2BSED

Structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
VQLQESGGGLVQAGGSLRLSCTASRRTGSNWCMGWFRQLAGKEPELVVALNFDYDMTYYADSVKGRFTVSRDSGKNTVYLQMNSLKPEDTAIYYCAARSGGFSSNRELYDGWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR BINDING PROTEIN
publication title Lactococcal Bacteriophage P2 Receptor Binding Protein Structure Suggests a Common Ancestor Gene with Bacterial and Mammalian Viruses.
pubmed doi rcsb
source organism Lactococcus virus p2
molecule tags Receptor
total genus 26
structure length 122
sequence length 122
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bseD00
3SE3A 4FMKA 1FNGA 1KJVA 1KIPB 3OKLA 5CFHA 1AGCB 4U6XB 1FZMA 2JE8A 1F4HA 3VXUA 1CGXA 5F8RC 3U36B 4P2RE 5CEZE 4NNPL 5TQ0H 1MELA 2YBRB 4GRLB 1IEBB 3NABL 4QRRD 4KVNH 4UU9A 4XMKH 4BH7B 5IWLC 2PO6D 4Z78A 1JUFA 2Q7YA 1IC1A 3MV8B 3UAJC 1TZHB 5ID0A 2SEBB 2HFFB 2YSSB 3EW3B 3IJHA 4OD2A 5DFVD 1DN0B 1Q0YH 3NTCH 1GVIA 1D9KB 5JOEA 4RFNB 1X4ZA 3KS0H 4JLRB 3TBTA 5DFTA 4LHUB 1U3JA 1ZKAA 4UI2A 3QIUB 5F97E 4G7VL 3WUWB 4QOKA 3HAEH 4XCNA 3MJ9H 4XX1E 3A6BH 3C5ZD 5KW9H 2AXHA 2P24A 4OIIH 3QDME 5GSVB 4JM4L 4PS4H 4HXBH 2DMCA 2P8MB 2KL6A 4GBXA 5AYQA 4MB5A 4ZAKD 4M9OA 2XIDA 4KKCC 2FJHB 1NAML 3VI4E 3HNVH 3HC3L 4TTDC 3TPUB 1I3VA 2BHUA 3MRCB 3MLSL 5J4MA 2PKDA 2BOBB 2O5YL 3IDYB 3JSSA 3N85L 3FQWA 3ROLA 5D72L 5IK3A 2C3GA 5D5MF 5C0BB 2ZPKL 1FFOB 4K2UL 4MCYB 3UJJH 1O7SA 4NQCE 2CH8A 5BQ7B 4WO4D 3WUZA 4JFHE 3DIFA 4TULL 2R15A 5BRZA 1MCDA 4PGEA 4KC3B 2ZCLL 1NJ9A 3K8KA 4TVPL 3ULSA 3SKUD 4M61B 2B4CH 3HNSL 4RA3A 4XPBL 4M1DH 1OAUH 1GZPB 1AE6L 2W9DL 5IW1B 1WWAX 2YD8A 3T3MF 4ZDHA 4XBPB 1JGEB 4OI8A 3TYFB 1IAIH 1HSAB 1UM5L 2Q86B 4PRDA 5LCVL 3S3SA 5BS0A 1OAXL 2JLLA 4JY6A 4NWTH 3I02B 2WP3T 5CUSH 2VN4A 1RHHA 3MV7A 4KJQD 4JO1L 4KJWC 4OCSL 3O2WL 3NFSL 3IJSB 4N68A 4QWWC 4HUUB 1H5BB 3PP4H 1B0RA 1I3UA 3OHXA 4P48A 4M8QB 3H8NA 1TVDA 4IIQB 4XVJH 5DJ8B 2H2PD 4HGWA 1G7LB 4TUOB 1XH3A 3ZTNH 5MEPB 4K3JH 4M03A 4ZUTB 5FYLE 1UACL 5CHNB 4PJXE 1IFHH 3U9UB 1INDH 4ODWA 2AV7A 3HNTL 4W6WB 3TO4D 5JIPA 3ZKNC 1BFSA 2RGSA 5IOPB 2VXTH 3WLBA 4NN6B 3BP4B 3O3EB 1NAMA 5D6CA 3DXAB 4NDMB 1NLDL 1EBPA 4YHOH 4UTAH 4LASL 5I8KL 3MJ7A 1KCSL 4K7PL 2HT4D 5C8JB 4PRIA 4G9FE 5IMLA 1HKLL 3RAJL 5KOVC 3RNQA 3OGCB 4U05A 3CNKA 4MMZC 4OM0H 5C86A 2NR6C 4XCFH 1W0WA 2EKSA 5JORB 1I7TB 3QEHA 4O2FA 5CP3A 3ZLQC 2NTFA 3C2AH 3SDCA 4ZSOA 3TH3T 4Q9RH 1OP3H 2DQTH 4PYGA 3FFCA 1J8KA 4R2GC 2WW8A 1RHFA 5CWSB 1TZIB 2W0LA 3FT4B 3DO7A 2DQGH 1UADC 3M8OH 3BN9C 3MA7A 5JOFB 4DZBA 4P49A 3VXRE 1A02N 2Z8VC 5F7MC 4ZS7H 1HQRA 1E4KA 2HJKA 1HEZA 1A3QA 5DJ0A 1IM3B 1BIHA 4WCYL 1SEBB 5J11B 3BKCL 4YLQT 2HRPH 3UROR 3CFBA 5GS0H 1XT5A 1JGDA 2G75A 2GSIA 2H6PB 2W60A 4L8SC 3S4SB 5FECB 3U79A 1J1XH 1Q94A 1G7PB 2BSRA 5DQDL 4J1UA 4MQ7A 1FBIL 5F89A 1T03L 4S1DC 4EVNB 2BC4A 4WW2F 4WTWA 5TDPA 3AS2A 5C3LD 3BZEA 2YD3A 3MV9D 2VAJA 3RA7H 5GRYA 3UPCA 5JLZA 1B0WA 4NHCL 1V3JA 4GAJL 4OZGA 5DK2A 1I9IH 3VCLA 5JUEL 2LVEA 2VSCA 2YPKA 5IW6A 3AB0C 5CBEB 3RWHB 1PKQB 1BLNA 3GBNL 3V79C 1W72H 3I9GL 1MCKA 5F88A 1KULA 3BIBX 2FX7L 1A6ZA 5HYJD 4D0DB 5KG9B 4M7JH 1OTUC 4I77L 2VC2H 4J3VA 5EBWA 3V4VH 4PJ9B 3TWCL 3EGSB 4O02H 4UZGA 3DUSB 1N6VA 2CSPA 4NKMA 1QSEE 1N0XH 2BNRB 5BW7C 4A6YL 4K9EC 4EUPG 4N0CC 3C60B 1MI5E 4KJYA 3FKUS 3HB3D 2UVFA 2R1YB 4Y89A 5I1AB 4R4BB 1NMAL 2FGZA 1RMFH 1BD2D 5I1DA 3RVWC 5A16B 3U0PB 1DBKH 2P5EE 4DGYH 4JREC 1NGQH 4L8SB 2CMRL 1VADB 2NY0B 3ZDXF 4P4RA 5DJYB 1K4DA 4BSVA 2J8UF 2N7BA 1ZHBB 5D93C 3SE3C 3WDJA 2DMKA 4KHTH 4HV8B 4JFPB 1LO3L 1DBJL 1RUAH 2OTUA 5E2UL 4XB8A 5GZOD 1WEJL 2E27H 4X8JA 2P4AB 4ODVH 1MRFH 2PYEA 5GRZA 3L95A 2HH0L 4OI7A 5MHSE 5DEGA 2RFXA 4Y4KD 1P4BH 3AB0B 4ONOA 4MAUH 4F37F 2RIKA 3RKPA 4XC1H 4PJEE 1ZTXH 3SDDA 4NRYB 4FFVD 1ZA6A 2AXGB 4YXHL 1PZ5B 3A6OA 2F53E 5FYJE 1CICD 3MYZA 3P4NA 2H8PA 1P5UA 1Z9LA 3MRQB 4ZFFB 4LPUA 3PWLB 4JM2D 1YNLH 1GOFA 5JHDB 5GHWH 4YPGB 3AFLA 1PGRB 5CIPA 2AGJL 4RAVB 3C08L 5F7YC 3BFOA 3V0WH 3MBEC 1BZ7B 1BQSA 1FC1A 2EDQA 2FATL 1OD7A 1ZHKB 4LP5A 5ISZE 1AGDB 2D9QB 3TNMA 5A40E 2W9EL 2ADIA 3QUMA 4I5BA 4XPHL 4TNVK 3PQYE 3N0PB 4DEPB 1EZVX 4GBXC 4MAYA 1IGFL 2V5SA 3TBWA 3O6FA 5DQ9A 3RGHA 1MHHB 4AMKH 4FABL 1CCZA 5HDBF 4A6YA 1RJZB 4QT5B 4XPAL 4PGDA 1D5MB 3KNBB 3MRIA 4L5FH 4LIQH 1UKTA 3TV3L 3DV6A 4BZ2L 2ITCA 3H9YA 3RWGA 1HH9B 4Y1AE 2QQLL 3QULB 1FZOA 3OPZH 1G7JA 3KWWA 5IMMB 2OBGA 1FL6B 5SWZA 3QHZL 4NBXB 1BX2B 3BEWA 3D0VA 3KYMB 2IF7A 3B2UD 3LKQB 2CJUL 2BSTA 1DQDL 5DJXA 1Z2KA 4KI5F 4KUCD 2O93L 5FA4B 2QSCH 1UZ6E 3D2UB 1A64A 1IC7H 2EDOA 1F90L 3P73A 1KENH 3WS6A 5KSUB 1H0DA 2HWZH 3PE9A 1D5XB 4HWNA 1N59B 5FOJA 4FNLH 4APQA 5B8CC 3FOMB 5T3ZE 3EJYD 2QADC 5EBLB 1MY7A 5AEAA 5H2BA 1MQ8A 3ARUA 3FQUA 1ZLWH 4Y4FA 1OTTD 3HRZA 1DANU 2Y07L 3EHBC 4GKNB 4LAJH 4UOW0 1N5AB 3WLWD 1DQQA 1P7QA 4XXDB 1CE1H 2QV2A 3REWA 1RULH 1DJSA 3QO0A 2F54E 4XAWH 1GJIA 2ICES 1S9WA 3EJZC 3VFPB 4BA8A 1IBGH 4OGYL 2VQTA 3R8BB 5CGMA 1FDLL 5B4MC 5EPMB 3WBDA 2NXZC 3RUGB 1IM9A 5FK9A 1ITCA 4AG4H 4GQ9H 3TIEA 3OJ2C 3GK8H 4OZFH 4PJAB 1YC8A 1RIVL 2HT3C 3FQRB 3ZHLA 4BSJA 3SE9H 2AK1H 1I8IA 1UVQB 2Z92A 4L4VD 4K3HA 1OOAA 4KGLA 3QUYD 3FTGA 4BQCA 1BOGA 3SOBL 5GGSB 4GS7C 3GMMB 4O51A 1CLOH 3VH8G 4PY8I 2YD4A 1P53A 3DX7B 3F7QA 1A7QH 2GUOA 4EDXB 3TLRA 2D0HA 5C6PB 3B5TA 1A4KA 3STBA 5DJ6A 2QADB 1BF2A 1U9KA 4CW1A 5I30H 4NO2B 3CMGA 2EKJA 5EWIL 2H32B 3WE6B 4NQED 2HMID 4Q58C 2F19L 4LAQL 1KCKA 2Q8BH 3MJ8A 3LD8C 2QTEA 3QNZA 4PJCE 3S37L 32C2A 2OL3L 4X9BA 1KJ3L 3RIAF 5HGDA 1ZOXA 1MRDL 1DDHA 3BW9A 3FAWA 1UWGL 2ADGA 2E5EA 4P5KB 3TO2B 4TPRL 2K7QA 1GGUA 1I7UA 1DUYA 1XGQA 3MGTB 1WWCA 5EIIA 3U0TB 3N1MC 2IBGA 3U2SA 5IT2L 4UT6L 1B2WH 3KGRA 3SQBA 5I1CL 1EHLH 4QTHB 3EOBA 2APXA 4DN3L 1E4KC 3L3OB 1OAKH 3OKDB 4JANA 3D87B 4Y2DA 5T1KA 3WFHA 1OAYH 2ZUSA 3KPRD 1FYTE 3QUZD 3DX9A 5EG6C 3OKKA 1MCEA 5K9JH 5DD3L 2RAMA 3ARTA 2VL4A 4GSDL 2CUIA 5EORL 5C92A 1MHPL 5GISL 1HOCB 2LE9A 3IDIB 5F7NC 2MHAA 3S97C 2I07B 2C1OA 1X44A 3WSQH 1TZGH 4RAHA 3RFZC 3OR7A 2DQCL 3CDYA 4HK0B 3O8XB 3T0DA 3B6SA 1FJ1B 1OF2B 1KG0A 2P8LB 3PP3K 4IM8A 5E56A 5LGJA 2PXYD 5L8LB 2DM3A 4Y5YA 1FL3A 4YDIL 1CGVA 1K6QL 5DC0A 4NN5C 1FNHA 2VRAA 3MLXL 3O4OC 2YKLH 5FV2A 1F5WA 1EJ6A 4NM4L 4OZ4A 5EFIA 4F33B 3DX8B 1EFXA 5D7IE 4N8VG 2R1XB 2R0ZL 5DEFB 4PJ8A 2VQ1A 3OKEA 4P4KD 5CKGA 2NZIA 3ULVF 3FONB 2NCMA 4FFWC 5BV7L 3V2AR 4L3AA 2MSPA 5I1LA 4YDJA 2Y5TA 3QAZB 5C09E 6FABL 3JV4A 3VU2A 1I3GL 2BERA 1K8IA 4O2CA 4DJMA 4ZXBA 1M7XA 2OCFD 1UJ3A 4CNIA 4QHNB 5FGSA 4E41D 3WNNA 3TFKD 4MJIA 3WO3B 2OK0H 5EO0A 2MQ0A 2AEPH 3LKSA 3WKML 3P9WB 3HI1A 1AGBB 3MRHA 5GS1A 2AV1B 1SYVA 4RMQA 1S9KC 2YPLE 4ZNEE 5E00B 5ADOL 1A6AA 4V2CB 3S5LA 5LGHL 4R8WL 4YWGH 2FO4A 2I9LA 4M7LH 3G6AB 4PRHD 1P1ZA 1A6VL 2WWMC 5DMYA 3ABZA 4G3YH 2X4QA 3QDGA 3E6HA 3SDDC 1MIEH 4OBRA 1LDSA 1LMKA 1DBAL 4CVZA 3GJEB 1TTFA 1MVUB 1Z9OA 3B8SA 4KUZH 5A43C 3O4OB 3QWOA 1MLBB 4WW2A 3MRGB 2DL2A 1KLFA 4DW2L 1MFAL 5J13B 3IXAA 3FMGL 1F3JB 4ZFOL 3IDNA 4NNPH 3S35X 4JQIL 3P0GB 1WFTA 3RWIA 5GRVL 5IB5B 1I8LA 4ESKA 2ZUVA 4HUNB 4JGJA 3NABH 4MXVE 1JF5A 1FP5A 3KHQA 1EHNA 4GAFB 5ENWB 4NUJB 2EE3A 4UIMA 3GSOA 3IDMA 5F6HJ 3G04B 3U46B 4UT9L 1U93B 5E8EA 3WHXB 4XNMA 2Q6WA 3HUJB 5CMAB 4LCCB 1H9VA 1TQBB 5TE7L 2MKLC 4GW4A 4LCIL 4LQFL 5GS3A 4X98B 4GRLD 4TUJA 4TNWF 3MRKB 1F6AB 2MPAL 4YPJA 3GMRB 3O6FC 1CQYA 3NCCB 3G6JB 5L2KD 5DUBA 2AJ3B 3MV8D 3QO1A 7FABH 4GAGL 5T1LB 3CLFL 4R26H 3J7HA 2ZCKL 1MAML 3EYOA 3L6FB 2GFBB 4G7VH 4P59H 2L4OA 2VL5A 4PTUB 4KK5C 3V5HA 2APBA 1D9KD 1AGCA 1RVFH 2X4NA 4JM4H 4UBDC 4WI9A 2AQ2A 3FO1B 4MNGA 4LHUD 4FQ1L 3U36A 2J8UA 4YZFF 3UTTB 5J1AB 3PWVB 4NQXB 2YUZA 3FN9A 1FO0B 3O2VH 4BH7A 4FQLH 2WZPD 2WINB 3PWJB 3KLSA 2O5YH 1WQVT 1F4XL 3N85H 3NPSB 1TZHA 4PRPE 4XRCB 3S34H 2IALB 3SJVB 2B8OT 2HFFA 4WUUE 1K3ZA 3P4LA 1DN0A 1YNKL 3TN0B 1BJ1H 3GSXA 1N64L 1DLFL 3HKFA 1HN1A 4LSQL 2AKRA 4L3CA 1INEH 5L7XL 4JRXD 4I48A 4TULH 3ZSTA 1BIIB 4Y4FC 2ZCLH 5E9DB 4HGKC 3QIUA 4URTB 3WO4B 2HG5A 5J9PA 3VFVA 2EEDA 2R0KH 2A1WL 3WUWA 4ZFOA 1INQA 3HNSH 4XPBH 2HT2C 3UAJD 1IILE 5E5RB 1IL1B 1RQ5A 4PIRF 1AE6H 3U48A 2W9DH 4JFFB 2Z93B 3V6OE 4G42B 5C6TL 3U6RB 1TXKA 5B21A 2GY7B 3NOIA 2YC1B 4ODXA 4QRPB 1EXUB 3G5YB 3E3QE 1B9ZA 5LCVH 5KSBF 2Q3AA 5FKPB 4G5ZL 1OTSD 2QBWA 4MYWB 4X9GA 4N8PA 3O9WC 4J6RL 4JO1H 4OCSH 1IGCH 4NQTA 1CYGA 3LN4B 4MX7A 4OJFL 2CKBB 3BDBA 3NFSH 1RIUL 2EEBA 1FYHB 3A67H 4FQ2L 5D7SL 1MVFA 3CSYB 1NGWB 5C0BA 3KXFE 4Y19A 3SKOB 5LGKA 1WLHA 4MQXD 4WFHE 2HJLA 15C8H 1R6VA 1E0OB 5GGTL 4IDLA 1BJMA 4KKCD 4ZFZA 1UACH 3I84A 2HJFA 4M61A 4TTDD 4MA7H 3DGGB 3ALXA 4NJ9L 2CDEA 3RL1B 1K2DA 2W65A 3QDJD 4CADB 1JBJA 2NW2B 3BZ4A 3QDHA 2NX5E 5IW1A 4K3DL 2A77L 4JPKL 4ETYA 1IC4L 1S9YB 4GUPB 3TYFA 3QH3A 4F58H 2AS5M 3GNMH 1QFOA 3X13A 5JR1H 1P7KA 1KCSH 1U41A 4K7PH 1IAOB 3U9PL 2YD7A 4MNHB 4WWKC 2DLEA 3EUUA 4PJHF 3CDGB 5JZ7C 3ZKSD 3ILPB 4Z6AT 3PWPE 2NY6B 1OP3K 4PJ5A 1U6AH 3IJSA 5DURB 4HUUA 3MLYL 3V9FA 3BKML 3ELAT 5FM5O 1RY7B 2NY5L 2EDKA 2OQJB 1MJ8L 5LQBL 3ARSA 4IIQA 3ARZA 3QFJA 5DJ8A 1FIGL 1PQZA 3DUUB 4Y2DC 5KSAC 1JPSH 5IFJA 1G7LA 2E9IA 2Q8AL 4JKLA 3TYGL 1PX4A 5MEPA 2P45B 2VWEC 3LEXA 5CHNA 3G9AB 1RZ8B 4GKZB 1CD8A 1GGCL 2GSGB 3K8LA 4JVPA 2EYTA 3LN9A 1RZJL 5CSGA 1KPUA 4J3TA 1D5ZB 3MLUL 4TSCL 4NSKB 2VYRE 5F9JA 3DXAA 4QWWD 4GW5B 4NDMA 5DVLA 1PDKA 2QJDA 2AK4A 2IAMA 5DS8B 3GBMH 4OQ1A 3GKZA 1I7RA 5KS9F 1P84K 4WCYH 1VERA 1CDIA 2WIIB 3VWKB 1X3DA 4Y5YC 5B38G 3RWEB 1OQXA 2LU4A 1FBIH 3PDDA 3K8MA 5F9AC 1LNUA 1RURL 3RGVB 3MACL 1BFOA 3ZKND 4QNPF 1U8JA 5GGTA 3X3GL 4OF3A 2V7NB 3OGCA 4WWKB 3B9DA 4WI5A 5ICYB 4IRJC 4EJ1C 4PJ8C 4KMLB 4G6KL 2ZSVA 2BOCB 1FFPA 2VLMD 5KSAB 3GBNH 3I9GH 5CWSA 3MRLA 3FT4A 4UDUA 1Q38A 3KPNB 4GW1B 4HT1L 1IGJA 3PWNB 4I77H 4ZXBC 3TCLB 5ITFB 5HHOD 1SVZA 4AQ1B 2EE9A 3MUZ1 5I9QB 4U1SA 1GOGA 5DHVH 3VFSA 3AAZB 2BY2A 4HUWB 2NR6D 2VXSL 4L8CA 4N0RA 3VXNB 2GCYB 4DUXA 1UGNA 3OR6B 1KEML 3EO9L 4NQCB 5GS1C 4A6YH 1X4XA 1D6VL 2H6PA 3NCMA 1P4IL 1RK0A 2LAGB 4FS0A 4PYHA 3BP6B 3M45A 4NPYB 1NMAH 1AH1A 1KGCD 3QI9B 1JWMB 1ZVYA 4HIEB 5T3XL 4R2GD 4N0FA 2CMRH 2F58L 1MQKH 3T0EA 1CGUA 2ZUQB 1QPPA 5F7DA 5HI5C 4KPHL 3BN9D 4YXLL 1CXHA 5DC9B 1U91B 1HXYB 2OZ4L 4MS8C 3BMVA 4WW2C 1UH4A 4PRBA 1ED3B 5FDWB 5J6GB 1DBJH 1IEAB 4IRJB 1S7RA 4FQJL 1PKQA 2P7TA 1ZLSL 2HH0H 1I8LC 1N3NA 1NGPL 4D0DA 4S1DD 4FG6C 4MWFA 4PJ9A 3NGBB 2PW2A 1QACA 1XF4B 3EGSA 4RIRB 4N0YH 5CEYB 3DUSA 3EDEA 1KJ2B 3GI9L 2JB6B 4RMUA 1G9MC 3DV4B 4AEIH 4C56D 1MFNA 5AZEH 5I1HH 1NEZG 4NOFA 3C60A 4ISVB 1PX3A 2JF1A 4QY8A 5IW3A 5I1AA 4PJXB 1PSKL 3ZHKA 1CIDA 4V1DD 1OWRM 3N9GL 2AGJH 4UUJB 5BV7C 2OS7A 3C08H 4JN2B 3K3QA 1OTUD 5DJYA 3GSVB 4YHKL 1KT2A 3E8UH 3OGOE 5DRXA 5A3ID 4P23B 2W9EH 3WFZA 4BZYA 5I8CB 5JW4R 2OI9B 4JFPA 5FF6B 5JHDD 2WLZA 3UTPD 4XPHH 4EI5B 4Z7OF 3MOAH 2DQFB 3IDXL 1IGFH 1NBYB 1ZT7A 4H1LB 5E1HB 1MCBA 1RUQL 3FQNB 3MJGX 3ZDZE 1OLLA 3RVWD 2YN3A 4FABH 4IOSD 3EOTL 3IT8D 1RJYB 4F2MA 4NRYA 5C0AA 5LBSH 5GGQH 4ORGB 4GAYB 4WTXA 4EEEA 2AXGA 4M5YL 3DTXA 4C54A 4ACPA 4HGMA 1TFHA 2YOCA 3R4DA 4ODSL 3H9HB 3BT2L 3AS0A 2QQLH 3D39D 1AGFB 1HNFA 2BRQA 2I27N 4HXAL 1MLCA 1TITA 3ARVA 1EGJH 1FCGA 1F2XK 3QHZH 1SJEA 3K1DA 2D31B 2OZ4A 4PP1C 1EEQA 4RAVA 2Z4QB 4JFOB 3MLTB 3PGFL 1FIEA 4ELMF 4R7NB 3LPWA 1F13A 1T1ZA 2JB5H 2CJUH 1DQDH 3STLA 4AYFA 1AGDA 1CU4L 3DMMA 5E2VL 3PJSA 4HIHA 5A2LH 1F90H 1KTRL 1WICA 1IAIM 4MMXC 1SJVA 5FKAA 3U7YL 4KRNA 2JCCF 1QP1A 3V5KB 4U6VL 2OJZH 3BH8B 4WFEE 5MP6L 3WDIA 3J8F7 4UB0L 3H3BC 5DQJA 3D2UD 3KNBA 4JG1L 4HPYL 4NQVA 2BZDA 4YAQA 3LSOB 3MBED 3QCVL 4NC1E 3QB7C 4QOKD 5BO1H 3I2CL 1CFQA 2CDGB 1HH9A 2BNQE 1X7QB 3QULA 2PYFA 2VLKA 5JOPE 2V7HA 4OGYH 3IAPA 3KLHC 4N1CA 4P9HC 2DLGA 3UTSA 1CXLA 4GBXD 5E8DL 2WV3A 1BX2A 2A83B 4BKLB 5I0ZA 2VABB 3GIZH 3U7WL 3FHAA 4O2EB 1G7QB 4LNRB 1N0LA 2MNUA 1KNOA 6CGTA 3WYRA 3DNKA 4MJ6B 4NNXB 1M6OB 3C6SB 1HIMH 4KZEH 4KI5C 5EU5A 1NCUA 5EUOB 1D5XA 1IAMA 3PNWB 3SOBH 3BIKA 4R4FL 4YHMH 3TEUA 3S7GA 5EBLA 2X44D 4P5TC 3BUYA 4YHLL 3BZFB 4KTYA 3V0VA 3F12A 1OP9A 3FB7A 5FYKL 1WC7B 1U8OB 1RUPH 4N90D 1MWAH 5D1QC 4JFQA 5IB2A 1E4JA 2WBJC 3WFBH 2NMSA 3NA9L 3L3DB 4YK4C 5E08L 4XNXH 4C4KO 5CILL 1UCBL 3VFPA 1G7MB 1IMHC 3BN3B 1KBGL 2VXUL 5JW4Q 4Q6IA 3FB6B 1KIRB 2XXCB 1KXVC 4LAQH 4MJ5A 3F62A 5DI8B 5EPMA 4L9LC 3MV11 5TPWL 5DJDB 5CJOL 2OL3H 3RZCC 5BS0D 1KJ3H 2QADD 3NH7L 3Q5YA 4PJAA 4PJEB 3O6KH 3SCMB 3W9DA 1DQML 3EHBD 3VFOB 1L0XA 1CDGA 5FYKU 4ONGH 5IT2H 5I1CH 2ZNWA 3EJZD 5E7FA 2DLFH 5I8EA 4M5ZH 1BAFL 3DX7A 3CLEH 5B4MD 4ZTPL 1YEHL 4PBVC 4EDXA 1GGIL 5CAYB 1UWXK 5E6IB 4JB9L 4BFIA 3G5ZB 3KVQA 2NXZD 4NNYB 3D25B 1VFBB 5DD3H 5E8NB 1CDYA 3HZVB 1XCTA 3A6CH 2YRPA 4P5TB 3NIDF 4GSDH 2HT3D 1JV5B 4PJ7E 1MHPH 5H37H 5GISH 2ID5A 4P2QD 5ETUA 3QEQB 3WE6A 1I85A 5D1QB 2WBJB 4Z7QE 1CIUA 2DKSA 5BVJA 4QRQA 2YXFA 4HS6A 3EZJB 3DVFA 35C8L 3GRWL 1KIQA 1VGKB 3L1OH 1VEMA 4FTVE 1MNUH 4JO4L 2IGFL 3U4BL 2VDNL 4I2XA 4P5KA 4IOIB 4NGHL 2HA1A 4OB5L 4HWBH 3MLXH 2DI9A 1ZEAL 3QQ9C 3O8XD 1Y0LB 3MLZL 5I1GL 4PJHA 3DVNA 3TA3B 2K1MA 3L3OA 2R0ZH 1KXTB 5HHQB 2CPCA 4QRRE 2NY7L 3OSKA 1UFUA 4MCZB 5CJQL 3WFEH 3ZT7A 5HYSA 2P46B 3UBXI 4JZOB 3L3IB 5F44A 4AL8L 6FABH 3ROOB 1WUNT 5I6XB 3BPOB 1I3GH 4WI2A 1BQLL 4Y16C 3ARXA 2AJYL 3T0EC 4F7TA 3QRGH 3EZ8A 1EZVY 1PYWB 4XHJC 2I07A 3JWOC 3SEPA 4CRPA 3BO8B 2RHEA 5K9QG 3MC0A 4Z7UE 4LSSL 4DVRH 3WKMH 1Z9SA 4WNQA 2VDOL 4LK4A 4X7SL 5HJ3A 3ARRA 5ADOH 4U2YA 5HHPA 4YR6B 1VSCA 3T2PA 4M93B 4HFWA 5CLTA 5KS9A 1A6VH 1ZMYA 1A1MB 4XI5C 1I7ZA 3MJ6A 3ZTJH 1MCWW 3UZVB 3DX8A 3ILQC 5I2IB 5EO1A 3PGDB 2BSSB 4Y88A 4K8RL 5DXWA 12E8L 2HLAA 3UTOA 4DW2H 1MFAH 2ICWA 2GTZB 3FMGH 3WNPA 3E2HC 4MVBD 1M7DB 5DMKB 2OJEA 3ULVC 1QFWI 3V5DB 1RAMA 1ZS8A 3MPCA 3GRWA 4NC2B 2J7LA 1PVHA 3NFNB 4LBEA 4RMTA 4QXUL 4O5LL 5C07D 1KB5B 5DJCB 3VRLF 5TE7H 1AGBA 4CJ0A 5IF0B 4LCIH 4JVUA 1JWUB 2AV1A 1RZKL 3NPZB 3C5JA 4U33A 3QEGL 4FFWD 1QR4A 5JXEC 3O4LD 3ARYA 4JFDA 1YQVL 4HWUA 3QUXA 4JFED 1KPRA 3BGMB 1LEGA 5D96B 3Q48A 5C0JB 2ZCKH 1FZKA 3GJEA 3SPVA 1JHLL 1MIML 3MRGA 3OXSB 5C08B 4RGMC 1NQBA 1JFQL 3OAZK 2R2EB 1OSZA 4Y5VB 4FQ1H 3CXHK 1IE5A 5E99L 2IG2L 3E0GA 2ESVA 5FO8B 1FAKT 5T1LD 1HHHB 4XNZB 1CXIA 5I1IH 4Z5RA 1EEZA 1M05B 4KROC 2C4FT 2UV3A 2WWMD 1NCBH 4NUJA 5CCKH 3DMMC 2CK0L 1LD9B 4WTZG 4PY7B 2OTWA 4JN1L 1CLYL 3SY0B 3S88L 4FXGA 1OGAD 1YNKH 4XVSL 1QHPA 2IQ9H 4KRLB 5IMKB 2Q76B 5EH1A 1MOEA 3DBXB 1N64H 4LRIC 4YO0B 2CKBL 1SBSL 4K55A 3T65B 5DGQA 5L7XH 2BCKB 5LG1A 4GKOA 3T77A 3SJVD 1U3ZA 4D94A 2MTPA 2O5ZH 4BJLA 2A1WH 4Q9CA 3EJJX 1FG2A 4EN3C 4LHQB 4QTIH 2YUVA 3CVHB 3FOLA 1QRNB 4M6NH 5JTWA 1LK3H 1ORQB 5J1AA 5E9DD 4JO2H 5DTFA 1LDPL 3BWUC 4K23H 2A6IB 4PJBE 2AQ1A 4G5ZH 1HCFX 1FSKC 3G5VB 5D7LB 3B9VA 4NQDA 4LGSB 4I4WB 4J6RH 2IPKA 1FFNA 3BEVB 4RDQF 4XRCA 4HK3N 1VFAB 3O6ML 4OJFH 4UAOC 3CJJA 1RIUH 4OD3L 1A14L 4KK5D 4FQ2H 5D7SH 2NZ9D 3TN0A 3SN6N 4XB7A 3DVIA 1C16A 2Q20A 4UBDD 3BPNB 2A0LC 3O3AA 3JV6A 5C09B 1TTUA 3B3IA 5IEHB 2J8OA 3MRBA 4KQ3L 2COQA 5IROA 4B41A 4NCC2 5F7FA 3MUGB 5CEZL 3IU4L 1HHGB 1KSRA 4BZ1L 1IC4H 1P4LB 1G9NC 2WSKA 1MFBL 4X4ZA 1QLEL 2YPLB 3LMJL 4D3CH 4MJ2A 1QVOB 4QRPA 4EN3B 2O5XL 2VSDA 1EXUA 3CIQA 3G5YA 4NP4H 2ICEB 2P49B 3WS3B 1NMBH 3MV9E 2JCCA 2I26N 1EAJA 1WBXB 1I1AA 1HILB 5SX5K 3ULUD 2NLJA 3LN4A 2G9HA 5JQ6L 1QSZA 3MLYH 3T4AA 2AEWA 2NY5H 2E7HA 5LQBH 4X6CE 3CSYA 1T89C 1CDUA 1WAAE 5HYJE 4ZQKB 4DWHA 3TT3L 1DSFL 1FIGH 1JI2A 3F7YA 1NC2A 3TYGH 4X6FA 2V17H 5D1ZB 2VZTA 4OIAA 3QIBC 2WM0A 3QHFL 5GQBA 5DURD 1GGCH 3HPLA 2Z31B 5EU7C 2BVTA 3DGGA 3O9WD 1RZJH 4GRWB 1TIUA 3V4UL 1IGMH 3LKNB 2IBZX 1MCQA 3MLUH 4TSCH 1URLA 4CADA 1F8TH 2H9GA 2V5TA 3FB5A 4TNVF 2QHRL 3W0WA 1BD2E 4OLUH 43CAA 1T5WA 2P5WA 3S8WA 3QXUA 4FXLA 1FH5L 3IF1A 5C0FA 3ARGB 5I74C 2LTQC 4GG8A 2IADB 1IAOA 3FT3B 5BVPL 5EOCL 4C4KT 5DD6B 3OJVC 2XFXA 2F74B 1IZKA 4OFPA 1NFDE 1H8OA 2DIAA 3WD5H 3ILPA 1JGUL 4OI9A 5E5MB 4H0HB 1T7YA 4PR5B 4U1LA 1A7PH 3X3GH 4PLOB 1FGVH 4WEBL 5LXGL 3DVGB 2APVA 5INDA 3DUUA 4EUPB 1G7IB 4F7CB 4G6KH 4P2RA 3HE6B 3FQTB 5A2FA 5D2LB 3X14B 2B5IB 3CFDA 4BQ9A 4LGPB 8FABB 3SDXE 2JELH 2OMNA 1U36A 3QWRA 4WWKD 3PV6B 2JTDA 3ORJA 3QIBB 3CD4A 4GW5A 4ZS6C 3DLQR 5DS8A 1A7NH 1AC0A 3VFUB 1CVRA 5JA9A 4HG4K 1ERNA 4Y2DD 5KSAD 3EO9H 2WIIA 3VWKA 4QRSB 2VQUA 4FFZH 4YBLC 4KK9C 4OZIF 3GKWL 1YY8B 1HHKA 4PJIE 3R1GL 4PB0L 1A6UH 5D7JC 3S96A 3CFKA 1Q9OA 4MD0B 1A7RL 5L88L 1JP5A 2F58H 5FYLL 3QDMA 1R3JB 2VDKL 1KCUL 3VGGA 4YXLH 3L3HB 4RISH 2X70B 4TSBH 4GLRI 3VI3F 2BOCA 3VD3A 1S9XB 5C2BH 1EEUA 3WHE1 3LPFA 2ZJSH 3BWAA 3VDBA 4FQJH 3T3PE 5IFAH 3VRJA 4RRPG 2UYLB 3WJLA 1OB1B 3KPTA 1NGPH 4GW1A 3PWNA 1NUGA 5ITFA 4QXTB 1CFSB 5IGXH 1MHEB 3WEXA 5ACLA 2DQEL 3KXFB 4LKCB 1EFXD 5JHLL 1PBYA 4IRJD 2GCYA 5JW5B 4PJ8D 4K94C 3OR6A 4NQCA 3BPLC 5J06A 2R23A 2C9AA 1T83A 2LQRA 2G5RA 4NO5A 1L6XA 1XF3A 3U82B 3QUXC 3V52L 3QI9A 5SX4I 1KLGB 5D6DC 3N9GH 4J8RA 4YBLB 4JDZB 3OKOB 1BEYL 5L0QC 1EAPA 4HJGA 4PJCF 1UWEL 5D7JB 4YHKH 4X7TA 2PETA 1U91A 4DKEH 4OFIA 3QNYB 3MRFA 1JPFA 5DYOB 5FDWA 1RJLB 3PL6B 1IEAA 3MRRB 4HIIB 1CR9L 2YR3A 5MENB 1JZ7A 3RL2A 3MO1B 5EU3A 3OB0H 1RUQH 3PWPB 4LCWB 3T8XA 3V7MA 1LO4L 1V3KA 2PW1B 2XV6B 4PLJD 3E1F1 4P23D 1AHWC 1XF4A 5CEYA 5HI5D 1JNJA 2JB6A 2VJXA 2UWEE 1NFKA 4X8XA 4ODSH 4MS8D 5DLMH 3BT2H 4ISVA 1S7XB 3LEYL 1YC7A 4PJXA 1S7UB 2OR8A 1A9BB 5KVEL 2XT1B 1I9JH 4L4VE 3I75A 4K8RC 2D9CA 2YD1A 2MKWA 3PGFH 4JN2A 3AU1B 4NT6B 4TSAL 4MD4B 1YPZF 2Y7QA 3ISWA 4U1MB 4FG6D 4LSPL 2YN5A 4PJDE 3WJJA 3GSRA 4HWZB 4H88L 2NY1C 4D8PB 5FF6A 1B6DA 3TVMC 2Q1EA 4G6ML 4FQPA 5L9DL 1UXSA 4YGVA 4RNRA 3U7YH 3DURA 3PIQB 1H3PL 1CN4A 4L4TB 3MNZB 1NBYA 2PCPA 4U6VH 5T5FL 4G9FA 1AFVL 2HTLC 4NZUH 5D7IF 2D7OA 1A6WH 2DQJL 2KZWA 1A3RL 4NQEE 2EE6A 3ARDA 1R3HB 2EDLA 4UB0H 1RZKC 1ZE3C 1NCDL 5KVDH 4HPYH 2H3NA 1J7VR 5I71B 3QCVH 1C8PA 2XG5A 4IOFD 3I2CH 4BYHA 1E4XH 1J05B 4JHWL 1AGFA 5A2KH 2F5AL 1UYWL 2AEQL 4EIZC 4H26B 5GRXG 4U1NB 1ES0B 4TRPL 3NCEB 4JFOA 3MLTA 1IGYB 2H32H 4R7NA 4Q2ZA 5E70A 3U7WH 4KRPC 1BJ8A 1RK1A 3KJ6H 3O41B 3DHJA 1QFHA 3VXRA 3KPRE 4HH9A 2IQAA 4H8WC 4JZJB 1T04A 2ERJB 1QFWL 4XC3L 3V5KA 1AGEA 4XCCL 5C0NC 3TVMB 5FYJL 2GJJA 1DZBA 4TUKH 5TF1H 1U3HA 2GTWB 4YHLH 1NCTA 1YEKH 1I1AC 2F5BL 2ZUWA 4JAMA 1HXMB 4JKPL 1FQ9C 1GXEA 4ZNCD 5EN2B 1L7IL 1A7OL 1TLKA 4BH8A 1ZWIB 3NA9H 5E08H 1ACYH 1UCBH 2H26B 1ETZA 3H9SE 1Z0NA 3TBYA 1KBGH 3GMLA 3KAAA 4MXVF 1MJ7H 5ACZA 2UVEA 1J8HA 5IB1A 3T2NH 1CBVH 3UBXA 5TPWH 4ZUWA 3HMWL 5CJOH 4B50A 5DJAA 3B5GA 3NH7H 3KPPA 4MQSB 5FYJU 1G7QA 3KS0J 1DQMH 2VISB 1OY3B 4K07A 4MJ6A 3D5OF 3IJYB 1M6OA 1QSEA 4HWEL 3V4PL 4XCYB 3X17A 3IYLW 5DVNA 2X9YA 1GZQB 1MI5A 2A9NL 1KN4L 4QYOA 1G0XA 3IRPX 2E7LA 4FQCH 5HHNB 3KPMB 1BAFH 3KLHD 3KJ4B 4R0LB 5E8OB 2P5EA 5I18H 4ZTPH 3BZFA 3THML 1GGIH 2XN9B 5JIKA 4E41E 1JE6A 4JB9H 1IEHA 5CP7B 1NGYB 3K80A 4Q97A 2H41A 1WC7A 3HC0A 4V2BA 1DEEA 2QQKL 4YHPB 2BHYA 3W39B 5BXFB 2J88H 4UQ3B 3WXVL 4YHIB 4EOWL 3ZYJA 4N8VB 4HUKB 4WDIB 2IH3B 1IGTB 4P46B 5TFSL 1MCNA 3FB6A 4KI5D 4N9GA 3FJTA 4HKXA 2ATPA 5DI8A 4AH2B 2DIBA 5DJDA 5GGRB 3QQ4B 3M07A 3W5NA 4DOHE 1NC4B 4P5TD 3GRWH 3F65A 1B4JL 4PGZA 1MCHA 4JO4H 4NO0A 3D69A 4PJEA 3SCMA 3U4BH 5KTEH 3QPXH 4TQEL 4NGHH 3QEQD 4OB5H 5D1QD 5T3ZL 2WBJD 4R96B 3VRIA 2F53A 1ZEAH 3MLZH 5KSVB 2VLJD 5CJ5A 3DSFL 4QHLB 5C1MB 1ZHLB 2NY7H 5HHVL 5CJQH 1S7QA 3SDAA 3MGOB 4P57A 4YEFA 4OZHB 1CTOA 3RZCD 3D25A 4GOSA 2HN7B 1YN7A 4LVNB 3Q3GA 4AL8H 2AABL 3Q5TA 2DBJA 5ISZA 1JV5A 3TA3D 4QF1B 1I4FB 5HGBB 3NN8A 1T80A 2AJYH 1QR1B 4HEME 2ZOKB 1R5WB 4QCIB 3JTTA 3PQYA 1MCSA 1Z9MA 3VFNA 4Y8AA 5L2KE 3DHMA 5BOZG 3MV8E 2FZ3B 1J0ZA 4HMDA 4Z76A 2VDOH 1VB9A 4P9ML 2EZ0C 3QT2A 2R4RH 1WFUA 2AQ3A 1DFBL 1U8MB 3WJLC 5F8QC 4IOIA 2ICCA 1I8KB 2YD5A 5CBAA 1KB5L 5LJYH 3VWJC 4WW1B 2CLZB 2BNUA 4MA1B 5GRJL 1X5IA 2CKNA 4YE4L 4S1RH 2BNQB 4Y1AA 3GM8A 4G8GB 4FQIH 5GRVK 2DQDL 2NW3B 4KAQL 4LLYA 1M7IA 1IAKA 1UXWB 3NA4A 1UZ8B 12E8H 4L3EB 1UC6A 3O3BA 3TH4T 5HXMA 3TBVB 1TVHB 1AXSA 2UZIH 4AJ0A 4G8IB 1YNTB 1BQHA 3I85A 1WJ3A 3STZA 3ROOA 4W4OA 4JGMA 2C1PA 2CIIA 1OSPH 3QQ9D 3ARWA 4LLUA 3BO8A 3ALPA 3CCHB 1J1OL 1FO0H 1OGTB 4JRXE 2VZVA 3SGDI 2XA8L 5E4IA 5F3HB 1AR1C 1E6OL 5C0RL 3QEGH 1S7SA 2ADFL 3MFFB 3PGCB 4CUCA 4Y0GA 1KTLA 5EO9B 5I0DA 4ONHA 3C6LA 1YQVH 4JQXA 4XPTL 5C0DB 3P9MB 2F54A 1A1MA 4JRYB 2Y9RT 4RMRA 4ZOAA 4Y16D 4OZIA 5HDQL 3TZVB 2QR0A 5C2UB 3F58H 4PTTB 4XHJD 3MR9B 5F1NB 2FSEA 4MDIA 1JHLH 4ZFGH 2BSSA 1MIMH 1NH6A 2X42A 4Z18A 1AIFB 4B7LA 4YDVA 2MCPH 2IG2H 5E99H 5DZNA 2J6EL 1M7DA 2GJZB 4GKSA 3W5MA 3EO1B 5J8OA 4Z95L 1YEDB 1CLZL 4XCEB 3CVHL 4XI5D 3OJDB 5C0GB 5C08D 2I9TA 5GGUB 4PGCB 4X80L 1JWSB 1QLRB 2A74B 3ILQD 1H8SA 4NYLB 4JN1H 1CLYH 1FRGH 3C2SA 5DJCA 1SY6L 3JTSA 3NIFE 3S88H 1V3LA 5IVZA 1P84J 3R0NA 4F7MB 2XKNA 1EBAA 4PUBL 5SWQA 3QDJE 2CKBH 3FRUA 1SBSH 4I0PB 5T5NG 3ARDC 3LRHA 3ULVD 3LHPL 1ORSB 5C0JA 1A9EB 1KV3A 5CZKA 1CT8B 1JMZA 3LKRA 3JWNC 2GJ6B 4PG2A 1UM6L 1ZA3A 3O6LL 2WUBH 1DVFB 4WJ5B 4NC0B 3MMEB 4UTBH 4CMMA 4PJCA 4JFXB 2R2EA 3QG7L 4LLQB 3JWDH 4HUMB 3FB8B 2DWDB 4OGAC 1ZHNA 5FO8A 4XP5L 2B2XL 5D7KD 5JXED 3EFFA 4MNQB 2X7LA 3ULUH 1LDPH 3AS1A 1M05A 2EDRA 2DJ4A 4HCRL 3VXMA 3T0AA 2ZSWB 3DROB 3UX9B 5INCB 3QBTB 5C0AD 3CFIC 3O6MH 1QRND 3VGDA 3FO2A 4UNVA 1A14H 1FYTA 1LEIA 2PO6B 1PY9A 5DWUL 1JPTL 3W81A 4Z7WF 3GMPB 2NY3C 5D7LD 3EYFB 3VXTB 4K7PX 5TQ0L 4E0RB 1EEYB 3H0TB 4M7LT 4OKVB 2HKHL 4OF8A 2AJVH 2DJUA 3P9LB 4XMKL 1FLRH 3HI6H 2J6EA 2VH5L 4HUXB 3VGHA 2DN7A 5HHMD 4J4PD 2E3VA 3B83A 1YPZA 4BZ1H 1HHJA 2BVQB 3CVHA 5K33A 5IFHL 4OLYL 2YHGA 3PWUB 3CX5K 1QLEH 1TVBB 4GG6F 5E1AB 2O5XH 4NKOB 2ATKB 3VG9C 1F97A 5DK0A 2CGRH 1SY6A 2A6IA 2VAAB 4PPTA 5BJTB 3MRMB 4I4WA 2E6QA 4ZAKB 5D7IA 1KJMB 1LO5A 3GGWA 3H6JA 3QA3A 5JQ6H 2VLME 3MJ9L 4EN3D 5KW9L 4S1QL 4FZ8L 2E7LC 1MH5B 4PS4L 4HXBL 4G9DA 3TT3H 1DSFH 1CGTA 5AG8A 5B38B 4EBQH 5HGHB 1SMAA 2BVOA 3K4AA 5E95B 2VR9A 3HNVL 4MA3B 4QEGA 3MUGA 4K3GA 2E6PA 3NAAH 2VZOA 1S5HB 3V4UH 4WO4B 3X3FL 3S9DB 3MRNB 3EDFA 3GMQB 5FO9B 2QHRH 3L9RB 1KGCE 4HCRA 1HZHL 5JIHA 1FH5H 2A0LD 1NCNA 1NMCC 2Z31D 3C5SA 3PG2A 1NUDA 2AJSH 2DBLL 5DRWA 1JGUH 4IMLB 4U6YB 5E7BA 2B4CL 2QSTA 3PABB 4M1DL 1OAUL 4ZUSB 5DSCB 2P8PA 5AUMA 4WEBH 4K71C 1FLTX 3D3VD 5GXBB 1U92A 2OLDA 4HC1H 4LVHC 4WFGD 1OL0A 4WFFD 4C56E 1AKJA 5B3JE 1FN4A 2PTUA 2D4FA 3LKNA 5E94B 2XNAB 3LH2L 4OQTL 5F9WB 5F3BA 3TO4B 4V1DE 5EC2B 1S7TA 3PP4L 1KELH 2EH8H 2X1PA 3INUL 2C3VA 3ARGA 3GHBH 2C7UA 3QIWC 2IADA 3HAEA 3GSNB 1E4WL 3MJ9A 4U49A 3VFMB 5DD6A 3DOSA 4OFKA 1BBDL 4OV6F 3RKDC 3GKWH 5HD8C 4K3JL 4PB0H 1KJ2H 1IFHL 3QIBD 1INDL 3RWFA 2A6KB 5HHXH 5E5MA 5JHDE 3UTPE 3U4EA 2QKIA 5I1EH 1A7RH 3RDTA 5L88H 4OAWA 3BHBA 4QXGL 4XVTL 3OF6D 1U58B 3B43A 2VDKH 1KCUH 4RZCB 4XZUB 2KUTA 3RRQA 4QHKI 4EUPA 1NEZB 4F7CA 3BVNB 3HE6A 3QYCA 3T2QA 4K71B 4PJBB 5GIRB 4JY4B 4W4OC 4TNWK 3PV6A 4O58L 4ZODA 3EOAA 3D39E 4PRPA 5GJTH 4WUUA 5I15L 5F9OH 4CVWA 1TJHH 2DQEH 4H1LH 4OCYL 4XCFL 5IEKB 1CGWA 2VLLB 3C2AL 1AI1L 1CFNA 3N1PC 5IR1A 3D85A 2X89A 2EDEA 3GHEL 3V52H 3QIWB 5F1OB 1BEYH 5ITBH 3LY6A 5AG9A 2DQGL 3M8OL 1UWEH 3OB0K 1HK6A 3MXVH 2AVGA 4ZS6D 4X4XA 5AYUL 3LB6D 1G6RB 1XGPA 1JPST 4OQTA 1Q9LB 3MV9B 5HYIA 2HRPL 4QOKE 4KK9D 3HFML 4HULB 4JDVB 1CR9H 3CFCL 5EOQH 1OB1A 3VFWB 3B9KA 5D7JD 4NHUB 4BELD 5IG7A 1LO4H 3T1WA 1CFSA 4QRUA 4ODUA 2NXYC 3G9VA 4LKCA 1F11A 1ONQA 2J4WL 2K3TA 5EBMB 3RA7L 4TVSa 2R69L 3MUY1 4XNQA 2FO1A 5MEND 1YEFH 4OFVA 4PJ7F 5DVKA 3KPSD 1CE6A 1TQCB 3BPCA 1ZT1B 2UZXB 4Z7QF 1KLGA 2IPTL 4Z7VB 1W72L 2RJMA 1YJDH 1D3CA 2HRLA 3HG1B 3OAYK 4YNYB 3RUGE 2NX5A 4TSAH 5ICXA 3V6ZB 4ZD3H 4PG2C 1BD2B 3V4VL 4CAGA 1U95B 3HR6A 1U8HA 2E7MA 1RJLA 3PL6A 4N90E 4G6MH 5CZXC 3QXDA 1EJOL 4IRSA 4GXUN 1NFDB 5GRWA 2CQVA 5T5FH 3MO1A 4JFDD 1AC6A 3PWPA 2DQJH 1X4YA 1A3RH 3MSPA 3QPQC 4UDTB 4ZO8A 5D2NB 1B3JA 5JA8B 4LSUH 4Y4KB 2QL1A 3LRSA 5BS0E 4OSUL 4WRLA 1BBJB 4L4TD 4IHOA 2GK2A 4GJTB 4JHWH 4KHTL 3TBSB 3ARBB 2A73A 1F58L 5FOBA 2DWEB 1RUAL 1S7UA 1UYWH 1T21B 2IBZY 3SDXB 1CICB 1ZVSA 3CFJB 4TRPH 1IARB 4Z7UF 4Z77B 4NT6A 3SKJH 4MD4A 3RTQA 1BQUA 4JM2B 3P4MB 4XC1L 1DBBH 2R56H 3RPIA 3VFRB 4OFYD 3IGAA 1QFWH 2BVYA 2FWOB 2AJUL 3ZMRA 4XC3H 3EYVB 3PIQA 3SGJA 3NCBB 3MODL 4PJIB 1QHOA 4LARH 1YA5A 4P2QE 1YNLL 2ARJA 2XZQL 5JDSA 5JDJA 1NL0L 1MFCH 1R3HA 3WCYA 4YXKL 1E28B 3JBG7 2F5BH 4JKPH 4K7FA 1U8PB 3V0WL 5D1XB 3WIHH 1BMGA 1BZ9B 3N1QC 5E2JA 4MHHI 1YN6B 2WQRA 1J05A 4JCMA 1W72A 2GHWB 4NM8H 2EIDA 4Y5XA 2NY1D 3VH8A 5ALCH 3TVMD 5IVXB 3H7BB 2EYRA 3GMOA 4KV5E 1P5VA 1WSST 3ZKXB 4AMKL 5JPMA 3O41A 3MNWA 3GI8L 3BDYL 4L5FL 2XKUA 1YYML 3KPQB 3S5LG 3DETC 4HWEH 5TDNB 1XF5A 3C9NA 4MXQC 3IKKA 3ZDYE 4S0SD 1MHCA 3BRFA 3ZE1F 3OPZL 2WBKA 3TGXA 4DGVL 2XTJC 4NZDA 1HSBB 2F15A 3O3DB 1J0YA 2RCSH 1SYSB 5DDHB 1S9VB 3G5XA 3P11L 3P0YL 4H1LG 2QQKH 1CGSL 3WHE0 5I17A 1RZFH 1ZWIA 5I66B 4M62L 4F7PB 1MCRA 3WXVH 3AREB 4EOWH 5C0EA 4HW6A 3GIVB 1T0NB 1BHGA 1KENL 4W70A 3SDYH 5TFSH 4Z0XB 2XN9D 4PLKC 1WT5C 1UENA 4IMKA 2I5YL 2X09A 3BMWA 1HHIA 4F80A 4FNLL 3CXHJ 4OF0A 2CDFB 5BCAA 2H1PH 1BJ1J 4M43L 1DANT 3FZUC 3GZKA 5EDXA 2DOCA 1NUFA 4L29B 3VFTB 3E6FA 1I1FB 5T3ZH 4X6DE 3ZSSA 1L9NA 2UWEB 1VDGA 1CE1L 3IJYA 1AXTH 1RULL 5ESAA 2VIRB 4XAWL 3HC4H 3NACL 3WIIH 1C5DB 3DSFH 4FQHB 5HHNA 5TDOB 1NC4D 2R2BB 4R0LA 5E8OA 1FE8H 1MSPA 5HHVH 3N1FC 3RZWA 4FMFA 2Z91A 1TNNA 1W8OA 3QUYB 5CP7A 2EDXA 1FZJB 5C07E 4GQ9L 4PJDB 4PREA 5J12C 2YRZA 3RDTC 4YHIA 5DT1H 4LDOB 4U7KA 4N8VA 3O4LE 5EU4A 3SE9L 2AK1L 4HF5L 3D1MC 3QJFA 3W0WD 2DKMA 2QQQA 4YFDB 4JFEE 1N8ZB 3BJ91 3VGAB 2C4XA 2JJTC 1JZ3A 3KDMA 1CLOL 4NRZA 4WGVB 5GGRA 1CK0H 4MSWA 4P9MH 1B0GB 3IVKB 4JHAL 1I1YA 1X5HA 5IBLC 5I1JL 2Z9TA 3F5WB 5ICZA 4RWHA 1KB5H 4R96A 1WBZB 4JGUA 5J89A 3G6JE 4HH8A 5EU6B 1UB5B 2R1WA 1T22B 4QHLA 4H25A 2DQDH 4KAQH 1JHTA 3UPRB 3I6LE 1KLUA 1LEKB 2B4CC 4N1HB 4X6BA 4P2RD 3MREB 1C08B 2YA1A 4N0UE 3T1FA 1IQDB 1T3FA 1MFDL 5IVOA 2H2SC 2AJZB 2YA0A 2HLFC 3P4OB 4G8GD 1OGAE 1NBZB 3QUZB 3SKMA 4RFEA 4ZYKA 5FGRA 1QR1A 1E27B 3IFLH 4QCIA 4OM1H 5HI4C 2CXGA 3DYOA 5IJVA 2GT9A 4L3ED 4JPVL 3OQ3B 2XA8H 5GGVH 1OAKL 3SJVE 5IQ7H 2V2TB 5C0RH 4OF7A 3D48R 3W2DL 3PDOA 1EUUA 5TJWK 1U8MA 1E6JH 3FT2A 4X6CF 1I8KA 3B9KC 1WAAF 4G80B 2XWJB 3MROB 2VE6B 5KAQF 3HR5A 2CLZA 4JY5L 4U1GC 1T2QL 4ZUUB 5IHZA 5KVMC 5E9DE 3WFDH 2NW3A 5FEBA 2VERN 3L3JB 4LEOA 4OZFA 1UZ8A 4WHCA 2X9WA 3I3BA 2X4SB 4WU5A 4ETQA 3TBVA 4LLVA 4JFFE 2EZ0D 4G8IA 5KANG 4JRYD 2AAVA 2J6EH 4P4KB 4P3CH 1R3KB 1H3VA 3CH1B 5HYQB 4Z95H 1CLZH 3VWJD 4OGXH 3BISA 3CVHH 2YKLL 1TDQA 2DQIH 1MFEH 1AO7A 4LQ1A 3FL7A 2Z8WC 3CCHA 1OGTA 1XGUB 1UB6A 5F3HA 4NN7C 4IRSC 5HGAA 4BSWA 4HIJA 3MFFA 3UZEA 1DR9A 4PUBH 3C8HA 5HI3D 4UV4L 2D3VA 2DTSA 3P9MA 4JZNB 4HKBB 3T4YA 4XWGL 3TZVA 3SKNB 4PTTA 2YWZA 1XCQB 1T1XB 4FQXA 1QKZL 1T1YB 1UM6H 3O6LH 4PRHB 4J23A 2OK0L 1LP9B 1B88A 4L8DB 2AEPL 5AD0B 4LLDA 3ULUE 3QG7H 4DOHB 4I0PD 4JFZH 4U0RC 5JO5B 1KCRL 1AD9A 1QA9A 1WFNA 4WHYH 4XP5H 4IJ3B 2GJZA 2PN5A 4YHYC 2B2XH 1SHMA 2Z8RA 1IKFH 3EO1A 4YHNA 4RQQA 1YEDA 1YEGL 2GJ6D 4NQSB 3MCKB 2MMXA 3RTQC 1RZIB 3ARFB 3W9EA 1DVFD 5GS0C 2G5BB 4F8QA 4UINH 4PJFB 2X9XA 5GGUA 1SEQL 1TENA 1JWSA 1MIEL 2YEZA 5SV4A 4QXWA 4XGZB 2DM2A 4KUZL 3MCLL 2OYPA 4HG4J 1JZ5A 3I6KB 3LN5B 5FHBH 4F7MA 3C8KB 1ZLUK 2GY5A 3AXLA 4MNQD 3V6FB 5DWUH 1JPTH 2D7PA 1AQKL 2ZUTA 5MERB 1VEPA 5D9SB 2LU7A 4D0BB 4NN7B 4IS6A 4HSQA 3GSUB 4U4BA 1BWWA 4PJ7A 1A5FL 3KYAA 2F9BT 1ORSA 2HKHH 5DJ2B 1CT8A 4QRTA 2YA2A 1LE5A 3VXSB 5FHAL 5DO2D 1A6PA 1SJXA 5L2KB 2VH5H 5D5ME 3LKPB 3OX8A 4Y5XC 5SX4H 1MCLA 1HQ4B 1WZ1L 4HKJB 4LLAA 4Y4HC 2YZ8A 4LLQA 1XF2B 1WZMA 5IFHH 3CX2A 2JKXA 3K4ZA 2ZOLB 4OLYH 5IESL 4HHAB 1OT1A 4FTVA 4PV9B 5I1KH 1T7XA 4GRWH 5L8KB 1MCPL 5E8PB 1FNLA 1T20B 1HDMA 2FR4B 3AROA 4UILH 4U0RB 1NFIA 4AENA 1DCLA 2D7NA 4KUCF 5INCA 7FABL 4R26L 4F57H 1TCMA 4QRRA 4P59L 3T3ME 3FCTA 4CGTA 4AM0A 1KOAA 2DYPB 4S1QH 1LK2A 4FZ8H 4I9WD 3RY6A 1JPGB 1RVFL 2X4TA 5C6WH 3IU3B 4PJGB 3GMPA 5HY9B 3X12B 3M1BB 3ZKQD 3BE1H 3FFDA 1EEYA 3BQUC 2L0DA 1JZ2A 1H3TA 3CGTA 1ODAA 3O2VL 3P9LA 5EOTA 4FQLL 4EUPH 2FIKB 1L6ZA 4YIQA 1BECA 2AW2A 3OKNA 2FD6L 4Z7UA 1I9RL 4JRXB 3DGCR 3X3FH 3S34L 5T1DL 2VWEE 5L8JB 3IS0X 5IQ9B 1HZHH 3PWUA 4HK3J 4IMKC 1KEGH 5IMOB 5LAXB 5J6HB 1CFTB 3C5ZA 4NKOA 2J8HA 2NY3D 4Y4HB 3P0VH 1F3RB 4XXCA 1INEL 1VESA 2DBLH 5JNYB 1S8DB 1SJHB 2R0KL 4UMGA 4X4MA 1J9CT 1A47A 1K8DA 2CO7B 4LF3A 1D5IL 1D6EA 2VITA 3WN5C 2X1XR 3F6LA 5DRZA 1S5IL 1J8HD 2JIXB 1PD6A 4G8FB 4ALAH 4NZRL 1EO7A 4KFZC 2IBBA 3IETB 4JQVA 2FL5A 2BRRL 3TNNB 5HGHA 3BH9B 2KKQA 1RZGB 3MYJB 4ONFL 1Z5LA 3F7PC 4NBYB 1S5HA 3BQUB 1IGCL 4WO4A 1NDGA 2P44B 4Z7WB 4YDKL 3GMQA 3LH2H 4OQTH 2YD9A 3A67L 2EYSA 4X7CC 3U7AA 3L3KB 3WMSA 3RX5A 3ZL4H 3INUH 3QDJB 4DFHA 1ZGLA 5JXAL 15C8L 3ZE0F 5EBGA 1E4WH 2ZG2A 2IPUK 3LIZH 4OUUB 4MGXA 1BBDH 3JUZA 3HZYB 1J18A 3O11B 2NY4C 3I3EA 4IMLA 3V0AC 3TT1L 4MA7L 3PABA 4YC2C 1FNEB 4QXGH 4XVTH 3L5WA 1S7VA 4I18A 3CC5B 3K4DA 4LVOC 5MEQA 4F58L 1Q9KA 3B2VH 3GNML 3F8UB 5JR1L 5M7QA 2N1KA 5E24E 4R3SB 4U1JB 1QUNA 2LABA 1A1NA 1CWVA 4O58H 3GBLA 1YMMD 5D8JL 5FGBC 3HZMB 2QHLA 1XIWC 1YMHB 3X11A 5I15H 1U6AL 4RMSA 5EC2A 2N4IA 4MD5A 5H94A 4WHYG 4OCXL 1EO8H 5DRNB 2WQ8A 4OCYH 3V8OA 5EB9A 5FIEA 1JPSL 1WFOA 3VFMA 1T5XB 5FB8B 1AI1H 1KCVH 4X5XB 2V2WB 2XWTB 2X4PB 3GHEH 2IANA 3NFPB 1BVKB 5ISZD 3P77B 1OAQL 2F8VA 3RY4A 4N5UA 2ZZUT 4HX1B 2DB8A 3K2UH 1ZXQA 1F42A 1PJ9A 1R24A 3JUYA 2VMFA 1NEZA 1F4YL 4JFYB 4YC2B 5AYUH 3GBML 2DL9A 5IIEB 4WHTB 5HVWA 1Q1JH 2FIRT 5J1SC 3QIWD 4PJBA 5GIRA 4PBXA 2FYYA 4RGNC 3HFMH 3RKDD 3CFCH 5HD8D 3D18B 1T2XA 3UZQA 4UQ2B 3L5XL 3ECBB 2ED7A 4XH2B 4CMHC 4DZ8B 5AAWA 3ZKMC 1OW0C 4K7PY 2J4WH 5IEKA 2VLLA 5HHOB 2R9HC 2R69H 2B7DT 2YD2A 3HE7C 4WV1C 4R97C 3HN3A 1A4JA 3VXQA 3HCVB 4S1SL 2IPTH 5MEOA 4JCLA 3MA9L 1DUZA 4FQXC 5JQHC 2EXWD 4KKLC 1KTDB 3OMZA 3I6GA 4R2GB 1QFUH 1XGTB 3JZ7A 3WL9B 1T6VN 2FDBP 4PV8B 4NKDB 1EJOH 1I3RB 3MV9A 3LQMA 5FUCC 3QEUB 5ID1B 4LEXL 1CG9A 3HG1D 5EUOE 4P99A 4DGIL 2NQCA 5SWSB 3MRJA 3VMPA 1FAIH 4NHUA 3PHQB 4G8EA 4RGNB 4X6CA 1MQKL 5IB3A 1WAAA 4KDWA 5HYJA 2APFA 4M4PA 4OSUH 2X05A 5FCUL 1IKNA 1R5IA 1XGRA 3G08A 5DD1L 1HI6A 1F58H 1KPVA 3LZFH 3I3DA 3MRPB 4C56B 1A0QL 1D5BA 4LCYB 5EZLA 4WV1B 1G1CA 2ADJA 4AEHH 3DRTB 3RBSA 2XY1A 1BD2A 4V1DB 1U95A 4ELKB 4F7EA 5EA0H 2NXYD 1VACB 3ARBD 4N0YL 3RX7A 2ITDB 1H8NA 3FQXB 5E03A 2AJUH 4AEIL 5AZEL 5I1HL 2W1NA 3MODH 1WWWX 5L2JB 4NO3A 5JPNB 2VLRD 2XZQH 1NL0H 2HP4A 2CLRB 3SGDH 4YXKH 4KI5E 2QQNL 3RNKA 1P2CB 1L9MA 4Y4KA 5HYSG 1MRCH 1B6UA 4JDTH 1UH2A 3E8UL 4JREB 4OT1L 5I73C 3H3KA 4MA8L 2RBLA 3TBSA 4HDIB 1TMCB 1Q9WA 2X2YA 3QEQE 1GIGH 5CZXD 3IDJB 3RWCB 3MOAL 3SDXA 3LKOB 2YWYA 2ZP0T 5D93B 1CICA 3QNXB 4DN4L 1J10A 1FNGB 1KJVB 1QEWA 1M71B 5DHVA 3D39B 2VLJE 5D1XD 4Z77A 1FZMB 3VXUB 4AT6A 4L8BA 3BAEH 3VXMD 3GI8H 3P4MA 3BDYH 1DE4A 4M1CD 5LBSL 4J12A 5GGQL 3VFRA 1YYMH 2DJSA 5DMJB 4G7YH 2FWOA 5TQ2L 3DECA 3K0WA 2I25N 4Z78B 1JUFB 2WANA 3VXPA 2Q7YB 4DGVH 4POYA 3IB4A 5ID0B 3OZ9L 1L4IA 1EGJL 3T08A 4OD2B 2HFEB 4Q0XH 3P11H 3P0YH 1U8PA 2X4RA 3SGKA 3VE0A 1CGSH 2JB5L 3CDFA 3PHSA 4ZOEA 1YN6A 4M62H 5E6ZA 1FHGA 3F7RA 3MBEB 3T0VA 3KLDA 5J0BA 4QOKB 2BK8A 2X41A 4XCNB 5DEZA 2I5YH 4NOBA 4JQVC 5F93C 2OJZL 4DKDC 4YX2L 4WENB 3DX6B 3VA2C 4U3CA 1WCBA 4M43H 1F3DJ 3MLWL 5F6IC 1U8NA 4S2SA 3ARED 4QHMA 4Z8FL 3HPJB 4GBXB 4JPIA 5D71H 1K5NB 5BO1L 3NACH 4KWUA 2J5LC 4J3OC 5GSRB 3FHQA 3ROLB 3RVVC 5IK3B 3O3DA 3IDGA 1B90A 4TOYH 5DDHA 1S9VA 1N6UA 2XPGB 3A0OA 3GIZL 4X0KA 4JR9H 2ZWLT 5I66A 4HFUH 3QRFM 5EULV 5CD3B 5B22A 5DMIL 1WGOA 3DIFB 1T0NA 1QLFA 4PGEB 2DLIA 4HF5H 4I18C 3DETD 1NJ9B 4Z0XA 1HIML 4HPOL 4KZEL 4MXQD 1GAFL 1SVCP 4PRNA 1UKQA 1EUTA 2XTJD 3TJEL 3H3PL 4YHML 3WIFB 4ZDHB 4JHAH 1JHKL 1S78C 3BGFC 5I1JH 5TH2A 1RUPL 1MWAL 5B8CB 3SQOL 4PRDB 4YBQD 1EGJA 3WFBL 5BS0B 2B1AH 4JY6B 4F9LA 4XNXL 5ESQB 2V2XA 1RHHB 1C5DA 1U8KB 2BX5A 3MV7B 3REVA 1JNHA 4K3EH 3KYKH 1CFVL 5DHYB 3DYMA 4PLKD 4L4VA 3U30C 3OHXB 5C08E 3SDCC 1MFDH 1FZJA 4S11A 4M6OL 4HGWB 4F3FB 4EZMA 1AKJD 3FZUD 4PJDA 3IKCB 5EU6D 3MOQA 3O6KL 1N2RB 5ABDE 1ADQL 2NXZB 4ONGL 3QCTH 3M17B 2AV7B 4ODWB 4G6AC 4KQ4H 4JPVH 4ZPVA 1EH9A 1N8ZA 3ULVE 3AY4A 3CX5J 4WU7A 4Q9BA 2DLFL 3OKMB 4P2QB 1DQJA 4M5ZL 3O2DH 3CLEL 4NQEA 1NAMB 2FRGP 5D6CB 3W2DH 4I1NB 4X6EB 3RWDB 3F5WA 43C9A 1MCFA 4GS7B 5HVHC 1HE7A 5FA3B 3MJ7B 4CN4A 1KC5L 4JY5H 3TCXA 3A6CL 3VW3H 1VHPA 1T2QH 2FEEI 3BJLA 2AXFB 5F1IA 3QXVA 2BJMH 5D7KE 4PRIB 5IMLB 3WKNA 3GSWA 2W0FB 4ZPTA 1C08A 3RNQB 4ZTOL 2XZCL 3DO3A 1IQDA 3VFGH 3WNLA 1BZQK 4XTRC 2PR4H 5C0AE 1W0WB 2FBJL 1QRNE 2EKSB 3K1KC 3L1OL 3P4OA 1MNUL 3KPRA 3QEHB 5IBLD 3QUZA 4O2FB 5EC1A 2NTFB 3B5HA 4PRPD 4U0QB 3LD8B 4HWBL 3KYNB 4XNYL 5D7LE 3S98A 3FFCB 5C0IB 1DP0A 1PW3A 3D0LA 3LV3A 4LCUB 1MWAA 3DO7B 4RFOL 1H3UA 1AQDA 3MA7B 4LDEB 5DZLA 2OM5A 4BK5A 1NGZA 3WFEL 1OP5K 1HQRB 2HVKA 2LAAA 5HHME 2H2SD 1R3LB 5TGBA 4UV4H 2PF6A 2XWJA 3MROA 2VE6A 2HLFD 4NZTL 3GSQB 3CFBB 1H15B 1VENA 2G75B 2GSIB 2PXYA 3H9SA 2W60B 4P2CG 4XWGH 1KTKE 5CSZB 3QRGL 3NZ8B 4NRXA 2OL3A 1RZ7H 1XEDA 1QKZH 4J1UB 4MQ7B 4DQOL 5HI4D 5F89B 1KYOK 3EFDL 4OLWL 3L3JA 5B3JF 1MCWM 2BC4B 2Y06L 1II4E 4DVRL 1BFVH 2X1QA 5TDPB 1ZT4B 1TCRA 5F96H 3BZEB 1KCRH 4U1KB 3FAXA 4GXVH 3L7FB 5JLZB 3NMEA 1R3KA 4RAUB 3CH1A 4OZGB 5DK2B 1RPQA 3VCLB 3B9KD 1YEGH 1E4XI 4X6DB 2EDHA 4PG9A 4H5SB 4EQ3A 1BLNB 2X4UA 3LQZA 1SEQH 5F88B 4PY8J 1A6ZB 4NN5B 3MCLH 5EBWB 5C0CA 2BP3A 4E41A 2DS4A 4YDLC 2BY1A 4U3XA 1QO3A 5C07B 1AQKH 3ARFD 4NKMB 2HTKC 5GZOC 1A5FH 4KJYB 1EIBA 2NX5D 3O4LB 3SKNA 5FHAH 1G7HA 5I1DB 1PEZA 1NUNB 3HS0B 4JFEB 4U7SA 3AMKA 1HYSC 4GRWE 3QP3A 2VXVH 1NCCH 1WZ1H 4HWBA 4P4RB 2K9UA 1Y6MR 5IESH 1R5VB 1K4DB 4BSVB 3DWTA 4MAYC 1MCPH 3VXSD 3MCKA 5ADPH 2XOTA 2OTUB 4HKZB 5E2WH 1BVLB 3D3VE 4X8JB 4FP8H 2IFFL 4P2OA 4WI6A 3L95B 3KHOA 4LLWA 2GQHA 2OTPA 5DVMA 4AEEA 4PBWD 4XGZA 5DD5L 3BESR 3I6KA 4WFGE 5FFLA 1KIPA 4N0UB 4WFFE 4U6XA 2R2HB 3SDDB 5GZND 1OPGH 5MERA 5FM5M 5KSBE 2EE2A 3GSUA 1M4KA 1OGAB 2YBRA 4GRLA 1J11A 3P4NB 4UNTA 5I1IL 1IEBA 5K9KB 2FB4H 5D2LE 3RTQD 1WIUA 1NCBL 4JHBA 5GS0D 2DYPD 5CCKL 5L2KA 2D7QA 2FD6H 5CIPB 3UYRH 1I9RH 3MV8A 5GPRA 3UTZB 5T1DH 2SEBA 1WWBX 4F15C 3RIFF 3WS6C 4HUVB 2YSSA 2ZOLA 1PG7L 4HHAA 4QKXB 5EU7E 4PV9A 2IQ9L 5HVGB 1D9KA 5E8PA 4APQC 3QUMB 2FR4A 2A6JB 3CFEB 4JLRA 4LHUA 3UEZA 5CINH 4MAYB 4O9HH 3BIAX 3O6FB 2O5ZL 3GSNH 2J1KA 4I3SL 1D5IH 4P3WA 1QBBA 5GSVA 1CS6A 4QTIL 3RUGF 2A6DB 4I2XE 3IU3A 4Y4HD 3X12A 1X5YA 2V5MA 3DV6B 1S5IH 4M6NL 1QSVA 1LK3L 2P8MA 5MI0C 3RHWF 4OKDA 4NZRH 4PJAF 2BRRH 3LOWA 4JO2L 1FZOB 3KG5A 1G7JB 3KWWB 5FAAA 4K23L 2FJHA 4ONFH 3EJYC 3TPUA 4JKWA 4LHJB 3MRCA 1JN6B 2BOBA 3BEWB 3D0VB 4JRXA 1CDCA 2EDBA 3MUJA 3QUKB 4YDKH 5JW3H 1U8LB 2JIXD 5I75C 5IQ9A 3WLWC 5IWLA 2BSTB 4GRMB 5DJXB 5EZJB 5F7EL 4I13B 5IMOA 3MRDB 4CU7A 3BKYL 3P73B 1FFOA 1MJJB 4MCYA 4AIZB 5JXAH 4YFLI 3ARPA 1H0DB 1QRKA 2VKXA 5BQ7A 3BQUD 3K74B 2MQCA 5JNYA 4APQB 3TT1H 3WNKA 1WF5A 2D0FA 2ZUXA 4CU6A 4XP4H 1GZPA 5H2BB 3BDXA 3FQUB 4Y4FB 3P3YA 4ZMAT 4XBPA 5KS9E 1JGEA 1P7QB 3REWB 4G8FA 3QO0B 4D3CL 2WP3O 1S9WB 1HSAA 1NCWH 2Q86A 4NP4L 3BH9A 2ENSA 1NMBL 3I02A 3NIGE 3LVEA 4IRZH 5MI0B 2PNDA 4X9HA 5MENE 1G6RH 2P1YA 5D8JH 4LCWE 1IM9B 1RJCA 5FK9B 1HCVA 1MUJB 3KPSE 2VN7A 1H5BA 3TIEB 4KK6C 4OCXH 3O9WB 4I0KA 4M8QA 4FOMA 1YEJH 4HS8L 3C8DA 3O3UN 3BD4A 2Z92B 3QDAA 4TUOA 4RRPA 3RX8A 2V17L 3FTGB 3DPBA 1CGYA 4ZUTA 4J7RA 2D4DA 3U9UA 1WCQA 4O51B 5IBUG 4M7ZC 4P5MB 1OAQH 4LSTH 5D5MB 2G60H 5IOPA 4KJWD 1IGML 3BP4A 3O3EA 4OV5B 1F8TL 2CRZA 1A4KB 5HVFB 4OLUL 3VD7A 1MCIA 3AGVA 4KTEL 1F4YH 5DJ6B 4CW1B 4RX4A 4LU5L 2DF3A 2JJVA 1TPXC 2EDTA 3W11C 4R3SA 3ESVF 1WTLA 4L4TE 2VXQL 5C8JA 2NY4D 3WD5L 3HZMA 3QNZB 32C2B 3L5XH 1YMHA 2X4OB 1A7PL 1AJ7H 5BOPA 1FGVL 5HGDB 4S0TD 1DDHB 2WMPA 3BW9B 1I7UB 5JORA 1XGQB 2KQNA 1J87A 1I7TA 5EIIB 3V8CA 3L5IA 1L0YA 2ICWJ 2VDRH 3EOBB 4XP6L 2APTA 4JANB 5T1KB 1NLBH 2JELL 3NFPA 4S1SH 4Y2DB 4J3UA 3DX9B 1TZIA 3MA9H 1PFCA 3UBXG 1XIWD 4OFDA 3OKKB 1UJ3C 1CD1B 5JOFA 4JFYA 1ZV5A 4DKFL 1A7NL 1NSNH 2MWCA 5DR5L 3KPLB 1IM3A 2MHAB 1SEBA 2C1OB 4FFZL 3SE4A 4LEXH 1WVZA 3S4SA 5FECA 1J0JA 1G1YA 4LGRB 4DGIH 1G7PA 3B6SB 3QFDB 1A6UL 1T1WB 4RDQG 4UQ2A 1CD0A 1KG0B 3UDWA 5IHUH 4XH2A 5LGJB 4EVNA 1ACZA 1A1OB 4Y5YB 4YFLF 1NANI 1FL3B 4RISL 5FCUH 4K9EL 5DUML 4TSBL 3FO9B 4WHDA 5SWSD 2BDNH 3TFKC 5DD1H 1UT9A 4OZ4B 5EFIB 5C2BL 2ZJSL 1EFXB 4XWOC 5CBEA 3RWHA 4KK8C 1A0QH 1X5AA 2VQ1B 4KY1L 3OKEB 4PJ8B 4RGND 5IFAL 1WBYB 1C5CH 2V9QA 3RJDA 2I60L 3HUJF 5KG9A 5I1LB 4YDJB 4OF6A 5IGXL 1ND0B 1AO7D 3JV4B 3ZKMD 4O2CB 2CXKA 4YFEA 4ZXBB 2BNRA 1UJ3B 2R9HD 4M7KH 4CNIB 3G6JF 3HE7D 4MJIB 5IHBA 1R0AL 2R1YA 5EO0B 3QR2A 4R4BA 5E4EC 4ELME 1SBBA 3HI1B 3MRHB 5A16A 5GS1B 3U0PA 1QSFD 4N8CH 1PEWA 3PXJA 2XN9E 4L8SA 4P2OC 2QQNH 1V3MA 3C09C 1VADA 1A6AB 3S5LB 4FQXD 5IVNA 2FO4B 2I9LB 2KBGA 4KKLD 1P1ZB 4TYUA 1ZHBA 1GGBL 4R4NC 2JCCE 4OT1H 1JGVL 2X4QB 3QDGB 4DKEL 5IJKA 4MA8H 3O81A 4HV8A 1FPTL 3RU8L 2FEEL 4CVZB 1RFDL 2EICA 4C56A 2P42B 4LDLB 3NCYP 4N0CD 4DN4H 4UV7L 1IZJA 4GRLC 4WW2B 2DM7A 2CUHA 2FH8A 3GM0A 1CZ8H 4LLMB 5F7HA 1JYWA 4WI7A 4V1DA 2W91A 5F7KC 1EMTH 3IDNB 2AJXL 1XZ0B 2L7UA 4XBEH 3RWIB 4JJHA 4EIGB 1NCAL 1G0YR 5A1AA 2O61B 1PZ5A 5TQ2H 4UIMB 3ZE2E 5DLML 1L7TL 3IDMB 4E9LA 1D9KC 2FJFB 3MRQA 4RFNC 5L2JA 4ZFFA 5E8EB 3VXUD 5JPNA 2Q6WB 3PWLA 3OZ9H 5KVFL 2FNBA 3GDBA 3Q1SL 5JHDA 1CL7H 1I9JL 4ODHL 4GW4B 4YPGA 2CLRA 3W0WE 5BW7A 1QOKA 5F21B 4TUJB 1UA6L 5E6YA 4OZHE 3T04D 3QIUC 1BZ7A 2B0SH 1ZHKA 3LQAH 4L9DA 1BQHG 2EC8A 5BV7B 1ZLWK 2XYCA 4HDIA 3EYOB 2OX5A 3RWCA 3LKOA 2IFGA 2A2QT 3QNXA 3V5HB 1M71A 3D39A 4NZUL 4YX2H 2X4NB 1A6WL 1MHHA 4MNGB 3MLWH 1RJZA 4QT5A 1VFMA 2J8UB 1D5MA 4Z8FH 5KVDL 3IDYC 1Z0MA 1UEYA 2JJWA 4N1EA 2UY6A 1P7HL 1E4XL 4X5WB 1XGYH 4G8GE 5BZDB 3VA6A 5IMMA 1FL6A 1GH7A 1LO0L 4L3EE 2HFEA 3KYMA 3GSXB 3ULUF 1GC1H 3LKQA 4H0IA 2AKRB 3KJ6L 5C3TA 5FA4A 4L3CB 3UYOD 1OTSC 5LVEA 1FVCB 3D2UA 5DMIH 2XG4A 1MJUH 4I48B 5KSUA 3MBEA 2HG5B 5J9PB 4HPOH 3VFVB 4ZFOB 1INQB 1GAFH 2D7TH 1N59A 1JYNA 4H0GA 1IRAY 3DX6A 3TJEH 3FOMA 4WVRA 3H3PH 2BVPB 2EIBA 5TF1L 4TUKL 3MQIA 4MQXC 5GJSL 2MJWA 1JHKH 1YEKL 4KU1A 3NIDE 2VR4A 3HPJA 3MTRA 5BRZD 4ODXB 4GKNA 1N5AA 3RVUC 3N1GC 3SQOH 3CMOL 4XXDA 2YMXL 1K5NA 2XZAH 1H5BC 1ACYL 4JRYE 5GSRA 4MZ3A 4WY7H 4IIQC 1MJ7L 4MX7B 2P47B 1CFVH 2VDLH 5GGSY 3T2NL 1CBVL 4I0CC 4ZG1A 3RUGA 4Y19B 1XMWA 3ARQA 2XPGA 4O4YH 4M6OH 2HJLB 3MV7D 3FQRA 1DN2A 4AK1A 5CD3A 3TJHC 3NCYS 4NN6C 1ADQH 4ZFZB 3RI5F 2N56A 4LRNL 1UVQA 2HJFB 2IH1B 4OIBA 2R2CA 1HINH 2CDEB 2IAMC 4FQCL 5GGSA 1K2DB 2DLHA 3GMMA 2W65B 4OCRH 3RVVD 3BZ4B 3WIFA 2Q3ZA 2FGWL 5I18L 3QH3B 5HSFA 2DICA 3X13B 3QXAB 3BZDA 5ERWB 1P7KB 5F1SA 5B8CA 3FRPG 1KC5H 4U1IB 2VDPL 2J88L 3UCRA 4XNUL 4NO2A 5ESQA 1U8KA 1V7ML 1UCTA 2H32A 1VA9A 2GJ6E 3VI4F 5DHYA 4PJ5B 2B20A 4YK4B 1OWWA 1QQDB 2FECI 4ZTOH 2XZCH 2VLJB 4QGTA 3QFJB 2FBJH 1T0MB 4F3FA 1PQZB 5IFJB 1S78D 3IKCA 2M1KA 1JNNL 5KTEL 1MY5A 1N2RA 1A3LL 3QPXL 4L9LB 4PRID 5DF0A 3SO5A 5EOCJ 4MNQE 3TO2A 3LEXB 3MGTA 3RZCB 4PLNC 1KFAL 3M17A 3U0TA 2K7PA 4XNYH 2PUQT 1IGIL 2EYTB 4QTHA 1KPUB 3OKMA 4TVPD 4P2QA 4RFOH 3OKDA 4BM7A 5F9JB 5J11C 2AXJA 3SE4C 3ZT6A 4X6EA 5EZOH 2NY5C 3CZJA 3RWDA 1LO2L 2AK4B 3SDCD 2IAMB 5IM7B 1I7RB 3P30H 2DI7A 4U7MA 5KVGL 5FA3A 1CI5A 2IAND 2FLRT 3FFCD 4NZTH 3UDWC 1FVDB 2AXFA 1HOCA 2D2OA 3IDIA 4WWID 4DQOH 4G6AD 3VRLE 3EFDH 4OLWH 4HZLB 1LNUB 4RMVA 4HK0A 1BFOB 2W0FA 3VGFA 1AY1H 1IQWH 1U8JB 1RZJC 3O8XA 4G6JL 2Y06H 1ZANL 4X9FA 4Z7NE 1FJ1A 1OF2A 3EYSL 2P8LA 4D9LH 4OF5A 2R4RL 2ZSVB 4I9WE 4NWUL 1FFPB 5DUPL 3KYNA 4PJ9C 2CRIA 3OXRB 4S1RL 4FQIL 5C0IA 4F33A 4DCQB 3WNOA 3MRLB 4PJXF 4LCUA 4UDUB 2R1XA 5DEFA 1IGJB 1PZUB 3H2WA 2UZYB 1VFUA 1M1SA 3FONA 3C60C 4U1SB 4UIKH 1UJTA 2DD8L 5LWYH 4XTRD 1RI8A 1R3LA 3VFSB 2UZIL 4L8CB 1CVSC 1XF1A 1RD6A 4M1GL 5CJBA 3GSQA 2A9MH 1H15A 3HI5L 1RK0B 5ALBH 1CF8L 2NY0C 3NZ8A 5CSZA 3U0WH 1ULVA 1OSPL 4B53A 4QHNA 2DDQL 4N0FB 3N06B 3IRZA 4NKIH 5IJKC 4Y16B 1FO0L 1WTGT 3T0EB 3HRPA 1ZT4A 5F7DB 4ZO6A 4GH7B 3VGEA 2OP4L 4U1KA 3L7FA 5E00A 3MLVL 5KANI 4RAUA 5B39G 4PRBB 1UEMA 1H3XA 4G6FD 4X6DA 3G6AA 4YH6A 4H5SA 1S7RB 3U4AA 1J8HE 3HAEG 2P7TB 2IFFH 5ANME 1IT9H 3F58L 3QUML 1N3NB 1XAUA 1YEIL 4OCMC 1MVUA 4ZFGL 5DD5H 4MWFB 1MLBA 2PW2B 3T09A 5A3IC 2D7MA 1EFQA 5C07A 1J0IA 1F3JA 2MCPL 5H35B 2PYED 5IB5A 1N4XH 4KDTA 4QY8B 3O4LA 3ES6B 5ENWA 2VB5A 2M8XA 3E2HB 3HS0A 1FFQA 4JFEA 3G04A 3U46A 3SDDD 3GMNB 1U93A 3WHXA 2C3XA 3OB8A 2YK1L 3HUJA 1FRGL 5CMAA 4LCCA 1JRHH 1DLHB 1PG7H 4X98A 1R5VA 9CGTA 4DEPC 3I50H 3MRKA 1KT2B 5DRXB 1F6AA 2YD6A 3GMRA 4D9QD 4LNVA 3UTQB 2HTKD 3G6JA 4HKZA 5BZWB 2AJ3A 1BVLA 2QEJA 3NCJL 3K46A 5T1LA 3D9AL 3EDKA 1ZT7B 3L6FA 2GFBA 4PTUA 2WUBL 2YRLA 3Q6FB 4I3SH 4N0UA 1HYSD 2JK5B 1K4CB 4XPFL 4F2MB 4UTBL 2R2HA 5C0AB 1EO5A 3FO1A 1YMME 3JWDL 3DTXB 4Y2OA 3UTTA 2QLVB 1OGAA 4MAYD 4P3DB 3PWVA 2APWA 4NQXA 3O6FD 1FO0A 5K9KA 3ULUL 4RGMB 3HZKB 1MLCB 2GIYA 4TN9A 2WINA 3PWJA 4NJAL 1SJEB 5EUOF 3UXFA 5CZVH 3UTZA 2IALA 3SJVA 4KROB 4HUVA 4KKBC 2W9LA 1T1ZB 3STLB 5F7EH 4KJPC 2RB8A 3DMMB 5HHMB 3GO1L 3PJSB 1RIHH 3BKYH 3L5JA 4HIHB 2A6JA 2WUCL 3CFEA 3TH2T 5SWZD 2DM4A 4OLXH 4R90L 4M6AA 3SGEH 5FKAB 4W6YB 2AJVL 1BIIA 5E9DA 3NCFB 1X5KA 1EERB 4WGWB 1FLRL 1G0DA 3HI6L 4J3XA 5DQJB 1IL1A 2KQMA 2ILLA 4NFDA 2A6DA 4NQVB 4JFFA 4YAQB 3Q5OA 2Z93A 4Q6IC 4G42A 3U6RA 1JTPA 1SQ2N 5CS7A 1CFQB 2YC1A 3LPGA 4PJEF 4EKXA 4I8DA 4DTGL 2VO5A 4APQD 4DVBB 2PYFB 2CGRL 1FNFA 2VLKB 2V7HB 3KYOB 5FKPA 3RWJB 1ROWA 3EYUL 3KR3L 1JN6A 2XACC 3UTSB 5C7XL 4Y4FD 3QUKA 1P7QD 1U8LA 2CKBA 2VNCA 3N50A 1FSKB 4GRMA 2HT2D 5EZJ<