2BSXA

Crystal structure of the plasmodium falciparum purine nucleoside phosphorylase complexed with inosine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
241
Chain Sequence
b'MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDELVPHQLENMIKIALGACAKLATKYALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
molecule tags Transferase
source organism Plasmodium falciparum
publication title Structures of Plasmodium Falciparum Purine Nucleoside Phosphorylase Complexed with Sulfate and its Natural Substrate Inosine
pubmed doi rcsb
total genus 70
structure length 241
sequence length 247
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bsxA00
5B7GA 3FUCA 1LX7A 2QPLA 4OEHA 1QE5A 4TXJA 3PNSA 4GKAA 1JDTA 2HWUA 3ODGA 5IU6A 3FWPA 3DPSA 2IQ5A 4LNAA 5CXSA 1Y6RA 1B8NA 3E9RA 1ULBA 3DP9A 4G8JA 1YQQA 3PHCA 3OCCA 3BGSA 3KHSA 4WKOA 3EUFA 3FNQA 1RXCA 1CG6A 3NM4A 3E9ZA 4BMZA 3OZDA 1V48A 4YNBA 3LGSA 1PWYE 1SQ6A 1YR3A 2B94A 4LDNA 1JDVA 5F78A 1PR4A 5B7PA 4TXNA 1PKEA 2QDKA 2QTGA 1RXYA 1U1GA 4QASA 4DABA 1JDSA 3BL6A 1N3IA 3IEXA 1Y1SA 1RCTE 4DA0A 4L5YA 3O6VA 4QATA 3BSFA 4D8YA 4R2XA 5CCDA 4I2VA 4D98A 1A9RA 5F7XA 4P54A 1JE1A 1ODKA 1Z38A 4YJKA 3OZCA 4LKRA 3DF9A 4G89A 4BMYA 5EUBA 1YQUA 4RJ2A 4X24A 3KVRA 4TYMA 2A0XA 1Z5OA 4NS1A 3OOHA 4D8VA 5IFKA 4WKNA 4BN0A 4L0MA 4GLJA 4R31A 1U1DA 1Z34A 3FAZA 3DJFA 4U2KA 4IP0A 1V2HE 4DA8A 1TGVA 4MARA 1G2OA 3K8OE 4GMHA 4TXMA 1JE0A 5C80A 1NC1A 4YO8A 4QARA 4DAOA 4MCIA 3P0FA 5EFOA 5CYFA 2BSXA 5I3CA 5CXQA 1Z36A 4KN5A 1CB0A 5CYGA 3KVVA 1T0UA 5F73A 4LNHA 1PK7A 3OPVA 2A0YA 4JWTA 1V45E 1VHWA 5CCEA 1OVGA 5F76A 4F3KA 1PR5A 1Y1RA 1Z5PA 1PK9A 4F1WA 1RXUA 1Y1QA 4D8XA 4TXHA 4L5AA 4LZWA 5F77A 3INYA 3ENZA 1T8RA 5F7OA 2I4TA 3UAVA 3C74A 4BMXA 3NM5A 4M1EA 3KU4A 4K6OA 1OUMA 3FOWA 1NC3A 5JPCA 1TCVA 5K1ZA 2PGAA 2GUWA 4M7WA 4QFBA 3D1VA 4OJTA 3LBAA 2HRDA 4YMLA 1PF7E 1JP7A 1Z35A 3BJEA 1A9SA 3UT6A 4WKCA 2H8GA 4TS3A 3T94A 2A0WA 1RFGE 5F7JA 1TCUA 4DA7A 2I8AA 1LV8A 1FXUA 1T8WA 3DDOA 4MCHA 4QEZA 1XE3A 5ETJA 4R2WA 3KVYA 2A8YA 3IOMA 1A9QA 4GLFA 1JDZA 4F3CA 3OOEA 4OF4A 2AI2A 2ON6A 1YBFA 4G41A 4EARA 1RSZA 5B7QA 1Z5NA 1LVUA 1Z37A 1K9SA 1RT9A 1B8OA 4WKBA 2AI3A 4OGKA 4M3NA 2AI1A 3NM6B 3OZBA 3EEIA 1A9PA 3OZEA 4PR3A 1C3XA 3PNPA 1NW4A 5EPUA 1U1CA 3K8QA 3FB1A 1I80A 3P0EA 1VFNA 1OTXA 1PR1A 1U1EA 1ZL2A 2QTTA 2HN9A 3E0QA 4TTAA 1PW7A 4TTIA 2XRFA 1PR6A 1VHJA 2OECA 1Z33A 2ISCA 4OY3A 1V4NA 3LA8A 1ZOSA 4PNPA 5F7ZA 3GB9A 1V3QE 1WTAA 1SD1A 3SCZA 4H1TA 1K3FA 3MB8A 2OXFA 3UAYA 1M73E 1RYZA 1Z39A 3EUEA 4D9HA 4E1VA 1T8SA 3PHBE 3KUKA 1A69A 1VMKA 1ODIA 4JP5A 3U40A 3OF3A 1RXSA 1K27A 1Y1TA 4L5CA 2RJ3A 1JPVA 4DAEA 4ECEA 1T8YA 3QPBA 1OTYA 4TS9A 4DARA 1PR0A 1RR6A 4DA6A 3O4VA 4EB8A 4NSNA 1TGYA 2Q7OE 3EMVA 2P4SA 1JYSA 5DK6A 2HSWA 3ONVA 1Y6QA 3MMSA 4WKPA 3GGSA 5B7NA 4QAQA 3UAWA 1SJ9A 4TTJA 1PR2A 3UAXA 1ODLA 1ECPA 3F8WA 2OC4A 1YRYE 4OGLA 4JOSA 1JDUA 1A9OA 3NBQA 1Q1GA 5KB3A 5FAKA 2AC7A 4NY1A 4DANA 4F2WA 1ODJA 3TL6A 4FFSA 1OV6A 1PBNA 1A9TA 1V41E 4UC0A 2OC9A 3UAZA 2QSUA 4F2PA 1OU4A 1ULAA 4L6IA 1TD1A 1U1FA 4TXLA 1SD2A
chains in the Genus database with same CATH superfamily
1FRVA 1I3NA 3LCVB 1ZM4A 3FUUA 2IZ5A 2DECA 1G98A 2REQB 4LHZA 3PPVA 4CW7A 1KR5A 2DLDA 4Y1GA 3UJBA 1N7JA 1HKUA 4R9VA 1WQ1R 4KZKA 1ECJA 3R3ZA 1EGMB 1XDWA 3CINA 4GX1A 3T7TA 1GFWA 5BUSA 5GTDA 3NKVA 5JQGF 1NIJA 3WLNA 3W2GA 3RIHA 4OIMA 5D1NA 3RJMA 3ASZA 3H04A 4M1OA 4XUCA 4QYIB 2I62A 2WSIA 5DHQA 1AKEA 5DP2A 3NHPA 4RSGA 1JDTA 3FPJA 4GOLD 4V1CB 5T4BA 5L40A 2W22A 1E2JA 4WXMA 4PPFA 3NQ41 1B3BA 2HK6A 4HXYA 1DRWA 2YY6A 3DQPA 2V98A 4FDTA 1B8NA 1II9A 2FZCA 5FFNA 4AS3A 3D3KA 1XMSA 1T4BA 3SMQA 4XQEA 3SQOA 5BRAA 1K68A 1SZCA 4G8CA 4JYAB 3K31A 3F5SA 5IH7A 1L4HA 3O8RA 3DWEX 4FINA 4TROA 3ZCQA 1XSEA 1K0FA 1LRLA 1ZD4A 3HJAA 2XUQA 5HK8A 4RHEA 2WWWA 4ROSA 5KNBD 1NVWQ 2YQZA 1HEIA 1R0ZA 2H7YA 3TAXA 2WKQA 1DQZA 2J3KA 3K9NA 4PNZA 3W6OA 4BQIA 3W7BA 5A0VA 5TS3A 3GVPA 4MS4B 1PW5A 2RJOA 5C8VA 4LHYA 3NTOA 2Q8NA 4X66B 3ETEA 4Q5IA 3TPCA 3KEFA 3MS2A 2VJMB 4AJLA 1DINA 3A1UA 4F38A 2BI7A 1B8PA 1I6LA 2V9CA 5DBEX 3ROFA 1GTVA 2NSDA 5AVTA 4R1LA 2FF7A 4OJNA 2AFRA 2C5LA 1C1XA 2VYND 2Y6UA 1RXYA 3L4BC 2GD1O 4A8JB 4BNFA 1RXIA 4OM7A 3GA5A 1FMCA 3BL6A 4PQGA 4LC1A 3Q6NA 1M2JA 3I6IA 5E6RB 3HEMA 4LHEA 1A50B 5ALLA 1NUPA 4BYGA 1YR6A 2HA2A 2LCFA 1B41A 3QFHA 4PLWA 3LFTA 4BJHB 1VL2A 4DRXB 1J25A 1MA0A 2XNDD 1CUIA 2I87A 2ZANA 1IPFA 1LLFA 1R9NA 1NNI1 4WLVA 4R2XA 4RQUA 5JZOA 2ERXA 5BN5A 2EP5A 5A4KA 4QUEA 3DYIA 1VXOA 3R6TA 1K7YA 3A2LA 5F7XA 1VPWA 3VDXA 1O8BA 1WZEA 2GJAA 4QUKA 2GF0A 3L18A 3WA7A 4MQFB 2IUSA 4LVUA 2WABA 2YVLA 1GFSA 3BXEA 1RXEA 3UGQA 4YRBA 2GEBA 1N2JA 3G0CA 1B6GA 2FZLA 3V6LA 3CLVA 2ZUUA 3HPQA 3M8KA 5DTQA 4Z8XA 2XQKA 2JC3A 5K3CA 4ENTA 1Z5OA 3AF4A 5BR4A 1II8B 3DLIA 2I7CA 5IC6A 1NULA 3P71T 1R6UA 2HHJA 1R4NB 5JAZA 1K98A 2DY0A 3CNLA 3FFWA 3G0GA 3LHSA 3IB3A 5FNVA 2ZB7A 4OYHA 2I9KA 4WEQA 3K6RA 3R5TA 5I7SA 1EWRA 2BH9A 1OFHA 1PUIA 1HC7A 4GLJA 4MJLA 1WDMA 2ATXA 3EFEA 4AXBA 3L05A 2B78A 4QDJA 2G0AA 1JWAB 3DJFA 3H9QA 3NT5A 1QFSA 2J9FB 1TU3A 1W5BA 3KT8A 4YP6A 5BNWA 4XCQA 5AW0A 3BGDA 1DLJA 1XA4A 1Q1EA 1NP6A 4CLOB 1OKKD 3ZDEA 3WGJA 5AKGA 3H0CA 5HGXA 4INJA 1IPHA 2VPPA 4HLNA 1QO0D 3HXQA 1Z82A 3IDSA 1G2OA 4TXMA 2EGHA 5K0BA 4H6WA 4A2WA 4FXPA 4I4TA 2SKCA 4W1QA 4EEZA 3RSSA 2D5IA 1A4UA 4QARA 2IGTA 4H6XA 4OH1A 4KEAA 5BWLA 1WQ3A 2QN3A 2H1OA 2NTNA 3ILYA 2ZRIA 3AF3A 3A4VA 3O38A 3QU5A 4UU0A 1Z28A 1N7IA 4FPXA 1XZJA 2C94A 2GD2A 2JGJA 2P27A 4M53A 4CTOA 1YT5A 4D2IA 1VJRA 1CB0A 3BMQB 1XTJA 4YJ2F 4F12A 4Z4EA 3P96A 1N2EA 4NV0A 1MEOA 5CYGA 2VQEB 4MYHA 3P5BA 4QOEA 4WN3A 4CU5A 1AKVA 4DF3A 5B4UA 1E79A 4A15A 1KY4A 2NZUG 4XQGA 5CCEA 3K09A 1OIWA 1BSVA 4FFPA 4HUJA 2UUCB 4QG3A 1UFRA 1G8PA 1FFXB 1YS2X 3GFRA 4OU5A 3V4LA 2H4HA 3KT3A 2Z1MA 1P9OA 1WMDA 3GA7A 4ND4A 3HXPA 4OOEA 4ETMA 2EWMA 1QGED 3W5SA 3CPEA 1Z7EA 3O0DA 3KJQA 4P82A 4PANA 1ZBDA 3GEEA 3KZVA 4W7IA 3X43A 2BFEA 4AN1A 3NWBA 2VDWA 1CV2A 2BGJA 2KMLA 2EVWX 3FR7A 2YZGA 2B7LA 3BX1A 2ONJA 5KYYB 4IIDA 1EXVA 1TKCA 1FXSA 1U8CB 2XT9A 4Z1OA 2GASA 4B33A 4YHHB 1KMIY 1YVEI 3ROEA 1YC2A 1Z2AA 5ENVA 2AVDA 3NYRA 4K6OA 5G0UA 1ZK3A 3BZUA 5I6DA 3K30A 4RLFA 4RLQA 4WN9B 1DKNA 1K8XB 2F55A 2D2FA 2Z8XA 1R16A 3ICPA 5KOHA 3W78A 1IZ7A 3U7GA 2JW5A 4W7SA 3G9ZA 2W90A 4LHSA 1VJCA 3LA6A 4S35A 2OO3A 4KRXA 5LUBA 4CQNA 4Q02A 2WIJA 1W47A 3FMFA 4GYYA 4AUMA 1VG9B 4WVLA 2M6KA 4F7DA 4X1IA 5DT9A 1EPUA 3JYQA 4R1OA 1WB4A 2QTFA 5JNWA 4ZYXA 4Z4IA 3SDZA 1O58A 1O96A 5DCWA 3RRXA 4MKHA 2CYBA 5DTRA 1T6BY 3QNMA 4BTEA 4EG4A 2GYUA 1XK7A 3AB7A 3E23A 3WLRA 4TWJA 1WZNA 1NKTA 5LR6A 1A9SA 4ZTBA 2FK8A 3QKTA 1EFDN 1BU5A 1JAIA 1ABEA 2VAPA 4BCDA 5JJLA 3ELUA 1PGPA 4L7VA 4WKCA 4GG1A 4IVRA 5B4VA 1DJQA 4GKKB 3C6BA 2ZWIA 4IWYA 2AZDA 2XPCA 2F1RA 3KQNA 2PNFA 2JKVA 2MSEB 4NWIA 1WCIA 3S6JA 5K4AA 5G02A 1OJLA 2YVKA 1RFGE 4Y6SA 3KU1A 1KOFA 1PS9A 3ZEIA 4EO7A 5I7FA 2XA1A 3AZPA 2CLEB 3L7CA 4C4ZA 4COKA 1LV8A 4L73A 1FXUA 4B74A 2XMCA 4KQIA 4B3MB 1MRSA 2NSLA 1D04A 1ZEJA 3C5WP 4H35A 1F9AA 3B85A 2VUSA 2QXTA 3UWPA 4BP1A 3NHUA 4Z7OB 4ZDJA 4Z7NB 5BQ5A 2RGNC 2BLLA 5D8DA 1WXIA 3AUYA 1L5OA 1A7UA 1VE1A 4JYZA 1UPUA 1LWNA 2PH1A 3MCVA 3RU9A 5LLTA 4RVSA 5LMCA 3F96A 3T4PA 3SYRA 2QD5A 2VFAA 4G41A 2HJRA 2CCJA 5FO0A 2WP0A 4LGCA 5DI3B 1MH1A 2JGEA 3LG2A 5BT9A 4E2ZA 5BNIA 4B09A 1Z0FA 2JAPA 2REBA 2CMFA 5B7QA 5DXAA 1RYMA 2D54A 4TLEA 2HEIA 4CIBA 3B8EA 4DPLA 4WOKA 5DTEA 4DDUA 1NATA 3AEZA 5AKYA 2IKQA 2ODQA 5IKOA 2QTHA 2WB4A 3GR6A 4Q3DA 1A5ZA 3IA7A 4S1PA 4IZIA 1IN4A 4Z86A 1PI3A 2H1VA 3QYJA 3S2GA 3UJ9A 4E2YA 3GQBB 3MWFA 2ZJ8A 4F6RB 4GT1A 1P62B 1JAHA 2GCOB 2YJGA 5TPWA 1VA5A 3OJ0A 3O4GA 1G9XA 2XUOA 1WW8A 3WADA 4K3UA 4FK8A 4WZAB 3QU7A 1TYAE 3CX7A 3RDPA 4QJ3A 3GLGB 3LFHA 4KQHA 1JX6A 1QGUB 3D4BA 4U5QA 3T6KA 4EHNA 2B4QA 3MJFA 3KAKA 1Q0RA 4ZPJA 2R00A 1NMZA 1P4GA 1UKEA 3IBGA 4YRDA 5DGCA 3U09A 3O4IA 2W6ZA 3AP3A 3EW9A 4UHFA 2D0OB 1EGHA 1C30A 1KU0A 1ZUIA 4FMBB 3LQFA 4BRZA 1M67A 2P9BA 2PBFA 2Y0CA 4DCUA 4I1RA 1RZ3A 2I91A 1VHDA 3EBOA 2QYOA 3P4XA 4FGSA 2AGVA 1C14A 2GFIA 4I1OA 4RULA 2W70A 3EXFB 1G9SA 1LSOA 2CHUA 2NTEA 3GWZA 2GXUA 2GOYA 3O2JA 7ADHA 1LRJA 3RC3A 5CYOA 3DMTC 5HF6A 1V95A 2GYWA 3K0CC 1VI6A 3EPRA 3PXAA 5CLQA 5D7NA 5C1DA 4HGOA 1NJ2A 4HXFB 3EDYA 1KJJA 2WYUA 2V5UA 3T7EA 4R7ZA 2Z8YM 5EIWA 2ES4A 4BO6A 3IMKA 4WINA 3E27A 4EO9A 2GFHA 3LZ6A 2NVOA 4OGGA 1UP4A 1O95C 3TZHA 3TTXA 2PY6A 1ZX1A 2CVOA 1SOMA 3NDJA 1ULSA 2BFDA 1CUXA 4UXJA 2G6BA 1DX6A 1CS0B 4QUGA 4ZRMA 1RBMA 1U65A 5ESDA 5CBPA 1A96A 5F2KA 3F78A 2OV4A 1D7OA 4CLRA 2R1UA 3JVDA 3UMJA 5F9HA 3S2EA 1DRJA 3QXCA 2R60A 2CVHA 5BURA 2HBYA 2HPAA 2ZBQA 3QE0A 1DCFA 3A4NA 2Q6OA 1EK2A 1U8YA 5AOAA 5EMHA 2XUJA 6PFKA 5JU6A 2PD3A 2Q3FA 2IX3A 1G8MA 1I2CA 3IBYA 3F97A 4ZAYA 4DLYA 5KBYA 1P5HA 2WG0A 4G6ZA 4K6GA 4MTLA 1B8UA 4NMWA 4YAWA 5DGTA 3H8SA 3QF7A 2CLCX 3KKLA 3CMCO 1S3IA 4IQ0A 2IOQA 3SPXA 2V7WA 4KE8A 1B93A 4GEGA 3T52A 3I83A 2BEUB 3D0RA 3UXEA 4B2PA 1RYFA 3TZCA 4N7MA 1SHKA 2F48A 4MV0A 4NE9A 1XKQA 2CL6X 1TUEA 2ECQA 3AG5A 5CVCA 4ZOEA 1ISFA 4IDCA 4U7PB 1DNPA 3H6KA 4MQ6A 4O2BA 1P0MA 4PRYA 5FOSA 1QVRA 4G1CA 4O25A 1Y8RA 2M1ZA 4UVDA 1IHPA 3OJOA 1NQ5A 3CPSA 3UHAA 4WWHA 2AKEA 4IY1A 3H1EA 4P4GA 2XAAA 4D1YA 1GPDG 2UVQA 4MYSA 5FUBA 3NEJA 3RJ9A 1BE8A 4TS1A 3WYCA 3TTUA 2QPOA 4AKIA 2ZPUA 5LSAA 3TD9A 1KEPA 2CVFA 1LC0A 1RWXA 3MRXA 1XYGA 4UM9D 5F5LA 1JU9A 3OLZA 3PYMA 3MVEA 5JBQA 2C99A 3EPPA 3FOFC 3BSWA 2HA6A 1E1RA 1CE8A 1TCBA 3SIXA 1UKYA 2ZRBA 5EZ5A 1R1DA 2CBGA 2CBZA 1U11A 2Z3ZA 1J21A 4LJSA 1UJ6A 1XXHB 3DBRA 3ZG6A 1Q95A 3CN7A 2MSDB 3OM8A 4ESHA 4ZMSA 1HDGO 1P91A 3RUFA 1POXA 4C4AA 4FYWA 4JVNA 3WRVA 2RHGB 5GJBA 3RHZA 4U8HA 4FEYA 4QDXA 4WFIA 5EKUA 1Y7IA 1QE3A 1F4VA 3JATA 1R3DA 5HZMA 3ETCA 4V38A 1XDUA 2Z08A 3ETLA 3GCGA 1XA3A 1G7TA 1SJ9A 16PKA 5DBHX 5DHPA 5IW8A 1SIWA 2QEQA 4TTPA 1LX6A 3C4JA 3DO8A 4K9QA 4HWKA 4ZREA 5H8WA 3WHIA 2C9ZA 3G1WA 4WV3A 2ZSUA 2HU7A 3FHJA 3LWBA 1JDPA 2J7PA 1EUCA 4KXLA 2VXYA 3DAHA 1GGMA 3GG2A 1Z4PX 1KDZA 3RR2A 1K7CA 1J0CA 3Q1KA 4HS9A 5BORA 4RETA 2R7NA 2PQ6A 4HDCA 5IKPA 4MITA 5B1YA 1AK1A 5FBVB 3HCPA 3TL6A 3IP1A 2CXHA 4MV4A 4J03A 3MSXA 3N1UA 4K6FA 4QJBA 2OQRA 2EYQA 5TGDA 4E7PA 4H77A 4X1IB 5DYGA 1GZ6A 1LU9A 3EEFA 3LDFA 3D7RA 1A76A 3IMFA 3SQLA 3ZD7A 1OF1A 1OU4A 3HJGA 2VHWA 3OY7A 3Q3CA 3QGMA 4PVCA 1JJVA 4DIEA 5ITZB 2E6UX 2BFBA 1G8GA 3C3AA 2R8RA 1E2FA 3L2OB 3BB1A 3MG9A 1S02A 1S2OA 2IYPA 4RTRA 3Q8LA 1YOVA 1JF8A 1SD2A 1W6UA 3WV4A 1N8NA 3S8YA 3ZW8A 3RK4A 4FEAA 2RC6A 1YRAA 4YI3A 4KQWA 2W6NA 3FVRA 3QVKA 4IMJB 4CIWA 3U7FB 4YDHB 3ZV5A 2IQIA 4BE7B 2ZYTX 1T9DA 4KR0A 1R2QA 5JASA 1K1EA 3A04A 4RKEA 1NR5A 4OEHA 3V4OA 1KZ4A 4DM4A 4CHGA 4Q1BA 3WZMA 1PGOA 5BUCA 1G42A 5DEOA 3K0AB 5FOWA 3M1YA 2O7NA 3OKCA 5CPFA 3KWFA 2XT6A 2Z2ZA 3IQIX 1XNJA 5KOIA 4Z5XA 3RBZA 3ANNA 1CB7A 4LZJA 1R88A 4PWZA 3SG0A 2CHFA 1DUVG 4X61A 3QXGA 3DHVA 3NNSA 1ULHA 3MGGA 1Y9EA 1G21A 4LNAA 1VDMA 4OXRA 4PZLA 5AFSA 3WGTA 2PFGA 2GH1A 2F3TA 1JFVA 2WAOA 3G2PA 3TRDA 1Z2DA 5JC8A 4MGEA 3VU8A 3AVVA 3GVIA 4HR7A 1VGVA 5LB4A 3BIWA 3IUPA 1PZEA 2DHQA 4HB3A 3KWJA 2EWVA 4F1KA 4DQKA 4PNEA 1S4MA 2ZI3A 3U4QA 4CV1A 1PVVA 3O93A 3BTSA 4Q7MB 2R47A 1DX9A 1HOXA 5JXGA 1DIOB 3EVBA 2XIQA 1K5GA 2HWWA 2R84A 4K2AA 4DVJA 4LI0A 1BHQ1 4V02A 2PPVA 3AETA 2AFHB 3RTGA 5H83A 1LBQA 1LDGA 1HDIA 4YNBA 2GFQA 1Q92A 4DR5B 1NR1A 2BFCB 3CLTD 3JR7A 3HXMA 1Y9DA 3OFKA 3SAJA 1P29A 4QDZA 2WPDD 4L3VA 1L7OA 2XVZA 2X1LA 2FV8A 1GAXA 2X4DA 4N6OA 1YFZA 1X7DA 2CJXA 2QDKA 2WUWE 4L76A 1M2VB 4UFOA 1YZTA 3A1FA 5CIQA 3RYTC 2FUKA 2IXAA 2ZIGA 3ASVA 2GCPA 3CC8A 4M46A 4Q4CA 2H1FA 5T64A 8LDHA 5IVPA 4JOQA 3WBKA 4H3SA 5JS8A 4IDGA 1Z5GA 1I51A 1YXMA 3EQ2A 1O96B 2ZSJA 5BSHA 2Z6AA 5AKHA 1M5RA 4W9MC 4RKFA 1GZ3A 2WFMA 1YD7A 3Q0EA 3UICA 1QGDA 1L7DA 1YQXA 3VO2A 2IX9A 4XUEA 4AAYA 3NX4A 1C9EA 1EHIA 3K0KA 5MN5A 2EFJA 1QMGA 2OP0A 2QV0A 1B0ZA 3Q3JB 3WR5A 1CP3A 1V4BA 1W46A 3WRYA 3A6PC 2JJ2A 1Y4SA 2GETA 3EDMA 4JUCA 4A6PA 1BWQA 3EXEA 5IAKA 5C2JB 4EJ0A 3ZU3A 1ZM2A 4N5MA 1YUBA 2WVJA 4ER7A 1X7XB 1YHYA 2D2XA 5K0EA 3NEYA 3I09A 1PTJA 2O8FA 1RACA 2D00A 3THWA 5TGZA 3H1FA 3ZDXB 2C07A 3QOWA 2FPIB 1DZIA 1F0PA 1YZQA 4XVUA 4JODA 1UZNA 2BFPA 2O0JA 4MIKA 1WPXA 2L19A 3OZVA 5DM70 1B23P 2JLVA 4GMGA 4RPIA 5GY7A 2QY6A 3NW9A 3NAMA 4JI6B 2FFRA 4M1YA 2YY7A 4RTOA 1Q7EA 3FOBA 1VRWA 3GJSA 4QWWA 5K05A 4PO9A 3PD0A 4FGZA 3OUTA 3AUSA 3PQFA 4BN0A 2WVGA 4MQ4A 4JY7A 3EYWA 2EDAA 3K9LA 4R54A 4JB3A 4QSHA 2JFWA 1S8AA 2XD9A 4POAA 3K2EA 5DCUA 5AM4A 3FTPA 4X1KB 2VCEA 1KDYA 3GUUA 4EPYA 2EHJA 3LSYA 4AJ1A 2XZLA 1YB4A 3OA0A 2WYWA 1Z6ZA 1RKVA 1TIKA 2KW5A 3DWFA 3FWNA 3JQFC 5H80A 3D4LA 3OX3A 3TW4A 2VF7A 4U2KA 2CNDA 1P2UA 1NLZA 3CJTA 3HB4X 4PZZA 2O8EA 3JPYA 1BHSA 5AVXA 3KDPA 3VSCA 3ZHZA 4ZQEA 1YSCA 1TGVA 2H5JA 4M4SA 1QRUA 3UA4A 1FMLA 1X14A 2LP4Y 4F9TA 3IO3A 1RU3A 4QFCA 1AG9A 1XELA 2HA7A 3F6EX 3L8HA 5A6VA 4XB2A 3UOGA 1OLSB 2PRKA 5JSYA 5KTKA 1YVUA 3DCIA 4N03A 4B40A 1AUOA 4TWRA 3ZWQA 1PAUA 3FG9A 1V3UA 3QW2A 5ERYA 1SRRA 4U9HS 5C7IO 2AZ4A 1N9GB 3L82B 2XMPA 1R0SA 3T5GA 3WY9A 4Q6WA 4G1UC 3KOUA 4EK9A 1FLVA 1UQUA 1ONPA 2GCOA 3PXUA 7ABPA 4F9FA 2GUGA 4L8LA 5EE0A 4EHKA 2FH5B 3TZBA 4NG4A 3AH8A 4YRFA 1EEHA 4HPXB 1QHNA 3QVOA 1NW8A 2HDNB 2ODNA 1NPYA 3IBFA 3GJRA 4FU0A 3TIGA 4B85A 2F3SA 4BPBA 1IZ0A 2R1VB 3NOOA 3TKLA 2YJ5A 2H85A 4MGHA 4A9AA 4DT1B 2PU5A 5CB4B 2P2DA 2XXBA 3MERA 5K99A 1OVGA 3LOQA 3NUGA 4KV7A 1KE1A 1NVGA 1I36A 4N0PA 3T4UA 2HDOA 3ESCA 4YCAA 3VGJA 3QBVA 1PK9A 1RRPA 2QYTA 1TJYA 4X1OA 2MYTA 1UZAA 2COKA 2AIRA 1WV0A 1AQJA 4S1NA 3IVCA 2EQ5A 4MXDA 4RK6A 2HH9A 1LI7A 3U61B 2RH5A 5EQJB 2WF7A 1EA5A 1H2HA 2GPNA 1AF4A 4KFTA 5CJJA 5BSGA 2J0QA 1RC0A 3UWKA 4LTDA 4Q93A 1ID1A 1KSGA 4HB0A 4KXXA 2UXCB 4FEGA 2R7KA 3CONA 4Q3NA 2F6RA 4IV8A 3TLYA 3I1JA 1QBKC 1XKTA 5IAAA 1PNOA 1KRWA 3NJRA 5H9VA 5HF5A 3R8FA 5B1DA 4LTMA 1RVV1 1AZWA 3LCCA 1OUMA 3LKDA 1T2FA 1NVXQ 4NABA 3Q40A 3RAJA 3HHEA 4YRNA 1PFYA 1BKDR 2FN3A 2G67A 2VUHB 3D54D 4W1PA 3ZZMA 4B87A 1J24A 4CMEA 4RBNA 2HK8A 4PLGA 5FQOA 4UMDA 4DCSA 1ZCJA 4IV5A 1WKCA 2Q6IA 2NU8A 5LDHA 3HKEB 4NAHA 3OZUA 2V7VA 3B2EA 5IM5A 3GJQA 3ZWBA 2R11A 2EXXA 1E7MA 4MW7A 2CFIA 2RK4A 3AFMA 4J2HA 5FD8A 1DXYA 8GPBA 2PKRA 4KH0A 2ODBA 4J3FA 4IL5A 1G8HA 1FDTA 4M9UA 3LH5A 2OZLB 4TLBA 4ZZ2A 2ZM6B 2QRVB 1FQOA 4AICA 2O2XA 3PFHA 2O1SA 4MKRA 4A5OA 1WG8A 4LHWA 3T38A 1AU9A 4B3GA 1ZGHA 1BKYA 3DZHA 4PQEA 1ZINA 2FCRA 2GD0A 5ITSA 4QOGA 2DC1A 3TSWA 3KSZO 4Z3KA 2I2WA 3F6PA 1VBFA 1EE1A 1YL6A 4Q1EA 4FE3A 1KH1A 1SAYA 3NO4A 4PIPA 4E2XA 5IHPA 1GPH1 1AKYA 1HF3A 4M88A 5IAEA 4HN4B 3DSRA 3QWBA 2FX5A 1J7KA 1ETUA 2GESA 3AKEA 2EC5A 3G59A 4ZAGA 5HF8A 2HWYA 1L5KA 3TPFA 4Z6KA 5I01A 5EAIA 2O5EA 2PDAA 3D6AA 1V7CA 4IDQA 3V4VB 4CI0B 4A8HA 4LRUA 4WVFA 2BFWA 3K1TA 3HZZA 3VR3D 4QYXA 2UYQA 4LVOA 1EXWA 2R66A 3E7WA 2P9ZA 5ALRA 1CUFA 2V6JA 4M99A 4EVSA 5C3UA 2YRFA 3EIOA 2X9NA 4WESB 5HJ7A 3NAGA 4PC6A 3TXXA 5KDDA 1KEZA 4DUPA 3D8HA 3DFMA 3WAKA 1JDBB 3MZ0A 4BCBA 3ZJUA 3WGZA 2H9AA 4HB4A 4B8ZA 1V16B 3DO5A 3EXHA 4G8BA 2BN4A 3QIAA 3QVGA 4EVIA 4LFBB 1QCYA 2DSNA 3R9IA 1LV7A 3FETA 3ZWMA 4F21A 2YHBA 3N58A 4S1TA 1NNSA 3NH6A 2P9JA 2FN7A 1I3KA 4TV9B 1NVUQ 3GUYA 4AB1A 2D4AA 4R98A 4BBPA 2FR8A 2HJVA 5K03A 5LPNA 4PAWA 5DJ5A 2DUMA 2BGNA 4TVKA 4YIKA 2Z6UA 5CHYA 1PIWA 3WK5A 1IM5A 2DFKB 4KKVA 1OY1A 1P2VA 1PD1A 2CJWA 4TN5A 2GKGA 4HDNB 1DTSA 1V8FA 1E99A 4IRXA 1WD5A 3TCXB 3R3HA 1DIBA 2ODAA 4B2LA 5EJ5A 4FFDA 4Q03A 5IXJA 1N78A 4JLKA 3B1FA 2A5FA 4LSZA 3C6YA 1IXSB 1HSOA 1LGYA 3GC6A 1SG0A 2XGGA 4X1YA 3EZ6A 4RA9A 1N6IA 2JLAA 2QLFA 3KPJA 3D3EA 2G17A 4HSEA 4MHOA 3T5PA 1BMFA 4NZOA 3WAJA 1YMVA 1FUEA 1O87A 4NX2A 4TSFA 3R20A 4LXQA 2JFFA 2P2ZA 1LA2A 3KBOA 4Y2XA 5TPZD 1WHTA 3PZRA 3TM4A 1L8AA 2GSWA 1KK2A 4F6LA 4DWOA 3UW1A 3OT1B 2I1LA 5J3JA 3DCNA 2OQ2A 3ZVLA 5KYUA 4RK5A 1ACMA 1AK2A 2XZOA 3NVKI 5JRZA 4ZO4A 1YK1A 2A1IA 3PD1A 2AJLI 3RS3A 5CEJA 3KQLA 3UG7A 1F17A 3OO1A 1I9CA 1OFTA 1R8XA 2QJTA 4GHWA 4P2BA 2CZQA 3BA1A 5LP1A 5KSWB 1YOVB 1T34A 2JJ1A 4WN9A 2E4XA 3P9PA 3NGLA 2XJ9A 4Y6RA 3WE7A 5K3OA 1JFSA 1PP4A 3QFSA 3PL5A 3WJ2A 2OFXA 4IAOA 4JITA 3O5AA 4H7DA 2HCJB 4M0CA 4RACA 4BN4A 5I9IA 1KWKA 4KSYA 2AWOA 3CO0S 1UPCA 2NXWA 2C84A 3NTXA 2Y8EA 3Q7QA 4FFRA 3OIYA 1NLUA 1F6WA 2VTVA 5T4EA 4EGSA 3II6X 1E2UA 4LV6A 4EKGA 3QE3A 1MO4A 1FF9A 3QUQA 1GPUA 3G7NA 5KTNA 3ZDZB 2DR3A 1HDOA 4R8MA 4RZSA 1GJRA 1TIBA 1ZYUA 4ALLA 2WINI 2G07A 1P4AA 3RB8A 1M5TA 2WKSA 2GAJA 2JRLA 1ZS9A 2EG5A 1RQNA 3BHJA 4OUDB 3OLXA 2PO5A 2OOSA 1P81A 3SKVA 4H1TA 4ZVOA 5SYMA 1Z8FA 2R3SA 1YVDA 4EUEA 3P9SA 1VJDA 5ALOA 1S2DA 1IC6A 2CL7X 4G97A 4G0NA 5K6TA 5J2TF 1XDDA 4A6DA 5DV9A 4DCJA 2W6IA 2PWBA 2J85A 3H3JA 1N4AA 4YMTA 1THMA 1NJFA 1Z4LA 2IIVA 1VIMA 3QLUC 1T8SA 4BUZA 2GEKA 2H1LA 2ZR8A 3KVOA 5AKXA 4EMUA 4EUFA 1W5TA 1BOFA 3EVGA 2F17A 1ODIA 2GZSA 2P9YA 2XMDA 4FVTA 4JLSA 3WGHA 1X77A 4KSCA 2AQKA 1RXSA 2O2YA 2WKPA 1IN6A 3RC2A 1Y1TA 1AUVA 3MCTA 5K0GA 2GBGA 3L7DA 2R25B 1NQAO 4D43A 1DSSG 3VFDA 5KNBH 2PH3A 4UFPA 2EJBA 1GUAA 2A84A 2ZIVB 3N3AC 2JJ8A 1OHHD 4LK2A 4LRQA 4TMKA 1ZGGA 1JHYA 5DH9A 2QTWB 3ZR4B 4ZHQB 1F7VA 3WP0A 3O8DA 4D25A 1OWLA 1ZK0A 2Q4BA 2CD7A 5A7GA 4C89A 1S1MA 3JQQA 5C52B 3EQZA 4ASUD 4CDNA 1Q14A 3SWWA 4G0PA 2X9GA 2QVBA 1VL6A 3NRJA 4EHAA 1XP5A 2NXNA 2PVCA 4EF4A 3LD9A 3E7FA 4NE2A 5AICA 3UWMA 4FZ5A 5EQTA 4AXXA 2B99A 4G9EA 3IEIA 4U3JA 4ETNA 2EL7A 1O77A 3ICCA 4Y9RA 4ARBA 2ORVA 2XMBA 3KPVA 4E22A 1CBUA 3G17A 3S2SA 1VCNA 3OZXA 5AUQA 3OIGA 2PKEA 3D6UA 2H0QA 4CEJA 2M1XA 2MYPA 4KVAA 1WB6A 1XLVA 2FQWA 2PCJA 1L4MA 3AMVA 5D86A 2W2KA 5CDFA 1MNAA 4JJIA 4GVXA 4PG5A 1RBZA 1SVUA 3AR8A 5KSOA 4L9WA 3PHIA 2IPAB 2G88A 2R6DA 1QF7A 4TTJA 5FA8A 2VDQB 3BGVA 4WXEA 2E89A 3QPAA 4CIXA 5ICSA 3HUUA 5C7YA 5D2CA 3K0FB 2BF7A 1O4VA 2H1RA 3F8WA 3LO5A 2JCXA 5K6AA 4B7UA 3ORSA 1RE0A 2GHQA 3E7DA 4J0GA 2ACWA 1GGEA 3WYFA 5A3QA 2MSNA 4J7AA 2YN2A 2DTDA 1VIAA 1TMYA 4F84A 2RB5A 1DOHA 2C4KA 5KPJA 1T5LA 4A0FA 5JZSA 3D3WB 1QKIA 3ZC3A 2KLHA 1SVMA 1Z5WA 3AJ9A 1N32B 1RJDA 3KQMA 3AR9A 3KDSE 3NB0A 4IFEA 1GUFA 1TTHA 2TMGA 1U0EA 3VPFA 4D9BA 1PR9A 3E9DA 2Q2QA 3PGLA 1MOZA 4WMLA 5CFLA 4KPGA 3ABQB 3M5WA 3WVNA 1AV6A 4HZGA 1TVEA 4L08A 2QSUA 2PNJA 5J4HA 4EYEA 2C54A 2BE9A 4EDHA 1S4QA 2ZIFA 4K6KA 1OBHA 3F3MA 1GSIA 2CSXA 3QPCA 4PSCA 4D45A 1EDEA 2WNHA 2H57A 5FX2A 4KR6A 4IDEA 3Q8KA 4O0LA 4L3OA 1OH5A 1OXKB 3E3NA 1VCOA 1YCGA 3CM0A 3P9NA 3PE6A 2X0KA 5INTA 1F3OA 1HE5A 2B0JA 2WAXA 4GKVA 3CT4A 4NV1A 3M6XA 3TW8B 1SUEA 3EMKA 3V32A 1TX4B 3RU3A 2HY7A 4CGZA 1PTJC 4J2TA 3W90A 1UDWA 3D6HA 1A82A 1CY2A 1BDMA 3JR3A 4RO0A 4HHEA 3G5LA 3QBDA 5AKZA 1HRKA 2B6HA 1J4AA 2X77A 3GWGA 4TSKA 4KPUB 4M0KA 4DZRA 4LJ4A 5C5DA 2VSYA 2ZWPA 3VVBA 3SIPA 1GNQA 1LZKA 1P33A 3QG1A 3V2GA 1VCIA 3DE0X 3WRYC 3M1IA 3P4YA 2WDPA 3ZGXA 4L6CA 3G89A 2PLWA 5I5GA 4U7HA 3TI9A 1UMDB 4TTRA 1CHDA 1EJBA 1PNVA 3LY5A 2YKGA 1U2EA 1PL8A 4MW0A 2OLJA 2C29D 3AK4A 3JARB 4BFSA 3N2NA 4JEHA 2F2TA 2A86A 2NZXA 3REFA 3WRWA 2Q7XA 4DV5B 1E2DA 1Y8AA 4BVKA 4XTRA 1KZHA 3TLZA 4AJOA 3H0EA 1R9MA 1T1GA 1V5WA 2IEGA 4PG8A 1FIUA 3GUHA 4O02B 1BA3A 2IRWA 1SQ6A 4JFRA 3JY6A 1RMYA 5AJXA 4I5FA 2PTGA 4RD0A 2ZRGA 1PR4A 5L3SB 3QKIA 4EUHA 3ENWA 1C9DB 5E6SB 2RARA 2VQDA 3LUGA 3NDIA 3E9NA 1G4UR 2VDUE 3AWDA 4I5GA 4YAEA 5H7XA 5EIEA 1BVYF 4UNIA 1DARA 1MB4A 2W8BA 2G4VA 4RYLA 5KNCD 3ZY6A 1PQUA 1SCBA 2EW8A 4B45A 2W43A 4DCNA 2JD2A 1G2QA 3HCRA 3UMGA 2PD6A 3CNNA 3IKVA 3KLPX 1FDRA 4Q4AB 5CPBA 1C3OA 2EL9A 2P41A 1ORVA 4LIPD 3UYLA 1DC4A 3ZS8A 1FJXA 3F73A 2QXUA 1TKRA 1YZGA 3CZAA 3QWAA 4KAXA 4MP8A 4FUQA 3KAQA 1TDJA 1Z2PX 3DEYX 3ZBTA 2G1PA 4TUYA 3JQAD 4X92A 4EITA 1G38A 3BQMB 1A27A 5AO9A 4PTZA 1AHNA 1XRJA 3I2GA 4IX9A 2WIGA 4ZARA 2Q62A 1U4SA 4HQFA 2E87A 2ONZA 3HL4A 4LQ4A 4D0LB 4N3GA 1Q84A 1OLXB 4KR7A 1CQZA 1Z5UA 2WAAA 2X0RA 4PZAA 2OD2A 1Z38A 1RKQA 3OZCA 4YAFA 3KV1A 3DF9A 4ZVUA 5LYJA 1I2BA 4HV4A 4N9WA 2QZJA 2H11A 1ST2A 1T9KA 1ORIA 1HSZA 1X80A 3AB3A 3JS5A 4CKEA 5CG1A 3NVMB 4AK9A 2PCLA 2P0AA 2GAFA 3UGJA 2ILVA 4OXNA 1C1YA 2D7DA 1WIWA 1NRJB 3GQBA 3T1OA 1PE0A 2OHGA 4D6XA 1V1JA 2YV3A 4RENA 1RMTA 4RK1A 3VBEA 1ZO8A 1ST3A 1YE5A 2PT6A 2YIDA 4O4LB 2YYSA 4ARVA 1S2MA 2GCNA 4HMOA 1TKBA 2IT1A 3R23A 3RHSA 4PIVA 4F96A 4DR6B 1CDDA 1LRKA 2YV5A 1QHYA 4JXKA 4MVJP 4QPDA 1Y5NA 4TZKA 5CW2A 3UUWA 3O84A 4C5BA 2PGDA 3KJHA 2W2NA 4Q47A 3HUEA 2D7JA 3CG0A 3PQ7A 2LGJA 4BC0A 5KTMA 3K4PA 1EVIA 4NFSA 3WL3A 5JAIA 3TJMA 3CF4G 3O8OB 1G8FA 4HWTA 3CCBA 4AL4A 1DC3A 4KYIB 3H8WA 5FAXA 4D9NA 4M87A 3FDIA 5ELXA 2ZI5A 1WL8A 1B2LA 1JAZA 1KZGB 2PL9A 4FJ0A 4DJJA 3IURA 4GNKA 5KO2A 3IEUA 5HJ5A 2IHNA 2XUZA 5JJIA 4KAJA 3QUAA 1FW8A 1OV4A 3W5BA 3UVEA 3G8AA 2CHEA 4V03A 5A9TA 1E3WA 1P61B 2LVBA 2KWIA 4ABYA 5CB0A 3BB4A 4QC2A 4RD2A 5HQJA 3LUFA 4A26A 4DMLA 4V0OA 1W88A 2GAOA 1KL7A 1EEXB 2YJ6A 1E3DA 2W2VA 3GLHE 3LGAA 2WJ3A 4RD3A 4GWLA 4R7GA 4KNYA 2IF2A 3QZUA 3PTZA 1IZ8A 3MYYA 3KKOA 1C9MA 3ANMA 5EHNA 5MF6A 2Q5CA 1X3LA 2Y67A 2YQ5A 3OH8A 3ECCA 4ZV9A 4WDQA 1V8BA 4WX2B 5LD2C 1TXGA 1V6AA 1NTRA 1CZNA 3G49A 3GLSA 3FYUA 5E1BA 4PXSA 3ESZA 1WA5A 5AHXA 3RVMA 1G21E 1JKMA 1LXCA 1PK7A 1X1SA 2WTAA 4ISCA 5JLAA 2BVNA 3GPLA 4JWTA 3IGFA 3KTAA 4B3FX 1T1SA 3A6KA 3GA0A 9ABPA 3ETJA 4YT8A 2C1EA 5CIWA 3TK1A 3A28A 1S3FA 1YF3A 4M9RA 1CY6A 3S7ZA 3KSAC 2QBYB 1ZVVA 1SPXA 3LXRA 3ZHBA 3TEFA 1DEAA 1E4EA 1EX1A 1XRMA 2JBWA 2ONKA 3FB4A 4F1WA 2D1FA 2DQSA 5JVDF 2Y1KA 2VHVA 3LS2A 4FM9A 4QPNA 3QVLA 4O2RA 2GR9A 3TQOA 1UBUS 1K0UA 4ESEA 2HSDA 4F0JA 4AF6A 1WSBA 3O03A 3OZRA 3HU5A 1IHOA 3MAJA 1UFQA 4LEIA 1LS1A 5TARA 3B8HA 1VPEA 2QI9C 3JQ7B 3CVXA 3SEQA 1IEWA 1KXJA 5EFZA 5A02A 3I58A 1N5MA 3NORA 4OQEA 3WLFA 2FW8A 5FORA 5U9CA 2H2WA 4EHJA 4GQBA 3CNQS 4G36A 5HKOA 4LA4A 3AOEA 1XZHA 4JJEA 3W2IA 4RPCA 4B44A 2J9ZB 1QGOA 2W2KB 4D57A 2F1KA 1TEXA 4PG7A 1L3IA 3FI9A 3S40A 4C0AC 5KTSA 1RVDA 2GRAA 4GX0A 4NCJA 4UBNA 3PKZA 5JO0A 3U2QA 4LTNA 4N8SA 3WLQA 2EATA 4I4NA 4KXFB 5A1JA 1MZPA 4A8PA 2RBGA 1YQ9A 4RANA 4J1QA 5ADWA 2C95A 2N75A 3I6BA 4HQNA 2FSIA 4KQGA 4QPCA 2YVQA 3HJUA 4X62B 2XCTB 3DXFA 1ZNWA 3K1AA 1U0NA 1IM2A 1F2TA 1FDOA 2MWMA 1ZNZA 2NYAA 4BV2A 1EHYA 5BSUA 4CMJA 3IAHA 4O4LF 2PVPA 3HY4A 3OFSA 4BLTA 3KOXA 3G8YA 2VH5R 4XLLA 3KP1A 4RWEA 5FOQA 4ARAA 4R2KA 4LXXA 5LCXA 1L7PA 5CYPA 3WYGA 5CFRA 3HABA 2AOXA 4RELA 1NNEA 3RBVA 2J5RA 3E2IA 3K53A 3UA3A 4J3NA 2O8DA 4X90A 1BXRA 1LBHA 4QJ5A 4CNQA 3TFOA 3N59A 3ZVKA 4O1HA 3PLAE 4RKYA 4QEKA 721PA 3QYAA 2AYZA 2I8AA 2RGEA 5JYBA 1IN5A 4FYKA 2WU3A 3IODA 1JXOA 3M6UA 3LY8A 2FR1A 3B53X 3DZ8A 3GH3A 2JFZA 3VDMA 4DLNA 1SXJC 4MOWA 5JD5A 4ETWA 3TFWA 1HX7A 1AUPA 1ISRA 2CN1A 4BZQA 1AQIA 2ST1A 3B1VA 2ZVPX 4KIGA 1SB9A 3Q10A 4LQCA 4RVOA 1UKCA 3IC5A 1ND6A 4H2DA 4LFAB 4Q7KA 1N92A 1UKBA 5FB3A 3MTGA 2YXDA 5CCBA 1OT5A 2GCGA 4HTAA 3ZS9A 5UKDA 3ANXA 2BGGA 3LC1O 1T0JB 2DFPA 5GP1A 4DWJA 3B7WA 5EJ8A 2NMVA 3AO0B 4ESVA 3CIFA 4HX5A 4PLZA 1IUOA 4L2IB 3MT8A 4ZD6A 1YACA 4FFOA 4K0KB 2JI8A 3E5MA 1ZH4A 5L45A 1TVMA 3EGVA 2SECE 4KIWA 1Z37A 3OQIA 3P97A 5EP2A 2QAJA 4H59A 4BFCA 4Y1FA 3OD5A 5BPFA 5JJ5A 3GRVA 3G2HA 3LUPA 1U28C 1PT5A 3EK2A 3INRA 3L6RA 2ZR0A 4ZP1A 3EVAA 2AOWA 3H87A 5I4CA 4UPEA 2AXEA 3ENQA 1GLGA 2X4IA 2WSBA 3E5RA 4G4IA 4N7BA 5K8IA 3F6RA 3OEHD 3OOJA 5JO9A 3U0VA 4DMGA 1WHSB 3STHA 5LOVB 3L4JA 4UUPA 5JQGA 5HQ3A 2QLNA 4IO0A 4IEIA 2FPKA 4QO8A 1JRLA 3ZW7A 4KG7A 1DRUA 4HX2A 4MW4A 3L6OO 3CZ9A 1UM8A 3CKKA 2V8BA 1YZHA 3SDBA 4DLAA 2HBZA 1N2CA 2H2HA 2ZBEA 1H42A 1TQ6A 1ZPDA 3B1KA 3PGKA 5AM5A 3WOVA 4C3VA 3OZEA 5TT1A 3A1VA 2OB2A 4MWTA 4YPFA 4BLVA 4E09A 5SZKB 3SXPA 3WLHA 3SS9X 3PSAA 4DZTA 1QH8B 3S3TA 3QMMA 4DUGA 4DYVA 4BZZA 2YH2A 5KVCA 1C3XA 2EJTA 2D0IA 3G3EA 1U4OA 3P9CA 2ZYIA 3PI7A 2XUIA 1OC4A 2QT9A 3QUTA 2EQBA 1Y8CA 3A4MA 3FCEA 2P3LA 5K3FA 5CFOA 3H9GA 1CIPA 1RS0A 3PDWA 1FL9A 4QHSA 3T7DA 5EJ9A 4JZYA 3V8MA 1B43A 3FNBA 5AKKA 3AEKB 3OQ6A 1OWNA 3RFXA 3RT9A 5DSTA 2A4MA 4DDHA 2O19A 3CUTA 2AEFA 4RPHA 4ZJPA 4H7HA 1YZYA 1J23A 2IS2A 1GAQA 4NCNA 1T43A 1QIDA 2IXGA 1IU9A 2F3QA 3L6DA 3ICWA 1IOLA 4S3MA 2I4IA 3AFGA 2JS7A 3COPA 3HJCA 2YFYA 4M21A 3RE1A 5BW6B 3PFKA 3T5AA 2F8SA 1JQKA 1YFLA 2WJZB 2P9CA 1Z33A 1N2HA 2ISCA 1V4NA 3C3JA 3LA8A 4IOJA 1F2VA 1G7RA 4DLWA 2HHAA 5KEIA 3TDKA 2Y1FA 4YQYA 1KYVA 2C96A 4KVZA 5ITVA 3EFOA 4TMWA 4BNDA 2YJZA 1V5EA 2KX7A 4FYXA 4X97A 3R0QA 2W7TA 3REGA 3SS7X 3VSAA 3MB8A 3MWEB 1K8RA 3DOEA 2XR1A 5LYYA 1K5PA 4BKPA 4XVQA 1NXSA 4ED9A 1GADO 2LE0A 2QUKA 4R9NA 5SY4A 4UU7A 1GCGA 3A11A 4PZ9A 4IS3A 4KMMA 4R1QA 5B55A 2QV7A 4QTUB 2ASVA 1JNYA 2HJWA 4DJFC 5EP1A 1R6TA 2CXSA 5AVKA 4DYDA 3BVPA 4DTCA 1ZC4A 5EVCA 2F00A 2R97A 1T13A 4HG2A 3W0LB 2I3ZA 1C7QA 1DAMA 2F59A 3C3CA 1HLFA 3PUVA 2CL5A 3UJCA 3WFZA 4BP3A 4C7OA 2P4UA 3FUTA 5A4DA 2LKDA 5CX1A 2B8TA 2XTJA 1ORHA 1O3YA 2GZ3A 2ID7A 2VF5X 3V2IA 5HJ2A 1JLLA 5KSPA 1JPVA 2XBUA 5MN4A 2XNHA 3JD4A 3WB1A 3HJFA 2PGXA 3LT5A 2JHPA 2RHDA 4BXOB 4JT8A 1BOOA 4R1MA 3FRHA 3CV3A 4AKTA 2O9JA 3VZBA 1OTYA 3I04M 1YBHA 1MUUA 1O6BA 2O8VA 5T4HA 1DKMA 4HQRA 3JZIA 1R6DA 2M6SA 3A70A 1E4VA 1FQWA 4BWVA 2XUPA 3O73A 3PGMA 4CDMA 2J87A 5L3VA 1EGQA 1AGYA 1GXSB 5FHRA 5ALTA 1JLRA 3OG9A 4CM5A 4M1KA 3ZHSA 3MBKA 1JZTA 2JF0A 3SFZA 2AF3C 5LQAA 2GHRA 2HADA 3KTAB 1U9YA 2L69A 1EAMA 2QYHA 1PJAA 1Y1LA 2P4SA 3CJRA 4D4MA 3ER6A 3AKYA 2OK7A 4NTZA 5K0LA 4RADA 2HSWA 1DG9A 1L2TA 2NUTA 1HL7A 5B58C 2W6ID 3GBVA 2AKAB 2D1SA 4YMVA 3EAQA 3AF6A 1HR0B 1WM1A 4EHHA 1C7EA 1P39A 3EULA 4I9GA 4EGFA 2X14A 3L84A 3V1NA 1O95A 3GRAA 5CURA 1DCTA 3T5BA 4EPVA 2I6QA 3GN2A 1DDGA 3TYXA 3MWDB 4FW8A 4QTYA 4RVHA 3M9WA 4U2EA 1ZXXA 2X23A 4XEHA 5KC8A 3KOOA 4M9ZA 3DE2X 2VS1A 1ZUNB 1I6MA 1ZC3A 2BLNA 1YFKA 1ZA1A 3OOWA 2YHSA 3I5AA 4E2FA 1L5YA 3ZD8A 2IZ0A 3GD5A 2D74A 2VP6A 1X0VA 1FNSA 1CUEA 1Q1GA 2FKNA 3PX2A 5F3DA 3WP1B 2P69A 5BSWA 2DE0X 1E61A 3G9UA 2ID8A 2OENG 2PMDA 4DLTA 3D5TA 5BN5B 1GEGA 2E9SA 2H5EA 5LP6A 4UHBA 2DYKA 3LQYA 3P20A 2YW9A 4IDAA 2VTDA 1R8SA 4XI9A 1UXOA 5FYDA 5C31A 4PYJA 1K4YA 4CMBA 4FZRA 3JYNA 5LIPA 1ZH0A 2WJ6A 1W4BA 4LY6A 3A9TA 2WJJA 2IU0A 4LHXA 1H05A 3QWHA 1T6XA 3QVWA 1ZJZA 3C4VA 4BS9A 1QZXA 3INNA 3L7MA 3OPYB 2BI8A 1O4WA 3I64A 1PRYA 3ZDQA 4A0QA 5CG2A 3RK1A 3P9KA 3RRYA 1ULTA 5DU2A 3GGJA 4JL8A 1CF2O 2I29A 1GTMA 2O2JA 1Z0ZA 4IHJB 2VTBA 4CG2A 5LQDA 1NVFA 3LIPA 2QMYA 4Q9JA 4AY6A 2RHCA 3GJ6A 2MYUA 1OI4A 2EHDA 3LPDA 1ZRMA 1X80B 3DR3A 3ORRA 4P36A 4CKEB 3OSUA 3ZDAA 2P0YA 2C2ZA 3DXZA 2VJMA 4YJHB 4C0WA 4JR0A 1O9BA 1MAAA 4HDAA 4JUDX 3R44A 5AM2A 3OZAA 3DD5A 3D0OA 1JI3A 3OPYA 2HWUA 5IP5A 5C35A 5K3BA 1NI4A 1FU4A 5AVQA 2POQX 2X8AA 4S0ZA 3RIGA 2EBWA 3HFGA 1Q6ZA 4BMSA 5KJ1A 1WO8A 1JG3A 4L9SA 4EX7A 1SOUA 4ETIA 2I71A 2R6HA 1M10A 3HFJA 3ELBA 3VNUA 6Q21A 1M6VA 4CLXA 2NV0A 2V7PA 3HP1A 1AA9A 3Q9UA 5EJMA 1P0PA 4BDTA 4GSYA 1F8GA 3R9WA 3KJFA 4JBXA 4WCFC 3ML1A 3GOHA 2CT8A 2DTXA 3LLVA 4D0NA 3SQXA 4RIEA 2AD1A 1QCZA 1TQ2A 2Q41A 1OWPA 5EG5A 5KYWA 3JQBC 4PC3A 2PBRA 5IARA 2ZR9A 3AM3A 3Q6MA 1V1MB 5DXFA 1XZKA 3TO5A 4YMHA 1V48A 3R0VA 1K2WA 5F21A 4I6JA 3WBFA 3PKJA 3C5VA 1H85A 2BRUA 1CVRA 3H1PA 5F78A 1QYIA 4DQXA 5HG0A 1V8DA 2FX2A 1KOLA 1NVKA 4M7OA 2C7BA 4TKVA 1WMBA 3DOOA 4XEUA 1GL7A 1SWVA 1GHTA 1PUJA 1TLFA 1PKEA 1EX7A 4K6CA 3ESYA 3JQ8A 4EB3A 1CFJA 2B4AA 1K7EB 1OCEA 4BB6A 3AJRA 4EHBA 2PE5A 3K72B 2ZAMA 1BE1A 4CZ2A 4PCAA 1KI4A 2XTMA 4FGWA 2WILA 4HQKA 4ZDIA 1RCTE 1T91A 4KITB 5L7WA 1UF9A 2ZBGA 1WP9A 4DKXA 3WDKA 1KAHA 5CVDA 2G04A 2HIGA 2HMTA 3A4IA 2VC2B 1CR0A 4PGHA 2B4RO 5F4ZA 4HDMA 5C34B 1KO5A 3HNOA 2PUGA 3EJWA 3QPUA 4LXGA 1NZFA 2Z2YA 3EARA 5HKAA 4WERA 4XOUA 1E7YA 2E37A 1B3RA 3DC7A 1W29A 3E9CA 4OAPA 4NDNE 4U6QA 1NF8A 4ZN6A 2OY0A 3F6SA 4OP2A 4A5SA 3A6EA 4PNHA 1LBIA 3FCSB 2EX1A 4IHKA 1A9RA 1IVNA 4P54A 3SHVA 1HG1A 4MMYB 4G1EB 3B9PA 3A6DA 3HO1A 1IJBA 1MABA 4KV9A 4LV5B 2N1MA 5HDQA 3ZI0A 1PU2A 3AEUB 3IPRA 2QTMA 4RLHA 2NP7A 4RHTA 1DXQA 4NEQA 1V8ZA 3NAQA 3INGA 1G20E 3PP8A 2YHAA 1A5TA 1BKSB 5DBFA 1W52X 3JTMA 5EUBA 2YDXA 2DLCX 3UANA 5ERGB 2VI5A 4JROA 2VOJA 1XYYA 3VU9A 3VNQA 5KNLA 4NL4H 3IAFA 3K0EA 5JCXA 3FHLA 1KPIA 3N6XA 1CY4A 3MJSA 4QOJA 3OTOB 4LZLA 4OHVA 2HU8A 4CT0A 4BNHA 5D3MA 2H18A 5JIBA 2EKQA 3ZCVA 3U16A 5J2UA 1E9SA 2C4WA 2B8JA 2XZTA 1KSHA 1CR6A 1NW9B 3EVCA 2AK2A 4BV9A 1QANA 1L4EA 1ML3A 1U2ZA 1WEKA 1DDOA 4N0EA 3A1WA 1DQNA 4J16C 2W4IA 4GPEA 4XIFA 4QVGA 2A14A 3DO6A 2YFKA 4MWCA 1A7KA 4ZZ1A 3HZRA 4FUTA 2WUGA 4OATA 5A3RA 2P90A 2WMOB 4CL3A 5JNTA 4MV6A 4DS3A 4OP1A 3BHNA 3LT1A 3QBEA 3ZKWB 3L1UA 3TRHA 3D6FA 3MTEA 2A9PA 2JIMA 2TECE 1YMUA 1OROA 2GRUA 2JAQA 2XVAA 5FR1A 4BQFA 5M29A 4Q01A 5FUMA 5HXAA 3PWTA 4WK0B 1XTUA 3VPDA 2C82A 1DJPA 1P9WA 2HDHA 3EBPA 1WXHA 1EJ2A 4JJ6A 2WQ6A 1GPYA 3WMFA 3IRUA 4MPJA 2LBPA 4LXTA 4P93A 4QGAA 2C7OA 3L04A 4WZAE 1A77A 1BRTA 2WF8A 4MSUA 4HDNA 1LSJA 1YNSA 4R2JA 4O3FA 3QFTA 4HLCA 3QJ5A 2ZIZA 5BR7A 3Q7EA 3FZEA 1KC1A 1NKVA 2IP2A 1MOPA 2Y76A 3CLTC 4FLFA 4K3VA 1WKBA 4Q3AA 1P44A 5CLGA 1AGXA 3KB8A 1ZXLA 1HMYA 1D1PA 3N0RA 3SBEA 1AKRA 4FNAA 3K1JA 4BAUA 3FSGD 4P0PB 4DRXA 1YRBA 3OETA 1X8XA 4M9SA 1O08A 4NPAA 4DV6B 1FNBA 1XQ9A 1BD3A 1JQ5A 4F3KA 1AS0A 1MBZA 1PYOA 3DKRA 3E3LA 3WL5A 3QEOA 4AIIA 2FFAA 3EA0A 1HDZA 3X1YA 2VAXA 3GLFE 4OUDA 1JDJA 4BNNA 1NR7A 3ADOA 2QZZA 1Y4AE 4JH0A 3WMGA 2JFOA 3CXRA 3O8BA 1DXHA 3N2GA 1YDFA 2DKFA 4TXHA 4C3ZA 3IVMA 3RG2A 2JFVA 3A4LA 4LZWA 3JW8A 5LXTB 2ROQA 1QR6A 4RH3A 3BWEA 3OAAA 4XTCS 1A98A 4GQIA 4GXTA 5ULLA 4L4XA 3HS3A 3VH3A 1T8RA 3V55A 3VC3A 1M2GA 4WZAA 3I4FA 2DUUA 1M5UA 1ZSNA 4XX0B 1DQPA 4Q7EA 1NLYA 2UVPA 3NM5A 4M1EA 2VDKB 2JGDA 3OMXA 3FDFA 3ZU6A 1BH6A 1UBSB 4ZDKA 3G0DA 3GLUA 3HB7A 5LOVA 4IDDA 2XCIA 1YB2A 3HDHA 2Z8ZA 4FN5A 4YR7A 4MA5A 4WACA 3UB4A 1P1KA 2L0XA 1AD2A 3Q72A 3QFRA 4NBLA 2NZVG 4TYPA 4ZT7A 2QJFA 1Y6GA 2Z4RA 4XD7A 1G6KA 4JVLA 1NBHA 3TWOA 2YJ4A 4DDKA 1R4MA 5KQGA 1SCQA 4XYEA 3EW7A 4EG7A 4G2NA 1TTPB 2Z83A 4O08A 3T0GA 4A6EA 5K2OA 1QQBA 3BXOA 1N7HA 1BFUA 3H2IA 2B8NA 1P5ZB 3EXFA 1TZMA 4KACA 5EE3A 1CIVA 2GPSA 3Q3VA 5A7HA 1ZD3A 4XWWA 1TZCA 3AVPA 1YR7A 3B12A 3B38A 3TEMA 3WIEA 3EC2A 2HMYB 2PSDA 4ZVPA 1SVKA 3GIWA 3VAYA 1FFDA 2YXNA 2OBNA 2GBLC 2HXGA 3C1OA 3DZKA 3EGCA 3KTDA 4H18A 5GOTA 5DM2A 4YJHA 3RAPR 1SKQA 2RKBA 4JKOA 4E4TA 1G0NA 1L8LA 1N6KA 2QX8A 3MNFA 4MIEA 3TAUA 4B79A 4BU1A 1NHWA 4YJ3A 4O8ZA 1OFUA 1YQWA 3QY9A 4BKMA 4TS3A 3UAGA 4XWKA 3TNYA 2PYDA 1GQFA 2V0GA 1KO1A 4KE6A 2C92A 1KI6B 2TSYB 2WKWA 2J41A 2JFBA 1SXPA 3I4CA 1UM9A 3ZBQA 3D2AA 1ZWLA 2ZJBA 2XDQA 3OZSA 4L5BA 1GT6A 2UYGA 2WJVA 2WBLC 2XRMA 4XVRA 1HH4A 4JU8A 2Q4EA 4YALA 4E08A 3PT5A 1WBBA 2YHUA 3B51X 3BH7A 1YCFA 3S27A 2OA0A 4YAIA 2FW7A 2ZZKA 3S29A 3SM3A 3ANTA 4DQLA 1CZHA 1P74A 1DRKA 1SVNA 1SY7A 1TYZA 3BL8A 2V5AA 3GV0A 2CMKA 3NOXA 5G41A 5TPZA 2PK3A 4CLHA 2Z2JA 5DLYA 1X7XA 2NSYA 3TR0A 4BX9A 1IRIA 4I4LA 2LNDA 2ON6A 1ODCA 1YZ3A 3I34X 3I42A 1G1MA 4K87A 4OFZA 1M1YE 4NOJA 4UEWA 3SEZA 4UMFA 1ULUA 3DMDA 1F2UA 2UYHA 1L5VA 3ZDRA 3LSTA 4IIGA 2NU9A 1P9NA 1MG5A 4DUZB 5THKA 3IMGA 2O3SA 4HXEB 3W1EA 1LVGA 5EZYA 1Y8RB 4W99A 4E0BA 5K0TA 4A1OA 3EQ9A 6CHYA 4KX5A 4W5WA 3UUEA 4QJIA 1SZPA 3U4IA 3L40A 3I4LA 2ATEA 1GIAA 2JHCA 5DNAA 1FYFA 5AOCA 5KKNB 2ZTMA 4J0EA 4R51A 3LK6A 5SV2A 5BR8B 2QORA 3AKDA 4HYEA 4C0KA 1RM5A 5M04A 4B3TB 3LQKA 4NZPA 1AF7A 1XZQA 2Q5IA 5MGNA 2VNKA 2PN1A 4GXRA 2DRIA 1AIPA 4J1SA 1WBDA 2PZLA 3ROXA 3Q7RA 2QR2A 2C2MA 1PFQA 3TINA 1BWRA 4BN5A 2D8AA 2CF6A 1QVAA 3EF0A 3L49A 1YZUA 2BFEB 4OFBA 4MX8A 2Y1DA 1D1QA 1F12A 5B57C 4ZQBA 2GKOA 1JHPA 3PXXA 5E8RA 1A71A 5SY9A 3FSEA 3HSYA 3MF4A 4IJ6A 3UN1A 4UMVA 3VYSB 3MK31 2RGYA 1MFZA 4DIKA 3T7KA 2B7CA 2RDMA 3VJLA 4ZVKA 3PGA1 4DXHA 4N0MA 4FZVA 3HH8A 1JHOA 1HWYA 1A9XB 3HXKA 1XZLA 1A5SB 2JVKA 2PMCA 4H7JA 2EZ8A 1DX4A 1TECE 2DMRA 1UMDA 3KYBA 4HY3A 2CLKB 4MPDA 2QNBA 4GP7A 3U4DA 3PNPA 2ADMA 1NW4A 1UK9A 3CEAA 1FYVA 3DTTA 1XPUA 3CX8A 1ZCAA 5G0VA 4AUNA 3NG1A 2ONCA 4P80A 2VTBB 1CP2A 2X22A 4X54A 5IDVA 3TLCA 3JQGA 3VAZA 2XB2A 1KEEA 3C8UA 4IJMA 1U1EA 2NU6A 1Y3AA 3T7CA 4TWIA 3WHKA 3L8CA 1AJEA 1ZOIA 1XFDA 3I8XA 1ZIDA 5LQMA 3E0QA 3O7MA 5JH7A 4G26A 3H17A 5HZHA 4GP6A 3KBBA 4B31A 1Z06A 2L2QA 1ZUNA 2Y92A 3ZGOA 1XAHA 2QTBA 1T15A 5JDCA 1KA9H 2QQFA 2O2ZA 2QZ4A 4REOA 1HBJA 5HBRA 3PEWA 3FDZA 5KJFA 5D87A 1EJ0A 2LW7A 2C4NA 1J2JA 2GPJA 1F2TB 1GWNA 1A4XA 4II3A 3UOWA 1GSOA 3QE2A 4X8MA 4QGHA 2PKQO 1QRTA 3DE1X 4J9UE 1CPYA 1G3RA 1QP7A 3IR6A 1U5BA 3KJEA 1XVTA 4DR7B 1QB8A 2Z2IA 3X2FA 1K3FA 4IEEA 1V5IA 3WMRA 3IKLA 4C9BA 3T1HB 1EH5A 2NSHA 3NFRA 4FZJA 1PJCA 3D1LA 2YZNA 1R0CA 1O97D 3C16C 5EJIA 4GW3A 1E60A 5T67A 5ADHA 3E4CA 1JH9A 1PFKA 3B36A 1M76A 3NBYC 3EGDB 2P4EA 2C4VA 4HMPA 4IKOA 1DO2A 1QFZA 3FJYA 5E3HA 4ENPA 1XL0A 5ALJA 2VSNA 1DIRA 2IF0A 3JQPA 3IPLA 4RGYA 2JLSA 2P3QA 1L1FA 2RE8A 4GI1A 6ABPA 1FSPA 5TT0A 3NNDA 2HLDD 2UV8A 4AY3A 4B3RB 4JLNA 1LEHA 2J08A 4X3PA 4TKUA 4BWGA 3AOGA 1U7UA 1YQGA 1Q3TA 3GYGA 4POOA 4MWOA 4RZ2A 1QC5A 2RBKA 4IDFA 1FOEB 2OO7A 4NZ9A 2VQSA 1JEYB 4N82A 3BXGA 4LGMA 5KHAA 3DOFA 1RCFA 5E4TA 3A58B 4YWHA 2Z3WA 3WJ7A 1PG2A 4WGGA 4X94A 3ISVA 1L5MA 3D8TA 1N0VC 2EZUA 3KB1A 4JIGA 1JDNA 2AUTA 2XYQA 5G2OA 1FXWA 3IJPA 3VPHA 4EY8A 4FIDA 5J58A 1M1YA 2W83A 3AV0B 4Q21A 1ZK4A 1JLKA 1R64A 1M0WA 1GKLA 2QP4A 3C3YA 1TGYA 4AN0A 4PQYA 3I8SA 5FQNA 4AQYB 4AZ0A 5A2QA 2PKYX 2BMJA 3SHTA 1AQLA 4NNOA 3L06A 5H82A 1QZ3A 3ENNA 2NU8B 3RVOA 2GA8A 2TMKA 2QRMA 1L7MA 2UZ0A 3LW8A 4L02A 1D3AA 2WMDA 4I1VA 4YAOA 1UIMA 1JYEA 3KD2A 4QREA 3UB2A 1TJ4A 4LWOA 4AJNA 1W581 2DJIA 2IPNA 4AULA 4FGKA 1X7HA 3U44A 2B8WA 2FMXA 5CTJA 3EZGA 4R2IA 5EGSA 4HNUA 1FTWA 5B7NA 2YXBA 4QGBA 2AL7A 3WO0A 3UAWA 4B7CA 2JLXA 2OKGA 1NUSA 3I05A 2FOIA 1SZDA 3N8DA 3SIRA 4CV2A 1T5OA 1TNDA 4BWYA 2ALJA 3HZOA 4XWOA 3TOCA 1NXWA 2C20A 4B7XA 4ICIA 4W5HA 5AI0A 4D8WA 1TQ8A 4OGFA 2WF6A 3CB2A 1U0BB 4H6PA 1CK4A 2CUKA 1F3LA 1JDUA 1YMQA 3H11A 1I6KA 2HCFA 1OIXA 3V1KA 5H4GA 2XB4A 2J30A 4P8RA 1HMPA 1LW7A 1TMGE 3EQ8A 4X64B 4GI7A 3W5JA 1UBJS 2R5WA 4K9KA 1FFXA 2I9PA 1IZ9A 3O8OA 5K3SA 3RIYA 2L42A 2CFCA 4RU1A 5IMBA 3O4JA 3VUFA 4CG1A 5K0SA 3LJKA 4KX3A 3SBOA 1C7FA 2GAIA 4DM3A 1A9TA 1O1YA 5ALHA 5GJWC 3SFTA 1SBZA 1H23A 2GK3A 3AFOA 1N2BA 4LYYA 4S0XA 5K20A 4I1PA 3ZDDA 4YAJA 3FVQA 3SC2B 2VAMA 3VSBA 2WWYA 3QM1A 4Q7JB 1M2OA 1UWVA 2ZRDA 2IA5A 2IP1A 2WV7A 2UU9B 4OLFA 3I3OA 2C2HA 4GC5A 4BRWA 1WZIA 1W4LA 1TD1A 1C1XB 4LX0A 1JR3E 1EQ2A 1YCHA 2WHEA 4UBJA 5JS7A 4J1TA 1U7DA 4LDZA 5DISB 2ZYUX 4O2AA 3C3EA 4ER0A 2JIPA 4DG8A 5JJCA 1M0EA 3E61A 3RSZA 1C9KA 4UTXA 4RDXA 4A73A 1JILA 4FOTA 1W5SA 1PZNA 3ANSA 3P2KA 2DM6A 3X2SA 4QGSA 1KAQA 5AQEA 4G5RA 3CUWA 4E51A 1FYXA 3W7VA 1QE5A 2FUCA 4ARUA 2GQ0A 1LI4A 2O1EA 2WK1A 3IHWA 1L6RA 5AI4A 3TQQA 4AW9A 1R0WA 3IV7A 1BH2A 3BK7A 1DIHA 5C4GB 3ZLUA 2B5OA 3HN7A 1PWXA 3JQRA 3ODGA 2RGGA 1SZJG 3FVVA 3ITKA 3IT2A 3KZOA 4QE3A 3VYTB 4C21A 5A2GA 4BFYA 1ZY2A 5I8ZA 3LMKA 1P75A 1RJEA 4GWKA 4C6RA 1LB1B 5BO5A 3M0EA 4GRIA 3AY6A 2RGXA 3L0OA 1G18A 2X7JA 3PX7A 1RYBA 3AR7A 3NFYA 4Y0AA 5TIIA 1KGDA 5KQSA 1G66A 1YR8A 4BGIA 2G9UA 4REMA 1ZM7A 4W8OA 3QF4B 5DM0A 4BVEA 3TVDA 1JEOA 2GF2A 2ZUBA 4PGMA 3BXZA 3VV3A 5TMBA 1OOEA 5FPHA 2WDZA 3OCVA 3EZFA 3OBBA 3VU0A 3E58A 4JQYA 1SCAA 2B25A 2VH2A 3EAFA 1NVDA 1UT6A 2QR3A 5H4HA 1FFSA 1W4AA 3SK0A 5KKCA 3TLGB 2FPSA 4C4TA 1TM4E 4DLSA 4UNSA 4C6TA 1CJBA 3LOPA 4RZXA 2OHJA 5GOZA 3ZHXA 2HJ9A 4BBAA 1U7PA 2FDRA 3C24A 3W8FA 5BP7A 2ECKA 3DMGA 3QKUA 2ZOSA 1P31A 2H3HA 1GGFA 2QX6A 1NVMB 3DBHA 4F6RA 3N8GA 2CLIB 2R65A 3AWIA 3RF7A 3K5WA 1VIVA 4EKDA 2CCGA 5AJYA 2G40A 3H5AA 2VP5A 1RQRA 1AQYA 2A94A 5DHTA 1VA4A 4L5YA 4Q48A 1IE3A 1QO9A 2WTMA 1YJCA 2AQIA 4ALNA 4N3CA 2SCUA 4MUJA 5FBWB 2IXTA 1Z2OX 2I6UA 2ICAA 3BSFA 4UAGA 1Q7RA 3PDCA 2HMAA 5GM1A 4BQEA 1GKUB 3AFNA 4HI0E 5KYKA 4KXMA 4BBZA 3SYLA 4P3YA 2VJCA 3MT7A 2PX6A 1I3LA 3WNCA 3BAFA 3LPMA 5JXJA 4DMHA 1ZICA 1RHJA 1WPRA 3CYFA 4NYMR 3OT4A 3T5TA 3THOA 3V8NA 1N2CB 5KS2A 4BVHA 2P62A 2PGOA 1YDMA 3G9XA 3TUJC 5JCJA 2R6AA 2ZB2A 4NBTA 1NXVA 4GDFA 1DL5A 2PWAA 3MT0A 4BO4A 2EF1A 3ZGZA 3ESBA 1NW5A 3PGJA 1VM6A 1DLIA 3QQ5A 4WBNB 1E7QA 4E31A 3SJCA 3OT5A 3I01A 2QM7A 3H2GA 3JQGB 3VYWA 3GEGA 1OZHA 5J2TA 3W3ZB 3MQ4A 3R5SA 3HGQA 4GMKA 2F9MA 3JYOA 4TRNA 4DSAA 1DUIA 1JB1A 2ZRMA 4JYPA 3I6ZA 5C3MA 5L8VA 3CZPA 4JBNA 2QTVA 1R5BA 4Y7DA 3RFFA 3O4FA 3VM6A 2G72A 3CISA 3OIFA 5DNWA 1E9AA 4GBED 2DERA 1XT6A 3EIXA 4GI5A 4RDCA 2NADA 1I3MA 3OQHA 5JRJA 3AP2A 1XTVA 1UINA 3IBTA 4O4LA 1RBQA 4TMFA 1V2HE 2NOAA 4DA8A 5JDCC 1S9DA 4PS0A 2OMEA 3LWZA 2QSZA 3A3PA 4RVCA 4OCZA 1OXBB 1DC5A 1DJLA 1Z0IA 4L9AA 4ZVNA 5J63A 5CFNA 3G2JA 1H2RS 3BIFA 4YA6A 1FSSA 4LNUA 4B3IA 2EFHB 2ZP1A 1R66A 3NC4A 1TO6A 4EB0A 4URYR 1JHUA 3NJ8A 4RDHA 3V7WA 2A1TR 2NQTA 3RHFA 1RWMA 2VHTA 5I4BA 2Q1UA 2VAWA 4PEVA 4F46A 4YRAA 2XGOA 4UCFA 2NM0A 4Q3LA 4GOKA 4Z9AA 1S0UA 4YY3B 3UKOA 3W3AD 5HZGA 3DOJA 4EJ6A 1L1RA 4LJ8A 1Z45A 1DS6A 1U3GA 4MW9A 1UJNA 2C42A 4N3NA 1F5NA 5TMDA 1KMNA 5TQJA 3WWCA 2Q5LA 5H1YA 4ZEVA 1A7AA 2JGIA 2PEZA 3FNIA 1WB9A 3U7QA 2FPGB 5KTYA 4RWZA 1QRRA 2R751 3EVFA 3K6KA 1Y1RA 3N6RA 3QVSA 2F8TA 3FYUB 4FMPA 2R87A 3HY3A 3IVXA 2AMLA 3A1CA 5LDGA 5LQJA 4HLDA 1UEJA 3W5IA 4IO1A 1XU4A 3CLHA 2I1QA 1KMMA 2GEFA 3M9LA 3MFYA 3UJDA 3C45A 3UMSA 2ZIXA 2QYSA 2WFLA 4L5AA 2IEAA 4EKNB 3QX9A 4REQB 3W8EA 3FMVA 4BO9A 4NV3A 3INYA 1NSFA 1E1CB 1J2EA 1MB0A 1QUEA 3NWPA 4ILKA 2QN1A 1MEEA 2ZJ1A 4LDQA 1NF2A 4KN8A 1VYUA 3MMXA 1KIMA 3BB3A 3C74A 3UAVA 2OXCA 2GVZC 2X2PA 3IJEB 4YLEA 2A9RA 3G0OA 3GFOA 3DM5A 3IKTA 1I2AA 5H02A 2HLNA 3Q88A 1WXWA 2R1TA 1PYGA 4I50A 2VJBA 1ZK1A 4M9CA 4XPZA 5IKEA 3U44B 2RAFA 2ZUCA 3E84A 3IULA 1T2EA 3NEAA 4PYKA 5ANRB 5B12A 4XUGB 1HTTA 2PZAA 2ZVJA 3A3KA 4NH4A 3VMMA 1SBNE 1UOOA 4YV2A 1C1HA 2BISA 2GYYA 3R0XA 3D3JA 4XSGA 5U4XA 1VC2A 2BT4A 2HNKA 5KJCA 1U7ZA 4JVOA 2GEJA 4N49A 4R2MA 4ZCQA 4HVLA 2FWIA 2H63A 3DPIA 5JAPA 3FWZA 4DLUA 3ZLVA 1Q7CA 4X84A 3KR1A 4J6EA 3W06A 2ZRQA 4BGUA 1LFAA 2CV2A 3U1BA 2JVIA 3ZDYB 5NLLA 4LOIA 4R1UA 5IDXA 4DA4A 1QDEA 4C7MA 2O0MA 4UQLA 1SNYA 3F67A 3RG8A 4EQZA 1I5OA 1V0JA 2F1IA 3BICA 3N7UA 1TK9A 3GNSA 1P6XA 3VDRA 3L1IA 1SXIA 1TT5B 4V3CA 3ORHA 5CM8B 4E94A 2BFAA 3GP3A 4AKGA 2V7EA 7REQB 4R6XA 1MPXA 2ILTA 1WDWB 2CXUA 2VH1A 4JENA 5JWRA 1XZIA 2YOHA 4GU5A 2VK2A 2RMKA 4GPD1 4GR4A 2DB3A 1N2GA 4I9FA 4LSMA 3K16A 4RMNA 2ZT8A 1U8ZA 2VPWA 2VPXA 3JD0A 4CF3A 1CLEA 1IOVA 2GXSA 2XY4A 2RKOA 3AUKA 3AVQA 5I7AA 1GKYA 2HCRA 3PICA 2ADFA 2CXOA 3NBXX 3SR0A 2W42A 3ZE6A 1QIMA 5CB4F 3OQPA 3ZX5A 2P35A 4Q4HB 1N7GA 3KE9A 4F3CA 1Q0SA 2EG9A 4RC9A 3W2FA 3A9UA 4BLOA 1Q15A 2C9OA 1IWOA 1KC3A 2JJYA 3VNBA 3NPAA 4G86A 3TDMA 1Q2XA 3TH5A 4XH9B 4DEVA 3VXKA 2OZLA 1ZKDA 2FSVA 3PUYA 1NP3A 4LC0A 4DSOA 3I5YA 1C4WA 1S7GA 3QUSA 3WJAA 4QZVA 5H3HA 5IFLA 3GLGE 5DM60 1CCWA 1NQTA 5AW1A 1DAEA 1RT9A 1NPDA 1LPMA 3QMPA 4IV0A 4O5OA 5BV1A 3GF4A 2FDXA 5DYTA 1JIQA 1IUPA 4XYLA 1IIBA 1NI4B 3PC7A 4IG4A 1PZXA 5TB5A 1GGVA 1BW9B 4HATA 4MVJM 3CUKA 1RIIA 6YASA 5CNKA 4KU4A 1IBRA 3NM6B 4LXHA 1CUYA 1FTSA 4EG8A 1TUIA 3VTZA 3A3NA 4J75A 3T3IA 1UEXC 4MYDA 5DHSA 4A0HA 5JANA 4YJGB 4ARIA 1ZMXA 1LUAA 3RUAA 3SLKA 2GVNA 1X94A 4AO6A 1S96A 1JEQB 1EUZA 1SOWA 3RM3A 4CRWB 4OV6B 1G19A 1QG0A 1RI4A 2RB4A 4KN9S 4YQZA 4HUTA 2CMGA 3A4TA 4P08A 1Q57A 3ZJYA 3ZTYA 2WTNA 2PGJA 3VI3B 1R37A 1ESZA 5BYKA 1L7EA 1L4UA 1CU1A 1QFJA 3RC8A 4EZEA 3FOZA 3IVRA 4U4AA 5KI6A 4QOHA 4GOND 4N39A 3GJ0A 1EWVA 3FNGA 1JTFA 1U2QA 3FFAA 1MOQA 1UPTA 4KLRA 1XLWA 5TPWB 4DPMA 5DYNA 1H1DA 3D7KA 3FPSA 3DDUA 1I7NA 2HYIC 1C4KA 4EJSB 1NHGA 4UDYX 4F5WA 5TEWA 4GPBA 1SPBS 1XTSA 4C30A 2N47A 4TSFD 2X15A 2XB8A 5ALPA 4HWRA 2D2IA 3D4PA 2GX6A 1TUBA 2D2VA 3P2YA 3EDOA 5L3QA 2Q2WA 1E3QA 1A5AB 1TMKA 2AKYA 3QHQA 4KXUA 7GPBA 2G06A 4UULA 1NM5C 4OMCA 4AP9A 3ZCUA 1VYHA 4RPGA 3ZCRA 5H9WA 4N8DA 5IZCC 4KR2A 1T5TA 2RHOA 2WIKA 3FNHA 1F60A 3JVVA 3BRSA 4QXMA 2P5SA 2ZETA 3T35A 4URFA 4KLZA 4H0NA 4M49A 1WTAA 3ABRB 4RH0A 4Z2YA 3U3OA 2FPUA 3D1JA 4HLUC 2VJNA 3TLMA 1N5RA 2HC9A 5TMPA 3L79A 8ABPA 4IVNA 3OTGA 2FW0A 2OXFA 4M8NE 4BASA 1R7RA 4XCXA 1NOIA 2C58A 3QA3E 5EKSA 2JAUA 4E32A 4TMTA 4WOBA 2NV2B 3ZIAA 1L7AA 1JV2B 2FJUA 3N8NA 5EMNA 5M3BA 1WF3A 3CX6A 1VRVA 5AW9A 3NHFA 5FBKA 3S99A 3MUNA 5B53A 4D9HA 5K4HA 1DEHA 4RD1A 3TI7A 3FTEA 3TECE 1EWKA 4E1VA 3L0IB 3PHBE 3FSGA 4KQXA 5E2BA 3V46A 3A1NA 1ORDA 2BJVA 4C5AA 1EDZA 5LFAA 1W93A 2QAIA 4L7QA 4KDRA 5FA6A 4UBOA 3DV9A 4CTJA 1TKAA 4WXRA 1NBAA 2B20A 2Q4DA 4Q1VA 3TLKA 3D0QA 1CZOA 4HNSA 4IGFA 2GZAA 5EXXA 2I80A 4KH1A 1FB5A 1XD2B 1U6JA 2VHCA 1PFGA 2D13A 3FNFA 3IVGA 2QVCA 4HXGA 4M22A 4X20B 4Y1EA 4KQFA 1MO6A 1DEKA 5EN4A 4BNLA 1ZNQO 2EU8A 2UKDA 3C3KA 3CVVA 1SMKA 4ENSA 5GVRA 3NBMA 5FPQA 4MI1A 1B16A 1RM3A 3NBUA 1F51E 1KS2A 5FL7A 1B2RA 1JW9B 3ZXSA 1RR6A 2Q5FA 4HFMA 4ZVQA 3TX2A 5BOSA 4IMIB 4IZ6A 1JSRA 1WF6A 4F8JA 4MEAA 3U7IA 3RAFC 4R8RA 4LI3X 5K51A 3I0MA 4AX8A 3K92A 1MT0A 2DQ4A 3G2LA 4ZCTA 3DBRB 5J9FA 5JTUA 4URUR 3H7IA 1UXKA 3DULA 1ZGJA 2DHCA 3OFJA 5IXSA 1B74A 1EWTA 2AOUA 2FEOA 5IANA 1V9LA 3ZTTA 5JAQA 4B1FA 1TVKA 1E32A 4F7WA 3PC3A 2QRHA 2AK3A 4CWAA 2P9GA 3OKAA 4AMGA 1B8VA 1ETHA 4ZT5A 1J22A 4YAGA 4PRLA 4RY2A 3L8YA 3PEEA 3E6AA 2WVAA 3WMEA 1YS7A 4RTPA 2V0NA 1L5QA 3AVOA 3IUBA 4XDGA 5HSGA 2OB1A 3LO8A 4YRIA 2AR0A 3OHMA 3GGGA 1EXMA 3OAAD 3UAXA 3FDJA 13PKA 5ISMA 4FJ1A 3CW9A 2K6GA 421PA 1ZSYA 3C1UA 3H4IA 1C1DA 4P4TA 4AP5A 4B46A 2DOKA 5JD4A 4UXIA 1B6TA 4JOSA 4ZK2A 3FCXA 4LJKA 3O3MB 4HUQB 2ZYHA 2OV1A 2FSUA 4D9KA 1ZD8A 2Z0MA 4QFMA 4B4UA 1DBQA 4DMFA 1A88A 1YKGA 3NHYA 3U4QB 3IDAA 2IEIA 1JZSA 4KPYA 5EIBD 4B4KA 2VL7A 3N05A 1Q0TA 4H3VA 4ZGWA 3KS9A 1KQGA 4KAFA 4FFSA 1ORTA 2JKYA 4RJIA 3ZX4A 3H3FA 5EIHA 3BF8A 3K0HA 4KBGA 4ZCMA 3KB6A 1GGJA 4FOOA 1W75A 1TRKA 1Z2EA 3AEXA 4Z9FA 5C5IA 3BD6A