2BSQE

Fitab bound to dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
ASVVIRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSMLASIGQEIGGVELEDVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Fitab from Neisseria Gonorrhoeae Bound to DNA Reveals a Tetramer of Toxin-Antitoxin Heterodimers Containing Pin Domains and Ribbon-Helix-Helix Motifs.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Transcription
molecule keywords TRAFFICKING PROTEIN B
total genus 17
structure length 68
sequence length 68
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2005-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bsqE01
2H1OE 2HZVA 2K5JA 1Q5VA 2WVCA 3VEAA 4HV0A 2RBFA 3FT7A 3LGHA 1B01A 2K1OA 2WVBA 2BJ1A 2BSQE 2CAJA 2BJ3A 2BNWA 2K9IA 1X93A 2BJ8A 2K6LA 3QOQA 1BDTA 2BNZA 2BJ9A 2BA3A 3VEBA 2JXIA 1U9PA 1BAZA 1IRQA 2K29A 1MYLA 2AY0A 3OD2A 1P94A 2CA9A 1PARA 2GPEA 2CPGA 1MNTA 2HZAA 2WVFA 3H87C 4ME7E 1MYKA 1ARRA 4FXEA 3GXQA 4D8JA 2CAXA 1BDVA 1QTGA 2CADA 2WVDA 1NLAA 2JXGA 1EA4A 1ARQA 3FMTA 2JXHA 2KELA 2WVEA 2BJ7A 1B28A 3VW4A
chains in the Genus database with same CATH superfamily
2WVCA 3SFGA 4HV0A 3LGHA 1B01A 2UUTA 2BJ8A 3UQSA 2BNZA 2BA3A 2ADLA 3NNEA 3NAHA 1IRQA 2AN7A 4LQ9A 2Q2KA 3UR0A 1SH3A 3OD2A 2CPGA 3H87C 1MYKA 4LQ3A 4D8JA 4LRVA 3H5YA 1QTGA 1BDVA 2KKEA 2KELA 2BJ7A 3VW4A 2B43A 1OG7A 1Q5VA 3QIDA 2A2BA 2RBFA 2BSQE 2CAJA 3SFUA 2K9IA 1BDTA 2BJ9A 1U9PA 2H3AA 1SH0A 3BSNA 2K29A 4NRUA 3G5OA 3NO7A 2GPEA 2WVFA 2HZAA 4ME7E 3UPFA 3GXQA 4MJWA 1ARQA 2JXHA 3NAIA 2HZVA 2K5JA 3VEAA 3IR7A 2K1OA 2BJ1A 2BNWA 2CKWA 1SH2A 1X93A 2KOEA 2K6LA 3QOQA 3LJPA 4O4RA 1OHNA 1MYLA 3BSOA 1PARA 2WK4A 4FXEA 2CAXA 2UUWA 4NRTA 1NLAA 4QPXA 2H1OE 2JBVA 3FT7A 2WVBA 2BJ3A 1Q16A 2JXIA 3VEBA 1BAZA 3H5XA 2AY0A 1P94A 2CA9A 1MNTA 4AAIA 1SIWA 1ARRA 2CADA 2WVDA 2JXGA 1EA4A 3FMTA 2WVEA 1B28A
chains in the Genus database with same CATH topology
2H1OE 2HZVA 2K5JA 1Q5VA 2WVCA 3VEAA 4HV0A 2RBFA 3FT7A 3LGHA 1B01A 2K1OA 2WVBA 2BJ1A 2BSQE 2CAJA 2BJ3A 2BNWA 2K9IA 1X93A 2BJ8A 2K6LA 3QOQA 1BDTA 2BNZA 2BJ9A 2BA3A 3VEBA 2JXIA 1U9PA 1BAZA 1IRQA 2K29A 1MYLA 2AY0A 3OD2A 1P94A 2CA9A 1PARA 2GPEA 2CPGA 1MNTA 2HZAA 2WVFA 3H87C 4ME7E 1MYKA 1ARRA 4FXEA 3GXQA 4D8JA 2CAXA 1BDVA 1QTGA 2CADA 2WVDA 1NLAA 2JXGA 1EA4A 1ARQA 3FMTA 2JXHA 2KELA 2WVEA 2BJ7A 1B28A 3VW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1O E;  2HZV A;  2K5J A;  1Q5V A;  2WVC A;  3VEA A;  4HV0 A;  2RBF A;  3FT7 A;  3LGH A;  1B01 A;  2K1O A;  2WVB A;  2BJ1 A;  2BSQ E;  2CAJ A;  2BJ3 A;  2BNW A;  2K9I A;  1X93 A;  2BJ8 A;  2K6L A;  3QOQ A;  1BDT A;  2BNZ A;  2BJ9 A;  2BA3 A;  3VEB A;  2JXI A;  1U9P A;  1BAZ A;  1IRQ A;  2K29 A;  1MYL A;  2AY0 A;  3OD2 A;  1P94 A;  2CA9 A;  1PAR A;  2GPE A;  2CPG A;  1MNT A;  2HZA A;  2WVF A;  3H87 C;  4ME7 E;  1MYK A;  1ARR A;  4FXE A;  3GXQ A;  4D8J A;  2CAX A;  1BDV A;  1QTG A;  2CAD A;  2WVD A;  1NLA A;  2JXG A;  1EA4 A;  1ARQ A;  3FMT A;  2JXH A;  2KEL A;  2WVE A;  2BJ7 A;  1B28 A;  3VW4 A; 
#chains in the Genus database with same CATH topology
 2WVC A;  3SFG A;  4HV0 A;  3LGH A;  1B01 A;  2UUT A;  2BJ8 A;  3UQS A;  2BNZ A;  2BA3 A;  2ADL A;  3NNE A;  3NAH A;  1IRQ A;  2AN7 A;  4LQ9 A;  2Q2K A;  3UR0 A;  1SH3 A;  3OD2 A;  2CPG A;  3H87 C;  1MYK A;  4LQ3 A;  4D8J A;  4LRV A;  3H5Y A;  1QTG A;  1BDV A;  2KKE A;  2KEL A;  2BJ7 A;  3VW4 A;  2B43 A;  1OG7 A;  1Q5V A;  3QID A;  2A2B A;  2RBF A;  2BSQ E;  2CAJ A;  3SFU A;  2K9I A;  1BDT A;  2BJ9 A;  1U9P A;  2H3A A;  1SH0 A;  3BSN A;  2K29 A;  4NRU A;  3G5O A;  3NO7 A;  2GPE A;  2WVF A;  2HZA A;  4ME7 E;  3UPF A;  3GXQ A;  4MJW A;  1ARQ A;  2JXH A;  3NAI A;  2HZV A;  2K5J A;  3VEA A;  3IR7 A;  2K1O A;  2BJ1 A;  2BNW A;  2CKW A;  1SH2 A;  1X93 A;  2KOE A;  2K6L A;  3QOQ A;  3LJP A;  4O4R A;  1OHN A;  1MYL A;  3BSO A;  1PAR A;  2WK4 A;  4FXE A;  2CAX A;  2UUW A;  4NRT A;  1NLA A;  4QPX A;  2H1O E;  2JBV A;  3FT7 A;  2WVB A;  2BJ3 A;  1Q16 A;  2JXI A;  3VEB A;  1BAZ A;  3H5X A;  2AY0 A;  1P94 A;  2CA9 A;  1MNT A;  4AAI A;  1SIW A;  1ARR A;  2CAD A;  2WVD A;  2JXG A;  1EA4 A;  3FMT A;  2WVE A;  1B28 A; 
#chains in the Genus database with same CATH homology
 2H1O E;  2HZV A;  2K5J A;  1Q5V A;  2WVC A;  3VEA A;  4HV0 A;  2RBF A;  3FT7 A;  3LGH A;  1B01 A;  2K1O A;  2WVB A;  2BJ1 A;  2BSQ E;  2CAJ A;  2BJ3 A;  2BNW A;  2K9I A;  1X93 A;  2BJ8 A;  2K6L A;  3QOQ A;  1BDT A;  2BNZ A;  2BJ9 A;  2BA3 A;  3VEB A;  2JXI A;  1U9P A;  1BAZ A;  1IRQ A;  2K29 A;  1MYL A;  2AY0 A;  3OD2 A;  1P94 A;  2CA9 A;  1PAR A;  2GPE A;  2CPG A;  1MNT A;  2HZA A;  2WVF A;  3H87 C;  4ME7 E;  1MYK A;  1ARR A;  4FXE A;  3GXQ A;  4D8J A;  2CAX A;  1BDV A;  1QTG A;  2CAD A;  2WVD A;  1NLA A;  2JXG A;  1EA4 A;  1ARQ A;  3FMT A;  2JXH A;  2KEL A;  2WVE A;  2BJ7 A;  1B28 A;  3VW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...