B 4MJIB 1IRAY 1QUNA 1VKXA 1QSEA 4FFYL 1D9KB 1CXEA 5LWYL 3SDDB 4XCFL 3ARGC 1UCBL 4Z7UE 4MWFB 5DYOA 4CMHB 3EOBB 3WS6A 5DDHB 2BSSA 3S5LA 4GBXD 2QQNL 4LARL 3S36X 4HDIB 1FDLL 5DVOA 1K8IA 3K1DA 1GC1H 4PJCB 1J8HE 1AFVL 1UZ6E 3JTTB 4FG6C 3NPZB 1I4FA 2APTA 5I1CL 4ENED 4I13B 5ETUA 4WU5B 1BFTA 1D7FA 1FP5A 1S3KL 3BH9B 3ZKND 1RJLB 4X6EA 1DQLL 3WHXB 3V52H 5KN5B 1KGCD 2P8LB 5D7SL 2R1WA 3S6CA 2IPTH 1LDPL 2DQGL 1N6QH 2EYRA 3EOBA 2BOBB 4E5XB 2CDGB 1ZVHA 3A6BH 3EFFA 1FVDA 1KLUB 4P9HH 3SDDA 2OK0L 2B4CC 4AEIL 4NJAL 5E8DL 5IVXA 2FX7H 2DJSA 2FX9L 1OF2A 3OAUH 3QUXA 4OZ4B 4NN5B 3LDBC 2YSSA 1D5IH 3N1PC 1AXTH 4Y4FB 4M43H 4JN2A 5MENE 4KMTL 5EIIB 2VITB 4Q9RL 4OZGB 1CTNA 2J8UF 1QQDA 5C07B 1NUNB 4H88H 1J5OL 5D1XD 3TYGL 3LD8C 2C7UA 3O0RL 2DB8A 4HZLA 2VR5A 4P4RB 1CZ8H 2DM2A 4LHJB 2NY6D 3PDOB 4LAQL 1Q1JH 3QUYA 4JFHE 4KRPD 3BP7B 1CICA 4ZMAT 3LRSA 5DMYA 4UTAL 4PRIB 3MUJA 5EFIA 5ACMA 5D2NC 4DTGH 1INDH 5HI4C 4LHUB 4QTHB 1MWAH 2PYEE 2YUZA 1X9QA 2ZUQB 4MJ6A 3BKCH 1T4KB 35C8H 32C2B 3MBEC 5IMOA 3BGMA 2Z31B 4GKSB 4OZHA 2D4DA 2NXYB 2A77H 2W9EL 5E8NA 3DRQB 3BIKB 1UYWH 4JKPH 3BP4B 4JM4H 3AS2A 1BVKB 4L4JA 1RZJL 1FFOA 1WICA 4PV8B 3HZMB 4HKXB 1R3LA 3C5JA 4PJ8C 2DQEL 3NOIA 5EIQA 5M94B 4JZJB 3D48R 5ADPH 1YEHH 1AQKH 4IRZH 3RVXD 4JY5H 5FO9B 2VDKH 5EOQH 4WEBH 3SE9H 1YN6A 2HFEB 3KLAA 3WFDL 5A3ID 2I60L 2YPKB 4XC1L 3D39E 3S37X 1MCHA 4NO2B 3L7FB 2FD6L 4DVBA 4PV9A 4XH2B 1OTTD 3WFBH 3KYMB 2FBOJ 1EAPA 1EHLL 1AHWA 2EYTB 5E6IC 1WVZA 1HI6B 5F9JA 4P2OC 4ZXBB 3VRLE 3F6LA 1WCBB 3L3IA 4XX1G 1T20B 3BUYB 5I19L 3CUPA 3GSVA 1HHHA 4KFZC 5IW6A 5T33L 3T3PF 2J5LB 3C5ZB 5FM5M 4GW5B 1OGAB 1KN4H 1ZHBB 4KTEL 3WIIH 5GS0D 5FYJE 4WY7H 3ILPA 1N2RA 3PUCA 3AS1A 3QUYD 5HSFA 4TRPL 3UPRA 5JW5B 3T2OA 4OCWH 1FZJB 5KANG 3CFCH 5ERWB 1JWMB 3GNMH 3WO4B 4YE4L 4MCZA 1RK0A 2J8UE 1CE6A 1DE4B 1HCVA 3KPLA 3SCMB 3O4OC 1B0GB 2IANB 3BDYL 3OKYA 3O11A 4F57L 1P7QB 2X4NA 4JRYB 3QNYA 2UZIL 3JV6A 2H2SC 5EUOB 1T1XB 1OSPL 1PD6A 3MA9H 1KT2A 3KGRA 4XNXH 5DK0B 3RIFF 1Q9WA 5DURB 1ZLSH 3H9HB 3MNVB 1CLYH 3QA3B 4C4KT 5LGJA 5DT1L 4ODVL 4N0CC 5TE7H 1L0YA 4GUPB 4NQVB 4NPYB 2A74A 2J6EA 2F53B 1HINH 3A67H 5E1AB 4U6TA 3MLWH 1RZGB 4PJEA 3FQWA 4U4BA 3RUGF 2IPKA 3MYJB 4PJHF 5DVNA 3PQYE 3MJ8B 4OT1L 4OLWH 1BVLB 4P2QE 2ITDB 3TNMA 1IGTB 4P23D 1X5ZA 2HTKC 3WKNA 2QHLA 3S35H 5E4EB 1FNEA 1P4BH 4KY1L 3JWDH 1X5XA 4JM2A 2DIBA 4DN3H 5IB1B 4YPGA 4XP1H 4ETQB 5FYJD 4F15C 4KI5D 1N59B 1PBYA 1QSFE 2YRZA 3GHBL 2CJUL 4M7KL 5BXFA 1JTTA 3MRNB 3GMMA 3ZL4L 1F2QA 2F5AH 5D7IB 1T80A 1QLFA 5I8OH 3H42H 4G6MH 1UACL 3NIFE 4PJFA 3MCLL 3RWFA 3T4YA 4Y4FD 4AEIH 4NJAH 5E8DH 3QDGD 4JE4B 2RAMA 3LRGA 3D0VB 2FX7L 4QRPB 1S5IL 5D5ME 4RMWA 3FB5B 5DMIH 5HDBE 4LCWD 5GHWL 4ZTOH 4BKLA 1D5IL 2WANA 4KRLB 4Y5YA 4M43L 4KDTC 4L4VA 4ZTPL 1PW3A 4YDKL 1LMKA 1C7TA 3KPQA 4Y7MA 5J11C 3BXNA 4AQOA 2BCKB 4RMRA 2V9QA 1TZGH 5DEGB 3MV9E 3TF7C 1CZ8L 4NO3A 3F7VB 4YBQD 3MXVL 3SE3C 2ZG2A 2KQMA 3RGVC 3QIUB 3K2UL 2NCMA 1CGUA 2VZ1A 4F7MB 2ENYA 1KIPB 4JLRA 2EDJA 1NFIB 1QBLL 2ZJSL 4FFVD 5I15L 3RZWA 2BJMH 4KRNA 3CSBA 4P5KB 1J0YA 4XPBH 4L29B 4JFZH 5IMKB 5GGUB 5ESVA 1KSRA 5IMMB 3T4AB 2Q87A 4IRSD 1Q72L 3RBSA 4QGYA 4ZYKA 2ZUQC 4Z7WA 3BRDA 4PLJD 4C55A 3G04A 4ZFGL 3MRLA 1A14H 4KK6D 1TJIH 1XGPA 5EU3A 5EDXA 1FN4A 1XIWA 2CKBB 2R2EA 1B2WL 3RKDD 2GUOA 2ZG1A 2GSGB 3O41A 1NGWA 4NM4H 1WIOA 1YEKH 2ATPB 5IQ7H 3U2SB 3FHAA 1CFQB 5K9OB 1U8IB 4O9HH 4M9OA 2ZCKL 1TTUA 5ADPL 3K8MA 1AQKL 3R06B 4JY5L 5F7DB 1QSVA 1G9MH 1MCOL 1DTUA 4W81A 1INQB 2DKMA 3WFDH 1QLRB 2YD8A 3T0VA 5I74C 1AO7D 1AGDB 2YEZB 3LDBB 1ZLUH 2MPAL 4YEEA 4RMSA 2GTWB 2E27H 4M8QA 4RWHA 4MS8D 2CRYA 3I3DA 2O61B 1BBDL 1CGTA 2J2ZA 4RMTA 1DBKL 4H0IA 4G8EB 1U41A 2ICWA 2VXQH 5T33H 3QUZD 2XKUA 4P46C 1U93A 3L5HA 1QFWL 2PNDA 1AD9B 2A6KA 4C58B 1U8PA 4J3UA 3FO2B 1V05A 1W8OA 2NXYD 4TRPH 3VXME 3EYFB 1XFPA 4F33B 5C9KA 2RFXB 3N50A 5HPMB 5FKAA 1C16B 3DO7B 1BREA 5DK3A 2ATKA 3E3QE 4K8RL 1H15B 3WXWL 2BY0A 4OUUB 3FT3B 3KXFB 4JDZB 5I73C 4IM8A 5ID0B 1NBYA 3ZDZE 2BVQA 2IG2H 5C0EA 2WBJC 2JKXA 3FHQA 1KJ2L 3J8F7 5DHVB 4PJDE 3RWGA 3CLFH 1HHJB 2ILLA 2R0LH 3DXAB 4X83A 1PGRB 4XP6L 5CJOH 3HR5A 3IFPA 1ZLSL 5EBWA 3KAAA 4NO5A 4WW1A 4UU9A 5DT1H 4EI5B 1FG2A 1AO7E 3SDXA 3N1FC 2V9TA 1ND0A 5F9WC 5IEHB 3AS3A 1I8KB 1ERNA 1UVQA 1BOGB 4PJIA 5C09B 3D2UD 3OJMB 4KUZL 4LBEB 5E08H 1RY7B 1F4YH 3ZE2F 5C0RH 4EZMA 4TSBL 4LLWB 3MLWL 4MGXA 1MRFL 2NY6C 3SDCC 2WK2A 3KPRE 3A6OA 5TE4H 3L3HB 5IR1A 3MV8E 1FC1A 5I18H 1WWWX 4JFDD 1PY9A 2DKSA 1RJCA 2A1WL 5IJVB 4Y5VA 3UTPE 3PWNA 4I0KA 3MACL 1V7NL 4RGNE 4BSWB 1Q9OB 4HIIB 1XGUA 3MUHL 4OCXH 4BZ2H 5FUCE 3CCHA 4Z7WF 5CBAB 3L3GB 1I7ZB 3AB0C 5SWQA 5TE6H 2F5AL 2PXYC 3MUGA 2JIXB 4MLIA 4JVWA 1DN2A 4UUJB 4WFEE 4JAMA 3T65A 1CLZH 1ZVSA 1JBJA 1MPAL 5I1GL 1H5BA 3PWVB 3ULUH 3HRZB 1VACB 2Q8BL 2V6HA 1XF5B 3PGCB 3HFML 1MLCB 4YFLI 5DMIL 5ESQA 5IFAL 2FYYA 3QFJA 3EFDL 4EI5D 2D03H 5LQBH 4D9RD 4OLVL 5KJRL 3IDGA 2IH3B 3MLYL 1JP5A 2OBGA 1RURL 1CVRA 2ARJB 2G75B 2EE6A 4G6AD 3KNBA 1G9NH 2F54D 4NUJB 5DFWH 4M7LH 2EO1A 1JCKA 4GT7A 2Y06H 4ONGH 1HHIB 1CK0H 4Z7UF 3ARWA 1HIML 1OAXH 3ZSTA 1FRGH 1JPTH 3BEVA 2YN3A 3BDBA 5D7LD 3QZWA 4JFDE 2Z8SA 1E4XI 3I02B 3MRIA 4KK8C 3QIBD 3PL6D 3BEVB 1Z9SA 4LQ1A 4RGND 1DQQB 4PGCB 4NZRH 4ELKA 1CD9B 1D3CA 4YFEA 5A16B 1MHCA 1X5LA 3V6FB 2Z91B 3FQRA 4XVSH 3QO0A 4Z76B 5L6YL 3VFTB 4LVNB 3N06B 2ARJA 2G75A 3CGTA 4OGYL 5C08D 3DROB 2CDFB 3H2WA 2Y4SA 3BMWA 1WIUA 2K9UA 1FGVL 5E1HB 4XZUA 5TQ0H 4HGMA 1HOCA 4G8IB 1T03H 3IDIB 4HKJB 4OI8A 5K9QG 4K9EC 4G8FA 1FL5B 2DMBA 5CBEA 4KK8D 3VRLF 1AO7B 4EI6B 5ISZB 4ZUWB 1ETZB 1EEYB 1RV6X 3MSPA 3HZVB 1OM3L 2Q76B 3FRUA 4JB9H 5B39B 2VXTH 2D7QA 1F5WA 4GRMB 3P9LB 1CQYA 3ZDXE 1XGUB 4LEXL 1RUAL 1KTKE 3CU7A 1A2YA 4MXQC 1UM5H 2GAZA 3F7YA 4HFUH 3HA0A 4ZQKB 1MIEH 2AS5M 4QF1A 3U1SH 1YNKL 3KDMB 1F3JA 3HNSH 4KK5D 4G3YH 5IR1B 3QI9C 4M48H 1QNZL 5ENWA 3EOYG 5HHXH 2X09A 3GBMH 2YA1A 4PJ5B 3P4OA 4PS4L 3RDTB 4EUPG 4ZNCD 1CG9B 3ZE1F 3U0WH 3RI5K 2OXHA 4P5MA 4R2GC 5F7EL 1WLHA 1YEIL 1KJMA 3GSQB 1A1MA 5I16A 5BJTA 1QR1B 3TIDB 4AT6A 3HG1A 3W9EA 2QV2A 3QO1A 2EH7H 4WI7A 3FB6A 3WXWH 2I07A 2IQAB 1H0DB 1MCKA 2A6DA 4TVPH 3CK0L 3TH2T 1HHJA 5KSAC 5C09E 3MNWA 5EH1A 2FL5A 3IFNL 3UJJH 4XAKD 2J4WH 2MSPA 4UOW1 2O26U 3LZFH 4XP6H 4LIQE 5CJOL 1NLBL 1QFHA 5CEZD 2AXFA 4BH8A 1ROWA 1J12A 1MHPL 4DZBA 2H8PA 3RX7A 1BAFL 1U92A 1A7BA 5E4EC 4PGEB 3B2VH 3A6CH 4LCWA 5C0DA 4LGPB 5DTFB 1CGSH 1RU9H 1AXSB 5E2TL 3MZTA 4GW1B 5DMJB 5ICXA 1A7PL 2D31B 2A6KB 5HYSG 1RUMH 2LABA 3RWJB 4R26H 4QXUL 1WCQA 4PJHA 4PRBB 4C54A 1IMHC 3C8HA 3PV6B 2VOTA 5TH2B 5HVHB 4N90E 3LV3A 5TFSH 1CIUA 2NXZD 5T1LD 2O61A 3UC0H 4KK9C 4UI2A 4F8TA 2OCFD 4QNPE 3LQAC 5JHDD 3TBSB 4OCXL 3EO1A 3D39D 4PJDA 1IAOA 1NGXB 3NFNB 2V7NA 3QYCA 1W0WA 4KKNA 5LGHH 3ZLQC 2CKBL 1LEKB 4Y1AB 3KPMB 1MCBA 2BVEA 2Q1EA 1QA9A 1QLRA 3DXAE 1GAFH 1G7MA 2BP3A 3HE7C 3QG6A 5FDWA 3BZFB 2LVCA 3N1QC 3FFCD 2R23B 4Y2DA 1QBAA 5HHNB 4CVXA 5E5MB 3ARED 2DKUA 4KWUA 3HPLA 3HZYA 3EFDH 4L8CA 1RAMA 4OZIF 1GIGH 1WC7A 3H9SA 2BDNH 5EBLA 3O3EA 2GSGA 3O41B 1DSFL 1S9WA 4J3SA 3VFRB 4LLYA 3KLHC 1EHXA 1ZA3A 1EO5A 4YAQB 3QUXC 4HHAA 1RHFA 2Z4QB 3AROA 3IDUA 4XNQA 2O5XH 3T4AA 1CK0L 2DQDL 1QKZL 2UWEA 3PL6B 3QIBB 4P5TD 2UWEE 3RAJH 1YN7A 5IVXF 4PJGE 3WFZA 4Z7OF 5E6IB 3AXLB 2BSRB 3B9KC 3ABZA 4QRUA 4RAUB 5D1ZA 3KJ6H 3IAPA 3QIUD 2PKDA 4JFEA 1GHFH 5DVMA 2VKXA 3HMWL 1Y0LA 3H9ZA 1J0ZA 3T3MF 4YBLB 5C1MB 3C5SB 4CVZB 1WSST 3HAEG 3T1FB 5HYIA 1QBBA 3DURA 1IC1A 4N0UE 1YECH 1T3FB 4QRRA 3MXWL 5JLZA 5IB3A 4F7EB 3ZHLA 1AGCA 4RAVB 5C08B 2XPGB 4G43A 5J6HB 1OB1B 2YD1A 4P49A 4PRHB 2HLFD 5I66A 3KPSB 1FFRA 4PJFB 4KPHL 1UCBH 5DMGC 1TCMA 4X5WB 3TV3H 5H37H 2GK0B 3DV6A 3TN0A 3TVMB 4KUCD 4R4FL 4U1GB 3CFKB 2R0WL 3DNKA 1FDLH 3AAZB 4RMQA 3D3VB 5FYLH 1SMOA 3K2MC 3QH3A 1CIDA 3QH3B 5B3JF 4NCDA 4ODTL 3AAZA 1DVFD 1FL3A 1FNEB 1WFUA 3ROLB 1IAII 3PWPB 4J1UB 4JFOB 3U1SL 3DV6B 5T1DH 3SDCD 4LCWE 1BVLA 1I1YB 3M17B 4X6BA 1YMMA 4YC2B 1QNZH 2G60L 3CDGB 1NFDE 3DVNB 5HHXL 4I2XB 3G6DH 2BZDA 1YQ2A 2XTJC 5E1AA 4PLJC 4P9HL 2AW2A 1W8NA 2OK0H 5J6GB 4M6NL 1B88A 4NQVA 4WTWA 4GUPA 5JLZB 1KIUA 4XI5D 5HPOA 3HC4L 3QA3A 3T1FA 3H9HA 1NAMB 4N8VG 4U1HA 2PXYD 4TVPL 5BS0D 1HN1A 3CK0H 2P45B 4ISVB 4QRPE 4HJJL 3JV6B 4GH7B 2D4FA 4CVUA 2CIIB 4XMPH 5JXEC 3QWRA 2EDXA 2YK1H 3QB7C 2EICA 3KPLB 3SCMA 1CFVH 2G2RA 4DZ8A 1DJSA 4MCYA 3AXLA 4QXGH 2SEBB 4AM0A 4UTAH 1KPUB 3QIBA 3PL6A 4A2MA 3FONB 2UWEB 4LPCA 3IJSA 3NABH 1IT9H 4ZO7A 4DTGL 3P9WB 1N2RB 5GJTH 1R5VA 3CDYA 3U4BH 4ZSOB 3U7WH 3QNZB 1GGTA 4LLYB 5CGMA 1TVBA 2MHAA 4G42A 2VR9A 1MCLA 3O3EB 4GAGH 3L3IB 4HQQL 2HT3C 3NIDE 3TJEH 3UC0L 4POUB 4OZFB 3DETC 3TPUB 1LO4H 3B6SA 1HI6A 5H37G 1WBZA 5F71A 2JE8A 5GQBA 1EAPB 4HBCL 2R23A 5D6DA 1RSFA 5AUMB 1IEAA 1RZJH 5ITFB 2V5YA 4NO2A 4IHOB 2NY3D 4RQQA 1UGNA 3GSNB 3DYOA 3PQYD 5GZOC 2Q3ZA 1Z5LA 2VDKL 3BWUC 2ADGA 5EOQL 1EEQA 1NGXA 4NCC1 2YC1B 3DX9A 3ZTNL 3GSXA 4Z7VF 1AR1D 3ECBA 1CDIA 3ARXA 4PJ9A 4ENEC 1BFVH 1QSFD 4KV5F 5AZ2L 5HHPB 1T0MB 2JJTA 4MA3B 3O81A 5IF0B 3NIGF 4PJHB 4PRBA 5JR1L 4WDIB 3RWJA 4K7PY 5F8RC 5I19H 3GMOB 4WWID 4XCNA 4X9HA 3ILQD 4Y5YC 5I30L 1BD2A 1J86A 1JN6B 5E03A 1PKQB 3EJZD 4HT1L 5EO0A 2DI8A 3C8KA 3RAJL 2X9XA 1A9BB 4P2QB 2VUOA 2IADA 3QEHA 3QCTL 4DZBB 1Q9KA 3F6IA 5D6CA 1P1ZB 3KJ6L 1WFNA 3ULVF 1XR9A 1W0VA 4PRIA 5J9PB 2BNRE 1ZE3C 4YO0B 4HG4K 3VXTB 1ORQB 2Q6WB 4LLMB 4PJIE 3WDJA 1T5WA 3VGAB 3N9GH 5HHMD 1YDPA 1YEDA 4TTDD 2Q20A 2A6DB 3WNOA 5JUEL 1ZSDB 3BUTA 4KVCH 1MVUB 3MLTA 3FQUA 2HLAA 3TIDA 2JB6A 3V0WH 4NWUL 1HH6A 5F7KC 4BFIA 4JN2B 3V0VB 3P9MA 4OZHE 4RRPA 3H9SD 1CGYA 4HIHA 3C6LC 3BX7C 4BQCA 4HXBH 3ZKQD 2RCSH 3VI3F 1KUMA 4PJ5A 5MP6H 2DLFL 5F9AC 3W11D 1S5HB 3QCVL 1OT2A 3X3FL 2FX8L 3TNNB 4QRRE 1ZWIA 3A67L 4E5XA 3P4MA 5FYJL 4FQ2L 4X6DE 2R0WH 5SV4A 3PQYA 2FB4L 3TO4D 2R1WB 2ZUYA 2P8LA 4LSPL 4FFWC 3FB7A 4GRMA 3OKLB 4S1RL 3O6ML 2VN7A 4PJEF 1U8MB 2VZ3A 2KZ1B 3HZVA 4PJCE 4M7KH 3ZT5A 5EOTA 4BQ8A 1J1XL 4F3FA 1EEYA 4X6CE 1ZHKA 4D9RE 3MNZB 1AO7A 2EDFA 3CVIL 4GMSL 1FL5A 4MWFA 3TCXA 5D1XC 3UJTL 4OM0L 1LO0H 3LS5L 1KF9B 1TNNA 2AXGB 1S5IH 2WLYA 4P57A 1PAMA 3DROA 3O3AA 3VW3L 2Y5EA 4BFEA 2EIEA 2DMCA 3FTGA 1OVZA 1P69B 3QO0B 1NBZA 2XICA 5I76A 4FQQB 2RQ8A 4YDKH 5FFLA 3GSOB 5D7LE 5A16A 5EU6A 2J3SA 4QXTB 3CXHK 4OF5A 4XMPL 4MD0A 1ZGLP 1AH1A 2AJSL 3QRGH 4ODHL 2YK1L 1YY9C 3CSGA 1XGQB 1F02I 2VDOH 4OCSL 1L4IA 4QXGL 5IB4B 3VWJC 4K3EL 3VFWA 3RY5A 4AJ0A 2BHZA 4KKLD 5DJXB 3NABL 4Y5VC 3OR6A 1KEML 1E4KC 3QXUA 4GFTB 3LKSA 3SGDI 4JFZL 1P2CA 1SEQL 1KB9K 5HHVL 2RHEA 4Q6IA 5FGCE 3CFEB 3OKMA 4GXUM 2PETA 5GGTH 1Q72H 3G5YA 5JDSB 3OR7A 1I85C 1WFTA 3CJJA 2XZZA 4DGVL 2NXZC 1QVOB 2X4OB 4R97C 3M07A 3QFJB 4FFZH 5IOPA 4ZUTA 1HEZB 3TO4C 4QHUA 1XF5A 3V7AG 5C0IB 4L4VD 1F4XL 5IQ7L 2MQ0A 3BVNB 3HE6D 5FHBL 2YA0A 1MNUH 3IETB 3THML 1TQCB 4O9HL 5GGTA 3EOTL 2E8ZA 5C3TA 5FGSA 1GXEA 1G9ML 1MCOH 3V8CA 3KWWB 2XKSA 4C56D 2Q86B 2WIIB 2ARWA 2EE2A 2AVGA 2IWGA 1BZ7A 1XGTA 5H2BA 3U4EA 4AMKL 3S4SG 1N7ML 2EDTA 4LLUB 3QXAA 4NRXA 5E24E 12E8L 4BA8A 4CN4A 3I6KA 3WIHL 2DQFB 3RDTC 1UH2A 4B7LA 1CL7I 2DQHH 2DQJH 2H26B 2APBA 2OR9H 5MEQA 4HT1H 3KYKH 1L7IH 4U6HB 4QCIB 4ZFOB 4KVNL 4AIOA 5C09D 4PB0L 4UV7L 3SHSA 1MCIA 1MCFA 1KG0A 4G8GE 4WW1B 1PVHA 2A38A 5EBWB 5DHVH 1I7TA 5CEZE 1KGCE 5CLWA 2Y07H 3RWGB 3VFVA 1QZ1A 4MNQD 5GRYA 5C8JA 3N9GL 1RULH 2E9WA 4OZGE 4PR5A 3FO1A 3KG5A 3VWKC 2YRLA 1S7TA 1AJ7L 1BFOB 5CUSH 3FT3A 3ES6B 4RFEB 2R15A 2W9LA 1MAML 1DL7H 2XOTA 5EU5B 2R0LL 4E41A 4NWUH 3GMQB 2RFXA 4I0CC 5HPMA 4N8VA 3EYFA 2VL5B 4I0PB 3RX5A 3C60C 4C56E 3K74B 1A21A 2ZNWA 4CDGC 4R8WH 4YDLC 1PDKA 2RCSL 2KDGA 1ORSA 2NTFB 4LLVA 4F2MB 3QUYC 3TZVC 1U8LB 2FX8H 5JXED 5H8DA 4N5UA 4TSBH 1B0WA 3BQUA 1G84A 1KCVH 2GFBA 3RUGE 4JFHD 2VDNL 1KENH 4ZPVB 2F53E 1WWCA 2FWOA 4Y1AD 4HUVA 3R1GL 4TULL 4IRSA 4N8CL 3IKCB 1M4KA 2P43B 1EZVY 3OXRB 2F15A 4IIQB 1GYAA 4R90H 4G8GD 5DRXA 1A6UL 5JZ7D 1CU4L 2VIRB 3O2WH 2IMNA 1BZ9A 2B5IC 2UZYB 3EUUA 4OGXH 2CK2A 5DRNB 5J1AA 1U8IA 2AJYH 3OTTA 3MLZH 4JG1H 4QTIH 1FYTA 1QBML 4HLZH 1WT5A 4M7ZB 4DUVA 2D7OA 5E7FA 4K94C 1NLDH 3AY4A 5I1GH 3GRWH 4EN3C 1EMTL 3E8UH 4KUCF 3V5DA 1NDGB 1NGZA 1VHPA 1QTYT 3GSRB 5AG8A 2FSEB 5LQBL 2BNUB 4L9LC 3ULUF 3WJLC 5IMMA 1AE6L 1G7IA 5D1ZD 2AV1B 2CGRH 4JRWA 3QRGL 4ODHH 1RHHA 3HB3D 4HWEL 2Z8VC 1NCCL 4FQHB 2WWKO 2X10A 5FGCB 4WUKH 2A9MH 5EPMA 5FO8A 2FO4B 1KIPA 1FRGL 1JPTL 2OP4L 4XPAH 2NY0B 4YXHL 1NDMB 5FO8B 2FEDC 4MXWH 4Y1AE 5GRJH 4DEPB 4FQHA 3RY6C 2R4SH 3OXSA 1B0RA 1IGCL 4Y16D 5A2LH 2DMKA 3ULSA 1G7IB 2R56H 4KZDH 2BCKA 3BXNB 4IOFC 5D1QD 4HFWA 5EWIL 2APWA 3C08L 4UIMB 1OP3H 3SDXF 1NCBL 1GOGA 4KROD 1FO0L 4FFZL 5FGBC 3LRHA 4YXLL 2QQQA 1OAZH 2F74B 3HPJA 3MOQA 3T2QA 1CGXA 1KN2H 1UH4A 2X41A 5J3HC 4F7TB 4PUBL 5D7LB 3O6FB 4HUWA 1T7YA 3B43A 1X3DA 1MRCH 5D7IE 1ACYH 4G6FB 4XNYH 3BESR 4LLDB 3UROR 4FQLH 3MRNA 5IFHH 5BXFB 3GKZA 1MCDA 5ISZD 4P46D 4MAYC 4KROC 2LFGA 5GJSH 4PJBA 2AEPH 4K8RD 3DYMA 5TPWL 5FXCH 3MFFB 4HWBH 4LNVA 4Y8DC 4WI2A 3VD3A 3TM6A 3WIHH 2ORBL 4M4RA 4YDVB 1TZHB 2QQKL 3BGFC 4X99B 2CDEA 5DJ6A 2VC2L 4KKCC 2O5YH 1T22A 2DQHL 2OTUA 2BRRH 1JMXA 2A74B 2AV7A 4YLQT 4PJAB 3T1WA 3ZE0E 3QXDB 1L7IL 1KIQA 2XWTA 2NTFA 3DUHA 3BI9X 2RJMA 4M1GL 1BQHG 4FABH 3PWUB 2X4QA 4MJ5B 2YRPA 1JFQL 2D0GA 4GKOA 4PB0H 5LGJB 2WP3T 5E8PB 1Q9WB 5D5MB 5DK0A 3C6SB 3DMMB 4K8RC 1VFBA 3IDNA 3VXOB 5EU5A 4OKVA 4X5LA 4XCEB 1LE5A 1AGBA 1GC1C 1FGNL 1CDHA 1E6OL 3BSZH 1VFAA 1RZIA 3CFJA 1VENA 3FO1B 4GLRI 3QXVA 2X4UA 4I8DA 4MCZB 3B5HA 4KAQL 1DL7L 3VFPB 1DANT 1EFXB 1XCQB 5ERWA 2J4WL 4IOFD 5H35A 3UPRB 1MHPH 3LPGA 3NACL 1KG0B 2AABH 4NHCL 3VCLA 4PJIF 2F8VA 3EBAA 2VISA 5DMKB 2EDKA 1OGAA 2B4CH 1IFHH 4XBGB 3LKOA 1CGSL 3HNTH 1HHHB 5HVFB 1T20A 4N68A 3ZYJA 1ZAGA 1OTSC 3MLSH 1LO5A 5E6YA 2VDNH 3LKQB 1KENL 3X14B 2NYYC 5HGAA 1AHWB 2EYTA 4JGMA 5TFSL 4MHHG 5T5NG 4UNUA 4APQB 4RGOH 3S37H 3L7FA 1S7WA 4TUOA 1MJJB 3GM0A 3IYLW 4NUGL 3EO9L 2WIIA 4R90L 2M8XA 2CLVB 4PBWD 3CFDB 5JDJA 4BK5A 5I2IB 2C3VB 4YHOH 4JFFA 3TT1L 1K9TA 4JG1L 4JZJA 4PP1D 1KB5L 1ZHNB 1Z0MA 1FFOB 2QADD 1EFQA 4AIZB 5JXEA 1NLDL 1MHHA 3LB6C 3WO3B 2XG4A 1OL0A 2R2HA 1JNJA 5IOPB 5IV2A 4NQEB 1OLLA 1MQKL 2GJ6E 1WIPA 3MRGB 3S88H 2BDNL 3WS3B 4Z95H 3G5YB 4M61B 4PY7A 5JDSA 4NN6C 4NQCE 1T7VA 2ZWLT 3OKMB 4V1DA 4KJQC 1YY8B 5T1KB 1NGYB 2O5XL 5GRVL 5CD5C 1J7VR 1CDGA 1TVHA 5HHME 4WUKL 1QKZH 4H25A 3DRTA 3L3JA 2HWZL 1K4DA 2XN9A 1DVFB 3MLVL 4C56A 5JO5A 3BZEB 3M1BB 4NZJA 1Y6NR 5JPNA 1NMAH 2EDWA 5GRJL 1XGQA 2R4SL 2IJ0C 2X4SA 1HZHH 4HZLB 5GISH 3QRFM 1FNSH 5I0ZA 4YGVB 1R3HA 3RVTD 2FGWH 3HMWH 4WWKD 3SO3B 3FCTA 5DD1H 3SCMD 3WFEH 5EWIH 1I8MB 1JWSA 3C08H 2EXWD 4FQQA 4NBZB 1MJ7L 2YSSB 1X44A 3EZJB 4PJEE 1PG7H 1U8QA 2ESVA 4HWBA 4XP9H 3C60B 2WV3A 5GGSA 3UYRH 3O8XB 2PTTB 1KLUA 3MRMB 4HBQA 4G5ZH 2XA8L 1T1ZB 2GJ6D 1FBIL 1U6AH 4PG2C 1A47A 2DQUL 3RVXC 5K9KB 4ZFOL 1QSED 3QWQB 4ODXA 1YJDL 5KSBE 3BH9A 3SKOB 1D6EB 4EUPH 4WU5A 5FYLL 2BHUA 2NMSA 5F7MC 3FB7B 5TPWH 4H5SB 2OJZL 1UJ3C 4P3DA 3NH7H 4DN4H 2ORBH 1ULVA 3LSOA 3B5TA 1WTGT 2NY4D 3FJTA 2NZ9D 4O58L 2HT2C 5MENB 2BRRL 4XBPB 2M26A 3GK8H 1S5HA 5FYLD 1FZOB 3DX6B 1U36A 3G6DL 3BE1H 4HX1A 4MJIA 5CMAB 5HI5D 1F6FB 4B0MM 1BQSA 2NLJB 4XRCA 1G7QB 3UTQB 4OCYH 5JW4Q 3WN5B 4HJGB 4E41E 5JW4N 3BIBX 2YA2A 3EO0B 1QRNE 4RGMB 1YEFH 4PYHA 4X5XB 2A2QT 3HC4H 3ZKSD 4JG0L 3WIHA 4U0RB 3HS0A 3Q2CA 4WGVB 1E6OH 3SBWC 1S8DA 3MV7E 5E00B 2BVTA 5D1QA 5CHNB 4MAYB 3RPIA 1QEWA 3V4UH 3QUMH 3KPOB 4GRWH 5I8EA 2PYEB 4DAGH 5JIHA 3T0EB 3QI9B 4KAQH 3CH1A 2Q6WA 1LK2A 4MNGB 4YO0A 4B7IA 3L7EA 1A4JA 1JGDB 1XR9B 4XMKL 3B2UC 3MRRB 1JHTB 1WAAF 4GLRH 2AABL 4NHCH 3IU4H 3QAZC 4WTZA 3QEHB 1KJ3L 2B4CL 4UINL 4MQXC 1PKQA 3IFOA 3MLXH 3GMOA 5HDBF 3Q6GH 4LDOB 4LLQB 4S2SB 1I9IL 4U7SA 3V5KB 2F19H 3MZGB 3I6LD 5AYQA 5EIVA 1UXSA 4ERSH 3FT4A 2CIKA 2I9TA 2G5RA 4J12A 3TO2B 2QQNH 3MO1B 3GMLB 1UXWB 4FQXC 2EDNA 4PJ9B 3NFPA 1OW0C 1IM3B 5I8KL 3EO9H 1QSFB 4X7CC 3QDMA 4P5TA 3TP4A 1G7JA 3PDGA 3ARTA 4N0FB 3KLDA 1U42A 3CX5J 3UTSB 3NZHH 1FFNA 4M8VA 1S7RB 4TQEL 4X8XA 5LGKA 2J8UA 3ARDD 4YHOL 3TT1H 1YMME 1WZMA 2VWEE 3SO3C 3KLSA 4IHOA 4OV5A 3U83A 2P5WE 3L1OL 4OTXL 5D7IF 2JK5B 5I8CA 2DQGH 4JFYA 5D2LF 3OF6A 5C0JB 1TETL 5C6WH 3N0PB 3P30H 5EZJB 1JWUA 3JUYA 3F7PC 5BRZB 4XB8A 4JFFE 4HS6B 4YDJA 1NBQA 4NDMA 4V2BA 5AZ2H 4U3CA 2FX9H 3OAUL 3DSFH 5GIRB 5SWSE 3PHOB 1U3HB 1TNMA 5MI0C 4NKDB 5E70A 5IVOA 2H32H 2DWDA 2GSIA 2Q3AA 4GJTB 4L8SC 1TZIA 2V2TB 4MNQE 5I1JL 3LN4A 1HSBB 1T6VN 3TYGH 1KPUA 2HWZH 1JGLH 2FR4A 5TGBB 1GGIH 4NSKB 1IEHA 4AM0B 4P3CH 2FATH 4YGAB 4IDJH 4K3DH 1W2KT 3D5OF 5J56B 4J23A 3VG0H 1K8DA 4ODSL 1TQBC 5H94A 5L88L 4GW4A 2G9HB 4C59B 1BGXH 2WUBL 5DGRA 5CSGA 3FO9A 5GS1C 1VCAA 4CMHC 5B4MC 1CFSA 1RIHH 4N0UB 4GAFB 5DD1L 3HLAA 4ISVA 4RAHA 4HAGA 4QHLA 3HE6A 2VE6B 3L3OA 5LCVH 4DOHE 3ULUE 3MOAH 3KLHD 1E4KA 1JGVH 1YMMD 2I24N 1FZMA 2ZUVA 4NHUB 1FZKA 2O93L 4MNGE 4UT6L 4ZAKA 4CRPA 1JRHH 1OWRM 3DUSB 1Q0YL 3ARZA 2X4RB 3QJFA 1B90A 2HKFL 2HT4D 4FMFA 1MH5B 1C7SA 3F58L 4K07A 4OFPA 4FZ8H 1G9EA 2FEEI 3X12B 3DVNA 2VQ1B 3RWDA 1U6AL 1YMMB 3M17A 3WD5L 5F1IA 4XAKE 1CDYA 3O3BB 1UH3A 5C0AD 5IEKA 3IDMA 1I7UB 1K5NB 1SJHB 1Q94A 3BKMH 1CD1B 5IHLB 2FB4H 2WQRA 5AZEH 1GPOL 4LSPH 4NNPH 2I60H 4XC1H 4EI5C 2ADJA 2YBRB 3UBXB 1GSMA 3NH7L 4DN4L 5HI3D 4Z7VA 4OD2A 3WFBL 3C2AH 2IFGA 5DS8A 1VPOH 4XXDB 4KKAC 4X5WA 4YQXH 4ORGA 3MBXH 4JEGB 3KPSA 4ONHA 3T04D 3BQUC 3T0DA 5CJ5A 3GO1L 1ZANH 2ICWI 3S97C 2PW1A 4ZS6C 1RZ8B 3WS6C 4A6YA 4RNRA 1AGCB 1LO0L 3VFOB 4JO1L 1GZPB 1KJ2B 3H3KA 3P77A 3S4SB 1AP2A 4WY7L 4QO1A 2A6IB 4F9PC 1NEUA 4Y2DC 5M7QA 3C5SA 4CVZA 1FL6A 3TFKC 3FOLA 4I2XE 3V4UL 2VERN 3DXAD 4EVNA 4MDJA 3OJDA 3UYPA 4YE4H 1Y0LB 4NN7C 1EEZA 2OI9C 1CT8A 4OAWB 2WLZA 3FFCE 2AJSH 3KPPA 2B0SH 1OTUD 3VDBA 4RZCB 5EC1A 5D1ZB 3RWCA 4QRUB 3MV7B 2CD0A 5FF6B 3RA7L 3L5WA 1H8OA 2DBJA 1JPGA 1YN7B 2PR4H 2GHWB 4W4OC 2AK4E 3D39B 4XNXL 2XWBB 5JORB 4D9LL 4UDUA 1ZA6B 2BY1A 2Z4QA 3D18A 1TCRB 3TFKD 1NJ9A 5JHDA 4YAQA 2X4PB 4ERSL 5E8EB 2DYPA 1S9WB 5GGTL 4Y89A 4RMUA 3SY0B 3ARFA 3TZVA 4JZOA 3GIVB 4LHUD 5DQJA 4XCYB 2GTZA 3OX8B 4K7FA 1YYLH 2ZSWA 5I8KH 4D0BB 4I5BB 3HUJB 1R3IH 4QNPF 3D69B 4K7PX 4WEUD 1FE8L 4LSUH 5DD0L 3JWDL 3ESVF 1XF1A 4KI1A 4YDIL 3T2NL 4WUUE 5D2LB 3BN9C 3MROB 4PLKD 1MNUL 1MCWM 3GHBH 2CJUH 4EUPA 2GJJA 3V4VH 1H3PL 2KKQA 3WJLA 3DTXB 3ZKMD 3BW9B 1IGYB 4OTXH 2P8PB 3RL1B 4PJAF 4TUJB 3U0TA 5FOBB 1I9EA 1WBYB 1TETH 3VWJD 1K3ZA 4KK9D 1UACH 1EIBA 3L5IA 2VLKA 5AAMA 4AMKH 2C5DC 4L9DA 3NIGE 4N0CD 1TTFA 2H2PC 3IS1X 3LQZB 5TJWK 5KVEL 5I1JH 2GYSA 1D5BA 1MY7A 4AQ1B 1FAKT 3GJFH 2VAAB 2EDRA 2HJFA 5M95B 1JGLL 4PGEA 1FH5H 1C5DA 2H8PB 4KQ3H 3G5XA 3PP4H 3VG0L 3K2UH 2QQLL 3P11L 3JWOH 4LVOC 1AR1C 5KVEH 3U9UB 3K4ZA 4G80B 1FNFA 1SBBA 4P2OA 3DI3B 2ZP0T 2FO1A 4XPBL 5BMFH 4WUUD 5SWZD 5LCVL 5SX5H 2P7TA 4EOWH 3NFSL 5T1KD 2E9BA 3QO1B 5DQ9A 2JJSA 1NQBA 1MRDL 3UX9B 5L9DH 4ZFGH 1A14L 1J0KA 3QP3A 4FTVA 1CWVA 1F3RB 4ZXBD 4XGZA 4LK4A 5CILH 4R8WL 3UTOA 1KC5L 1B2WH 1DBJH 3JV0A 1MF2L 4R3SB 4J3TA 1LILA 2CUIA 4I0PD 4QRPD 4NM4L 2DIJA 5ENWB 2DL2A 2PW2A 4PRAB 2VLJB 2AERT 3CVHH 2R39A 4X6CF 3E6FA 3OB0K 1CQKA 4XNMA 4TSAH 5IQ9B 3IXTB 2AJUL 1NGPH 3OKEA 4QRSA 1B6DA 5HGBA 4U1IA 4KJQD 1KCUH 1A2YB 1KB9J 4G6AC 1GPOH 4QHNB 2P47B 4P23A 1J8KA 3R1GH 1IAKA 3WNKA 5HYSB 2GITB 5BV7C 5CP7B 1XCTB 1JZ3A 3FRUB 5B39A 1UG9A 5HY9B 3MJ9H 1IAKB 3HN3A 4P23B 3WNMA 4H0HB 1CU4H 5I75B 3KR3H 3BJ91 4WW2F 4ZUWA 4OGXL 1DBKH 4NQCD 1T1WB 4QRSB 5F70A 1TPXB 4OB5H 3PP3K 2PW2B 1VA9A 3DWTA 2C26A 1HOCB 5I1DA 3WO4C 1S9VB 4XZUB 4HH9B 1EMTH 2B1AL 4FQCH 4NGHL 5E6ZA 5DK2A 4JM2C 2E8YA 4MMZC 4ZOCA 3WNNA 5JOPE 3QNXA 3SGKC 2PTUA 4HJ0C 2F58H 2XY1A 4HD9A 3HE7B 4WU7B 4ELKB 1EVTC 3VGDA 4LL9A 1LQSR 3PABA 1DQQA 5IBTH 4LRIC 2DBLL 4XMLH 4G9DB 1V8HA 2OX5A 3QZWB 4G80A 1J18A 4FXLA 5CP3A 2L0DA 1UKSA 3DUUA 4PLOB 4D9LH 4MXWL 4V2CB 4R6UA 4KI5C 3P0YH 3W82A 5BOZG 1C5DB 1XT5A 2ZCHH 4NUJA 3BOVA 3B9DA 4PGZA 2HJFB 5FM8A 1OCWH 5DEZA 2R56L 4KZDL 5JMRA 1F4YL 3V6BR 4R4ND 3LQZA 3RNKB 3LHPL 4LPYA 3STBA 2KQNA 1FO0H 3LKRB 4BSJA 2MQ3A 1KXTB 1OARL 2LE9A 1YYLL 1JK8B 2B7DT 1I1AD 1OAZL 3K81A 4F7PA 5I18L 4DVRL 5J06A 3FMGH 2AEQH 3QG7L 5DD0H 4CL7A 1K6QH 4JPKL 1EO8H 3W2DH 9CGTA 4JAMB 3T65B 5D1ZC 1KCLA 3CFIC 2W60B 5HTSA 4E42A 1WBYA 4S1QL 1H3PH 2FDBP 2R1XB 4JGJA 1J05A 5IFHL 1MEXH 1LDSA 4FTVB 1FQ9C 4XHJD 1OP5H 4HIIA 1AIFA 1F4WH 5DC9B 5E8OA 2HYMA 3PWNB 4Y5VB 5DQ9B 3UZQA 5F21B 2GK2A 1ZT7A 3FRPA 2Q8BH 4WCYH 3EDJA 3RQ3A 1R3KB 1TJGL 4PRPD 2X4TA 4I4WA 4K7FB 3OX8A 3U9UA 3DECA 5EN2B 2QLVB 3ARFB 4R9HA 3CPLA 5FYKH 5I1KL 4Z78A 3MV7D 4P4KC 4K3JL 3G5XB 2DI7A 5IEHA 4M7LL 3T0WA 2Y06L 4ONGL 1IBGH 2VAAA 1BLNB 1A1NA 3QEGH 3PP4L 3IFPB 1AKJB 2DDQL 4QLRA 5K93A 1KFAH 3DXAA 1S9YB 3FFCA 4W6WB 3VXQB 4HEPG 1MVFA 2YXFA 2E7BA 4AEEA 3MV7A 4EN3B 1NKOA 2VXUH 1LGVA 1DZBA 2HG5A 3MV9B 5B4MD 5L0QB 4M7ZC 3BP6A 1EEUA 1S7VB 3WLWC 3GBLA 4BSVA 1IGIH 1CT8B 3ZYOA 1EEZB 1M6OB 2XTJD 3VXSE 1VSCA 4P46A 4LKXB 3VH8B 5F6IB 1HCFX 3PWPE 4XVSL 5L6YH 4TUJA 4YBQC 1KIRB 5CJQL 3DBXA 2P8PA 4H1LH 3NACH 1G6RL 4CN1A 5MERB 3EYVA 5MEOA 1DBJL 2A0LD 2DRUA 1AP2B 1BQLL 3PG2A 4N1HB 5HHOA 3MC0A 4Z8FL 1A6WL 5TQ0L 1AD9A 3MROA 1XF2A 4UT9H 4YWGL 3H6JA 3HNTL 1RZ8A 4NKIH 1MJUH 1DQJB 2WIMA 4G6JL 3D69A 1NBVL 2AJUH 3QHFL 2QBWA 1QYGH 1U8JB 3SDDC 2XZAL 3E2HB 4O2EB 5HHMB 4MX7B 3AM8A 1RK1B 1JYVA 5HJ3A 4XXDA 3GIVA 5DS8B 1OM3H 3SY0A 3TZVB 4S0SD 4J4PA 2I27N 4GS7B 4JB9L 2YEZA 2YBRA 3UBXA 5DJAA 1JZ5A 2H9GA 1JUFB 1DDHA 3SKJL 1SYSB 4F58L 3MRKA 2VABA 3QIBC 3PL6C 3KR3L 2HFTA 5FV2A 1T0NB 5F7DA 5B38A 4PGBB 4HFUL 1DUZA 5DLMH 1N5AB 3O3BA 4E0RB 1JHKH 5FF6A 4ZUSB 3AS0A 3U2SA 4U1LB 1UB6B 5DJZB 2VQ1A 4UTBL 3RWCB 3HB3C 3RL2B 2VTFA 1IJ9A 3BPLB 2FJGB 4FQCL 4NGHH 1MFAH 4NT6B 1FN4B 1XIWB 2CKBA 3U0WL 3UTTE 3PWPD 5EU3B 1X6LA 3G5VB 2H3NB 2F58L 5FYLE 2CMRH 5DUBA 4O51A 5CKAA 2HH0H 1RPQA 1T66D 2EXYC 2Y7QB 2CLZA 5E94A 3B5GA 2NX5D 5GZOD 5KTEL 4P5KA 4KDWA 4ZUUA 4IEFB 1QRND 3FO9B 1NFIA 4GW4B 4NP4L 3IJHB 4KJWD 3IFNH 4JGUA 5FHAH 4G8GB 3OKDA 3QIUA 4I48A 2OL3A 2MQCA 2AKRB 3OG6B 4ONHB 2FH8A 4PJ9C 3F7VA 1U2HA 4PJCF 2ZCHL 1U0QA 4L1DA 3TBTA 4Z6AT 4L8BA 2GEEA 4HCRA 2FGWL 2B20A 4LIQH 4R7NA 3UXFA 2ADJB 4Q58C 3I85A 1TZIB 3RVUD 2V2TA 3WIFA 2WMPA 2VSDA 2BNQB 4P0DA 4D2NA 4NKDA 5B8CA 3U36A 3KPRA 5EOCL 1I3RA 1SJHA 3CMGA 4R2GD 5KBNC 4DVRH 1QFWM 1OTTC 4QRPA 3D0VA 4Z7QE 1CDCA 1HXMA 2J8HA 2IQ9L 3W2DL 3X12A 2R4RH 1HHKA 4GG6E 2VLRA 4G5ZL 3UTTD 3I6LE 3EYUH 4CADA 2CKBH 3H7BB 4JZNA 1JIBA 1MEXL 3QJHA 1OTSD 2R1YB 3ARSA 3MV8B 3REWA 2X9WA 1ADQH 2J8UB 4X9IA 1I8IB 1DLHA 1U8HA 3EYOB 1YPZE 5IB1A 1G7JB 2EEAA 3TNMB 2UY6A 5IK3B 1CFSB 4YUEL 5BW7C 4ODUB 4N8PA 1IILE 4XPGH 3S5LG 2VKWA 5H94B 3BP5B 1OGAE 1UFUA 4GRLC 2X44D 2JCCE 3QHTC 3DVGB 4MVBD 2F53D 2ITCA 4DJMA 3G08B 2XWJB 3VFGH 5E9DE 4JFFD 3ARVA 2VXVL 1JGEA 1NCNA 3MNVA 4L3EA 4UQ2B 4LRNL 4X4ZA 1KT2B 1AR2A 2IAMD 3V79C 4U2YA 1NUDA 1T1XA 4XC3H 1JNNL 3QQ4A 2H41A 3MRRA 4ZDHB 2AEIT 1CGVA 2AK4D 1A4JB 1JGDA 1IGML 1WGOA 1UA6H 4JREC 2ZUTA 4M6ML 1UM4H 3CLEL 5C0JA 5I75C 1DN0A 2YMXL 1OGTB 3IFLH 4QOKE 5CJQH 4CMMA 3HAEB 2R2BB 1OHQA 1DFBL 1T0PB 1BQLH 4Z8FH 2B1HL 5IVZB 1A6WH 4P9HC 3MXWH 1A5FL 2BX5A 3EO0A 4M3KB 5MEPB 4LF3B 1VGKB 4ZO9A 5CZVH 5CCKL 1EXUB 1MJUL 5F3BA 5I17B 2N7BA 3ULUD 4R4BB 3AVEA 4EDWH 1IGFL 4Y2OA 1FZOA 4ONOA 3NFPB 3RY6A 3IDXH 3TEUA 3RVVD 3K8LA 4PP1C 2XNAB 4Q0XH 3TV3L 3GSUA 1EH9A 1VFUA 1IE5A 3B9KA 3KVQA 4PV9B 2V5RA 3OKOB 4MQTB 1BEYH 3EJZC 4KRPC 3LKPB 2YPKA 3QIUC 2YPLB 4M62H 1YN6B 2CXKA 3MCKB 3B9EA 3UPCA 5C0AE 3VFSA 5K9KA 5DLML 1QHPA 4I77H 1WWBX 2Z93A 4D94A 4UTBH 2VZTA 1BQUA 2ADIA 4HMEA 5ADOL 4PJXE 5E8NB 1IAIM 3MRMA 3CH1B 4M3JA 1UQSA 1QSZA 1OSZA 5D96C 4QOKD 5E2VL 3SO5A 2PYFB 4WV1A 1BM3L 3TO4A 4OQTL 5E00A 1OOAA 1ZTXH 3RUGA 3QBTB 5DA4A 2QKIB 1T4KA 3DGGA 2V5TA 3SGJC 5GRZA 5DJ2B 4HF5L 3LEYH 5ISZE 3W0WD 3FCTB 4YR6A 5HYJB 5DJYA 1I8MA 1CBVL 3QI9D 1G7PB 4NP4H 4AIXA 3RU8H 1G7QA 5F9OH 5FHAL 1XGRB 3QDJA 4OLXH 3CX2A 3VGFA 4ALAH 5LKNA 4K3DL 3EJYC 4NNXA 1ZLWH 1CFVL 2ICEA 1V3MA 4ELMF 3PDOA 4YZFF 5HDOA 4HV8A 2XN9B 1XGRA 1M7DA 1FAIL 3AMKA 3QDJB 3RIAK 3LSOB 1WEJL 3DRTB 5GGQL 1IT9L 3UCRA 3V5HB 1TVHB 4GKNA 4P3DB 1QQDB 5C07A 4XAWL 1YEJL 4F80A 4UDTA 1NGYA 4OZGA 4PJGB 5CEYB 3VU2A 5GJTL 3P3YA 5CEZL 1RQ5A 1YZZA 5HHQA 1V3LA 4HMDA 2UY7A 5HGHB 4PY7B 2ZPKH 2GY5A 4PJFE 1IAIH 5INCB 1LE9A 5IBLD 1Q0XH 2IQ9H 2XKNA 1T1ZA 1RZ7H 1KLGB 1N3NB 1NC4D 2VDML 4BZYA 3VWKD 5GSVB 1QP1A 1F58H 5GS3A 4PJGF 3ORJA 3VWKA 2PO6A 4XVUC 1F00I 3SGDH 4X6EB 3RVTC 1MSPA 4UB0H 1A3LH 3N1MC 1CICD 3UP1A 4KJPC 2BC4B 3CFDA 2MJWA 5TF0A 5FOJA 4NNPL 3IF1B 5C0BA 1K8IB 4JFED 4TUOB 4D3CH 4XPGL 4O2FA 3C2AL 3D2UA 1RMFL 2OL3L 4APQA 3O4LE 4HIJB 1EJOL 3GSUB 3C5ZC 2RIKA 5KZCB 4GBXB 3LKQA 3MBXL 2X70A 4F37K 5JOPD 5JXAH 4HC1L 1VKXB 4NNXB 1ZANL 3BZEA 5JO5B 4C56B 4ZSOE 4NN7B 4C83A 4P2OD 3U7YL 3VFGL 1PEZA 3BZDA 3TWCH 4Q9QL 4EJ1C 3WJJC 4GXVL 2IGFL 5T1KA 2HT4C 4TVSa 5IVZA 4J3VA 5EU4A 4IDLA 5DJ2A 5FYKE 4PRNA 3VCLB 3QCTH 1P53A 5FB8B 3BKJL 3F8UB 1OGTA 5ESAB 3UZVB 1NAML 3SKMB 2PYFA 4OCLC 4S1DD 1QRKA 4NQEA 1AGFA 4MHHI 2X4UB 1MREH 1QG3A 1WF5A 5CJXA 4PJ8B 2MOVA 1T21B 4FMKA 5DUPH 1M71B 2YMXH 4HPYL 5FECA 4ZDHA 4MD4B 4AIZA 1C08A 4KVCL 1LE5B 1P6AB 5DO2D 4BQ9A 2JJTC 1MUJB 3IDNB 3PV7A 3VXOA 43CAB 1I9JH 4ZFZA 5IB5B 4LCCA 2EDHA 2X4QB 4HXBL 3KS0J 4PFEA 5CCKH 4JFEE 5IHBA 1TDQA 2YPLA 4EDWL 5CAYB 2ITCB 5MP6L 2DLFH 3O4LD 3OKOA 2QADB 3GMNB 5I0DA 4NC1C 4XXCC 4HK3J 1SY6L 1F90H 2HVJB 5E5UB 2XNAA 1URLA 2CDEB 4YDVA 4ODUA 4HCRH 5DD3L 1LO5B 4DEPC 2K7PA 3BHBA 5I17A 1CXIA 5F3BB 4ESKA 3UO1L 3DJ9A 5IB2B 3DSNA 3EYOA 4YDIH 1DLHB 3T2NH 5FYKD 3S96B 3HI5L 4PJ7B 3V52L 3QJHB 5BV7B 4Q6YA 3H7BA 4QKXB 4BH7A 4XCCL 5KSVA 4I1NB 5ADOH 4FHBD 4EQ3A 5J11B 1EDQA 1YMHB 3A6BL 3C6LA 3Q3GA 1HHKB 5HYJE 2CR6A 4OM0H 1XEDA 2IF7A 1HXMB 1NCWL 1L7TL 3DX7B 1KJVB 3HUJF 3CFJB 4YFDB 3R4DA 1VFAB 4OQTH 4NO0A 1ZTXL 3AU1B 3OAYH 5B8CB 4HGWA 1KELH 1AXTL 4ETYA 1OAQL 4OKVB 1U3YA 4KMTH 4UIMA 1SM3H 1VFBB 1VEOA 3C6SA 3DMMA 3G5ZB 2V7HB 1QSEE 5JW3H 4R7NB 3G6JE 2NY2C 4L3EB 4UQ2A 5F9OL 4X6DB 3G08A 4IRJC 1G9MC 3MRBB 4OCSH 1WK0A 2BRQA 2VDOL 5D9SB 4JQVC 4F15B 4LP5A 1HSAA 2XY2A 2QQLH 3P11H 1A6AB 3CDFA 2EIBA 3QQNA 3TIEA 2BVOA 2KH2B 3IJHA 3CZFA 4NZUH 1JL8A 1TZHA 4LVOB 4UIKH 1YEJH 4GRWF 5IK3A 2CLZB 5E94B 2YPVH 4AH2A 5BMFL 2ZOKA 4E41D 2LU4A 2X40A 4JCLA 2ZPKL 3REWB 5DMGD 3G5VA 1UWEL 3CD4A 4DGVH 1LO2H 3WJJA 4PJBE 3NGBB 4LLDA 1AGEA 1RZ7L 1N0LA 3WFHA 2LAAA 1CFTB 3TH4T 1OQXA 5KSBA 2O5ZH 5CKGA 1BBJA 1D5ZB 3F62A 3O6FA 5F7LB 2DQEH 3THMH 4OZGF 4G9FB 2F74A 5B38B 1KCUL 1BZ9B 2RBLA 3SE9L 3MRKB 5A2JH 3WIFB 4MA8L 3MLUL 1JUFA 2H9GB 3D87B 1MHEA 2N4IA 3KPNB 4NJ9L 4GRLB 3AREA 1WV7T 3QUZA 1V3KA 1JZ2A 3ULVD 3ULSB 4WO4D 4PJ5E 1T2QH 5CZKA 1JPST 3VFNA 5J7CC 4LNRB 1UEMA 2W0FA 2I25N 4I48B 3OKDB 3TCLA 4MVBC 1DQJA 5I73B 2D2OA 3JSSA 3IS0X 2OR9L 1RVFL 4PY8J 1HE7A 1XF2B 4O5LH 4PRPA 2BMKB 1DQDL 4LLVB 2Y7QA 1RHHB 4PRPE 4U1JB 1MCNA 1MFDH 2NY5C 4O51B 4OFYA 3DBXB 4JCMA 3F12A 4N8VB 5C70A 5L2KB 4I9WE 2Y6SD 1NAMH 3CFCL 3GNML 4P46B 2FSEA 2P5WD 3HCVB 1OP5K 1MREL 4BSVB 1T6WA 1I1AB 4NT6A 5FA4A 5IBTL 1RULL 1NGZB 4FZEL 1NDGA 1S7TB 3NMEA 5DUPL 3V5DB 2YXMA 3G9VA 1QO3A 1NCDL 5EA0L 4CNIB 5FCUH 1HYSD 1MAMH 4L3AA 1UB6A 3RIFK 3S3JA 4ZOAA 3I75B 4IOIA 4U1KB 4E0RA 1I7TB 2FIRT 5SWSD 3SJVA 3EOAB 1DUZB 1I9JL 1JYWA 2AXJA 4KJWC 3TA3A 3IVKA 1T0NA 7CGTA 3BAEH 2NXZB 1SYSA 5EZIL 1DDHB 5I9QC 5DJAB 3MBEB 3PIQA 1MAKA 3BJLA 1OPGL 4LSTL 4PJ5D 2VZSA 3UPAA 3TN0D 2PCPB 4HUVB 2H6PB 5EN2A 3QSKB 1JNHB 2BY2A 4HCRL 5D1XA 3JWDC 3MOBH 3QXAB 3BQUB 1ZS8B 3FMGL 4TULH 3S35L 3UO1H 3L5JA 1XGTB 4DN3L 2E7LC 1K6QL 3HI6H 4NC2B 1U8LA 4LOUC 4NFCA 1K4CB 3HI5H 4KDVA 3ZO0A 1MI5E 5HHOB 4AZ8A 3QUXD 2X1PA 4I9WD 5HI5C 3GMRA 1IKFH 4UT7H 1OGAD 3GMQA 4FQIL 5I8OL 4DQOL 1QBMH 3TH3T 3AC0A 2KUTA 1E27A 3MCLH 1NCWH 1L7TH 3LB6D 3I9GL 3WV0A 4FQPA 3MGTA 4WCYL 3E8UL 4QHUB 1T7XA 4LCIH 3NN8A 5JOEA 1JK8A 3G6JA 2QL1A 4JVPA 5C2BL 2XV6B 1VGEH 1QVOA 1I8LA 2X4OA 1KELL 3QDGB 4ZTPH 4Y4HC 4X80L 3VI4E 3GUTA 1AKJA 4Q6IB 4PLKC 1A1NB 4K3JH 2ZUXA 2DQTH 4BQBA 1GGCL 4TSCL 2DD8L 3T77B 3CH8A 1JGUH 4HWEH 5EORH 5EO1A 4U6VH 5A2KH 3V4PH 3I50L 4MQXD 3CPLB 5T3ZE 2X1XR 1ZGLM 4OQTA 4YXHH 1UJ3A 4TUKL 1XH3A 2BJML 4I4WB 1HQRA 2VXUL 1O5DT 4LLUA 4NRXB 3ZTJG 5KVDL 5EBMB 3PABB 3WNLA 5ANME 5HYQB 4QXTA 5FM4A 3W11C 4HULB 5F6IC 2F5BH 2E3VA 2NY2B 1NCBH 3S98A 5I76B 4CN6A 3O3AB 2R1XA 3I2CL 4YXLH 5L0QC 2W60A 5DURD 3IETA 1S9VA 4PUBH 1ONQA 3E6HB 3N1GC 4HK0B 4NKIL 1MRCL 2A6JA 3QWRD 1A7QL 4NNYA 3O3UN 1BOYA 1CICC 4JVUA 2N56A 3RNKA 1E4WL 5HY9A 1X4XA 4NJ9H 5C0GA 3ARBC 5I1HL 5HYSA 1NC2D 2NW3A 3K8KA 4CGTA 3OJ2C 5HD8D 4YHLH 1KBGL 3QT2A 4OD1H 4HAFA 3DUUB 4OJFL 2VC2H 1FNGB 3IXTA 1G1YA 1ZLVK 2ENSA 2E7MA 4FQXB 5D7KD 5IB4A 2VXQL 4B5EA 4FP8L 5D93B 3SDAB 1DQDH 4C57C 5K9QI 4LSVH 2A0LC 2OJEA 4M1GH 5L2KE 4WHYG 5TDNA 3UAJD 3B9KD 5F7WC 3HE7A 2JCCA 1UM6L 3V0VA 2X7LA 5ACZB 1HH6B 5DFVC 3LQAH 1RZFL 2JB6B 2DQIL 5INDA 2HH0L 4Z7UB 3SEPA 3QAZB 2UV3A 4KU1A 3TYFB 5E9DD 3GM8A 4HH9A 5KTEH 1YNTA 5I1DB 4P2OB 3NCJL 3R0MA 1O0VA 2X1OA 3DOSA 3VXTA 1V7ML 5F7NC 3DHJA 1NUGA 4U7MA 2MCPL 1J0JA 4WTXA 5F6HI 4KZEL 3B8SA 3CAFA 4F3FB 2XRAL 1CE1L 4N1CA 3EJYD 3NAAH 4WO4B 3KHQA 4FQJH 3C8KB 5EO0B 4UILH 2C3WA 1U8MA 2XQBH 3STLB 1IM9D 3ZDZF 1OPGH 4LSTH 4ELMA 5CP7A 3MA7A 1CXKA 1MRFH 1OTUC 4QHNA 4XNZB 4JHBA 4PBXA 1BX2A 4X0KA 5D7KE 4U1IB 3LPFA 5IF0A 3GI9L 2P5WB 1BP3B 3T0AA 1F8TH 2VLJA 3LY6A 2IC2A 1FVEB 1V7NH 2I9LA 1CD0A 5L2KD 2ESVD 3NCCB 3BQUD 5IWLC 5SWZE 4XGZB 3FB8A 2YN5A 1ZK9A 3D9AH 2VDRL 2QSQA 3IXAB 3VE0A 1TENA 1KB5H 1ADQL 3D25A 2HLAB 4G6FD 4O02H 1MVUA 3MLTB 1MPAH 4OFYD 2D9QB 5ITFA 3I9GH 1T04A 4IS6A 2P7TB 3WDIA 4HIXH 2WWMC 1YEDB 4JDVA 4J3WA 2XZQL 4U7KA 4YUEH 1C5CL 1JNLL 3KYOB 4P23C 4N1EA 4N5ED 5T1MA 4L4TA 2HTLC 3S88L 4NIKB 4Z95L 5KJRH 1NFDF 1CFNB 3NGBC 1RURH 2DYPB 5E8EA 5JQ6H 3U79A 1Q9KB 2DQTL 1G9NL 4YC2C 4TSCH 2DD8H 1ZVYA 2XA3A 4U6YB 1ZA6A 5E2UH 4NQUA 2Z35A 1LVEA 4U6VL 3IJSB 1GH7A 2IAMC 4UDUB 5ANMB 4MD5B 4XCNB 5B3JE 3OPZH 3P73B 3CC5A 4YHNB 3U7AA 3O8XD 4UQ3B 1II4E 1PQZA 3W5MA 3DLQR 1HZHL 3K46A 1T0MA 5KVDH 5LJYH 1U8KB 2VLKB 5T3XL 3MR9B 3VXRB 4GG8B 4D9QE 1KLFA 1WTLA 1W72A 3CLEH 2ADGB 3RL1A 3IGAB 1IGYA 3EDKA 2P24A 2A6IA 1GOFA 4OGYH 3X13B 1PG7L 1DFBH 1JF1A 3M8OL 4K7PH 1FGVH 4XP9L 3PWLB 2HRPL 4JPVH 4NN6B 4IJ3B 3ULVH 4NRZB 5IP4A 5CZVL 4Y5XC 4HXAL 3DVFA 1JTOA 5CGTA 4YBLC 1WBZB 25C8L 3ARGB 4D0BA 1FBIH 2A73B 5C3LD 4QT5B 2QHRL 1HWGB 3RX8A 4JZOB 3PWPA 2FHBA 4RFNC 4OD2B 4OFVA 2YD7A 1H3TA 4AL8H 1SBSL 5I1HH 1TCRA 3H0TB 3MGOB 5BZDA 4I0PC 2OJZH 1RIVH 5D70H 4KHTL 1RUAH 2F8OA 4PGDB 3GKWH 1P4IL 3U4AA 5FCSH 1ES0B 1A7NL 3AMLA 15C8L 4LP4A 5GGSY 5IEKB 1JPGB 1BF2A 3HNSL 5F1IB 1T5XB 3RWDB 4APQC 4FP8H 5I66B 1D9KD 4PRHA 5J13C 1FYHB 4LU5H 1MFBL 1MH5A 1SQ2N 2OM5A 3DARA 1UZ8A 3JTSA 3RNQB 2X4RA 3QJFB 5E7BA 2YKLL 1CR9L 5GPRA 1QPPA 5IB3B 3KPTA 1UM6H 1T3FA 1YEFL 3FOLB 1FL6B 4Z7NF 1IZJA 4KTDH 3DURB 4AY0A 4JG0H 3HI1A 4RSVA 5BQ7A 4OV6F 2V2XB 1FV1B 1CDBA 5BQ7B 2CPCA 3HI1B 4YHKH 5T3ZL 1PG7W 4U1NB 3P77B 1X5AA 3VFOA 5J6GA 4UBDD 2Z0BA 3NCJH 2G9HA 3IRZA 4RNRB 3RU8L 1YPZF 4MYWB 1CVSC 1YPZA 1Q38A 2XRAH 4ORGB 1U58B 1T5XA 5I9QB 4X6BB 4OI9A 1XR8B 1PLGL 4RWYL 1FAIH 4NSKA 4UAOB 2DWEA 1KJ3H 3A6CL 1OQOA 2AJXL 4XNQB 2GSIB 3H0TA 3MGOA 1SJEB 2GW5A 2W91A 4X6CA 5C71A 3D3VA 4P59H 4JZJC 1Q94B 3CFKA 1I7UA 3IDMB 4OZIA 1ITCA 43C9B 4QT5A 5E5MA 3HC0A 3I6GA 3BN3B 5HHNA 5GRWA 4MA7L 4KKLC 1N6VA 2XPGA 5LGHL 3L9RB 2JK5A 3BZFA 1KXVC 4TQEH 2XTJE 3VXSD 5EZOL 1Q9LB 4AYFA 4QRRB 3D9AL 4Y19D 1QA9B 4NKMA 1GAFL 2OMBA 4HG4J 1OP3K 4O02L 4BK4A 1FVCB 4N0FA 3U9PH 2JJSC 2V7NB 3HE6B 1W72B 3QDMB 4JY6A 3KJ4C 4N0UA 1XGYH 5F1KC 1WAAA 3LQMA 1C5CH 3VXRA 1UXWA 2VDLL 5EZLA 4OCNC 2X1WL 1RMFH 2OL3H 2UVEA 4ZS7L 4JFEB 1DSFH 4PPTA 1PQZB 4MXVE 2NY0D 4AENB 1LK3H 4RAUA 1FO0A 5JXAL 4HC1H 5JQ6L 1BQHA 3GFUA 3EHBC 4K23L 2L7UA 2OS7A 3QUMB 1M05B 4DKDC 3P73A 4YK4C 1AXSA 3BYYA 5DTFA 5E2UL 4Q9QH 1FG9C 4P5TC 3U30B 4YPJA 3OPZL 1YC8A 4KMQA 3TBYA 4ZFFB 5C0CA 1OP9A 4EIGB 1U3HA 2FNBA 3STZB 1CCZA 3PHOA 4KQ4L 4ODSH 5EBLB 1ED3B 1FCGA 1EV2E 1GHFL 4NDMB 1LEIB 1UADC 1BGXL 2WUBH 3MNWB 4ZOEA 3TJHC 4CVXB 5BRZA 3KPOA 5EZJA 3HC3L 5D1QB 3LH2H 1H0DA 2ICES 4K9EH 4Y19E 4EXKA 5DI8A 2HA1A 3V9FA 5C7XH 3M8OH 3IXAA 1YECL 3VE0B 4UT6H 2WSKA 1JRHL 1KJMB 5I16B 4P5MB 1Q0YH 3KPMA 4F8QA 1S7RA 1P7HL 4N0RA 1PZ5B 4KTYA 4M6AA 5D72L 3UTSA 2HKFH 3WN5A 5K59F 1WUNT 3OWEA 4L8SA 3I3EA 1IAOB 3DPBA 5SWSB 3NZ8A 4LHUG 2NX5E 1XIWC 3RWHA 3TBSA 1MFEH 1FVEA 3MO1A 2QHRH 2DQCH 4KPHH 4XBPA 2CSPA 1SY6H 3FRPG 4RGNC 5C6TL 5GXBB 1AXIB 5JTWA 4R4FH 2YD2A 3PV6A 2CIKB 3F7YB 3BKML 5DD3H 4YHPB 4CW1A 2YUWA 4X98A 2P1YA 2B5IB 5ICXB 4GW1A 4YX2H 4KHTH 3PP3H 3SKOA 1T1YA 4LCWB 5C0DB 1CFBA 1ZV5A 4ODXB 3MMEB 5F1OB 4JHAH 5CJBA 5E2WL 1A7NH 15C8H 3RI5F 5T1DL 4WO4A 3PWJB 4F7CA 4YQXL 3PXHA 5CIPH 2VH5H 3GO1H 4XCCH 5C0FB 4RX4A 2NW2A 5J12C 1MFBH 3CVHA 3L7EB 1NMCC 5CS7A 5KZCD 4GO6B 3IAQA 5GGSB 4M6NH 1RUQL 1M7IB 1N6UA 4LDEB 2ESVB 3RPIB 4X7SL 3LIZH 1U8QB 5F7FA 3WXVL 3V8OA 2I07B 2IQAA 5HYEA 3MRDB 3BDXA 3W9EB 5INDB 4YHKL 5IHUH 4X5XA 4K3GA 5T3ZH 1QR1A 3OAZK 5ELIA 2X7LB 4PD4J 4YGVA 4HJGA 4XHJC 4RRPG 1I3VA 3RDTA 3MRCA 2X4SB 1A02N 4HS3A 3DX6A 1KPRA 3SDAA 2VDPH 3SE4A 2EDBA 3M1BA 1DVFA 2PR4L 1F3JB 4JN1H 1K4DB 1FNGA 1OW0A 3L3JB 4MZ3A 4U3XA 2R0ZL 1H3GA 1JYXA 4NZUL 5IFJB 1HHIA 3ARDC 5SWZA 1NC2B 1W0YT 2AJXH 4Q2ZB 2VB5A 3SDYL 4NCC2 2Q8AH 4ZD3L 2NW3B 3QR2A 3KNBB 4V1DB 1CTOA 2Q76A 4YHZH 4R4NC 4GAGL 3TJEL 3QFDA 3FO0L 1WBXA 4MNQB 1I1AC 5KVGL 2IBZX 3VH8G 1MLCA 1R3IL 1U95B 5ID1B 4LPVA 2J1KA 4HBCH 1Y6MR 3HMXL 4CUCA 3TC9A 1ZHNA 1ONQB 2DL9A 1X4ZA 2EDOA 3O8XA 1ZVSB 4G8IA 4OLZH 4HJ0D 2WWKT 2JIXA 1CF8L 1JPSH 4RGMC 5BVPL 2NY4C 4JFFB 3V4VL 4E9LA 1EBPA 3VFMB 4JHWH 1DANU 4PJFF 5I2IA 4Z76A 3JVGC 2FGZA 4ZAKD 2CLVA 3ZTNH 2WBWB 1Q9OA 1MHCB 2X5PA 4WVRA 3O3DA 2NY1B 4R0LB 2W0KA 1R3HB 2VDLH 2FJFA 2IH1B 4NQED 4URTB 3MRIB 2B8OT 3WSQH 5HGAB 2OR7A 1T2QL 3X14A 1Z0NA 1XH3B 2M1KA 3B9VA 4Y4KD