2BSED

Structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
b'VQLQESGGGLVQAGGSLRLSCTASRRTGSNWCMGWFRQLAGKEPELVVALNFDYDMTYYADSVKGRFTVSRDSGKNTVYLQMNSLKPEDTAIYYCAARSGGFSSNRELYDGWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR BINDING PROTEIN
publication title Lactococcal Bacteriophage P2 Receptor Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Lactococcus virus p2
molecule tags Receptor
total genus 26
structure length 122
sequence length 122
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bseD00
2Q7YB 1OW0C 2NXYD 3O6LL 2D3VA 5AUMB 5BJTB 1T5XA 3CFBB 3GBNL 3PABB 4X6CA 3D39B 5J1AB 4OQTL 4DAGH 4R7NA 1F00I 4I2XB 5GGVL 4UUJB 5EULV 1VADA 5D2NA 3FL7A 3OAUH 3VWJD 4XB8A 1ZLVH 5E2TL 3MNVA 4OZ4B 5CKAA 4KKLC 4OLWL 2EDTA 4DW2L 1S7RB 4F33A 1IKFL 2E9WA 3NA9H 5CJOH 5M7QA 3ZE0F 1YEHH 2VWEC 3FO2A 3ARGA 1T5WB 4BELD 1CXEA 3OKLA 1DL7L 3SN6N 5DHVB 3B5TA 5HJ3B 1RVFL 1MLBA 3HR5A 1EXUB 4QHKJ 3BZFB 3VD7A 1YYLH 4JM2F 1ORSB 3LRHA 4RZCA 2ICEA 3RGHA 4AG4L 3U46B 4UBDD 5AD0A 3KJ4B 5E8NB 5BVPH 2VZSA 1UWXK 3A6OA 2FH8A 1KGCE 1FE8L 4NM4H 1J8HD 4WFED 5LXGL 2VDMH 4NFDA 5KS9B 4JVPA 4KDVA 4FABH 4Z7QF 3ZDXF 4HMDA 2RQ8A 1G7QB 5GHWL 4GKNB 1OARH 3WIHA 3H6JA 4HS3A 4YDLC 2XWBB 2EDHA 1K8IA 1JF1A 4JFXB 2X4OA 5ICXA 1Y0LB 1XGTB 3T1WA 3HN3A 5T1KA 5CZVH 3W5NA 1CFSB 3S35X 5T1DH 4RISH 1U8MA 5ITFB 1P4LA 3T0WA 4PGZA 3DX6A 4PYHA 4U7MA 3QRFM 1NDMA 1ZHLA 3HC0B 1IC5H 1OAZL 5IKCB 2HLAB 2R4SL 2HP4A 1OD9A 1RPQA 2P48B 3RTQB 2HT4D 3DGGA 5I1CH 1LO2L 1U0QA 1S78D 1JHKH 4AIZB 3TBTB 1BD2A 3QZWG 2ZPKH 4JE4B 2P8MA 1G9NH 2MHAA 3HUJF 5BZDB 5DEZA 4G8GD 5LKNA 3UZVB 1C5DA 2YEZB 3MOBL 3LN4B 3HZYB 5ESAA 2C9AA 3TO4D 3O9WD 1S7UB 4MMXC 4MZ3A 4G6ML 2J5LC 3TP4A 4RMVA 1QFWH 1QFUL 2NLJB 4L8CA 3BIAX 3ARFD 1JK8B 1ONQB 4JQXA 3CFJB 2FR4B 4MNHB 3L3DA 4WHTB 2Z31A 2OR9L 3WO3B 2Y06L 1QTYT 3ULVD 4RBPH 5HHVL 1YECL 4KZEL 3CFCL 4MLIA 2XKUA 2BX5A 5IWLC 3H9SD 1OAXL 4Y0GA 4X6BA 4PJ7A 2NYYD 3KVQA 3QRGH 3WUWG 4M7ZC 5HHQA 2CRZA 1Q9LB 4LCYB 3V8CA 4UI2A 4JZJA 3O3BB 4JM2B 3OHXB 1YNLH 1LHZA 4PB9L 5CJ8A 3SE4A 1TETH 4BUHA 3BWUC 1AGBB 3GJFK 3BKCL 1T1WA 2BVOB 3L5JA 4YHMH 5D1QC 2EDXA 1OM3L 3CDYA 5KN5A 1JHLL 4PJHE 3EO0B 2F15A 4XP1H 2ARWA 2A1WL 2LVCA 4KJQD 5HYJE 2YD6A 4LLVA 1A22B 3DVGB 5IVXF 3SDCB 2IFGA 3EUUA 2A9ML 1EZVY 3OGOE 4M62L 3ISWA 3TT3H 3L3KA 1DQLH 2A6DA 4NFCA 5GXBB 5E94A 1NCDL 4HWNA 1UH4A 3SGDI 4E0RA 4N0UB 5C6WH 4C55A 4ZDHA 1QEWB 2EYSB 3EOBA 4Z0BH 1QR1B 3FRPA 5EDXA 1WK0A 4MAUL 1I8MA 5DJ0A 4ODBD 2H3NB 3ILPB 4FQHA 3VD3A 4KHTH 1P1ZA 5DFVC 5F7NC 3A0OA 4PRNB 3P30H 3G6JA 5CJXC 1KYOK 4LSVL 3KR3L 3UYPA 1UWXH 3V95A 3HUJB 1GZPB 5HI4D 4MD4A 1TPXC 3O4LB 1A6AB 5D7JD 5BS0D 4P49A 3H42H 3B3IB 2IALB 4P3DB 3S35L 4CADB 1IT9H 4K2UL 3QJHB 4WUKL 5H37G 3RA7L 1QNZH 5D72H 4HS6A 5EWIL 2GFBA 1VGEL 3RHWF 3D6GA 3PUCA 1EHLL 1LGVA 1G1YA 1IC4H 1IAMA 4XZUA 4YGAB 5HVHC 4L3CA 4K23L 2X4UB 4P2RA 4OZHF 1BZ9A 2GK0A 4KU1A 1G7HB 1YQ2A 2E9JA 3I6GB 3VDCA 3RL1A 4LKCB 4P4RB 4ZUTB 5LGJB 1FBIH 4XGZA 3IVKB 3GSNB 4DAGL 5CEZE 1G7PB 4GLRH 5HVFB 2ZJSH 5GGUA 1LE9A 2I24N 2CXKA 2MOVA 3OAUL 5IVZB 3W9DA 3HE6B 2Y9RT 1VEMA 4HCRA 2H9GA 3VMOA 2BRRH 1RIVH 4MDIB 5FF6A 3BJ91 7FABH 3NA9L 5CJOL 2AV7A 5HHOD 1YEHL 2AK4E 1WWAX 2H2SC 3EJYC 1P7KB 5IVXB 3QIWB 3U4EB 3KLSA 4OD2A 4CVZA 2OP4H 4HAGA 1YYLL 1A4JA 3NACH 3WBDA 3KPNB 3OB0K 3KGRA 5IF0B 5ILTH 2BOBB 3L5WB 5F7KC 2W0LA 5IJVA 5BVPL 1CGUA 4WU5A 4NM4L 3FFDB 2VDOH 2VDML 1U8NB 4FABL 1L6ZA 2XFXB 1A7QH 1A0QH 3X13A 3CZJA 4P4KC 4NN5C 3VXQA 1OARL 2FNBA 3TIEB 2X89A 1CGXA 2NPLX 4PRHA 4F8QA 3EDEA 1NFDF 1CDYA 1U8PB 2CLZB 4TSCH 4WI3A 3GJFH 1JHTA 5CZVL 2DTMH 4I48B 4I2XE 4S1QH 5E5MB 5T1DL 2I9LB 4NSKB 2YD3A 4RISL 3ZTNH 5GGSY 4LDOB 3PHQB 3QFJB 5D93B 3SGJA 4I77H 5JIKA 1EK3A 4ZFGH 1IC5L 4K7FA 1JNJA 1JZ2A 2J4WH 3B9VA 3OKDB 4HK3N 3FONA 2BOCB 3VXSB 5I1CL 3PGCB 4MX7A 1HH6B 4LCWA 4X98A 3BO8A 1E27B 3HR6A 1AIFA 1JHKL 1CZ8H 4X9HA 2ZPKL 1JMZA 1G9NL 4NN6B 3P77B 2CO6B 1WAAF 2OJEB 1K8DA 4NKOA 4OZHB 3QI9D 3ARUA 3F7YA 1Q9WB 4QRQB 1FL3B 2PKDA 4ZNEA 1MRCH 5KS9E 1QFWL 4JG0H 3WLBA 4ENEC 3KPSB 3ZHLA 5B22A 5T3ZE 4X6CF 1H5BC 2X7LA 5I2IB 1RZ7H 3WUZA 2P24B 5T3XD 3U36A 1AO7A 3VMNA 1TNMA 3LRGA 3ARZA 1G7LA 3E6HB 4I13B 5EZLB 1NDGA 4LSQH 1CBVH 1IGCH 5GRVK 1CXIA 2APWA 3U4AA 4PG2C 2WW8A 1I8IB 3QRGL 2QADC 4ACPA 1A4KA 1KJ2A 1I1YA 1P7QB 3EBAA 2DQEH 1AI1H 5DFTA 4Y4FC 4XBEH 1YNLL 5D1QD 4L9LB 3P4LA 1TETL 4IOFC 1ZA6A 5IR1B 4M6AA 1EIBA 4YHML 4NNYB 4MDJA 1MUJB 2FJFA 3G04A 5DUBA 5IGXH 5IV2B 1FYTB 4G7VH 4XP1L 3QUZB 3OQ3B 2QKIA 2P5WA 2J3SA 1KUMA 1QLFB 2P8PB 3TCLA 3JWNC 1HHIA 3D0LA 1LE5B 1FNAA 1FVCB 3DV6A 1KTLA 1NFDB 4KKCC 3TT3L 1DVFC 5D7SH 4Z6AT 1SBSH 3IRZA 1DQLL 1NUNB 2V2XA 4U6VH 1JGDA 3IAQA 5DD1H 4OF6A 2FYYB 1EGJH 3Q48A 2AKRB 4OKVA 4Z0BL 2DRUA 5KANI 4O2FA 4R4BB 4M93C 3BAEH 4KFZC 3GSOB 5DFVD 3RIAF 5B38B 1ZSDB 2B4CH 3P9WB 3OB0H 4TNWF 4U1HA 4E5XB 4KHTL 1S5IH 1XF5A 3P30L 3K80A 1HXYA 5EG6C 3RZCC 1X5GA 3UBXI 3NCJH 3TPUA 1Z5LB 2X1QA 4MAYB 4Q6IA 4RQQA 3H42L 3IDGA 3QQ3A 3WN5B 3KYMB 3MZGB 2GCYB 5ESVB 2HG5B 1IT9L 3BPCB 3RWGB 1R3KA 1QNZL 2YN3A 5FO9B 5D72L 4Z7QE 2YOCA 5F1KC 1T5XB 4X6CB 1IC4L 1NAMH 1WICA 4HD9A 3BD5A 3M45A 3T65A 4EIZC 1B2WH 4HH8A 3MNWA 1TQCB 4GG6F 1QSED 4I18B 1N7MH 1G9NC 5D2NB 1G0XA 3QDMB 4MQ7A 4LU5H 4N0UE 3MNVB 1FBIL 2ICWJ 3QDGA 4V1DD 5HPOA 3DX9A 2ZJSL 4LSTH 4KHXH 3EDFA 4AQ1B 4M1DH 4PJ7F 1WITA 3LOWA 3ARGB 1QSFD 2BRRL 1RIVL 3O2WH 1VERA 3OKLB 7FABL 1MLBB 3HR5B 5CBAB 2CGRH 2H2SD 3EJYD 3RKDC 4X9FA 3HUJE 3VD9A 5CJ5A 2C7UA 1R5VA 4RZCB 2ICEB 5C09A 6CGTA 2XWTA 3O4LE 4QXUH 3DLQR 5AD0B 4X7EC 1XH3A 3WO4B 1PAMA 2OP4L 2BNRD 2OSLA 5TPWH 2R2HA 3NACL 5I1KH 3PWPD 5ILTL 3ULUH 4GXUM 3UAJC 1OL0A 2W9EH 1TVBA 1YY8A 2V5YA 4HS3B 2VDOL 2F54A 4P4KD 1ES0B 1FFPA 3FO1B 1A64A 2VKXA 2X4OB 5ICXB 1A7QL 1ADQH 1A0QL 4M1GH 1A2YA 2HJLA 3C6LC 1BZQK 1U8MB 1P4LB 4ZS7H 2QBWA 3DX6B 4TSCL 4LVHC 1NDMB 1ZHLB 4GUPA 2DTML 4HUNB 4KAQH 1RUQH 4S1QL 3HB3C 3ZTNL 3DGGB 3ZKXC 1NBQA 4I77L 4ZFGL 1YEKH 4XVSH 5I74C 1FGNH 3P0VH 3G6JF 5SWZD 1BD2B 5IB2A 2J4WL 2P8MB 4B7IA 2MHAB 3MOQA 3KDMA 2DJ4A 3ALPA 4RFOH 4LHUD 3D25A 4U1NB 5ESAB 5IVXE 4QWWC 1MCJA 2X4RA 1CZ8L 4KKBC 3EYUH 2YR3A 5IBUG 3PDOB 4F2MA 1MCDA 4XI5D 2EDNA 1MCQA 2H32H 4GG6B 2O5YH 4BUGA 4L8CB 2ZG3A 5DJDA 5IP4A 4DJMA 3L3DB 4ENED 4I0PC 1MRCL 3SY0A 4E41A 1HHKA 2BZDA 4JG0L 1MI5D 4FQXC 2VLJA 1I8LC 5ADPH 4X7FC 3RY4A 4DTGH 4X6BB 3E1F1 3O4OB 4PJ7B 4Z7UA 3NGBC 4ODUA 5HHQB 1L9NA 2G2RB 3OBAA 1JFQH 1KB9J 2PETA 7CGTA 2QADD 4LSQL 1CBVL 1IGCL 5GJTH 5KZCD 4XX1E 1KT2A 2NY3D 4Y4FD 3QFJE 5IM7B 4IOFD 4AYFA 5KN5B 4OF0A 2DQEL 1AI1L 4XBEL 3VXSE 4YK4C 2CUHA 2UZYB 3CLEH 4LLVB 3IDMA 1NFKA 1FSKC 5K9QI 2FL5B 5IGXL 3S88H 1N3NB 4RAVA 4G7VL 1EEQA 1T3FA 2VLKA 4P2QE 3V6OC 4YNYA 1D9KA 1IL1A 4NQEE 4KKCD 2A6DB 5E94B 1DVFD 1GHFH 4E0RB 3AREC 2UVFA 4GRWH 3EOBB 5D7SL 1GH7A 2VTFA 3B5GA 1SBSL 4UT6H 2X1WL 3P2TA 1I8MB 4U6VL 5DJ0B 3BVNA 1NMCB 3KPSE 4FQHB 5DD1L 5C0AB 1A5FH 2D7QA 1EGJL 1FQ9C 2G5RA 5MHSD 4RDQF 3G6JB 3BAEL 3HPLA 4J3SA 3KPRD 1F2QA 2B4CL 5C2BH 1FPTH 4L4JA 3RZCD 4OI8A 1EO5A 5E99H 1S5IL 2UWEA 4KI5C 1DN0B 1MRDH 3HI6H 3V6ZA 4QRUB 1EEZA 3W0WD 2P5EE 4GW1B 1NUFA 4MQTB 3NCJL 3S9DB 4PFEA 3O6FA 2GFBB 3L1OH 4KDTC 3N50A 5I9QB 2J8UF 4NHUA 1P84J 3D85A 1PBYA 4XZUB 4ZQKB 5ENWA 3RWFA 4PGEA 2IC2A 4L3CB 1FYTE 2OYPA 1JV5A 4P2RB 1Z6JT 1ITCA 4WI7A 4NRZB 2GJ6D 1BZ9B 1NAML 3MUGA 4JZOA 4TUKH 1I3GH 4XGZB 1B2WL 2WBWB 1PKQA 1FJ1A 3MLUH 5GGUB 1LE9B 1AKJA 4YGVA 1N7ML 3N1QC 1N8ZB 4LU5L 2I25N 4IHOA 3W9DB 4B50A 3VDBA 2H9GB 4JFDD 3JVGC 4KI1A 5FF6B 3BESR 4LSTL 4KHXL 2H26A 1OP5K 1EX0A 4M1DL 5F7DA 4IDLA 3RKDD 4DGYH 3O2WL 4XC3H 3H3PH 4KVNH 1A3LH 4C57C 2CGRL 4CVZB 4OD2B 1U8QA 2KQNA 2AJVH 1V7MH 2WUBH 4QXUL 5H8DA 5E6IA 3SE3C 5IJVB 3QXTA 8CGTA 3QXDA 4WU5B 2W65A 4MJIA 3UAJD 5TPWL 5I1KL 3ULUL 3WFDH 4MA1C 3OKKB 1A7PH 3X13B 2J1KA 5D6CA 2WINB 3VXQB 1JNHA 4FZ8H 2W9EL 4X6CE 5GRVL 2KPNA 4G9DA 3B4NA 5IB4A 2YS4A 3C6LD 1ADQL 3QA3A 4HJJH 4M1GL 3PP4H 3BX7C 1EUTA 1KPRA 1VFBA 3LH2H 4KY1H 5D2NE 3ABZA 1G0YR 3BPNB 3QDME 4ZS7L 3HB3D 3DYOA 3VXUA 5IQ7H 2YUVA 3L9RA 4K7FB 4KAQL 1RUQL 3FONB 3CSYB 4R2GC 1AR1C 4JRYA 2ESVD 2VIRB 3JSSA 4LCWB 3IFLH 3K4ZA 3L5HA 4X98B 3BO8B 1YEKL 4XVSL 2J8UB 1FGNL 3P0VL 3HAEG 2IPTH 4HPYH 4RA3A 5DUPH 3RL2A 2V5MA 3F12B 5DF0A 3TA3A 4UDUA 3UBXB 4JR9H 4QWWD 4NQUA 5ELIA 4JQVC 4YC2B 4RFOL 4Z7WE 2IQ9H 1NCWH 1K8DB 5GZNC 4NKOB 2YRPA 3IJYA 3DVNA 2BSSB 3EYUL 4Y2DA 2D7PA 4JG1H 4PLOB 4IMKC 2PO6A 3VW3H 3WLBB 1ERNA 2O5YL 4I0PD 1YMHA 4MNQE 4XNYH 4FQXD 2X7LB 1O7VA 3U36B 1AO7B 1LP9E 3V79C 5DJCA 1G7LB 1U3JA 5BRZA 5DA0B 3R06B 4QHNA 1NDGB 5ADPL 4HWZA 4HIJA 2GEEA 1BPVA 1U92A 5TJWK 4DTGL 3PV7A 4KKNA 4J3VA 2AEIT 2FIRT 4LVOC 1A4KB 2WIMA 4LGRB 1JFQL 1KJ2B 4MJ2A 4DEPB 2JJWA 4NKIH 2YD4A 3TWCH 5GJTL 5DLMH 4GRLC 3VRLE 5TDPA 3G5VA 5FO7A 3OJDA 4JGUA 4JFEA 4S11A 1WBYA 4MDJB 2FJFB 1BD2E 3G04B 5DUBB 3VH8A 2QKIB 1J1XH 3EOAA 3NIGF 3CLEL 3TCLB 1NCCH 2HYMA 1HHIB 4LPCA 3S88L 3BSZH 1LMKA 3DV6B 1V3JA 5F1NA 4GO6B 5JW4R 4L3EB 3NTCH 4GG6E 2V2XB 1GHFL 4H0IA 2E8ZA 2BVQA 1OP5H 2E5EA 5EO0A 4F57H 3X3GH 4RNRA 2QQQA 4OKVB 5ICZA 1PZ5A 4P5TC 4UT6L 3LN5A 4WUUE 5DC9B 4U1IA 1A5FL 2JCCA 4U1HB 4IRSC 1NL0H 1XF5B 4J6RH 2Q86A 4KI5D 3D1MC 3MC0A 1FCGA 5C2BL 3GM8A 1FPTL 5E99L 3TPUB 3RU8H 5IJKC 3FQNA 1PG7H 4QRPA 1MRDL 4Q6IB 2W9DH 3C8KB 4RQQB 3IDGB 5C0EA 3HI6L 3S4SA 3NCEB 2PXYA 2HJKA 3QIBC 3IAPA 1R3KB 4X9IA 4UOJA 4FTVD 3BMVA 1YMMA 1MCCA 5E00A 3OPZH 3L1OL 3RX5A 2DM7A 3T0EC 2C1PA 2J6EH 3HG1E 3VGBA 4YLQT 3T65B 1ZHKB 2QTEA 1CIDA 3MNWB 5HDBF 5FGBC 1ITBB 1MJJA 4TUKL 1T2JA 1I3GL 2Z8RA 4MQ7B 3O8XA 4M48H 1WTGT 3QDGB 1AD9B 2PW2A 2MNUA 4KVCH 3MLUL 3DX9B 1QO3A 3NABH 4X0KA 1WT5A 1ZKAA 4X6DA 3QDJA 2DTSA 2PTUA 3TNNA 1MCWM 5C0AE 4Z7UF 1FO0H 3I9GH 4HDIB 3GUTA 2VKWA 1YJDH 3RUGA 2BVPB 2Q8AH 2IAND 3JV5A 2C7UB 3TPKA 4DGYL 1R5VB 2MKWA 5C09B 2XWTB 1T21B 4N8VA 1N0LA 4XC3L 3H3PL 3PHOB 4KVNL 4EI5A 1A3LL 2OSLB 3SBWA 4XAKD 1RI8A 4OF5A 2AJVL 2GY7B 1V7ML 2WUBL 4PJCA 5T5NF 2C1OA 1GL4B 3FAWA 3V7MA 5L9DH 1TVBB 1YY8B 2P46B 1QACA 3DX8A 4PY7A 2F54B 1FFPB 3BEWA 3GMPA 1CL7H 3WFDL 1JNNH 1CXKA 1A7PL 4P2RE 1W8OA 4FZ8L 1A2YB 2HJLB 4FQQA 3C5JA 2IJ0C 1LQSR 1F4YH 1PG7X 3SKOB 5HHMB 2X40A 3F6LA 4HJJL 3PP4L 5IQ9A 1FAIH 3LH2L 4QGYA 2OI9B 4KY1L 1HI6A 3GDBA 1NUGA 2FWOA 2UYLB 2G60H 4R2GD 3FB7A 5IQ7L 3HAEH 5IB2B 3PP3K 1BBJA 5JLZA 2GK2A 5EOCJ 3IFLL 3D25B 2UWEF 1T0NA 2IPTL 4HPYL 2JJTC 2X4RB 1QQDB 5DUPL 1LEKA 2V5RA 4FMFA 5GZND 1U8IA 4F2MB 4JR9L 4WEMB 2CLRA 3T77A 2P7TA 1UKTA 5D1ZC 1QUNA 2IQ9L 4NPYA 1NCWL 2E7BA 2YA0A 1NBYA 4XVJH 5DJDB 3TF7C 4HHAA 1F5WA 1IZJA 2PCPA 1BVLA 4JG1L 3RQ3A 3SY0B 3VW3L 3OXRA 4M9OA 4E41B 1HHKB 2VLJB 4ORGB 4XNYL 4J3OC 4L9DA 1X5FA 2F74A 3FB8B 4B7LA 4Y19A 1D5IH 4Z7UB 2FCBA 2XZZA 4F37F 5I8EA 4G42A 4LNRA 5E1HB 5C3LD 1B90A 1CT8A 3GBMH 4YDVB 1KT2B 3WXWH 4Z7NF 3VMPA 5FK9A 2UY7A 4GRLD 4UILH 1Q94A 2FHBA 4NKIL 4YHYC 3QIUA 3TWCL 4KTDH 4Y1AA 5DLML 4YWGH 3V8OA 4LCWE 4P23C 5FGCB 5CS7A 2J8UE 3IDMB 1ZWIB 3V4VH 3K2MC 5I19H 1HIMH 4RAVB 3PGFH 4PBWD 1T3FB 2VLKB 4PY8I 1J1XL 2UVEA 3RNKA 4YNYB 4JY4A 4LCCC 1D9KB 1P9MC 2Y6SC 1NCCL 3QUMB 4PV8B 5F7YC 3BSZL 3U30C 4ZNEE 1J9CT 1ZGLM 2NTFB 3L3GA 5TDOA 1VKXA 3NTCL 4LASH 4P5TD 5DRZB 1DUYA 1D3CA 3KXFD 4Y4KC 4X99A 4F57L 1MQ8A 3X3GL 4XPHH 2FGZA 1NH6A 4H1LA 5HYSG 3HPLB 3ULUD 4IRSD 4HT1H 1KLFA 1CDIA 3A6BH 4Q74A 2G75A 5GS0H 2NY0C 1MWAA 2YXFA 2UWEB 1NL0L 4J6RL 1CXFA 3V6ZB 1CYGA 3CDCA 1EEZB 3H9ZA 1IBGH 4K3DH 5CHNA 3RU8L 5JNYA 5AEAA 5DD3H 1PG7L 3KAAA 3QIBD 3IDYC 2W9DL 4CL7A 5B8CB 4NHUB 2HLFD 5ENWB 3RWFB 4PGEB 3T0ED 2HFTA 1YQVH 4NC2B 1FGVH 1JV5B 2VR5A 3OPZL 3BW9A 1OWWA 4Y88A 2J6EL 4PJ9C 3P11H 3MUGB 1X3DA 4JZOB 1JL8A 4YFEA 2HT2C 1PKOA 1R3JA 4JHBA 1PKQB 2YMXH 1FJ1B 4L3EE 5HDQH 4YGVB 3PP3H 3D0VA 3I3BA 3DSNA 4DZBA 4IHOB 4M48L 1Y18A 3MRJB 4BFGA 4KVCL 1IQDA 1HSAA 1OLLA 3NABL 2H26B 3MO1A 1BM3H 1GGTA 4QT5A 1EAJA 4U6YA 1FO0L 2C3XA 3I9GL 5SWSD 1YJDL 1MRFH 2Q8AL 1CE6A 4XC1L 5IMKA 2XV6B 1LO5A 4JHZA 1P2CB 3L3OA 5E6IB 4Q58C 4LL9A 1H3UA 3QXDB 3TNMA 1ZLWK 2W65B 2EECA 3TFKC 4OBSA 2N7BA 3CSPA 2VLMD 2WM0A 4MGXA 4EUPA 5CEZH 5D6CB 3PWJA 4R4FH 1H3XA 3DECA 1AC6A 5L9DL 3MUHL 2DQUH 3VFUA 5IB4B 1CL7L 2YC1A 5A16A 1JNNL 4MJ5A 3QA3B 3WFHB 3BKYH 4APQC 5LWYH 1KPRB 1VFBB 4JGJA 5TE7H 3MV8D 1N4XH 1SY6H 4WFGE 1XGQA 1CVSC 1GGCH 3LQMA 4K3GA 2DICA 1F4YL 3VXUB 1D5ZA 5D7IF 1J0JA 1JZ8A 1FAIL 4MMZC 1O7SA 4HAFA 2JCCF 2ZNXA 4JRYB 1J8HE 2W92A 2G60L 3QHFH 2IMNA 3QEUA 5F6HJ 4F15C 1U8OA 1IFHH 3RL2B 3TA3B 5HHNA 5IT2H 2W0KA 3DMMA 5FGRA 1XGUA 5L8LB 3PQYB 3NIGE 3IJYB 3DVNB 4XXDA 5D1ZD 4FMKA 4Y2DB 4XP6H 4QHLA 5IEHA 2ZUQB 3LQZA 1BVZA 1YMHB 4GS7B 4FXKA 4XVJL 5DMJB 3AY4C 1TTUA 1IVLA 4HC1H 2YWYA 1R3IH 5CGYC 2DM4A 2F54E 4OFKA 3VXMD 4HKJA 5BRZB 1L7IH 1W0VA 4QHNB 4HWZB 4HIJB 3LDBC 1KCRH 3ARSA 3R8QA 2PNDA 5E95B 2JELH 1U92B 1S9WA 1D5IL 1RU9H 1KPVA 3TYFA 5D2LE 1GOHA 3U79A 3N06B 3U7YH 3QCVH 5DHVH 4OQ1A 4X6DF 3FT3A 5I73C 3GBML 3MGAA 4X6FA 3WXWL 1E4JA 5TDPB 2LFGA 3JUYA 1UGNA 3G5VB 3OJDB 1QRND 4UILL 3RUGF 1WBYB 3BKMH 5GS1C 2XZQH 4KTDL 4YWGL 5DRWA 3VH8B 4JKKA 2AJSH 3MRNB 3OZ9H 3EOAB 3PDDA 3V0VA 2I9TA 4LPYA 5T3ZH 3V4VL 1K85A 2YD2A 3CUPA 3EOTH 2Y6SD 4JPIA 5I19L 1HIML 3PGFL 5F1NB 3H9SE 1YJDC 4GMSH 1H8OA 1TTGA 3GIZH 1GXEA 1XGPB 1B88A 2BVQB 5EO0B 4RNRB 1U95A 5ICZB 2A6KA 4E41E 1WIUA 4WV1C 4Y4KD 5D7IB 3LN5B 4LASL 3IDJA 2VLJE 3EAKA 4U1IB 2JCCB 3MNZA 25C8H 3EYFA 5I8OH 4XX1G 4Z7UE 4XPHL 4TULH 2Q86B 1QD0A 5KVEH 4V2CB 4HT1L 1ZLWH 3A6BL 5GS0L 3FQNB 4RGMC 5MEPA 5C0EB 3P0GB 1XF2A 3S4SB 2PXYB 2VR9A 2HJKB 1T1XB 2BHZA 2YPLD 4L4VB 4GBXA 4Y5YB 1IBGL 4JDZA 4K3DL 4KTYA 5DD3L 5E00B 1JZ4A 4KDWA 3TVMC 2C1PB 2KZWA 5DJZA 1YQVL 4PJ9D 4MYWB 4OLYH 2R69H 3B2VH 1FGVL 3FAXA 2HT2D 5HYQA 3NFSH 3P11L 1MJJB 4MD5B 2CKNA 5CP3H 1XIWA 1JMXA 4Y16C 4U1KA 3O8XB 4QRSA 3GM0A 1F8TH 2XI9A 2YMXL 1QO3B 2B20A 2Z91A 4X0KB 5HDQL 3HMWH 4U7SA 4U0QB 1AH1A 4X6DB 1JPGA 1LO4H 3QDJB 5J11B 3TNNB 1J0YA 1WBXA 4CW1A 2R0ZH 4UAOC 4UIMA 3DUSB 3GUTB 5CP7A 4KJPC 1ZANH 3RUGB 4TVPH 5CEXB 4J3UA 4OGXH 1BM3L 3MPCA 5I1GH 2A6IA 1RJYA 2UWEE 3BPLC 4LEOA 1MRFL 4EI5B 3FCTA 4JKWA 4PJ5D 4PRIA 1BQLH 3RHWK 4L8SA 3TFKD 4D9LH 1B0WA 2C1OB 5KSAC 2A0LD 2DB8A 3DX8B 4MA3B 1M71B 2BDNH 3BEWB 3GMPB 2H41A 4NT6A 5CEZL 5EU5B 2EO9A 4R4FL 3P9LA 3K1DA 4FQQB 5ITBH 2DQUL 1X5XA 4UNUA 3C5JB 4HGMA 4APQD 3LSOB 2HTLC 3PWNA 3BJLA 3W82A 1UB5A 4M7JH 4X7TA 4HZAA 2HVJA 4ZUWA 3BKYL 2CR6A 3V5HA 5IQ9B 5LWYL 5TE7L 1N4XL 1SY6L 5B38G 1GGCL 5F6IB 4DFIA 1NGXA 4ELMA 2FWOB 4JVWA 3OWEA 4Z7NE 3FB7B 5KOMC 1BBJB 4LARH 5J89A 3FJTA 2GT9A 3QB7C 4XCEA 2A6JA 3E2HC 2VDQH 2BXYA 3GBLA 3QHFL 1T0NB 2V2WA 1IFHL 1LEKB 4ZOCA 5IFJA 1N5YH 1JPTH 1U8IB 5IT2L 3T77B 2C3VB 2P7TB 4NPYB 4OCXH 2DIAA 3QEQD 4KRPC 2EXYC 4HHAB 1PJ9A 4FA8A 5GS0C 5GZOC 1BVLB 4PG9B 4J3WA 1YEJH 4XP6L 2RBLA 3OXRB 4OV5A 5CGYD 5T1LD 2Q20A 2WWKT 3GSNH 4U6XB 2NY4B 4RWHA 4HC1L 2WZPD 3KS0H 1R3IL 2F74B 5GSRB 4ZO7A 4Y19B 2EXWC 3F7VA 3KLAA 1L7IL 4DFHA 1FHGA 3T2NH 1X7QA 3IDUA 4G42B 4LNRB 3HI1B 1DFBH 1KCRL 1CT8B 2JELL 1A6UH 5L8JB 3EYQC 5C0JA 4NO0A 1RU9L 4F7MA 3W39B 4FOMA 3VXUE 1TJHH 3U7YL 1S7TA 4OD3H 3QCVL 2DYPD 4W4OC 3QIUB 2DAVA 2DQHH 4Y1AB 1WSST 1CDGA 1EVTC 4NKQB 1RK0A 1TFHA 1KCVH 4JLRA 1FFRA 3BKML 2DMKA 1KCSH 2XZQL 2EDRA 2AJSL 3NPSB 3OZ9L 5T3XE 3PQYE 5EN2A 3NZHH 5EZOH 5T3ZL 3EOTL 3WNKA 5A40E 5HVWA 5ADOH 4OTXH 4GMSL 5TDOB 1DR9A 3GIZL 2NMSA 3U0PB 5J9PA 1VKXB 4Y7MA 1C5CH 4IRJD 1ZE3C 1B0RA 1RIHH 3GRWA 2EKSA 3D2UD 1EJOH 4X99B 2WWMC 1I9JH 2K3TA 3TZVA 4HJ0C 4H1LB 3BRGC 4G43A 2G75B 2D03H 5I8OL 1YZZA 25C8L 4XPGH 1MWAB 4NC1E 2GJJA 4Y5VC 4TULL 4NO3A 4F7EA 3BP7A 3LIZH 5KVEL 1S9YA 5T5FH 2F58H 3QUXB 3ULSA 5CHNB 5JNYB 3FKUS 1ZT7A 2VISA 4N0RA 3CPLA 4GFTB 2XG4A 5JIIA 5I16A 1CLOH 3P40A 4RCAA 1C8PA 3BW9B 5BO1H 5JOEA 1WEJH 4OCSH 3VWKA 1PQZA 2VXSH 3MREA 1KGCD 1PZUB 2BY1A 2R69L 2XA3A 3B2VL 4OLYL 3DO7A 3NA4A 4Y16D 3GNMH 2AW2A 4G8GA 3NFSL 1FVDA 1M4KA 5ID0A 2GTWA 2DMCA 5IB1A 4DZBB 4BFBD 1X5IA 1Y18B 2E6JA 5KAQF 4K55A 1OP9A 1F8TL 1CFQA 1IQDB 1HSAB 2IMMA 5T1MA 5D7IE 1XAUA 3HMWL 1KSRA 3RIAK 2KH2B 4KJPD 3MO1B 1LO4L 2Y4SA 3Q5YA 2R0ZL 3ARFA 1V8HA 2JCCE 4QT5B 4U6YB 3QUYB 4TNWK 2A9NH 5CBEB 1MCOH 1ZANL 2I60H 3VE0A 4Y8AA 4TVPL 1CE6B 2AXGB 4NQDA 2AV1A 4OGXL 4GKZA 4O51B 3TJHC 1HCVA 5I1GL 3Q6GH 3BEVA 5GIRA 2H2PD 3L3OB 4RX4D 5DVNA 3W2DH 1H0DA 1FVEA 3TNMB 3W9EA 1FL6A 1BQLL 2V9TA 5KSAD 4TTDD 4J4PC 4L4VE 5DDHA 3LAFA 2XWJB 4PJBA 4TUOA 4D9LL 4QCIB 1G7JA 3PWJB 5JIPA 1GOFA 2XG5A 3VFUB 1PDKA 2BDNL 3NFPB 1AD0A 2YC1B 1YDPA 2C4FT 1PYWA 5A16B 4MJ5B 3QWQB 5C0BB 4LPXA 3FRPG 2HTLD 4HK0A 3KJ4C 1PW3A 1XCTB 5ITBL 1XGQB 4NBXB 4JY6B 1AGEB 4GOSA 2F8XC 1UZ6E 4M7JL 5A2IH 1PEZA 3EO1A 4LOUD 4ZG1A 5JXEA 5L0QB 3QDJE 3V6FB 4JO3H 4LDEB 1N2RA 3QEUB 3H3BC 2OX5A 1U8OB 4OIIH 3S98A 1Q9KA 3RUGE 4LARL 2OTUA 5HHNB 3QULA 1U3HA 4IOSD 3GI8H 2LV4A 2QL1A 2VJXA 3DMMB 1XGUB 4DGIH 4CMMA 3MGOA 2NY1B 2VDQL 1OSZA 4NKDA 1WFTA 3BT2H 4XXDB 3QXUA 2WSKA 1XF3A 2NW3A 4DKEH 1JPTL 1N5YL 3U9UA 3RTQC 4HFWB 3SJVB 5IEHB 2EXYD 5GS0D 5GZOD 1INEH 4FXKB 4OCXL 4X8JA 5HYJD 3WJJA 4MVBC 3LKSB 1ROWA 1YEJL 3IETB 3H8NA 3D3VA 4WI6A 5L6YH 5DA4A 1WZMA 3G6AA 4HKJB 2ED8A 3IFNH 3GSNL 4C56B 2EXWD 1W0VB 2D9CA 3LKPA 2AJXH 1VGKA 2ZWLT 4GQ9H 5FB8A 1KPVB 3RBGA 4J3TA 3TYFB 5DJ6A 3EYQD 2EDFA 5DK2A 1F11A 3T2NL 4JKMA 1DFBL 1JF6A 4O58H 1A6UL 4H25A 3ARXA 4RGNE 3ZTJG 3DETC 1TJHL 1UJ3C 4OD3L 4RGOH 4PJAE 5F88B 2DQHL 5DRWB 2VMFA 3RWJA 1DJSA 4ISVA 4A6YA 1BX2A 1T4KB 3V0VB 1KCVL 4WTWA 1A1NA 2I9TB 4KUZH 4PS4H 4F7CB 3LS5H 3CUPB 1KCSL 3WIHH 4J7RA 4JPIB 4JM2C 2NY7H 3IDNA 5BZWA 3UTOA 5HHOA 2BVYA 3HI5H 3MLRH 5FYJE 4Y8DC 3E8UH 1E28A 1LNUB 1Q8MA 1T22A 3NZHL 5EZOL 4D0CA 4JJHA 3O2DH 1U95B 4DKFH 4OTXL 4TSBH 2A6KB 5ADOL 4RDQG 1MHCA 4FQLH 2WWMD 1C5CL 4ONHA 3THMH 4HJ0D 1RIHL 3WEXA 2D0FA 3HLAA 4RFNB 3MNZB 2D0HA 3EYFB 3LQAH 1BP3B 1EJOL 2E7HA 2FO1A 4Y19E 1I9JL 1RZIA 1HQ4A 2MCPH 5CEZD 2IBBA 3DHMA 3U4BH 1UM6H 1WIPA 2D03L 4HV8A 4XPGL 3UTQA 4ELMF 1IM9D 5B3NA 5MEPB 5DQDH 3LIZL 1XF2B 1L0XA 3RPKA 3GK8H 1G6RH 4LFHG 4WW2C 4GBXB 3UBXG 5T5FL 2F58L 4JDZB 1QRKA 3U2SA 2VDKH 1ZVSA 2NTSP 2M8XA 1RHHA 1XF1A 2R2CA 3PL6D 1CLOL 1C1EH 1H3VA 4HX1A 5BO1L 5MHSE 5ACZA 1WEJL 2EH7H 4OCSL 4EN3B 3QP3A 3CJJA 1CXLA 4C4KO 4BZ2H 2VXSL 1XIWB 4S1SH 1NGWA 2P49B 4U1KB 2NY6D 4QRSB 3FT4A 2ENYA 1S7WA 4LLYB 5J56B 4PLKC 3GNML 2Z91B 1UM4H 2C3GA 2ERJB 4O00A 5I8CA 4PRBA 1RD6A 1NC4A 4CW1B 4GRMA 3W0WE 1EA9C 5CP7B 4JEGB 4OZGF 2CDFB 3BGAA 3RJDA 1UWGH 2SEBA 5HI5C 3U7AA 1FNGA 5ISZB 3ARRA 2A9NL 2A6IB 3VU2A 1MCOL 1RJYB 3JWDH 3TJHD 3AM8C 5EOTA 2I60L 5IWLA 1NCTA 3FCTB 4OLZH 4WWKA 4PRIB 3KG5A 4Z7VA 2GW5A 2NZIA 4KXZH 2QQKH 3Q6GL 5FA4B 3HE6C 4MXVF 3MFGB 4L8SB 1VACA 4MLSA 1VFAA 3W2DL 1JZ5A 3H9HA 4MS8D 5JW4N 4HKZA 2AEWA 2CK2A 1EH9A 3CXHJ 4AIOA 4AZ8A 3QIWC 5D1QA 2EDQA 3P9LB 1KULA 4IJ3B 1VDGA 4OFDA 2GSGA 2AEPH 2NY2B 3GSUA 2Z92A 4ZUWB 2HKHH 5E4IA 5JIHA 4H26A 5FO8A 4PV9A 4PR5A 4ETQA 1K4DA 1AQDA 3IF1A 4M7LT 1NGXB 4OCWH 3FOLA 4R6UA 4ELMB 5T3ZD 5KOVC 1VEOA 3P4MA 5DQJA 2XQYK 4HIEA 3EJZC 3SOBH 2GT9B 4JO3L 5DK3A 1FIGH 2A6JB 4XCEB 4N9GB 1MFNA 3QJFA 3SO5A 4OIIL 5IFJB 1A6WH 1AXTH 1CICA 1E6JH 5ALBH 3GI8L 4DGIL 5D93C 3RTQD 5CJXA 1RY7B 2X44D 3BT2L 4NRYA 4P2CG 5IHBA 1U8HA 1VB9A 3BDBA 3C2SA 4DKEL 3QXVA 4YBQC 1RUKH 2PYEB 1KB5A 1NC2A 3IAGC 3AXLA 4MVBD 1AXIB 4YR6A 1JI2A 1INEL 2X1PA 3QEHA 1RZJH 2YPKB 3PWUA 3OJMB 5L6YL 3F7VB 1KEMH 3KLAB 3K8LA 2BNQB 1R5IA 2ADJA 4OZGB 4HCRH 3IFNL 3LRSA 4XNZB 1WLHA 1X7QB 2AJXL 5C0BE 2YHGA 4GQ9L 1KIPA 4BQ8A 4XXCC 4NO0B 4G6FB 3ZTJH 2GJZA 5IFHH 1S7TB 4O58L 3DETD 1QSEA 2O93L 1RK0B 3KNBA 1EDQA 3WYRA 3P3YA 4JLRB 3MX0A 4RGOL 4GMTH 5LCVH 2XPGB 3VI4F 2X1XR 3GJEA 3GZKA 4C59B 3U1SH 4OM0H 4JM2D 3BDXA 4KUZL 1GIGH 4PP2B 5EN2B 3V5DA 3ZE1E 1I3RA 4PS4L 3LS5L 5MERA 1V05A 1Z0NA 1V5JA 3DYMA 4TVPD 3WIHL 5K9QG 2NY7L 4R96A 2DIJA 3SJVE 4RA0C 1Y6NR 5E5UB 3TIDA 3MTRA 3HI5L 3MLRL 2QQNH 4PJBF 3E8UL 2ARJA 2AQ3A 4KQ3H 1B0RB 3L95B 5J06A 3SDCD 4YH6A 3O2DL 3QUZC 4TSBL 4DKFL 5ID1A 1KCUH 2VH5H 3O3EA 3TZVB 3Q3GA 1E6OH 4FQLL 4C56E 4G43B 4NNXA 4PJDA 4WVRA 3THML 2FSEA 3QYCA 3TBSA 3LQAL 1GC1H 2EIZA 4RMQA 4X7SH 2MCPL 3RFZC 3L5IA 4NO3B 4F7EB 5E2UH 1M6OA 2E9IA 4ODTH 3U4BL 1UM6L 3MJ9H 5I0DA 1S9YB 1UKSA 2L4OA 1EBAA 3ULSB 2OBGA 4S1RH 4DVBB 1ZT7B 2P47B 4ONGH 2VISB 5DQDL 4ZSOE 3CPLB 3DXAE 2WIIA 3GK8L 1G6RL 5I16B 4FQIH 1QBBA 1QPXA 2VDKL 3EJJX 4QLRA 1FDLH 3O4LD 8FABA 3VWKB 2FEDC 1PQZB 3MREB 4L29A 1KJVA 5JA9A 4QYOB 32C2A 1ZT1A 1C1EL 3DO7B 4MAYC 4N0CC 4GJTB 1RK1A 3WN5C 5FHAH 5E56A 4HUKB 2EH7L 1F58H 2GTWB 2W38A 3CDGA 4DN4H 5EIIA 4JFFA 4BZ2L 5IB1B 4S1SL 4WFHD 5DC0A 3ME0A 4L8DA 3NMEA 1CFQB 3TBYA 5T1MB 1UM4L 5CD5C 4P57A 1FZKB 1KJ2H 4P2OC 1FC1A 1YEIH 3MRIA 2Q3AA 3ARFB 4JHAH 5HI5D 2ENSA 2V6HA 5FXCH 3HZKA 3BN9C 4JRXA 5EBMA 3CX5J 2IH1A 1UWGL 3K8KA 4I18C 1H5BA 5D2NC 4NQDB 2AV1B 5IMOA 4GKZB 3BISA 5GIRB 3FHQA 2VZVA 4PPTA 3JWDL 5T5NG 1CQKA 4MJ6A 1ZHNA 1NANH 4OLZL 3HE6D 1FVEB 3W9EB 3OJVC 1CK0H 4OF8A 2QQKL 5DDHB 4PG2A 3ARGC 4PJBB 4TUOB 4M6OH 1G7JB 1CCZA 1X5LA 4EI6A 4D9RE 4I9WE 5IVOA 1T20A 3QIWD 4O02H 5H94A 1AD0B 4LPWA 1M1SA 1YDPB 2UUDK 1BJ8A 3FQTB 1JWSA 4HK0B 1Q9OA 3WO4C 1GJIA 3MRGA 2AEPL 3MYJA 5KVDH 3EO1B 5CIPB 4JJ5A 3UYOD 2HKHL 4PTUA 4EVNA 4JFQA 3RPIA 4OCWL 1N2RB 2X6MA 4LNVA 2DF3A 3EJZD 3VD4A 1JZ7A 1RMFH 1Q9KB 1XF4A 2HN7B 5AAMA 2R4RH 2JF1A 3QULB 4NQTA 4QF1A 1U3HB 1JYVA 1A9BA 3H3KA 3PV6A 5ISZE 3GSVA 3SOBL 1I1RA 4CMMB 1FIGL 1OSZB 2YN5A 4NKDB 4NJAH 1UB6A 4PRPA 2NW3B 1A6WL 3QFJD 4W68A 3LQAC 1AXTL 3QQNA 4PRIE 3ARVA 1E6JL 4NWUH 4LSRH 5CZKA 5ALBL 1XGRA 4QHMB 5ACMA 4YBQD 3VXSD 1CFTA 3C6SA 4KMLB 1I9EA 4HUUA 4X8JB 1DQQA 2BSRA 1RUKL 5DEGA 3D3VB 2VQUA 1KXQE 3G6AB 4K71C 2CKBA 1BFVH 1U3YA 2DQDH 4NQCA 1T7ZA 1S5HA 1VGKB 1RZJL 1AP2B 1MQKH 3WE6A 4XWGH 1I1AC 5FB8B 4H8WH 1KEML 3WNNA 2CPCA 4PJ8C 3SDAC 1QVOB 1XZ0A 1CLCA 4HCRL 4NUJB 5DJ6B 5DK2B 1F11B 4PJFA 4JQXC 1N0XH 1KV3A 3KYAA 4K07A 4JKPH 1TLKA 2HTKC 1FZOA 2WK2A 4H25B 3KPSD 3MJ7A 4ELME 5GGVY 3SKJH 4HJGA 5AZEH 2W60B 3O45A 1IGYB 1T0MA 4U3HA 4EIGB 3O4OC 3RWJB 3T0DA 4WTZG 4ISVB 1ZHBB 4A6YB 1BX2B 3TH4T 1A1NB 1PD6A 4GMTL 5E7BA 5LCVL 4JFDA 4Z7VF 2DM2A 3IDNB 1U58A 5BZWB 3SE4C 1P7QD 1TJIH 1FL5A 5HHOB 5HGHA 4OM0L 3U1SL 4XBGA 1GIGL 2G5BB 1E28B 1T22B 4D0CB 1IGJA 4G5ZH 1ZOXA 4OUUA 4OCMC 2PYEE 3PHSA 4YXHH 2DOCA 3JWDC 1MHCB 5DFWH 1FYTD 2QQNL 3QUZD 2XKNA 4KQ3L 1KTKE 4ONHB 3WEXB 3CVHH 1RZIB 4ORZC 1JF5A 1KCUL 2VH5L 5EU6A 2BNQE 5CKGA 3STZA 4OZGE 5C08A 1E6OL 1TXKA 3MBEA 1IE5A 2EIEA 1F6AA 2YPVH 4PJGA 1GC1L 4X7SL 1G9EA 1PFCA 5E2UL 1CD0A 1OWRM 4ODTL 2ICES 5HPMA 1UH2A 2CO7B 3C6LA 1NMCC 3MJ9L 2J8OA 5C07B 3RY5A 5B3JF 1HXMA 4XRCA 4S1RL 3U2SB 2UUDH 1ZVSB 4ONGL 1RHHB 3LD8B 2J88H 3VI3F 5JMRA 2WANA 3O3DA 3VXNA 3ROOA 5SWQB 4FQIL 2FEDD 5JO5B 3KXFE 4QHKI 3V4UH 1N6QH 1MEXH 4YFLI 4D8PB 5ACZB 3Q6FA 1FDLL 5CILH 5J4MA 3ULUE 4MAYD 4N0CD 1NGWB 4YPGA 5GGRY 3FT4B 1S7WB 1LVEA 1TZGH 5I9QC 5FHAL 3VXPA 5I8CB 1F58L 4DN4L 4PRBB 2J5LB 1NC4B 2VB5A 5CD5D 3FZUC 4GRMB 2XTJB 1FNGB 1KJ2L 3BN9D 1YEIL 2YRZA 4P59H 2GHWB 4L4TA 4XMKH 4JHAL 5EIQA 4DK6A 4FQXA 3LKQA 3QDMD 2AJ3A 4MSWA 1HK6A 5EOTB 4WWKB 1RZJC 5ERWA 4Z7VB 3MCLH 1K3ZA 3WDJA 3VH8G 3W5MA 3N1GC 1VACB 1MCNA 3F7RA 5L2JA 1VFAB 5AYQA 3RWDA 2ITCB 3H9HB 3ARGD 3QUMH 1CK0L 5KTEH 1F4AA 4HG4J 3JXAA 4M6OL 1E4XH 1ZA3A 2Y5TA 4O02L 2GSGB 1RULH 3KLDA 3NBNA 4OLUH 1SJHA 2Z92B 2BVEA 3CMOH 5FV2A 1KPUA 2B8OT 2VZ1A 4HUVA 4ZOEA 3T3PF 4PV9B 4PR5B 5FO8B 1AQDB 3FOLB 3SKMA 3CAFA 5KVDL 4D2NA 3P4MB 5DQJB 4PJDF 3G6DH 2ZUYA 4WHYG 3AREA 4HIEB 2EZ0C 1Q38A 4ODVH 3VFTB 2LTQB 5JHDA 3QJFB 4AMKH 2YSSA 4JZNB 1RMFL 3S4SG 2R4RL 1CICB 3VI4E 3BPNC 4NQDE 5IMMA 1N59A 4NCDA 2K7PA 4ZOBA 1CN4A 1C12A 4XNUH 4NRYB 4MB3A 4NJAL 1U8HB 2WBKA 4O2EA 1GC1C 4QNPF 3B9DA 1KB5B 4LSRL 4NWUL 1NC2B 1BD2D 3AXLB 4YR6B 5T33H 5HGBA 1G9MH 2FJHA 1EFXA 2DWEA 4PJBE 2RFXA 3QEHB 3PWUB 1PG7W 1X5HA 3BKJH 1YN7B 4OBRA 5J1TC 4KQ4H 1R5IB 2ADJB 3GJFA 5DTFA 3LRSB 1BFVL 2DQDL 2QV2A 4X5XA 3DUHA 5F8QC 1MQKL 4XWGL 1KIPB 4H8WL 2HTKD 2FX8H 3Q0HA 1INDH 1N0XL 3KPPA 5HXMA 4JKPL 4Z8FH 5FDWB 4U1MB 1IKNA 1QSEB 4ESKA 3SKJL 5FV1L 3FOMA 3KNBB 1DZBA 1VFUA 5AZEL 4F9LC 4HSQA 1VSCA 1EHXA 2QSTA 1G7IA 3V5DB 4DEPC 1I3RB 4FS0A 3GGWA 5D1XA 4R96B 3HC4H 5F7MC 1TJIL 35C8H 2CSPA 1JUFA 1Z9MA 4NCC2 4E42A 2I07A 4OCYH 3UTTE 3AS3A 4U3CA 4G5ZL 4YXHL 3O6KH 3S3JA 5ID1B 5HGAA 4WFFE 1CGSH 3U48A 1BF8A 4LHUG 1F13A 3MRDA 4HF5H 2GYSA 4NNXB 4PJDB 4G80A 4P46B 1P4IH 2FSEB 3TBSB 3CVHL 2EIZB 4U1SA 5KJRH 1M6OB 3X14A 4ZFFA 2FIKA 2ICCA 1BLNA 4D3CH 2YPVL 2IG2H 3X11B 5EH1A 5C0AD 2WLZA 2R1YA 2WIIB 2OTPA 1JYNA 3K7UA 5TE4H 4NKMA 2VZUA 5C0GA 2J88L 1TIUA 8FABB 4C83B 1IARB 4L29B 5ALCH 32C2B 3G9VA 4NBZB 1ZT1B 3HPJA 3IXTA 1TJGH 4TPRH 3V4UL 1N6QL 2ZUXA 1DANU 1MEXL 1RK1B 4OF7A 5CILL 5EIIB 4JFFB 4J1UA 1HKLH 4JQVA 1TZGL 1U36A 3FZUD 3OGCA 3BHBA 5FM4A 4P2RD 5C92A 1FFQA 1QLEH 3MRIB 3T04D 1J86A 4F3FA 3MV9A 3ARPA 4JO2H 3HZKB 4JRXB 5EBMB 3NZ8A 4PJFF 4PGBA 3MGTA 4GAJH 2EIDA 4P59L 2EDKA 4XMKL 4AL8H 2V7NA 4MJ6B 1SJXA 1ZHNB 4G8FA 2G9HA 3AU1A 4H8WC 3MCLL 5C07E 4NRXA 5IB3A 1SVZA 2XXCB 4EI6B 3U0TA 3GMMA 3JUZA 4G8IB 2NX5B 1T20B 2FB4H 3QUML 4QRRB 5H94B 5E9DE 5IOPB 4GRLA 5KTEL 2VDRH 4N8PA 1E4XL 3DBXA 3T1FA 3VXRA 1Q9OB 1JTOA 1J1OH 5F7UA 1VENA 1EUUA 1IAKA 1KCKA 5EIVA 1RULL 4OLUL 3MYJB 1MCWW 1MLCA 1GPOH 4EVNB 1MFDH 3CMOL 4H1LG 3MUZ1 3RPIB 3LEVH 3CMGA 2RR3A 3ET9F 2X89D 5IESH 2XTJE 2X4NA 2EZ0D 1X5YA 2ZP0T 3G6DL 3ROLB 4QF1B 3INUH 2XN9A 1A9BB 3GSVB 4PJGF 4P3CH 3HMXA 3QNXA 4ODVL 2MQ0A 2GIYA 4AMKL 4OZIE 1J18A 1UB6B 4PRPB 2ICWA 3KPMA 3O9WC 3M8OH 5IVNA 1XGRB 3PXHA 5JPNA 4XNUL 3RVXC 1CFTB 3C6SB 5EU7E 4HUUB 2CIIA 3ESUF 4PLJC 4LCWD 1DQQB 5HBBA 2BSRB 5DEGB 1KG0A 1LEIA 5IJKA 1ADQA 1ZLUK 4LFHD 2EEAA 5T33L 1G9ML 2CKBB 2K9UA 3ARBC 4HQQH 4NQCB 3I2CH 1CDJA 1S5HB 2VXTH 5GGQH 1T1YA 3WE6B 3MODH 1JGEA 1F3RB 1M7XA 2KZ1B 3BKJL 4KWUA 4KQ4L 1XZ0B 3T8XA 4YHPA 5KVGH 4PJFB 5JMOC 3RDTA 1R24A 1XR9A 2HRLA 4CJ0A 1JWMA 1O5DT 4HFUH 3BMWA 1B0GA 1DUZA 2FX8L 4XHJC 4DKDC 5FGBA 5HTSA 1INDL 2JKXA 1AO7D 1X4XA 1T0MB 5B3JE 4Z8FL 1S7QA 3GSQA 3QSKB 1BFOB 1II4E 1MCBA 3UTSB 5IHLB 4LDLB 2ZUSA 3RBSA 1IAIH 1QSVA 5D7LB 4F7TB 5F7HA 2H32A 3GKZA 1U58B 1FL5B 1UKQA 5HGHB 3QXAA 1OTUC 2YD7A 4AM0A 3HZVA 5DYOA 4B5EA 1IGJB 5A1AA 5SWSA 1NAKH 3FQRA 3D9AH 3HC4L 5BV7B 3CSGA 35C8L 1YN6A 4MCYA 1BIHA 1JRHI 4Z76A 2XKNB 4ZXBB 4OCYL 5AG9A 2BMKB 4HW6A 1S9XB 3HS0A 4NN7B 1A21A 3O6KL 2CDEA 5EU6B 1CGSL 4PTTA 3STZB 5C08B 3BZDA 1D9KC 3MBEB 1CFVH 4HF5L 5I17A 4YO0A 1P4IL 2R0WH 3EFFA 4L3ED 4PJGB 2EEDA 3MACH 5KJRL 3EYVA 5GS2H 1J0KA 3G08B 5HPMB 3C6LB 2YUWA 4D3CL 4JDVB 4XRCB 1Q1JH 2IG2L 3PJSA 3MOAH 5E2VH 4X9GA 5FYJH 2IAMB 3O3DB 3VXNB 5DS8A 1JPSH 3ROOB 3HNTH 3VFNA 5TE4L 2JB6A 1JCKA 3Q6FB 43CAA 3RWCA 1O0VA 5ALCL 3CSBA 2W91A 5KAQG 1TJGL 3HZMA 4TPRL 4KH2A 1QPPA 2JJTA 5B8CC 3VXPB 5E6YA 3FT2A 1F3DH 3T3PE 1HKLL 5IIEA 3OXSB 1RHFA 3HC3H 1DP0A 2JLLA 1T0PB 12E8H 5DVOA 5JR1H 3LHPH 1HHGB 1QLEL 4L4TB 4WFGD 3BN3B 1G9MC 4JO2L 4FQXB 3O6MH 3MUY1 3QDGD 5ERWB 1FLTX 1NEZA 5GISH 1NMAH 2XZAH 4GAJL 4XBPB 4KJYA 2OL3B 2DS4A 2J8HA 1ZLUH 4AL8L 1IGMH 3ZZ1A 5J57B 3R1GH 4QXGH 3RWDB 5L2JB 2CIKA 1AE6H 1CTOA 3SDXF 5DURD 3EOYG 4CNIA 3P4NA 5FA3A 3OV6A 1C08A 1GGYA 3OAZK 4QNPE 3K3QA 1H3GA 3K0WA 1ZA3B 2BSTA 5C09D 2FB4L 2NCMA 2Y5TB 4YE4H 4LP5A 5DI8B 5E5RB 1SJHB 2WMPA 2V9QA 4PLNC 4P23A 2VDRL 1I75A 5E6IC 2ZCKH 4H1LH 1J8KA 3Q5OA 1J1OL 2DI8A 1UCBH 4PP1C 4JFFE 1IEHA 1CD1A 5FDYA 5C0CA 2VZ3A 3I75A 3SKMB 5FKAB 1GPOL 2F54D 2IPKA 1FNFA 3CFDB 1MFDL 2KKQA 3LEVL 2L0DA 3AREB 4ZODA 3B6SA 2FJGA 5JHDB 5IESL 4OKDA 2YSSB 1BFSA 2DLIA 4JRXE 5I6XB 5E24E 4ELKA 2NQCA 3INUL 2MPAH 4OCNC 1D7FA 4P3CL 5DR5H 3M1BA 1C12B 3X3FH 5I1DA 5I1JH 3QI9C 4O2EB 3RVXD 1U3ZA 3RGVA 1DE4B 1XT5A 4OGZA 3M17A 5J12B 2D7OA 4PLJD 2CK0H 3M8OL 3LKRA 3EDDA 5I1HL 5HGBB 2FJHB 1EFXB 3VA6A 4WO4A 5K59F 4ZAKA 2DWEB 2RFXB 4PJIE 1CLYH 1V3MA 5KW9H 3ARBD 2BFVH 2NX5E 5F7LB 4QRRE 3DGCR 5FOBA 3GJFB 5DTFB 3FB6A 4HQQL 5E8DH 3I2CL 2VXTL 5GGQL 3SO3C 2OXGA 1BOGA 1DSFH 3MODL 4Q9QH 4Y2DC 2APBA 4L5FH 4UU9A 5KVGL 4GS7C 4JB9H 1NJ9A 4E41D 4XHJD 2VLJD 2WBJA 1WC7A 4HFUL 4FQPA 3C5SA 3SCMA 4RSVA 3FOMB 4NP4H 3SDXB 1K5NA 3OF6D 1AR2A 4NC1C 1FIEA 4F80A 4JN2A 2VXQH 2X1OA 3CC5A 4M03A 3P4OA 1MOEA 3I84A 3GMQA 2AERT 1OTUD 1IAIL 3GGWB 5D1XB 3VFMB 1JUFB 4QY8A 3V9FA 2ARJQ 4E42B 4I3RH 2I07B 2X9YA 1NAKL 4A2LA 5INCA 1RAMA 4ZPTA 3WV0A 1OTSC 3D9AL 1J87A 4LP4A 5HGAB 3MRRA 5DVMA 5KG9A 2VLKD 1CG9A 4G80B 4NQCE 3MLZH 1D9KD 1F45A 1WVZA 4U1SB 3BXNA 5BQ7A 4MA1B 5A2LH 3MRCA 1CFVL 3X14B 5F89A 2FIKB 4ZFFB 1BLNB 1I85C 2QSQA 2R0WL 2EIBA 3OAZH 2EE3A 3UTPD 4EXPX 3MACL 4PRDA 1QFOA 4JAMA 1MCIA 2O61A 4P5KA 5DWUH 1KIQA 3KPLA 1Q1JL 2ED9A 4NKMB 3MFFA 5F44A 5C0GB 3CNKA 3MOAL 5E2VL 3UTSE 5FYJL 1OGTA 3ZT5A 4XVUC 3ETBF 1CDCA 5JQ6H 1JPSL 3HNTL 5D7LE 4ZO6A 3IXTB 2A2QT 4J3XA 3QISA 4OFYD 5I18H 2QJDA 4U1LA 4IRZH 1MELA 2PXYC 4J1UB 4KGJA 3E0GA 3NCYP 4Y5YC 4FNLH 4HMCA 1F2XK 3QPXH 3OKEB 4P5MB 3L3JB 2HFEA 3TH2T 3ZHKA 2DDQH 3OGCB 2Y5EA 3C60A 3BHBB 4JFPA 15C8H 4F3FB 3MV9B 2AXFB 3QEQA 4BSVA 2EEBA 3HC3L 4P9MH 5EFIA 5EU6E 1EERB 5J13B 2AJYH 4WCYH 12E8L 4PGBB 5JR1L 1L7TH 1SYSA 2ZSWA 3MGTB 3LHPL 2PW1A 5T1LA 3NCFB 3VFSA 3O8XC 4PJGE 4OV6F 3MQIA 1BJ1H 4KXZI 4Z0XB 4IIQA 5IW3A 3O6ML 4G8FB 2G9HB 1WT5C 3PGDA 1NMAL 3AU1B 1U42A 2XZAL 5GISL 5MENA 3FO0H 1F6FB 1EFQA 1IGML 4Y4HA 4LVOB 3S5LA 3R1GL 4QXGL 1JWUA 3VGAB 1AE6L 3U0TB 3GMMB 4G6AC 3SKNA 3KLHC 1Z9SA 4UV7H 3ZDZF 2QSVA 4P0DA 4W6WB 3D39E 3DBXB 3T1FB 4OGAC 3VXRB 4EI5C 1OB1A 1X4ZA 5MEOB 4YE4L 1IAKB 3SBWC 5E6ID 1S7XB 1VPOH 4BKLA 2CJUH 2EYRA 4PP1D 1MLCB 1P53A 3WKNA 2ZCKL 1CQYA 3QR2A 1UCBL 5E2WH 2GUOA 4X9BA 1KYOJ 3STLA 1K6QH 1QP1A 3JV0A 5K9OA 5I1LB 2X4NB 3SE9H 5EPMA 3VD5A 5J6HA 2XN9B 2Q76A 3QNXB 2VDNH 4L4TE 3L7EA 4WV1A 2EICA 5A2JH 4A2MA 1CFNB 2OTWB 5EBLA 3VXUD 2ICWB 3KPMB 5F9AC 3WJLC 1YEGH 2MPAL 5F6IC 3VFOA 1LD9A 5DR5L 4RGNC 5JPNB 4XI5C 3X3FL 2BP3A 2CIIB 4JRYD 5I1JL 1ED3A 2VE6B 4YX2H 4KK9C 1KG0B 5DD5H 2CK0L 1LEIB 3ARDB 4M3KB 3S36H 1MIEH 3S6CA 1BJMA 4OLEA 3I6LD 3GSRB 1T1YB 1CLYL 3UZQA 5KW9L 5IROC 3PQYD 2BFVL 1JGEB 3GIVA 4DWHA 2FECL 4GRWF 4KK8C 4NOBA 5F1IB 4Y2DD 2ZNWA 2RHEA 2X41A 5C6TH 3TVMA 5E8DL 2EC9U 3RDTB 1R24B 1XR9B 2HKFH 4M8VA 1DSFL 4Q9QL 1NFIA 1NBVH 3WS3A 4F9PA 1B0GB 4L5FL 1I7UA 1MFBH 2JIXB 3HAEA 4BA8A 5GGTA 5JW4Q 2ADIA 2NY3C 5J0BA 2NY4C 4JB9L 3T0VA 5BRZD 3BQUB 3UP1A 1S7QB 2JTDA 5EO1A 1UG9A 1QR4A 4WNQA 5JHDE 2XY1A 2HMIC 4NP4L 1KOAA 5A2KH 4OZFA 4UQ2A 2H32B 4TYUA 5DQ9A 3MRBA 1BGXH 4ZYKA 2VXQL 3QXAB 4S0TD 4AM0B 3HZVB 1A6PA 5DYOB 4LLUA 2Q6WA 1DQJA 3QIUC 1YY9C 2VL5B 3FQRB 2AQ2A 1M7IA 2B5IB 2VLRA 4MCYB 4Z76B 1OTSD 3WNLA 4HXBH 4WTXA 4I3RL 3R4DA 2VITA 1XMWA 3EHBC 5E6ZA 3HS0B 4RX4A 3C5ZA 1TVHB 4PTTB 1KF9B 1OGAA 1HDMA 4LHQB 5I17B 3ZE0E 3MLZL 2D7MA 3EFFB 4YDKH 5EU3A 3DNKA 5FYJU 1YEDA 1KJMA 2X70B 5D7KE 3O11A 3O41A 1RZFH 5IW1A 3S36X 4TVPE 3PJSB 4BSWA 3FFCA 4J12A 1U8LA 5GGSB 5TH2A 3SDXE 5DS8B 4LCIH 4WEUD 3VFNB 5DWUL 1MPAH 3ZDXE 4AIXA 4XVUD 2JB6B 4CU6A 4D9QE 43CAB 5JQ6L 3RWCB 4GRWB 4R7NB 4W81A 5GRXG 5CAYB 3QUXC 2X4PA 2PXYD 1VADB 3HZMB 4L4VD 5I18L 1NKOA 4IRZL 5C1MB 1F3JA 3TM6A 4F58H 1I3VA 3FT2B 2WQRA 4PGJA 3BP6A 5IIEB 2ITDA 1L0YA 4U31A 5JW5A 4FNLL 4F33B 3QPXL 3S8WA 2DDQL 5I76A 3EW3B 1ZVYA 4XCNA 3FO2B 15C8L 3VA2C 3U9PH 3QNYA 2CH8A 1GCFA 5HYJA 3DX7A 4YQXH 4P9ML 4OFPA 2AJYL 3O8XD 4YZFF 4WCYL 1NEZB 2D4DA 1L7TL 4M6NH 1MCPH 1NBZA 5IHZA 1NANI 5HD8C 4KJYB 2FHCA 3AS0A 4R9HA 1RUPH 4HULB 3QDJD 4NCC1 5FYLE 4QXTA 4WDIA 5GRUH 4H88H 5IMLA 4CNIB 5FA3B 1C08B 4HLJA 3KLHD 4G6AD 3FO0L 3GFUA 5FKPA 3QUYC 4WFHE 4TUJA 5EORH 1K8IB 1K9TA 1JF1B 3CZFA 2BSTB 4L3AA 4U0RC 4UV7L 2IH3A 1SM3H 3GRWH 4OGAD 5T1KB 4EI5D 1IJ9A 4P23B 4R7DA 1I8KA 3CFEA 3HE7A 1QZ1A 3VRJA 4HS8H 1MCHA 5C0CB 1VPOL 2CJUL 3NCCB 2X9XA 4M9PA 2IPKB 1TNNA 2PN5A 1PLGH 2FLRT 3U30B 1MIMH 5E2WL 4HBCH 3B6SB 3MV9E 2R56H 1PVHA 2A74A 2FJGB 2AVGA 1K6QL 2V7HA 3SE9L 5TQ2H 1C5DB 3ALWA 4H20H 2VDNL 4DUVA 4LLQA 2DD8H 1UYWH 1D6VH 4RGND 4OAWA 3VG9B 1KTRL 4JN1H 4O9HH 3RGVB 1YEGL 2NY0B 5L0QC 3KYNA 3GMNA 3O3AA 4KK9D 4WO4B 4UTBH 4ZAKB 5LGKA 2Z31B 5GS2D 1S8DA 4YX2L 2OM5A 5BVJA 5DD5L 3DMMC 3FQUA 5F3HA 3S36L 1MIEL 3WDIA 5FOBB 2NY1C 5CSGA 4GSDH 4KK8D 1RZ7L 4OUOA 2VLLA 3NIDF 3HNSH 5J6GA 5FYJD 3ZHDA 1F02I 2QSCH 2ORBH 1RJLA 2AK4A 1TDQA 2AAVA 4UU9B 2QR0A 4I3SH 4JZJB 5C6TL 4M8QA 1ZGLA 2HKFL 4JFYA 2NY4D 2WBJB 3WNPA 4I5BA 1NBVL 1T1WB 3C5SB 3SCMB 1RZ8A 4M3JA 1MFBL 3HA0A 4Y19D 5LVEA 1I3UA 1T83C 2HMID 1T7XA 2XN9E 4JN2B 5EA0H 3OJ2C 1FRGH 5AUMA 3P4OB 3GSXA 3GMQB 3L3KB 5HHXH 1R6VA 2Q1EA 1BGXL 1HZHH 1K4CA 3MROA 3QIUD 4OZHE 1LK2A 1YY9D 4QY8B 4Y1AD 4B0MM 4ZDHB 4NGHH 3CDFA 2VOTA 5FYKE 5INCB 4OT1H 3EHBD 1BQSA 1GZQA 4HXBL 5CIPH 5TFSH 1CG9B 3B8YA 1P1ZB 4J4PA 1S7VA 3BXNB 2ADGA 5JDJA 5BQ7B 3MRCB 5DHVA 4MD4B 1EXUA 3KHQA 1VHPA 3IYLW 4K8RH 1K3IA 4PRDB 4YDKL 4OCLC 1NGQH 2FEEI 4KRLB 4OLVH 2O61B 5JA8B 3C8DA 4HS6B 3S37H 3I3EA 3C9NA 4P5KB 4RFNC 1KIQB 4MWFA 1RZFL 3KPLB 3MFFB 1FG9C 4S0SD 1OGTB 1CGWA 2RJMA 1AHWA 3MV11 4BK5A 3N0PB 5K9KA 4LCIL 1MPAL 1KN4H 3ZDZE 1WF5A 1JI1A 2GK0B 3RX8A 3QUXD 4U1LB 3RL1B 2YK1H 5TF1H 1NFDE 4X5LA 4GBXC 4AQOA 3TN0A 2ZUVA 5ANMA 4R26H 5FUCE 5HYSA 2HFEB 3C60B 5F9WC 4JFPB 5IKCA 4LAQH 4F58L 3DURA 1JGUH 3RTQA 1OOAA 1GSMA 5CSBA 3SGKC 1BAFH 1A7NH 1E4KC 2AV7B 5EFIB 2Z93A 2HT3C 3TBTA 2VN4A 1SYSB 2ZSWB 4EN3C 3BDYH 2PW1B 3U9PL 5L2KA 1XIWC 4N9OB 3EO9H 4YQXL 1VCAA 1IM3A 5HD8D 4IIQB 3HZYA 1AGFA 3WMSA 4A6YH 5FM5O 1A4JB 2ERJC 4ZS6C 3ZKQD 1S7UA 4M6NL 3ZL4H 5MENB 1MCPL 3OTTA 1WAAE 2EE6A 1RUPL 4QRTA 3BGMA 1C5BH 4Y4HB 3S5LB 1HINH 5GRUL 1JWUB 3RJQB 4H88L 1ONQA 3SKNB 3QUYD 4MNHA 1QYGH 1E4XI 4EBQH 2WP3O 5F6HI 1DDHA 3C2AH 2GITA 1UJ3A 5EORL 4PRHB 4G8EA 1OB1B 2DLFH 1KBGH 1B6UA 4NQXA 3GRWL 1SM3L 1JHTB 4BKLB 4L8SC 2DKMA 4ZOAA 5BOPA 3S37X 4H5SA 4HS8L 2FO4A 2GUOB 2VDLH 5LAXA 3STLB 5C0DA 5HDLA 5K9OB 2BVOA 4MX7B 4LSSH 1HKFA 2H6PA 5EPMB 5J6HB 1PLGL 3B2UC 4UOW1 2FGWH 1AIFB 1MIML 2Q76B 2LAGB 5C0BD 5LQBH 1OLZA 4HBCL 4UZGA 2R56L 2NY2C 4XNQA 3L7EB 5L7XH 3D87B 4FXGA 2DJUA 4PJXA 4BM7A 5TQ2L 1GGIH 5EBLB 2D0GA 1UC6A 3VFOB 3R0MA 4H20L 3ZYOA 1YYMH 2R2BA 3F7YB 2B4CC 4ZD3H 2DD8L 1UYWL 1D6VL 2VAAA 4R0LA 4O9HL 4JN1L 2NNAA 3DUUA 3M07A 2EYSA 3HKFA 1SMAA 4UTBL 3DMMD 2X2YA 2NR6C 5DJYA 2NY1D 4WW2A 3GIVB 5ETUA 3TVMB 4KKAC 4GSDL 3SJVD 4O2CA 3HNSL 3AMLA 2QSCL 1QFPA 2ORBL 2NXZB 1NFIB 3BZ4A 4WI4A 1A6AA 1I1YB 1I7UB 2CMRH 3HAEB 2ADIB 4I3SL 2R2EA 1MY5A 3QJHA 4C56D 1ZA6B 5EO1B 5DZOA 3QPQC 3ZDYF 2CUIA 2DM3A 1BQHG 4XNZC 4HEPG 5IFAH 4OZFB 2P5WB 3CK0H 3K8MA 5DQ9B 1EBPA 3MRBB 4JFHE 4XB7A 4ZYKB 5I75B 3IDIA 4CKVX 3D0LB 5EA0L 1FRGL 1J5OH 2CUMA 2PTTA 1KTLB 4LLUB 2Q6WB 1DQJB 5GPRA 3CD4A 4KPHH 5HHXL 2A38A 3DXAD 1M7IB 1HZHL 3RAJH 2VLRB 1JGDB 3AM8A 3BPLB 2O5XH 5CLTA 2VITB 4NGHL 2XY2A 4HUMB 4O2FB 4OT1L 3C5ZB 3T2QA 5AG8A 1FP5A 1OGAB 1I7RA 1HDMB 5TFSL 3ULUC 2UY6A 4PJ7E 3WD5H 1JGLH 1A47A 5EU3B 3D48R 1HXYB 1KJ3H 3F6IA 3CH1A 3X12A 1X44A 2DWDA 1YEDB 2P4AB 3O11B 4K8RL 4HGWA 2ATPA 3O41B 3QQ3B 5SX4I 3F5WA 5IW1B 1I9RH 4BSWB 1CI5A 1BVKA 1NGQL 3FFCB 3TZVC 4OLVL 1U8LB 5TH2B 1BIIA 2HLFC 3S37L 3MLYH 3QT2A 1KB5H 1KIRA 3GB7A 5HYFA 1WWWX 2OXHA 4EEEA 4QOKA 4L1HA 1W2KT 3VRIA 3QQ4A 1KN4L 3E2HB 2X4PB 3MYZA 4WHCA 2F53A 4GBXD 4U6TA 4I48A 2YK1L 5TF1L 1F3JB 4M6MH 4ZUSA 1D5MA 1JN6A 5E5MA 2ATKA 3BP6B 4NSKA 2ITDB 4D9RD 5JHLH 5JW5B 1EHNA 4I9WD 4R26L 4U05A 2B0SH 1A02N 2HH0H 4KRPB 3VCLA 4LAQL 1JGUL 3O81A 2BOCA 4XCNB 3VWKC 2HT3D 3QNYB 3BPOB 3G6JE 1BAFL 4EN3D 1A7NL 5HYJB 3DX7B 1XIWD 2DMBA 2PR4H 2E27H 1A6VH 1EO8H 1AGDA 3BDYL 4DZ8A 3K1KC 4CU7A 1NBZB 1A1MA 4P2QA 3EO9L 4ZS6D 3Q2CA 1XH3B 4NQEA 4QXTB 4WDIB 4A6YL 2R2HB 2KL6A 3JBG7 1MHEA 1Q9WA 4N90E 3ZL4L 5IMLB 4YEEA 1UFUA 1BECA 2CQVA 5A3IC 5FKPB 3AVEA 5ISZD 1KENH 1C5BL 1HINL 5IB5A 4NZRH 3CZFB 4WHDA 4XMPH 4IOIA 1QYGL 1W8NA 4EBQL 2IH3B 3C2AL 4PRID 5FM5M 5FM8A 2F9BT 4R7DB 1P6FA 1I8KB 5EZLA 4AH2A 4NQSA 3CFEB 3NIDE 3HE7B 2DLFL 3WCYA 1KBGL 1Z0MA 3VRJB 4GUPB 3AGVA 1CD8A 1WUNT 1R3LA 3T4YA 1KIUA 2P5EA 3BYTA 1B9ZA 2W0FA 2VDLL 3TLRA 2DN7A 2A74B 3B2UD 2V7HB 4UB0H 1OT1A 2YXMA 2NY2D 4LSSL 5BW7C 5E08H 3KDMB 1YEEH 2FGWL 5LQBL 1UH3A 3QUZA 2FRGP 2J7LA 5L7XL 4UNTA 2P8PA 2R39A 1JE6A 1DBKH 3AUVA 3RKPA 4OAWB 1GGIL 5JXEC 5LG1A 3GEWB 5MENE 2XQBH 1YYML 3KYNB 3GMNB 1IAOA 5TDNA 4ZD3L 3O3AB 1S8DB 1UACH 5DRNA 4K8RC 4M5ZH 5GRYA 1WCQA 5BVJB 2NR6D 3FQUB 5F3HB 1JZ6A 4GKOA 1SYVA 2VLLB 1ZSDA 5DEFA 5J6GB 1YC8A 4ODUB 4KKAD 4PRHE 1RJLB 1ZT4A 2AK4B 4POZC 3FN0H 2VL4A 2PYED 1UCTA 2QR0B 4M8QB 2E9BA 3MJ6A 5B21A 4Q9RH 4JFYB 3K4DA 4I5BB 1MHPH 1Z5LA 1RZ8B 2CMRL 4WEBH 3IFPA 2E6QA 3WN5A 4AENA 3QPQD 4CVWA 1PY4A 2BNQD 4AT6A 4PREA 3CFKA 4X4ZA 1M05A 3RWGA 1J1PH 5FO9A 4MZ2A 1CGYA 1IAII 4LCUA 1VFMA 1PY9A 1A6ZA 2XNAA 4NO0D 4G6FD 3GSXB 5IFAL 3CLFH 4P2OA 3WXVH 3CK0L 1IL1B 2EDWA 2V5SA 5ESQA 1K4CB 3MROB 1LK2B 3S3SA 1J5OL 4I18A 5AAWA 3UC0H 3EDKA 4CMHB 3QDMA 4KPHL 1ZS8A 4FZEH 5CUSH 3BVNB 1FNHA 5CMAA 3RAJL 1I4FA 2O5XL 1GZQB 2HJFA 3MV7A 4XHQA 1FN4A 4OGYH 3UTZA 5D96C 1AO7E 1S7VB 2MJWA 2E8YA 2ADGB 1SBBA 3OMZA 2HA1A 2OR8A 3QEGH 1W72H 5CBAA 1GAFH 2V9RA 1SJVA 3WD5L 2VUYA 2W59A 4Z7WA 1JGLL 1T66C 1KJ3L 1HSBA 3QWOA 5JUEH 3UCRA 3O6FB 3TZVD 3C9NB 2FLBT 4MWFB 2Z4QA 3NCBB 1I9RL 3D85B 3ZKND 1SEBA 3SDDA 4MNQA 3MCG1 1AHWB 4PJXF 5K9KB 3MLYL 1ES0A 1LP9A 2P5WE 3FO1A 1KB5L 1FC2D 3NFNA 3R0NA 3BUYA 4LIQE 4I3GA 2CKBH 1P7HL 3O2DA 2DLHA 4XP5H 3TN0B 5ANMB 3QXWA 1AKJB 5HYSB 4EZMA 2VLRE 3LD8C 4M6ML 3DURB 1D6EA 4HWBH 4WW2F 5JHLL 1TMCB 4NBYB 4NUGH 3VWKD 2CD0A 2B0SL 2Z93B 4G6KH 4TOYH 2HH0L 5MP6H 1OGAE 4G9FA 5F7DB 3FRUA 3L3HA 2OK0H 4HEME 1BBDH 3ESVF 1Q72H 5L2KB 1P5UA 2VQ1A 5F7WC 1IM3B 1U8QB 2PR4L 1AGFB 2E27L 4U1NA 1A6VL 3QDAA 1EO8L 2KDGA 4KUCF 1G6RA 1DQMH 2P45B 3PDOA 1I1AA 1CE1H 3NVQA 1HHHA 1BZ7A 4PJ8A 4JO4H 4QRTB 3BGMB 3SDAA 2XTJC 4GG6A 2IF7A 4MJIB 5A3ID 3LEYH 3FFCE 2A0LC 1L4IA 3QWRA 4BZYA 3GI9H 4MQXD 3IJHA 1DDHB 1JNHB 1T89C 4NQDD 1KENL 4WUUA 5BV7H 2GITB 2P8LA 4G9DB 1UJ3B 1MCLA 2GKIA 4NZRL 4WWKC 4G8EB 4XMPL 1URLA 4NQXB 3DYPA 3O2VH 5EU7C 5DT1H 2G2RA 4FQ1H 4Y2OA 4IM8A 2YRLA 3QDGE 1BWMA 4H5SB 2FO4B 4JM4H 5D5MA 3L9RB 3L3IA 5LAXB 5C0DB 1F6LL 5IM7A 1IILE 5F7EH 2R29H 2H6PB 5DZLA 2DQGH 5H2BA 4XNQB 4TVSa 3ZDYE 2W9LA 4FXGB 4UDUB 2EH8H 3KHOA 4CJ1A 4UB0L 3VXOA 1CDHA 3HG1A 4PJXB 5E08L 2FL5A 1JTPA 3FMGH 1YEEL 1N3NA 1DEDA 5C09E 2JJUA 3SQOH 2R2BB 5JXED 2BCKA 1QHOA 1DBKL 2PO6B 2VAAB 3OSKA 4R0LB 4LVNB 4MB4A 3F7PC 2NNAB 2ZZUT 3DUUB 4GAYA 5B39A 2XQBL 4BYHA 4K8RD 3PXJA 2LTQC 1U3HD 4R97B 2FECI 1UACL 5DJYB 4M5ZL 4WW2B 5DJCB 5C0AA 5JORA 3VGFA 1CICC 5C3TA 4RMRA 1YNTA 1WISA 5ETUB 4D94A 4POZD 1E4WH 4O2CB 4D0BA 5EBWA 3BZ4B 5HHME 3FN0L 3UTTD 1DN0A 1YPZA 4GQPH 3D3VD 4QRUA 4WFFD 1XGYH 4Q9RL 2R2EB 2Z8SA 4GW1A 3UPCA 5FO7B 1MHPL 4JFEB 2BHYA 2OL3H 4WEBL 1IQWH 4K7PH 4ZQKA 4J23A 3MUJA 1J1PL 1C7SA 5DSCA 3IDIB 1KCLA 2P1YA 3I6KA 5D70H 4NRZA 2PTTB 3CLFL 3WXVL 2IQAA 3S97C 4PJCF 5HDBE 1DLHA 3ZT7A 4OFIA 5I66A 3VXTA 1KLGA 1FNSH 4KKLD 3UC0L 1PZ5B 4IRJC 1N8ZA 4FZEL 5CUSL 3KJ6H 1V3KA 3Q1SH 2OR7A 1I7RB 2EYTA 4LKXA 4OGYL 2P43B 5LJYH 4FG6C 1T1ZA 4FFVC 3CH1B 3X12B 2DWDB 1T66D 3QEGL 1W72L 1GAFL 1ZMYA 4QRPB 4HGWB 1JYWA 2ATPB 3F5WB 4NZTH 1BVKB 5JUEL 3GMRA 1BIIB 1YMMB 4P46C 4G3YH 3IRPX 1KIRB 3GB7B 5FGCE 3OKKA 5J8OA 2WINA 4QOKB 4N5EC 5FAAA 3VRIB 2VLKE 3QQ4B 2C5DC 4PGDA 5FCSH 2BXZA 5C07D 2F53B 1GYAA 2CKBL 4ZUSB 4OCRH 2QEJA 1D5MB 1JN6B 3UZEA 2PW2B 2ATKB 5EO9A 2GAZA 4XP5L 3UTPE 5E9DD 1R3HA 3MA7A 2AS5M 1DLFH 1NGYA 3VCLB 4K7PX 4LPUA 4X83A 2R15A 1G6VK 2GTZA 2C3WA 4H0GA 3CSYA 4HWBL 4RMTA 2VIRA 4NUGL 4AEIH 5ACLA 1J0ZA 1T7WA 3RP1A 2J8UA 4G6KL 4TOYL 4M1CC 5MP6L 5DUMH 2OK0L 3MJ9A 1AGDB 5AYUH 1BBDL 3F12A 4DZ8B 3UBXA 5EUOA 1A1MB 1Q72L 4P2QB 4N8VB 4Z5RA 4NQEB 5LGHH 2H2PC 1NC4D 1ZGLP 4UTAH 1MHEB 2XTJD 4N0YH 1DQML 2BSSA 3RRQA 3ZMRA 1CE1L 1WZKA 3MRPA 4PJCB 4TTDC 3QAZC 4JO4L 4ODXA 1LDSA 4PY7B 2DLGA 3LEYL 2EDLA 5IB5B 2Q8BH 3BI9X 4IOIB 4PBVC 2I5YH 1J0IA 1HHJA 3GI9L 4WWKD 2F19H 4HKXA 4CUCA 4DUXA 2PYFA 5BV7L 3R06A 4AH2B 2HRPH 43C9A 4F9LA 2OQJA 4NQSB 1ETZA 1EEUA 5B4MC 1PKQE 1R3LB 1JIBA 3O2VL 3SHSA 4YBLB 5ANME 3T4YB 5DT1L 1HI6B 3O3UN 4FQ1L 2P5EB 4LOUC 1INQA 3NN8A 3RY6A 2W0FB 2VZOA 2JE8A 4HKBA 4JM4L 4XNMA 2CDGA 5FYLH 3KS0J 5F7EL 5JLZB 2R29L 2HFFA 3STBA 2DQGL 5C86A 2KBGA 5L2KE 4Z7WF 2EH8L 2CLRB 2VZTA 1N6UA 3FMGL 3BH8A 1ZTXH 1NBYB 3SQOL 1IAOB 5TDNB 1WWBX 2DL2A 2PCPB 4L3EA 4MJIE 5I15H 5DRNB 4QGTA 1DBMH 4X4XA 1I9IH 1LP9F 1CICD 1SYVB 4B53A 1H9VA 1H15A 3WFZA 5KBNC 3JZ7A 5DEFB 4ZFOA 2X42A 1ZT4B 1FNEA 5I8EB 3F62A 2Y1VA 1OCWH 1IZKA 1E4WL 1NC2D 4ZO9A 4F7PA 3T0AA 5H37H 1P69B 5FK9B 3VRLF 1Q94B 3IFPB 3C8KA 4AENB 1XGYL 4AT6B 1PSKH 1F42A 1NEZG 4PREB 3CFKB 4JRYE 1A7OH 3T4AA 1M05B 2LAAA 1UXSA 3VWJA 3BGFB 3HTLX 4LCUB 2OL3L 1A6ZB 2K7QA 4OI7A 1IQWL 2XNAB 4K7PL 2JK5A 4P2OB 3UDWC 1UA6H 3I6LE 4PJXE 1T03H 3ELAT 1ZXQA 3RNKB 2ZKHH 4NNPH 4JY4B 1ZHKA 5F9OH 3HNVH 5ESQB 2AQ1A 5D70L 1X6NA 2Z35A 3L3GB 1ZS8B 5F9JA 5E1AA 5E03A 3UJJH 4FXLA 1AD9A 1MY7A 1JP5A 3DRTA 5CMAB 1KB9K 1I4FB 1DEEA 1DUYB 2HJFB 2Y23A 3MV7B 4BJLA 1JRHH 1FN4B 1FNSL 3UTZB 1AQKH 1J8HA 2C3HA 5BRZE 9CGTA 3KJ6L 4HDIA 3Q1SL 2A83A 4LLWA 5BMFH 4FG6D 4CU8A 2BVPA 4FFVD 3EFDH 5CINH 2EE9A 2QHRH 4Z7WB 1JZ3A 4JCMA 1HSBB 5D5MF 5BV7C 1NKRA 2ZCHH 1T21A 3HMXH 3T09A 3QWOB 1L9MA 2XIDA