2BSKB

Crystal structure of the tim9 tim10 hexameric complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
LEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9
publication title Crystal Structure of the Mitochondrial Chaperone Tim910 Reveals a Six-Bladed Alpha-Propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 18
structure length 65
sequence length 65
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 2bskB00
2BSKB 3CJHA 3DXRB 2BSKA 3CJHB 3DXRA
chains in the Genus database with same CATH superfamily
4L87A 4MTOA 5J2TA 2YDEA 3RVYA 1HNWO 3LNMB 1X4TA 1FXKC 3CSXA 1V54B 2DYSB 4LF4B 3STZC 3FAVA 1P84F 4X1YA 2F4VB 4GCZA 5H6QA 2F66C 4YJ2B 2NLJC 4PELA 3D36A 3T2MA 3QO8A 4FLYA 5KMGA 1PNMA 2W6JG 1ZL8A 2HHHO 1AJQA 5CMUA 1CEZA 4GZRB 2FYUH 2UUAB 3QO7A 4PD4F 3DC6A 4GKJO 4LF8O 4DV7O 2L6LA 1FFTB 4OXSA 4PA6A 4JYCA 4FM2A 1E79G 1ZTEA 5IE9A 2BSKB 3WB1A 1XL6A 1N0NA 2ZE5A 4LNUA 4LF6B 4NXMB 3VOUA 1IBKO 4AHCA 3LNNA 2EZOA 2NNUA 3AG2B 2WLKA 2XAQA 4X64B 2XAFA 1ENVA 4PI2A 1JFFB 4DV1B 2GTAA 1M57C 4DV6B 3CC2V 2YIDA 4CBCA 1S0VA 2ITCC 3DXRB 2KQXA 2ZKOA 4QPKA 3B40A 1GTOA 1HR0B 3A8TA 1A32A 1F51A 1M5IA 3H1KH 5J2UA 1KC8W 4JI2B 1R3IC 3BA8A 3SJAC 4Z1MG 2LP7A 4PJ0Z 5CA1B 2E74B 4IYIA 4NTXA 4LH7A 3QNEA 4P9PA 2QR4A 3ZHTA 3HKDB 3HKBA 1ORQC 3DTUB 1OCCC 1VQPV 2Y48A 4I9WA 4YJ3B 4QIWF 3JD3A 5KX5A 4GT1A 1D5AA 2EILC 3I55V 1YDXA 2CTWA 3L75H 3ETDA 2EINB 5BY1A 4B7KA 2UXBO 1XILA 3ZCCA 5IJ9A 1BT8A 1Y67A 3ZRWA 2CAZC 5IT9N 2UXDB 2JGUA 3CCUV 5H9CA 1M57B 5K1PA 1BE3H 1TA8A 1AR5A 1MG1A 1VF6C 3HKCA 3ABMC 3JD2A 5L3BA 1K97A 3VQXA 3C90A 1TVKB 4J42A 2LGQA 4UCSA 1JQ0A 5A2QN 1Y76A 5IYZA 4WFHA 3P32A 4FLWA 3F7VC 3H1LH 3APOA 5LA6B 3SYCA 2DE0X 1HNZO 2YC0A 1Q7YW 1Y74A 2RNBA 4X66B 4JV5B 2E5LB 4I50B 3ZEDA 1F4MA 3H01A 1OCCB 5LYJB 4MTGA 1L8DA 3HB3B 2IJHA 3OR7C 4W4LA 1O9GA 4I7ZB 2ZR3A 1XUQA 5JQGB 3S3WA 1K92A 3K59A 4X1IA 2O57A 3DC5A 4GX2A 5JCOC 1R73A 2JIZG 2VWKA 5CB4B 1WB8A 3KG2A 1YTFD 4MVOA 4NXMO 4JTCB 3RVZA 3CCLV 5BR8O 4X64O 1JJ2U 1YJWV 4DV1O 4J11A 3ML0A 4K0KB 1N4CA 2IU0A 1XNRB 4DV6O 1SA0B 5HFMA 1RP3B 5LP6A 1S77D 1XMQO 4DXWA 4YHHO 1OCOC 1FYJA 2QM7A 5EZYB 3IC7A 4DV0B 4DV5B 4FFBA 4O4HA 3ABKC 1QCEA 4YIOA 4E2LA 4JYYA 5IJ0B 3ABUA 3CCSV 5KHJA 2P6JA 2XAGA 4EB6A 1DLBA 2R9IA 3OUFA 4H44B 4MVSA 2W0XA 3U11A 2LO1A 1H2NA 1Q81W 2JDIG 2A3QA 1I5YA 3RYIA 2P4KA 1NR1A 2AXTZ 4TV9B 3CS5A 4FFKA 3O65A 4MTFA 4PA3A 4RQEA 4DK1A 4FVMA 4WFFA 4JI7B 3JASB 4LR3A 3UT5A 1YCIA 2XNDG 1N32B 4JI5O 2MW2B 4B3RB 4L8JA 4FLTA 4LFCO 3L73H 3CRQA 2LFSA 4UCVA 3E89A 5LHIA 1OCOB 2YXHA 4O4JA 1R1BA 3RBZA 3N2GB 4UV8A 1K5SA 2EIMC 3SYQA 3WB2A 2Q7EA 2F43G 3G6BA 2ITDC 4B3TO 1MSDA 2JK5C 1ZLZA 4R7CA 2E75B 5EYPA 2VRZA 3J81N 4X66O 2VQEB 2E5LO 4UB8Z 1IXMA 4R50A 2ZD9A 2BOCC 3JARA 5D5QA 3ASNB 4B7EA 2HJDA 3IFXA 3UM7A 1KB9F 3OT7A 1WA8A 3RYHB 1VQLV 5BMVB 5JH7B 2DQ3A 2DW4A 2P67A 3LSQA 3BEHA 1QLNA 5CBFA 1YJ9V 3K06A 1VQ4V 2R9AA 1EBOA 2EJ7A 3L71H 4TQFA 3VQVA 2WLHA 1HDJA 4UCUA 3OMAB 3ZRXA 4AILC 3OFNG 3OTFA 2YIBD 1NJIW 1KMIZ 1PL0A 2V7QG 2UXCB 2LJ2A 1IXBA 4K0KO 3FKSG 1NH2D 2Q4PA 1I7FA 3W7WA 1RPOA 1VQ8V 1MZEA 1JX9A 2Y4TA 1Q6HA 4J80A 1RFYA 5B1BC 5FL7G 2KG7A 3JCZA 1EN4A 2ZXWB 5L3FA 3OGIB 4JI3O 4O2BB 3ZX6A 2BE3A 2JVDA 2CGNA 4O4LA 4F6RA 3BAAA 4QPJA 3ZHUA 5K1XA 1QHTA 1AI6A 1BHAA 1Y66A 3BY6A 1N36O 1G4YB 3T1HB 1GN4A 2PYJA 2VWJA 4DR3B 2QKAA 2WLIB 1MSWD 3CRCA 3P30A 1TUEB 1MNGA 1JOYA 1J95A 2FMLA 4I4TB 4Q6GA 3ZBHA 4OX9O 2Z3YA 5DECA 4UXNA 1U96A 1FKAO 4TSFG 2LGWA 2PYLA 1N32O 4PA9A 1LUVA 2LFRA 1TUBB 4YIPA 2M6YA 4MTXA 3QF7A 4TV8B 2JS5A 3ICXA 1Z5WA 4X65B 1IX9A 4X8AA 4J7JA 1R6KA 1JJOA 1PPJH 2JJ1G 5AG2A 1CP9A 5B1BB 1FXKA 1G8MA 1JCHA 3CPWU 3P3PA 4B08A 3G71V 1XMOO 1SQXH 3SDLA 3ZHRA 1PNLA 4D7SA 2DQ0A 2WLLB 4CH3A 3E8GA 1KD1W 4QGPA 2QKSA 2DYSC 3G67A 3OAAG 1B3QA 1M93A 2RCVA 2EX3A 2WWWA 2A79B 1NTKH 3JYCA 2KKWA 1IZ3A 4I55B 4PDVA 1QVFU 2ZNIA 5IYBO 2V4DA 2IU3A 4RWUA 3RYFB 1GN2A 4TUYB 2PI4A 2CH7A 1BS3A 5CBGA 1VQKV 3SYOA 2X7RB 4I0XB 2QWOB 5GW7A 4H33A 4LP8A 5CN0A 5GTHZ 3C3TA 3H9VA 5CA0B 5JJEB 4DR1O 4JTDB 3R65A 4ZI7B 2XUMA 3CJHA 5B1NA 3CHXA 1N34B 1SZTA 2CK3G 1SQBH 1K9MW 4QE7A 5IWAB 2UXCO 3E8FA 1XREA 2Y4UA 5DEDA 2YIAA 3OE7G 3A2FA 3GB7C 3SYPA 1W0KG 2YSUB 4UUJC 5F2VO 3H1IH 1SRYA 3ZRVA 3K5NA 4W4KA 5LMNB 3M7MX 4BWAA 1WPBA 1L1FA 4EFBA 2QA4V 1L0LH 1Z2GA 3OEHG 1BSMA 4JI0O 4FM1A 1DK1A 4J7KA 4BR6A 2BTQA 4C7UA 4WFBV 4HNAA 1B6QA 5EIBC 4ZOLB 1DGSA 2ZE8A 2ZM6B 1XHXA 3B4SA 3PJSK 5EIBD 1PM9A 3ABLB 3QG5A 2F93B 3OUSA 1I08A 1YZBA 3JAWB 5IYDO 1VP7A 2UUCB 2ARHA 1COWG 3BRCA 4JI1O 1SQQH 2GTSA 1HW7A 2EINC 2UUBB 4DR6O 2WSSG 1IBLB 4WBNA 1AR4A 5LXTB 2JEXA 1VF6A 4BW5A 3GWKC 4GUNA 3FB7C 5JJJB 4TOIA 3U0ZA 4IL6Z 1VQMV 1IURA 1VIBA 4DUZB 4GKKB 3BA9A 4N23A 1E1RG 4X65O 1P49A 3K3WA 4IIJA 3CD6V 2JGDA 3DSQA 1NKDA 2JS3A 5KA6A 2YI9A 3ASOB 2YEVA 5LOVB 3THOA 4DR5B 1JMKC 1Q90D 2WLJA 1SQPH 4B3MB 3F5TA 4X1KB 1DTOA 2QJ1A 1YIJV 2K9PA 2ZDIC 2X6AA 3RW0A 3FFQA 4X62B 2OCCB 2H3OA 2WAMA 4U3JB 4PDLA 3MHSC 4X20B 5KUKA 1XQ8A 4MVRA 2HFEC 4Z1VA 1Q6IA 5JCOA 2MK3A 1Q6UA 4DV2B 1GN3A 5EBMC 4AQYB 2EZPA 3ZMVA 3OW2U 1I94O 4DV3O 2PY5A 3SGIA 1QQCA 3ZRSA 3B8NA 1AVMA 2N04A 4UCRA 5DN6G 2W6IG 4KHPO 4KFMA 3JD4A 4PDRA 2GUZA 1X59A 1HWYA 2XHBA 4GYCB 3JALB 2GSMB 4HYOA 1OV9A 4BIUA 2QWNB 3P3NA 4G2KA 3E22B 1LR1A 1J5EB 2JJ2G 2AZ0A 3SPGA 3FD9A 4DV4O 3LSUA 5GONA 4K8XA 1PP9H 3LDEA 1FFXA 2B5UA 1K73W 4ZHQB 3JD1A 1AP6A 5FNVA 1GKFA 2B9ZA 1VQ5V 4KUMA 4B3SB 3SR2C 4HAMA 1IBMB 4LF4O 1AI5A 1CPYA 2F4VO 3TGUH 3ETEA 1ZUQA 4DUYB 1M90W 1H2MA 4O2AA 1YSCA 5TISZ 2GBOA 4JI8B 2L35A 3E8BA 2UUAO 3FAVB 4R8CA 4X1YB 4K3AA 1IDSA 3K5LA 1Y6XA 2ZT9B 4LFBB 1MA1A 5KMGB 1M56B 2QWPB 2IW5A 1PD3A 1ZL8B 2RDCA 1XDCA 2PTMA 4LWSA 3K0DA 1IBLO 4TQDA 1JPXA 2NN4A 4LF6O 5KAIZ 3K79A 2VS0A 3FYIB 4JYAB 1OCZB 2AHZA 3UO2A 2F1MA 5LBQA 4D7TA 5H2FZ 3LDCA 4LNUB 4NYKA 2VQFB 1HR0O 1I5XA 1PKXA 2IBZH 3CYOA 3BFRA 3OEEG 3AK2A 1UPGA 5LGNA 1FPOA 1R3JC 1WN7A 3H1JH 3K9SA 4JI2O 4DR5O 1AILA 5J9PC 4TWKA 4B3MO 1AJNA 2M7WA 5KA5A 3STLC 2QDOA 2QTSA 5KHKA 3B77A 3FX7A 2QSAA 4KL1A 4NVPA 3K5OA 1H2SB 5JVDA 4FLZA 3ASNC 2A0LA 5J2UB 2V1DA 1KKCA 4R6ZA 2ATKC 2F95B 3HKEA 1ZSPA 4HBNA 3SYAA 3CB2A 3JATA 1NTZH 2D3OW 4AQYO 3SPJA 3K0GA 2ADQB 1AP5A 3ZMZA 3ZHQA 2IH1C 3HKBB 3KKYA 4CH6A 4LFAB 3N2KA 1UFIA 3ZIAG 2XAJA 3OGCC 1XEQA 2OIGA 4JF3A 4KXRA 2Q68A 2QKCA 5KX5B 4DYLA 3QTCA 3OTOB 2UXDO 4LC1A 1NQTA 1OCRC 4JGSA 1XNQB 1NZ6A 3IGAC 5LHGA 2XTAA 1XBLA 3JSLA 2EIKB 3W7SA 4NTWA 5IJ9B 1J5EO 3JD0A 1Q3EA 2WLMA 3ZRWB 1RSOB 3E86A 1N33B 1HP8A 1HNXB 1U97A 4FM0A 1MZFA 1FXVA 3HKCB 4NR1A 1H38A 1IBMO 4JV5O 1H8HG 4GLXA 1D5NA 1NS1A 1K34A 1PNKA 1YJNV 1VEWA 4J41A 4JTAB 1CXZB 2ZXWC 1Y76B 5IYZB 4DR4B 4WFEA 3TXQA 5ITZA 2CE4A 4UVAA 1JR9A 4DR2B 1H8EG 4JI8O 1Y74B 1P7GA 3TETA 1KU9A 3MDSA 2PZSA 3L9DA 3RYFA 1GN6A 1KKDA 1VF7A 4ZBMA 5IY5B 4PA7A 4YXWG 2DYRB 4NXNB 4PDMA 4MT8A 2X6CA 2YXLA 5CA0A 2OWOA 4PI0A 1N8RW 1RM1B 4F6EA 3H1HH 3L72H 1K3EA 1OCRB 2CTPA 3CXCU 2ADPA 4DRXA 3CCRV 4QJFB 4JI4B 4X1IB 2RJZA 3BCCH 1R3LC 2Q67A 3ZN0A 5EK0A 1Q86W 1E1QG 1XNRO 1WPXA 2A9HA 3JAKA 3T1YB 2PI5A 2ZIMA 5C8YA 2RN9A 3RYCA 2UXXA 5KAFZ 4O4IA 4H37A 2HKOA 2ETNA 4JAVA 4UVBA 1IVSA 2EIJC 3CCEV 1WJZA 1M4UA 4DV0O 4DV5O 2UU9B 1S5LZ 1H2KA 1PL4A 1Z5VA 3LDDA 5CA3A 4P9OA 3J7AU 4P30A 1W59A 1QBZA 5E1AC 5LP6B 1LNQA 4RUEA 3SPHA 4YJ2A 3CRAA 3E35A 4FFBB 1YVWA 3X2QB 4KP4A 4MW8A 4O4HB 4ZOLA 1HNWB 1P7BA 3EXAA 1S5HC 4K35A 3JAWA 4EB6B 1SQGA 4JASA 4JI7O 2HEPA 1ZWIC 2HHHB 1GO3F 2BSKA 1K4CC 5EC2C 3RYIB 2AW9A 2JEUA 1SESA 3SPCA 3W7XA 4B3RO 4P2ZA 5FPRA 4ABMA 4GKJB 3WB0A 4LF8B 4IYHA 1JFFA 2YICA 2CUGA 2QWQB 5LL6Y 3BPZA 3QVNA 3UCSC 2HP8A 4CS4A 2EIJB 4X9QA 1Y4MA 3DXRA 4LF5B 3TK1A 1K33A 2CTQA 3KCXA 1MABG 1IBKB 1YXBA 5B66Z 3AG3C 2IJJA 4MW3A 1FXHA 3FB5C 3VQWA 2VQEO 1K8AW 4O4JB 1KQSU 1FS0G 5CA1A 5EBWC 3CCVV 4J9YB 3CCJV 2EBOA 2CGOA 1NI8A 2F23A 4CS3A 3HKDA 2ILMA 3CRRA 5EYPB 5JJNB 3BABA 4YJ3A 3ZHVA 4E4EA 3GWOA 5EC1C 2YUAA 2BTOA 2Q8VA 4UVCA 3ABLC 3JARB 4NXNO 2EULA 5B1AB 4DW1A 1KP2A 1WA8B 1QLEB 3WU2Z 3ABTA 5BZBA 5B3SB 4PV1B 2A7WA 2LW1A 2Q73A 4J9ZB 4CC6A 4JI4O 3TJTA 3NR7A 1YHQV 4I5SA 3A0HZ 5LHHA 4OGQB 5KUMA 3RGBA 5LGTA 2EJRA 1BGYH 4UCTA 1TVKA 5KHHA 5C93A 3UQ8A 2UXBB 1SQVH 1W0JG 3JSNA 1F4NA 2IH3C 3CE2A 1GK9A 3AG3B 3AG7A 1KP3A 2OIEA 5B1OA 3OM3B 5LA6A 2ZCEA 2OTLV 1F7YA 3ASOC 4IHJB 3VBBA 4ASUG 1Q43A 1Q82W 4I50A 2LQTA 1AB3A 3FB6C 3ZS8C 3LUTB 3T4ZA 2ZDIA 1BHBA 3UO3A 1XL4A 4UB6Z 4DK0A 2Y0IA 4ZKIA 4FJCC 2HVJC 5LYJA 4CC5A 3IJ4A 2Q6AA 1YEWA 1HNZB 2DN9A 1YITV 1XI1A 3KCYA 5DM6V 3T1HO 2ZIOA 2KG7B 4DR3O 1GM9A 2OCCC 3B09A 3WG7B 1SQFA 5JQGA 4JZGA 5KHIA 1AROP 4O4LB 4F6RB 3WFVA 1OJHA 3RN4A 3E2EA 3M8AA 5CB4A 4FPPA 4X89A 3D3QA 5JWPA 1FD9A 1SETA 2HLDG 5D5PA 1R6NA 1SC5B 4QE9A 2K1EA 3AG4C 5H5NA 2AGAA 4QNHB 4LBEC 1SA0A 1G6UA 1KECA 3OR6C 3K08A 4LF5O 3CP1A 5EZYA 2Y69B 2QEXV 5BR8B 3KZIZ 4JPRA 1JVMA 1EZJA 3CX5F 4MSWC 3HPLC 4EKWA 4U3FH 4G28B 5IJ0A 3F5WC 1L0NH 1PV0A 2OT5A 4DW0A 2Q0OC 1XMQB 4YHHB 3LSSA 4PA4A 1URFA 2CTRA 2ZE7A 2P7TC 4XDJA 1FXKB 1I0HA 2N74A 4BW9A 2N05A 2IJKA 2YS8A 5IYCO 2E3CA 1GH6A 4TV9A 1R6TA 5L3GA 3K58A 1ZX3A 2NR5A 1WP8A 3JASA 3D36C 4F4LA 2WA3A 4XDKA 2KSDA 1M56C 2IM9A 1N34O 2ZNJA 4FLUA 3AEIA 3AG4B 5IWAO 2ZE6A 2CH7B 1Q5OA 4LF7B 4X88A 1OCZC 2Q5ZA 2ZQMA 2DWDC 4N21A 2AHYA 5H6RA 3CC4V 3EFFK 2QM8A 3N2GA 3CJHB 2R70A 1M1KW 1V9PA 1K4DC 1RSOA 4JI5B 2OCHA 2FKXA 2Z0AA 1BCCH 4LFCB 3MAQA 4Q20A 1FAFA 1QR8A 5LMNO 4GX5A 1NVPD 3OMIB 4TT3G 1NU1H 4UCOA 5LMUB 1S3JA 4MVMA 4WF9V 3Q4HB 3OMNB 4MVQA 3K57A 1SZXA 4B3TB 1G1XB 1GAXA 5J2TB 2ODMA 3T1CA 3RYHA 2DOSA 5BMVA 5JH7A 2ZM6O 1GRJA 1BMFG 5L3CA 5CBHA 5KLVH 4YY3B 4WCEV 1QNMA 4LF9B 1S5JA 2BTQB 3AK3A 1OZ0A 4G27B 2UUCO 4BIZA 4HNAB 3D3IA 3PN1A 3NXSA 4U7OA 4BAYA 2OTJV 5FPOA 2UUBO 1WLEA 2EILB 4XDLA 1US6A 4RO2A 1B04A 1VQNV 3G6EV 4DUZO 4CZZA 1F23A 4NB5A 2G38A 4GKKO 2XT9A 4U7NA 4FLVA 1NVPB 4WBNB 2A06H 2EIKC 1KYOF 1VQ9V 4MS2A 3QO5A 2Q69A 3ABMB 1MMMA 4FMTA 1WB7A 3CEIA 3TXSA 1XOUA 2IJIA 4JAAA 4HZ3A 4MVZA 1WAZA 4IGGA 1AR1B 2XASA 4O2BA 3JAMN 4IIJB 4ZIBA 5FLXN 1LUWA 5KHGA 2JGDB 2FTKA 4X62O 5E79Z 2YEVB 4RAIA 1ZAUA 3ZHSA 1OHHG 2B1IA 2WLIA 4JI3B 3W7UA 3TCUA 5L3EA 1BL8A 1R3KC 4DV2O 4J7ZA 2YIBA 1EFRG 1VMGA 3ETGA 3CC7V 4I4TA 2GV9A 5IY5C 1WNSA 1AJPA 2DYRC 1YF2A 1N36B 4JI6B 1SERA 1AI7A 1N0JA 5A9GA 3A0BZ 1KBHA 1RM1C 3CMEV 1YTFB 1SF9A 1TUBA 2C2AA 4LF7O 1FJGB 4OX9B 1M9NA 2HG5C 1NBMG 4TV8A 1RPRA 3SJQC 2R72A 2YXYA 4IT5A 4RQFA 4Z2WA 1QVGU 3IC9A 4GX0A 1GM7A 3ZJZA 3AK1A 1DF5A 2GUZB 1S72V 4B3SO 2GHYA 2P22C 1V55C 2P4VA 2WLLA 5LMUO 3A0RA 3ZMTA 3C3SA 1DF4A 2UXNA 4OPAA 5GONB 2DJVA 4DUYO 2Q7GA 3ABKB 5LP6C 3SPIA 4CS2A 1FFXB 2PF4E 1VQ7V 3G4SV 3AG1C 4MVUA 1Q8IA 2CDYA 2Z5UA 5FNVB 1XMOB 3L74H 1EN6A 4I55A 2GDSA 3X2QC 4EFEA 4YY3O 3FYEB 4TUYA 2RMKB 4LF9O 2X6BA 2Q7HA 1VF5B 2HJFC 2ZR2A 5EBLC 4I0XA 3B8MA 3G80A 2H94A 1AI4A 5BXZA 3APQA 4O2AB 4I9QA 4LFBO 1BQZA 2Q0AA 4FZ1A 4ZI7A 2DWEC 3MD0A 2XAHA 2WLNA 2FL4A 1MOFA 1T5EA 4JYAO 3J80N 4DR7B 2KB1A 3BHPA 5B5EZ 4UFZA 4DR1B 3DGEA 3T4DA 4BIOA 4LWSB 2X0LA 2VQFO 3N27A 1O9HA 3ZMUA 4LH6A 2P90A 2E76B 5LGUA 1V55B 3K03A 3VQYA 3ZN1A 2EIMB 2WPDG 4IHJA 1NT2B 2H8PC 1XHZA 3RFRA 3K5MA 1BZKA 1EM1A 1P4RA 3CRMA 3AG1B 4ICGA 1K5QA 1QU7A 1B06A 3K04A 3SJCC 1ROPA 2P06A 1VARA 5HFLA 4JI0B 1D2DA 4FK5C 3EVKA 2HVKC 2LW7A 2P5OA 2B1GA 4CH5A 3OD4A 5JVDB 4PHZA 3S3XA 4LFAO 5B1AC 4GX1A 3M99B 4JI6O 3SJBC 4FZ0A 1QLEC 3B2EE 5LXTA 1TGOA 4NKGB 3HKEB 3OTOO 1NR7A 2XOKG 3JATB 1TAEA 1THZA 5B3SC 3RWRD 1XNQO 1FJGO 4DV7B 3CMAV 1SS3A 1H2LA 2QWRB 4JI1B 2AZ2A 5GTIZ 1EZVH 3N2KB 2JRIA 2W0FC 2YI8A 4NTYA 1SKVA 4DR6B 4JZ2A 3UT5B 1NH2B 4J10A 5IDJA 2R9RB 1N33O 1K7DA 4WFGA 1KUQA 3EHBB 1WP7A 1HNXO 2QE7G 4AI8A 5LOVA 4K8ZA 3R66A 2RQ6A 3IAYA 3W7TA 3FB8C 2Q9LA 4OPHA 1QR9A 1GM8A 3I56V 3ETQA 4X1KA 4FIPC 4CH4A 3L70H 1H2GA 4DR4O 3GVMA 1UJWB 3CCMV 4JAUA 4H13B 4DR2O 2QGNA 4U3JA 4XBFA 4X20A 2PGGA 1S76D 1YI2V 3O9OA 3ZMSA 1V54C 2BOBC 4H0LB 3WG7C 1NTMH 5ITZB 3I5DA 4A5UB 2Y0PA 1EN5A 2BCCH 4FLXA 3CWBH 3HR0A 2QM4A 5L3DA 3E8HA 1JA8A 2WA4A 3UKMA 4RUFA 4DR7O 4EEQA 3JCUZ 2FB5A 4LCUC 1VQ6V 3U10A 3CXHF 1W2BU 1I94B 2PUSA 4DV3B 3JALA 3T1YO 1VQOV 2D2CB 3F7YC 3E22A 1GMGA 3MHHC 2HR3A 3E83A 4JYBA 4WFAV 3RT3C 2ZINA 4DRXB 4KHPB 4DO2A 2Y69C 3K9AA 2UU9O 4ZHQA 4UV9A 3AG2C 4D6TH 3CCQV 3JAKB 2QTOA 3BVOA 1BQ0A 3RYCB 5C8YB 3Q4HA 4O4IB 2OYQA 2DMXA 3D8CA 4DV4B
chains in the Genus database with same CATH topology
2BSKB 3CJHA 3DXRB 2BSKA 3CJHB 3DXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSK B;  3CJH A;  3DXR B;  2BSK A;  3CJH B;  3DXR A; 
#chains in the Genus database with same CATH topology
 4L87 A;  4MTO A;  5J2T A;  2YDE A;  3RVY A;  1HNW O;  3LNM B;  1X4T A;  1FXK C;  3CSX A;  1V54 B;  2DYS B;  4LF4 B;  3STZ C;  3FAV A;  1P84 F;  4X1Y A;  2F4V B;  4GCZ A;  5H6Q A;  2F66 C;  4YJ2 B;  2NLJ C;  4PEL A;  3D36 A;  3T2M A;  3QO8 A;  4FLY A;  5KMG A;  1PNM A;  2W6J G;  1ZL8 A;  2HHH O;  1AJQ A;  5CMU A;  1CEZ A;  4GZR B;  2FYU H;  2UUA B;  3QO7 A;  4PD4 F;  3DC6 A;  4GKJ O;  4LF8 O;  4DV7 O;  2L6L A;  1FFT B;  4OXS A;  4PA6 A;  4JYC A;  4FM2 A;  1E79 G;  1ZTE A;  5IE9 A;  2BSK B;  3WB1 A;  1XL6 A;  1N0N A;  2ZE5 A;  4LNU A;  4LF6 B;  4NXM B;  3VOU A;  1IBK O;  4AHC A;  3LNN A;  2EZO A;  2NNU A;  3AG2 B;  2WLK A;  2XAQ A;  4X64 B;  2XAF A;  1ENV A;  4PI2 A;  1JFF B;  4DV1 B;  2GTA A;  1M57 C;  4DV6 B;  3CC2 V;  2YID A;  4CBC A;  1S0V A;  2ITC C;  3DXR B;  2KQX A;  2ZKO A;  4QPK A;  3B40 A;  1GTO A;  1HR0 B;  3A8T A;  1A32 A;  1F51 A;  1M5I A;  3H1K H;  5J2U A;  1KC8 W;  4JI2 B;  1R3I C;  3BA8 A;  3SJA C;  4Z1M G;  2LP7 A;  4PJ0 Z;  5CA1 B;  2E74 B;  4IYI A;  4NTX A;  4LH7 A;  3QNE A;  4P9P A;  2QR4 A;  3ZHT A;  3HKD B;  3HKB A;  1ORQ C;  3DTU B;  1OCC C;  1VQP V;  2Y48 A;  4I9W A;  4YJ3 B;  4QIW F;  3JD3 A;  5KX5 A;  4GT1 A;  1D5A A;  2EIL C;  3I55 V;  1YDX A;  2CTW A;  3L75 H;  3ETD A;  2EIN B;  5BY1 A;  4B7K A;  2UXB O;  1XIL A;  3ZCC A;  5IJ9 A;  1BT8 A;  1Y67 A;  3ZRW A;  2CAZ C;  5IT9 N;  2UXD B;  2JGU A;  3CCU V;  5H9C A;  1M57 B;  5K1P A;  1BE3 H;  1TA8 A;  1AR5 A;  1MG1 A;  1VF6 C;  3HKC A;  3ABM C;  3JD2 A;  5L3B A;  1K97 A;  3VQX A;  3C90 A;  1TVK B;  4J42 A;  2LGQ A;  4UCS A;  1JQ0 A;  5A2Q N;  1Y76 A;  5IYZ A;  4WFH A;  3P32 A;  4FLW A;  3F7V C;  3H1L H;  3APO A;  5LA6 B;  3SYC A;  2DE0 X;  1HNZ O;  2YC0 A;  1Q7Y W;  1Y74 A;  2RNB A;  4X66 B;  4JV5 B;  2E5L B;  4I50 B;  3ZED A;  1F4M A;  3H01 A;  1OCC B;  5LYJ B;  4MTG A;  1L8D A;  3HB3 B;  2IJH A;  3OR7 C;  4W4L A;  1O9G A;  4I7Z B;  2ZR3 A;  1XUQ A;  5JQG B;  3S3W A;  1K92 A;  3K59 A;  4X1I A;  2O57 A;  3DC5 A;  4GX2 A;  5JCO C;  1R73 A;  2JIZ G;  2VWK A;  5CB4 B;  1WB8 A;  3KG2 A;  1YTF D;  4MVO A;  4NXM O;  4JTC B;  3RVZ A;  3CCL V;  5BR8 O;  4X64 O;  1JJ2 U;  1YJW V;  4DV1 O;  4J11 A;  3ML0 A;  4K0K B;  1N4C A;  2IU0 A;  1XNR B;  4DV6 O;  1SA0 B;  5HFM A;  1RP3 B;  5LP6 A;  1S77 D;  1XMQ O;  4DXW A;  4YHH O;  1OCO C;  1FYJ A;  2QM7 A;  5EZY B;  3IC7 A;  4DV0 B;  4DV5 B;  4FFB A;  4O4H A;  3ABK C;  1QCE A;  4YIO A;  4E2L A;  4JYY A;  5IJ0 B;  3ABU A;  3CCS V;  5KHJ A;  2P6J A;  2XAG A;  4EB6 A;  1DLB A;  2R9I A;  3OUF A;  4H44 B;  4MVS A;  2W0X A;  3U11 A;  2LO1 A;  1H2N A;  1Q81 W;  2JDI G;  2A3Q A;  1I5Y A;  3RYI A;  2P4K A;  1NR1 A;  2AXT Z;  4TV9 B;  3CS5 A;  4FFK A;  3O65 A;  4MTF A;  4PA3 A;  4RQE A;  4DK1 A;  4FVM A;  4WFF A;  4JI7 B;  3JAS B;  4LR3 A;  3UT5 A;  1YCI A;  2XND G;  1N32 B;  4JI5 O;  2MW2 B;  4B3R B;  4L8J A;  4FLT A;  4LFC O;  3L73 H;  3CRQ A;  2LFS A;  4UCV A;  3E89 A;  5LHI A;  1OCO B;  2YXH A;  4O4J A;  1R1B A;  3RBZ A;  3N2G B;  4UV8 A;  1K5S A;  2EIM C;  3SYQ A;  3WB2 A;  2Q7E A;  2F43 G;  3G6B A;  2ITD C;  4B3T O;  1MSD A;  2JK5 C;  1ZLZ A;  4R7C A;  2E75 B;  5EYP A;  2VRZ A;  3J81 N;  4X66 O;  2VQE B;  2E5L O;  4UB8 Z;  1IXM A;  4R50 A;  2ZD9 A;  2BOC C;  3JAR A;  5D5Q A;  3ASN B;  4B7E A;  2HJD A;  3IFX A;  3UM7 A;  1KB9 F;  3OT7 A;  1WA8 A;  3RYH B;  1VQL V;  5BMV B;  5JH7 B;  2DQ3 A;  2DW4 A;  2P67 A;  3LSQ A;  3BEH A;  1QLN A;  5CBF A;  1YJ9 V;  3K06 A;  1VQ4 V;  2R9A A;  1EBO A;  2EJ7 A;  3L71 H;  4TQF A;  3VQV A;  2WLH A;  1HDJ A;  4UCU A;  3OMA B;  3ZRX A;  4AIL C;  3OFN G;  3OTF A;  2YIB D;  1NJI W;  1KMI Z;  1PL0 A;  2V7Q G;  2UXC B;  2LJ2 A;  1IXB A;  4K0K O;  3FKS G;  1NH2 D;  2Q4P A;  1I7F A;  3W7W A;  1RPO A;  1VQ8 V;  1MZE A;  1JX9 A;  2Y4T A;  1Q6H A;  4J80 A;  1RFY A;  5B1B C;  5FL7 G;  2KG7 A;  3JCZ A;  1EN4 A;  2ZXW B;  5L3F A;  3OGI B;  4JI3 O;  4O2B B;  3ZX6 A;  2BE3 A;  2JVD A;  2CGN A;  4O4L A;  4F6R A;  3BAA A;  4QPJ A;  3ZHU A;  5K1X A;  1QHT A;  1AI6 A;  1BHA A;  1Y66 A;  3BY6 A;  1N36 O;  1G4Y B;  3T1H B;  1GN4 A;  2PYJ A;  2VWJ A;  4DR3 B;  2QKA A;  2WLI B;  1MSW D;  3CRC A;  3P30 A;  1TUE B;  1MNG A;  1JOY A;  1J95 A;  2FML A;  4I4T B;  4Q6G A;  3ZBH A;  4OX9 O;  2Z3Y A;  5DEC A;  4UXN A;  1U96 A;  1FKA O;  4TSF G;  2LGW A;  2PYL A;  1N32 O;  4PA9 A;  1LUV A;  2LFR A;  1TUB B;  4YIP A;  2M6Y A;  4MTX A;  3QF7 A;  4TV8 B;  2JS5 A;  3ICX A;  1Z5W A;  4X65 B;  1IX9 A;  4X8A A;  4J7J A;  1R6K A;  1JJO A;  1PPJ H;  2JJ1 G;  5AG2 A;  1CP9 A;  5B1B B;  1FXK A;  1G8M A;  1JCH A;  3CPW U;  3P3P A;  4B08 A;  3G71 V;  1XMO O;  1SQX H;  3SDL A;  3ZHR A;  1PNL A;  4D7S A;  2DQ0 A;  2WLL B;  4CH3 A;  3E8G A;  1KD1 W;  4QGP A;  2QKS A;  2DYS C;  3G67 A;  3OAA G;  1B3Q A;  1M93 A;  2RCV A;  2EX3 A;  2WWW A;  2A79 B;  1NTK H;  3JYC A;  2KKW A;  1IZ3 A;  4I55 B;  4PDV A;  1QVF U;  2ZNI A;  5IYB O;  2V4D A;  2IU3 A;  4RWU A;  3RYF B;  1GN2 A;  4TUY B;  2PI4 A;  2CH7 A;  1BS3 A;  5CBG A;  1VQK V;  3SYO A;  2X7R B;  4I0X B;  2QWO B;  5GW7 A;  4H33 A;  4LP8 A;  5CN0 A;  5GTH Z;  3C3T A;  3H9V A;  5CA0 B;  5JJE B;  4DR1 O;  4JTD B;  3R65 A;  4ZI7 B;  2XUM A;  3CJH A;  5B1N A;  3CHX A;  1N34 B;  1SZT A;  2CK3 G;  1SQB H;  1K9M W;  4QE7 A;  5IWA B;  2UXC O;  3E8F A;  1XRE A;  2Y4U A;  5DED A;  2YIA A;  3OE7 G;  3A2F A;  3GB7 C;  3SYP A;  1W0K G;  2YSU B;  4UUJ C;  5F2V O;  3H1I H;  1SRY A;  3ZRV A;  3K5N A;  4W4K A;  5LMN B;  3M7M X;  4BWA A;  1WPB A;  1L1F A;  4EFB A;  2QA4 V;  1L0L H;  1Z2G A;  3OEH G;  1BSM A;  4JI0 O;  4FM1 A;  1DK1 A;  4J7K A;  4BR6 A;  2BTQ A;  4C7U A;  4WFB V;  4HNA A;  1B6Q A;  5EIB C;  4ZOL B;  1DGS A;  2ZE8 A;  2ZM6 B;  1XHX A;  3B4S A;  3PJS K;  5EIB D;  1PM9 A;  3ABL B;  3QG5 A;  2F93 B;  3OUS A;  1I08 A;  1YZB A;  3JAW B;  5IYD O;  1VP7 A;  2UUC B;  2ARH A;  1COW G;  3BRC A;  4JI1 O;  1SQQ H;  2GTS A;  1HW7 A;  2EIN C;  2UUB B;  4DR6 O;  2WSS G;  1IBL B;  4WBN A;  1AR4 A;  5LXT B;  2JEX A;  1VF6 A;  4BW5 A;  3GWK C;  4GUN A;  3FB7 C;  5JJJ B;  4TOI A;  3U0Z A;  4IL6 Z;  1VQM V;  1IUR A;  1VIB A;  4DUZ B;  4GKK B;  3BA9 A;  4N23 A;  1E1R G;  4X65 O;  1P49 A;  3K3W A;  4IIJ A;  3CD6 V;  2JGD A;  3DSQ A;  1NKD A;  2JS3 A;  5KA6 A;  2YI9 A;  3ASO B;  2YEV A;  5LOV B;  3THO A;  4DR5 B;  1JMK C;  1Q90 D;  2WLJ A;  1SQP H;  4B3M B;  3F5T A;  4X1K B;  1DTO A;  2QJ1 A;  1YIJ V;  2K9P A;  2ZDI C;  2X6A A;  3RW0 A;  3FFQ A;  4X62 B;  2OCC B;  2H3O A;  2WAM A;  4U3J B;  4PDL A;  3MHS C;  4X20 B;  5KUK A;  1XQ8 A;  4MVR A;  2HFE C;  4Z1V A;  1Q6I A;  5JCO A;  2MK3 A;  1Q6U A;  4DV2 B;  1GN3 A;  5EBM C;  4AQY B;  2EZP A;  3ZMV A;  3OW2 U;  1I94 O;  4DV3 O;  2PY5 A;  3SGI A;  1QQC A;  3ZRS A;  3B8N A;  1AVM A;  2N04 A;  4UCR A;  5DN6 G;  2W6I G;  4KHP O;  4KFM A;  3JD4 A;  4PDR A;  2GUZ A;  1X59 A;  1HWY A;  2XHB A;  4GYC B;  3JAL B;  2GSM B;  4HYO A;  1OV9 A;  4BIU A;  2QWN B;  3P3N A;  4G2K A;  3E22 B;  1LR1 A;  1J5E B;  2JJ2 G;  2AZ0 A;  3SPG A;  3FD9 A;  4DV4 O;  3LSU A;  5GON A;  4K8X A;  1PP9 H;  3LDE A;  1FFX A;  2B5U A;  1K73 W;  4ZHQ B;  3JD1 A;  1AP6 A;  5FNV A;  1GKF A;  2B9Z A;  1VQ5 V;  4KUM A;  4B3S B;  3SR2 C;  4HAM A;  1IBM B;  4LF4 O;  1AI5 A;  1CPY A;  2F4V O;  3TGU H;  3ETE A;  1ZUQ A;  4DUY B;  1M90 W;  1H2M A;  4O2A A;  1YSC A;  5TIS Z;  2GBO A;  4JI8 B;  2L35 A;  3E8B A;  2UUA O;  3FAV B;  4R8C A;  4X1Y B;  4K3A A;  1IDS A;  3K5L A;  1Y6X A;  2ZT9 B;  4LFB B;  1MA1 A;  5KMG B;  1M56 B;  2QWP B;  2IW5 A;  1PD3 A;  1ZL8 B;  2RDC A;  1XDC A;  2PTM A;  4LWS A;  3K0D A;  1IBL O;  4TQD A;  1JPX A;  2NN4 A;  4LF6 O;  5KAI Z;  3K79 A;  2VS0 A;  3FYI B;  4JYA B;  1OCZ B;  2AHZ A;  3UO2 A;  2F1M A;  5LBQ A;  4D7T A;  5H2F Z;  3LDC A;  4LNU B;  4NYK A;  2VQF B;  1HR0 O;  1I5X A;  1PKX A;  2IBZ H;  3CYO A;  3BFR A;  3OEE G;  3AK2 A;  1UPG A;  5LGN A;  1FPO A;  1R3J C;  1WN7 A;  3H1J H;  3K9S A;  4JI2 O;  4DR5 O;  1AIL A;  5J9P C;  4TWK A;  4B3M O;  1AJN A;  2M7W A;  5KA5 A;  3STL C;  2QDO A;  2QTS A;  5KHK A;  3B77 A;  3FX7 A;  2QSA A;  4KL1 A;  4NVP A;  3K5O A;  1H2S B;  5JVD A;  4FLZ A;  3ASN C;  2A0L A;  5J2U B;  2V1D A;  1KKC A;  4R6Z A;  2ATK C;  2F95 B;  3HKE A;  1ZSP A;  4HBN A;  3SYA A;  3CB2 A;  3JAT A;  1NTZ H;  2D3O W;  4AQY O;  3SPJ A;  3K0G A;  2ADQ B;  1AP5 A;  3ZMZ A;  3ZHQ A;  2IH1 C;  3HKB B;  3KKY A;  4CH6 A;  4LFA B;  3N2K A;  1UFI A;  3ZIA G;  2XAJ A;  3OGC C;  1XEQ A;  2OIG A;  4JF3 A;  4KXR A;  2Q68 A;  2QKC A;  5KX5 B;  4DYL A;  3QTC A;  3OTO B;  2UXD O;  4LC1 A;  1NQT A;  1OCR C;  4JGS A;  1XNQ B;  1NZ6 A;  3IGA C;  5LHG A;  2XTA A;  1XBL A;  3JSL A;  2EIK B;  3W7S A;  4NTW A;  5IJ9 B;  1J5E O;  3JD0 A;  1Q3E A;  2WLM A;  3ZRW B;  1RSO B;  3E86 A;  1N33 B;  1HP8 A;  1HNX B;  1U97 A;  4FM0 A;  1MZF A;  1FXV A;  3HKC B;  4NR1 A;  1H38 A;  1IBM O;  4JV5 O;  1H8H G;  4GLX A;  1D5N A;  1NS1 A;  1K34 A;  1PNK A;  1YJN V;  1VEW A;  4J41 A;  4JTA B;  1CXZ B;  2ZXW C;  1Y76 B;  5IYZ B;  4DR4 B;  4WFE A;  3TXQ A;  5ITZ A;  2CE4 A;  4UVA A;  1JR9 A;  4DR2 B;  1H8E G;  4JI8 O;  1Y74 B;  1P7G A;  3TET A;  1KU9 A;  3MDS A;  2PZS A;  3L9D A;  3RYF A;  1GN6 A;  1KKD A;  1VF7 A;  4ZBM A;  5IY5 B;  4PA7 A;  4YXW G;  2DYR B;  4NXN B;  4PDM A;  4MT8 A;  2X6C A;  2YXL A;  5CA0 A;  2OWO A;  4PI0 A;  1N8R W;  1RM1 B;  4F6E A;  3H1H H;  3L72 H;  1K3E A;  1OCR B;  2CTP A;  3CXC U;  2ADP A;  4DRX A;  3CCR V;  4QJF B;  4JI4 B;  4X1I B;  2RJZ A;  3BCC H;  1R3L C;  2Q67 A;  3ZN0 A;  5EK0 A;  1Q86 W;  1E1Q G;  1XNR O;  1WPX A;  2A9H A;  3JAK A;  3T1Y B;  2PI5 A;  2ZIM A;  5C8Y A;  2RN9 A;  3RYC A;  2UXX A;  5KAF Z;  4O4I A;  4H37 A;  2HKO A;  2ETN A;  4JAV A;  4UVB A;  1IVS A;  2EIJ C;  3CCE V;  1WJZ A;  1M4U A;  4DV0 O;  4DV5 O;  2UU9 B;  1S5L Z;  1H2K A;  1PL4 A;  1Z5V A;  3LDD A;  5CA3 A;  4P9O A;  3J7A U;  4P30 A;  1W59 A;  1QBZ A;  5E1A C;  5LP6 B;  1LNQ A;  4RUE A;  3SPH A;  4YJ2 A;  3CRA A;  3E35 A;  4FFB B;  1YVW A;  3X2Q B;  4KP4 A;  4MW8 A;  4O4H B;  4ZOL A;  1HNW B;  1P7B A;  3EXA A;  1S5H C;  4K35 A;  3JAW A;  4EB6 B;  1SQG A;  4JAS A;  4JI7 O;  2HEP A;  1ZWI C;  2HHH B;  1GO3 F;  2BSK A;  1K4C C;  5EC2 C;  3RYI B;  2AW9 A;  2JEU A;  1SES A;  3SPC A;  3W7X A;  4B3R O;  4P2Z A;  5FPR A;  4ABM A;  4GKJ B;  3WB0 A;  4LF8 B;  4IYH A;  1JFF A;  2YIC A;  2CUG A;  2QWQ B;  5LL6 Y;  3BPZ A;  3QVN A;  3UCS C;  2HP8 A;  4CS4 A;  2EIJ B;  4X9Q A;  1Y4M A;  3DXR A;  4LF5 B;  3TK1 A;  1K33 A;  2CTQ A;  3KCX A;  1MAB G;  1IBK B;  1YXB A;  5B66 Z;  3AG3 C;  2IJJ A;  4MW3 A;  1FXH A;  3FB5 C;  3VQW A;  2VQE O;  1K8A W;  4O4J B;  1KQS U;  1FS0 G;  5CA1 A;  5EBW C;  3CCV V;  4J9Y B;  3CCJ V;  2EBO A;  2CGO A;  1NI8 A;  2F23 A;  4CS3 A;  3HKD A;  2ILM A;  3CRR A;  5EYP B;  5JJN B;  3BAB A;  4YJ3 A;  3ZHV A;  4E4E A;  3GWO A;  5EC1 C;  2YUA A;  2BTO A;  2Q8V A;  4UVC A;  3ABL C;  3JAR B;  4NXN O;  2EUL A;  5B1A B;  4DW1 A;  1KP2 A;  1WA8 B;  1QLE B;  3WU2 Z;  3ABT A;  5BZB A;  5B3S B;  4PV1 B;  2A7W A;  2LW1 A;  2Q73 A;  4J9Z B;  4CC6 A;  4JI4 O;  3TJT A;  3NR7 A;  1YHQ V;  4I5S A;  3A0H Z;  5LHH A;  4OGQ B;  5KUM A;  3RGB A;  5LGT A;  2EJR A;  1BGY H;  4UCT A;  1TVK A;  5KHH A;  5C93 A;  3UQ8 A;  2UXB B;  1SQV H;  1W0J G;  3JSN A;  1F4N A;  2IH3 C;  3CE2 A;  1GK9 A;  3AG3 B;  3AG7 A;  1KP3 A;  2OIE A;  5B1O A;  3OM3 B;  5LA6 A;  2ZCE A;  2OTL V;  1F7Y A;  3ASO C;  4IHJ B;  3VBB A;  4ASU G;  1Q43 A;  1Q82 W;  4I50 A;  2LQT A;  1AB3 A;  3FB6 C;  3ZS8 C;  3LUT B;  3T4Z A;  2ZDI A;  1BHB A;  3UO3 A;  1XL4 A;  4UB6 Z;  4DK0 A;  2Y0I A;  4ZKI A;  4FJC C;  2HVJ C;  5LYJ A;  4CC5 A;  3IJ4 A;  2Q6A A;  1YEW A;  1HNZ B;  2DN9 A;  1YIT V;  1XI1 A;  3KCY A;  5DM6 V;  3T1H O;  2ZIO A;  2KG7 B;  4DR3 O;  1GM9 A;  2OCC C;  3B09 A;  3WG7 B;  1SQF A;  5JQG A;  4JZG A;  5KHI A;  1ARO P;  4O4L B;  4F6R B;  3WFV A;  1OJH A;  3RN4 A;  3E2E A;  3M8A A;  5CB4 A;  4FPP A;  4X89 A;  3D3Q A;  5JWP A;  1FD9 A;  1SET A;  2HLD G;  5D5P A;  1R6N A;  1SC5 B;  4QE9 A;  2K1E A;  3AG4 C;  5H5N A;  2AGA A;  4QNH B;  4LBE C;  1SA0 A;  1G6U A;  1KEC A;  3OR6 C;  3K08 A;  4LF5 O;  3CP1 A;  5EZY A;  2Y69 B;  2QEX V;  5BR8 B;  3KZI Z;  4JPR A;  1JVM A;  1EZJ A;  3CX5 F;  4MSW C;  3HPL C;  4EKW A;  4U3F H;  4G28 B;  5IJ0 A;  3F5W C;  1L0N H;  1PV0 A;  2OT5 A;  4DW0 A;  2Q0O C;  1XMQ B;  4YHH B;  3LSS A;  4PA4 A;  1URF A;  2CTR A;  2ZE7 A;  2P7T C;  4XDJ A;  1FXK B;  1I0H A;  2N74 A;  4BW9 A;  2N05 A;  2IJK A;  2YS8 A;  5IYC O;  2E3C A;  1GH6 A;  4TV9 A;  1R6T A;  5L3G A;  3K58 A;  1ZX3 A;  2NR5 A;  1WP8 A;  3JAS A;  3D36 C;  4F4L A;  2WA3 A;  4XDK A;  2KSD A;  1M56 C;  2IM9 A;  1N34 O;  2ZNJ A;  4FLU A;  3AEI A;  3AG4 B;  5IWA O;  2ZE6 A;  2CH7 B;  1Q5O A;  4LF7 B;  4X88 A;  1OCZ C;  2Q5Z A;  2ZQM A;  2DWD C;  4N21 A;  2AHY A;  5H6R A;  3CC4 V;  3EFF K;  2QM8 A;  3N2G A;  3CJH B;  2R70 A;  1M1K W;  1V9P A;  1K4D C;  1RSO A;  4JI5 B;  2OCH A;  2FKX A;  2Z0A A;  1BCC H;  4LFC B;  3MAQ A;  4Q20 A;  1FAF A;  1QR8 A;  5LMN O;  4GX5 A;  1NVP D;  3OMI B;  4TT3 G;  1NU1 H;  4UCO A;  5LMU B;  1S3J A;  4MVM A;  4WF9 V;  3Q4H B;  3OMN B;  4MVQ A;  3K57 A;  1SZX A;  4B3T B;  1G1X B;  1GAX A;  5J2T B;  2ODM A;  3T1C A;  3RYH A;  2DOS A;  5BMV A;  5JH7 A;  2ZM6 O;  1GRJ A;  1BMF G;  5L3C A;  5CBH A;  5KLV H;  4YY3 B;  4WCE V;  1QNM A;  4LF9 B;  1S5J A;  2BTQ B;  3AK3 A;  1OZ0 A;  4G27 B;  2UUC O;  4BIZ A;  4HNA B;  3D3I A;  3PN1 A;  3NXS A;  4U7O A;  4BAY A;  2OTJ V;  5FPO A;  2UUB O;  1WLE A;  2EIL B;  4XDL A;  1US6 A;  4RO2 A;  1B04 A;  1VQN V;  3G6E V;  4DUZ O;  4CZZ A;  1F23 A;  4NB5 A;  2G38 A;  4GKK O;  2XT9 A;  4U7N A;  4FLV A;  1NVP B;  4WBN B;  2A06 H;  2EIK C;  1KYO F;  1VQ9 V;  4MS2 A;  3QO5 A;  2Q69 A;  3ABM B;  1MMM A;  4FMT A;  1WB7 A;  3CEI A;  3TXS A;  1XOU A;  2IJI A;  4JAA A;  4HZ3 A;  4MVZ A;  1WAZ A;  4IGG A;  1AR1 B;  2XAS A;  4O2B A;  3JAM N;  4IIJ B;  4ZIB A;  5FLX N;  1LUW A;  5KHG A;  2JGD B;  2FTK A;  4X62 O;  5E79 Z;  2YEV B;  4RAI A;  1ZAU A;  3ZHS A;  1OHH G;  2B1I A;  2WLI A;  4JI3 B;  3W7U A;  3TCU A;  5L3E A;  1BL8 A;  1R3K C;  4DV2 O;  4J7Z A;  2YIB A;  1EFR G;  1VMG A;  3ETG A;  3CC7 V;  4I4T A;  2GV9 A;  5IY5 C;  1WNS A;  1AJP A;  2DYR C;  1YF2 A;  1N36 B;  4JI6 B;  1SER A;  1AI7 A;  1N0J A;  5A9G A;  3A0B Z;  1KBH A;  1RM1 C;  3CME V;  1YTF B;  1SF9 A;  1TUB A;  2C2A A;  4LF7 O;  1FJG B;  4OX9 B;  1M9N A;  2HG5 C;  1NBM G;  4TV8 A;  1RPR A;  3SJQ C;  2R72 A;  2YXY A;  4IT5 A;  4RQF A;  4Z2W A;  1QVG U;  3IC9 A;  4GX0 A;  1GM7 A;  3ZJZ A;  3AK1 A;  1DF5 A;  2GUZ B;  1S72 V;  4B3S O;  2GHY A;  2P22 C;  1V55 C;  2P4V A;  2WLL A;  5LMU O;  3A0R A;  3ZMT A;  3C3S A;  1DF4 A;  2UXN A;  4OPA A;  5GON B;  2DJV A;  4DUY O;  2Q7G A;  3ABK B;  5LP6 C;  3SPI A;  4CS2 A;  1FFX B;  2PF4 E;  1VQ7 V;  3G4S V;  3AG1 C;  4MVU A;  1Q8I A;  2CDY A;  2Z5U A;  5FNV B;  1XMO B;  3L74 H;  1EN6 A;  4I55 A;  2GDS A;  3X2Q C;  4EFE A;  4YY3 O;  3FYE B;  4TUY A;  2RMK B;  4LF9 O;  2X6B A;  2Q7H A;  1VF5 B;  2HJF C;  2ZR2 A;  5EBL C;  4I0X A;  3B8M A;  3G80 A;  2H94 A;  1AI4 A;  5BXZ A;  3APQ A;  4O2A B;  4I9Q A;  4LFB O;  1BQZ A;  2Q0A A;  4FZ1 A;  4ZI7 A;  2DWE C;  3MD0 A;  2XAH A;  2WLN A;  2FL4 A;  1MOF A;  1T5E A;  4JYA O;  3J80 N;  4DR7 B;  2KB1 A;  3BHP A;  5B5E Z;  4UFZ A;  4DR1 B;  3DGE A;  3T4D A;  4BIO A;  4LWS B;  2X0L A;  2VQF O;  3N27 A;  1O9H A;  3ZMU A;  4LH6 A;  2P90 A;  2E76 B;  5LGU A;  1V55 B;  3K03 A;  3VQY A;  3ZN1 A;  2EIM B;  2WPD G;  4IHJ A;  1NT2 B;  2H8P C;  1XHZ A;  3RFR A;  3K5M A;  1BZK A;  1EM1 A;  1P4R A;  3CRM A;  3AG1 B;  4ICG A;  1K5Q A;  1QU7 A;  1B06 A;  3K04 A;  3SJC C;  1ROP A;  2P06 A;  1VAR A;  5HFL A;  4JI0 B;  1D2D A;  4FK5 C;  3EVK A;  2HVK C;  2LW7 A;  2P5O A;  2B1G A;  4CH5 A;  3OD4 A;  5JVD B;  4PHZ A;  3S3X A;  4LFA O;  5B1A C;  4GX1 A;  3M99 B;  4JI6 O;  3SJB C;  4FZ0 A;  1QLE C;  3B2E E;  5LXT A;  1TGO A;  4NKG B;  3HKE B;  3OTO O;  1NR7 A;  2XOK G;  3JAT B;  1TAE A;  1THZ A;  5B3S C;  3RWR D;  1XNQ O;  1FJG O;  4DV7 B;  3CMA V;  1SS3 A;  1H2L A;  2QWR B;  4JI1 B;  2AZ2 A;  5GTI Z;  1EZV H;  3N2K B;  2JRI A;  2W0F C;  2YI8 A;  4NTY A;  1SKV A;  4DR6 B;  4JZ2 A;  3UT5 B;  1NH2 B;  4J10 A;  5IDJ A;  2R9R B;  1N33 O;  1K7D A;  4WFG A;  1KUQ A;  3EHB B;  1WP7 A;  1HNX O;  2QE7 G;  4AI8 A;  5LOV A;  4K8Z A;  3R66 A;  2RQ6 A;  3IAY A;  3W7T A;  3FB8 C;  2Q9L A;  4OPH A;  1QR9 A;  1GM8 A;  3I56 V;  3ETQ A;  4X1K A;  4FIP C;  4CH4 A;  3L70 H;  1H2G A;  4DR4 O;  3GVM A;  1UJW B;  3CCM V;  4JAU A;  4H13 B;  4DR2 O;  2QGN A;  4U3J A;  4XBF A;  4X20 A;  2PGG A;  1S76 D;  1YI2 V;  3O9O A;  3ZMS A;  1V54 C;  2BOB C;  4H0L B;  3WG7 C;  1NTM H;  5ITZ B;  3I5D A;  4A5U B;  2Y0P A;  1EN5 A;  2BCC H;  4FLX A;  3CWB H;  3HR0 A;  2QM4 A;  5L3D A;  3E8H A;  1JA8 A;  2WA4 A;  3UKM A;  4RUF A;  4DR7 O;  4EEQ A;  3JCU Z;  2FB5 A;  4LCU C;  1VQ6 V;  3U10 A;  3CXH F;  1W2B U;  1I94 B;  2PUS A;  4DV3 B;  3JAL A;  3T1Y O;  1VQO V;  2D2C B;  3F7Y C;  3E22 A;  1GMG A;  3MHH C;  2HR3 A;  3E83 A;  4JYB A;  4WFA V;  3RT3 C;  2ZIN A;  4DRX B;  4KHP B;  4DO2 A;  2Y69 C;  3K9A A;  2UU9 O;  4ZHQ A;  4UV9 A;  3AG2 C;  4D6T H;  3CCQ V;  3JAK B;  2QTO A;  3BVO A;  1BQ0 A;  3RYC B;  5C8Y B;  3Q4H A;  4O4I B;  2OYQ A;  2DMX A;  3D8C A;  4DV4 B; 
#chains in the Genus database with same CATH homology
 2BSK B;  3CJH A;  3DXR B;  2BSK A;  3CJH B;  3DXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...