2BSXA

Crystal structure of the plasmodium falciparum purine nucleoside phosphorylase complexed with inosine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
241
Chain Sequence
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDELVPHQLENMIKIALGACAKLATKYALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Structures of Plasmodium Falciparum Purine Nucleoside Phosphorylase Complexed with Sulfate and its Natural Substrate Inosine
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 70
structure length 241
sequence length 247
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bsxA00
3UAZA 4NS1A 2PGAA 4EB8A 4H1TA 3ENZA 1Y1TA 3FNQA 1ULBA 5B7NA 1YRYE 1RXSA 3C74A 5I3CA 3MMSA 4L6IA 5EUBA 4F3CA 1VHJA 3DP9A 3OCCA 1OTYA 4MCIA 3O6VA 4U2KA 4TS9A 2ISCA 2QSUA 5IU6A 3BL6A 2OC9A 1OUMA 3TL6A 1NW4A 3E0QA 1V48A 1TD1A 2HSWA 1Z33A 3LGSA 1Y6QA 3INYA 4LZWA 1ODJA 1PK9A 1ZL2A 1TCVA 1Y1RA 4F2WA 1ECPA 4R2XA 3IOMA 5CYFA 1TCUA 4L5CA 1U1GA 4PNPA 2H8GA 3DDOA 1V4NA 3PHBE 1JPVA 2OECA 4QAQA 4GMHA 5CCEA 1PKEA 4DAOA 1RXUA 4TTAA 1PWYE 4QEZA 4L5YA 4QFBA 4OJTA 5CCDA 3UAYA 3EUFA 1Z5OA 4M1EA 1U1EA 3OF3A 1RSZA 4UC0A 2RJ3A 3KUKA 1N3IA 2A0YA 1PR2A 4BMYA 1VFNA 4RJ2A 4BMXA 4TYMA 4ECEA 3PHCA 4YNBA 4G8JA 1ULAA 1PF7E 1RXYA 1A9OA 3IEXA 1Q1GA 1OU4A 1VHWA 1I80A 1PR4A 1T8RA 3BGSA 1PR0A 3UAWA 2I8AA 4FFSA 1RYZA 3KVRA 2B94A 2HN9A 4MARA 2Q7OE 1Z37A 1LX7A 3ONVA 1A9QA 4TTIA 1U1FA 5B7GA 2A8YA 1T0UA 4M7WA 1RXCA 1YBFA 4LDNA 2GUWA 1JDVA 3EUEA 4QATA 1M73E 1U1DA 4G41A 1LVUA 5IFKA 1T8SA 3NM6B 3T94A 1FXUA 4JOSA 1JDUA 2A0WA 4DARA 4F2PA 4D9HA 1V41E 1C3XA 1V45E 4DANA 4F1WA 1LV8A 2OC4A 5F78A 4TXHA 3GGSA 4QASA 1K9SA 3D1VA 4WKBA 3OZDA 4PR3A 3PNSA 2AI1A 4JWTA 1TGYA 1JP7A 3NBQA 4YMLA 1CB0A 3KU4A 4QARA 3E9RA 1ZOSA 3O4VA 3K8OE 5F7JA 1Z5NA 1JDTA 4GLJA 1SQ6A 4F3KA 3DF9A 1NC1A 2P4SA 4MCHA 2I4TA 5F76A 1JE1A 1QE5A 4R31A 4R2WA 4JP5A 2QTTA 5F73A 4OGKA 4IP0A 5JPCA 3MB8A 3GB9A 5EPUA 3P0FA 1NC3A 4X24A 1SD2A 5F7OA 4TXMA 2OXFA 4GKAA 1T8YA 1XE3A 4OY3A 4DA7A 1RT9A 2AI3A 4DABA 1U1CA 1JDSA 1TGVA 1Y1QA 3OOHA 5F77A 1PR5A 4NSNA 5F7XA 4WKOA 4LKRA 3FWPA 1A9SA 3U40A 4D8YA 1SD1A 1T8WA 1B8NA 4TXNA 3EMVA 3EEIA 1K3FA 1A9RA 1PW7A 3UAVA 1B8OA 1ODKA 1PK7A 1VMKA 1A69A 1OVGA 3FAZA 4KN5A 4TXLA 3DJFA 2A0XA 5KB3A 4D8VA 3OZBA 1OTXA 1V2HE 3ODGA 4M3NA 4LNAA 4D98A 3OZEA 2IQ5A 3FUCA 3DPSA 4BMZA 1Z39A 3OOEA 3FB1A 4WKPA 2QPLA 1ODLA 4D8XA 1Z35A 5F7ZA 3F8WA 1Z38A 5DK6A 5CXQA 1Z5PA 5K1ZA 4G89A 4P54A 2XRFA 4BN0A 1V3QE 3OZCA 4DAEA 1JDZA 5CYGA 4OF4A 4TXJA 4TS3A 5C80A 5FAKA 3NM4A 5CXSA 3FOWA 1RFGE 1SJ9A 2HRDA 3UT6A 3KHSA 1RR6A 4LNHA 4GLFA 3OPVA 1A9TA 2BSXA 4YJKA 4WKCA 1K27A 3UAXA 3PNPA 4TTJA 2HWUA 4NY1A 2QTGA 5EFOA 5B7QA 4L5AA 4OEHA 1JE0A 3P0EA 4EARA 1JYSA 4DA8A 5B7PA 3KVYA 4WKNA 1OV6A 1WTAA 3LA8A 4I2VA 4DA0A 3LBAA 5ETJA 1PR1A 4DA6A 3SCZA 1PR6A 1RCTE 1G2OA 1Z34A 4OGLA 4E1VA 1YQUA 4L0MA 1YR3A 2AI2A 2ON6A 3KVVA 1PBNA 1ODIA 1CG6A 1YQQA 3BSFA 1Y6RA 2AC7A 1A9PA 1Y1SA 2QDKA 3E9ZA 3QPBA 1Z36A 3NM5A 4YO8A 3K8QA 3BJEA 4K6OA
chains in the Genus database with same CATH superfamily
1BH6A 5I01A 4DV7B 1N2BA 3MGAA 4M7PA 3UEOA 4LE1A 2Q0QA 3F98A 1FDTA 2FEAA 4IXTA 3VU0A 2PKEA 3E82A 4TL6A 1CERA 2QR3A 1ZWKA 3K9BA 3ENZA 3TCXB 1YRQA 4OFBA 3FNQA 3W5BA 1MCZA 3R3SA 4M0CA 4OV6B 4P2GA 1XLTC 3K09C 3UV6A 2XMDA 4G1CA 4C7MA 1D8AA 1K6MA 4J16A 4LNUA 5G4KB 1LQTA 5FH9A 2Y0EA 3GNQA 3N70A 2J31A 1AQYA 2DECA 1T1GA 1TYEB 4A2PA 4R9NA 3A37A 1ND5A 1CY6A 2BE7A 2XUOA 3LYHA 3U09A 4ZCTA 1R7RA 1ZN7A 2PWPA 2QSUA 3V7YA 2NP6A 1KY3A 4ZDWA 1CQPA 4EHJA 4MQ4A 3DDUA 3HABA 3P71T 2HAEA 4M0FA 5DVZA 1T6XA 1EK2A 2Y0DA 4Y2TA 1NRIA 4PZ9A 5J5AA 4BJ1A 3LAWA 3FI9A 2Z8XA 4W5JA 4HQRA 2XMPA 1P4AA 2Q1XA 3KE9A 4QDOA 5CM8B 5BVGB 4H16A 1GV0A 3S8EA 2X7JA 2EQBA 4UZEA 3QBTA 1DFGA 4D3SA 4EGJA 1XNRB 1Z6TA 1W94A 1WXWA 2I6TA 4IMIB 4ZVTA 1C81A 3MMXA 3PQ5A 1CZRA 1T9DA 2XGOA 3AZQA 1PDOA 1V6CA 3IUSA 3QVXA 4BECA 1IY1A 2D4AA 4NMLA 2XZTA 4BE7B 1V8BA 4E11A 4D2IA 3VC3A 3MINA 3INYA 4X7PA 2PGLA 4XQ0A 5BSUA 3RUHA 9ATCA 2QVZX 1A77A 2UXBB 2EERA 1RAHA 1I0IA 2FEMA 3IRUA 3M9LA 3NAMA 4X1OA 3BE4A 2V0GA 4L9RA 4DQUA 1Q17A 4P22A 4K28A 3VNAA 1U9JA 1UFVA 2P2DA 2E82A 4F2DA 1ZJJA 4FKMA 1ECPA 4EUHA 2WWGA 3LX5A 1YU6A 2VJAA 10MHA 4E88A 3AUUA 1KBQA 4W5WA 2V4UA 5JEDA 4GZ3A 5ILOA 1RM4A 2QXTA 2HCFA 2W6MA 3C24A 3I4FA 4L5CA 2WIJA 3P5SA 1TVEA 1AZTA 4Q1FA 4MZDA 5CW2A 3B6ZA 3E2IA 2B4RO 2IIPA 3HUUA 3PXBA 1K5GA 1XLWA 2VJCA 2GT1A 4NV0A 4QFCA 4QM6A 3GEEA 1DAGA 4GMHA 4TV9B 4O2BB 2VIIA 2EHDA 3VPFA 1XTSA 1J9GA 4CTNA 3C6QA 2BKEA 3OECA 3D3QA 2PJRA 1X19A 2PX3A 2JCXA 3U2QA 2O05A 2ID4A 5AVXA 2RBGA 4NMMA 1DPGA 2VT7A 3M49A 4M2LA 3UB3A 5KDDA 3PQFA 3QOWA 3EEFA 4S12A 1ZH6A 2G1AA 3G9UA 3OO1A 1PBTA 1T1EA 4GI2A 3VV3A 3WGNA 3VSBA 1JR4A 3D5TA 3UHFA 4AVYA 3LF2A 2WVGA 1RBMA 4ZMBA 3T12A 4AYTA 1PYOA 1NYLA 2MT9A 4ZRDA 3Q72A 4M37A 4I1OA 5KYGA 4PYMA 5GOZA 2YZ7A 2CL0X 4LVCA 3ELWA 2SKCA 4CQLB 4S05A 3MHTA 1JX6A 3CB4A 4UC0A 4RAQA 3N2GB 1ZS9A 3WLPA 5L51A 3EFEA 3ZK9A 2NMVA 3K0KA 3LTEA 5F5XA 3WL3A 1ZD9A 3O9ZA 4BEVA 1O58A 2REOA 3ESXA 1RWWA 1JDPA 3T3IA 3NVKI 4R2IA 3AOGA 3IBYA 3T06B 4BIIA 1ZVMA 5FJJA 4C5CA 4BAZA 2ZBGA 2HPHA 3VBEA 5DWQA 3FCXA 5CXUA 1KMHB 1NPTO 2PXAA 2ZSHA 2F1HA 3GRCA 4M98A 1AIPA 3RBZA 3R75A 3FNHA 1T3TA 5ALHA 1GRCA 2R1VA 5IRCD 1NQXA 4B3RB 4X1KA 1UM8A 3WL7A 2RONA 3GLVA 2H7VA 2IPXA 1UPAA 2O2ZA 2XA1A 4QPZA 1Y1LA 2ZWOA 5B3AA 2I1LA 2WTEA 2PGOA 1EA5A 3KPVA 3QTBA 3LUPA 2HA7A 4PFJA 3WLHA 4BO8A 1T8RA 1RMYA 3DEHA 3EDMA 1BE0A 2IW3A 3BGSA 3O7MA 3SKXA 2Z6QA 4PPGA 3ROXA 1Y4AE 2H31A 1SHUX 2PSHA 4EO7A 4FFSA 2JGMA 2DC1A 2ZYIA 4QG7A 4DIDA 4Q9NA 2XB6A 2IPOA 3QFCA 1G98A 2QK4A 3EG5A 4FFLA 3IUNA 3RRFA 5KSOA 4IH1A 1YRLA 5IH3A 3L7MA 1TZ2A 1JF8A 1MO2A 2ZUBA 3HNOA 5NULA 1N4AA 1WHSA 3LECA 3CG4A 3QJYA 4Q82A 3SFTA 1E5XA 2MJLA 2NO9A 4DW8A 1IJBA 3EGXA 4FLFA 4IUDS 3O83A 4D0SA 5FA8A 4BCDA 2IYUA 3OQVA 4PLHA 1YUBA 1NXTA 3EXHA 3AUAA 3BCSA 1YBFA 1EZZA 2E85A 2UAGA 2GLXA 4GNKA 3VKFA 3EUEA 5FWYB 2YYYA 3GFOA 5IARA 3ZWMA 3K4HA 2CMHA 2R7MA 3G1WA 1S9DA 1RCFA 1YC2A 3C7KA 3FHCB 3S68A 2XMGA 2XV1A 4KDFA 4MKGA 2HMSA 5SV2A 1KDVA 1KC1A 4G0WA 1B74A 3CH6A 4R1MA 1AB6A 1Z0SA 1YO6A 5EHQA 5JCXA 2AD1A 2X19A 4F92B 2Q3EA 4B9EA 3E3MA 2IE8A 4IJUA 1C3XA 4O4JA 3GNTA 2FRXA 4UUOA 2FN9A 3PQDA 2B7LA 3JQ8B 5DOVA 1JB9A 3Q88A 2C9DA 2QBYA 3QEMA 4D3YA 1GRNA 1BIFA 5EXDA 2AFVA 1C0EA 3OMLA 2GEDA 2JRCA 2IRWA 1L5RA 3OWXA 3WICA 2XT6A 2HA2A 3IUBA 4MUJA 2H1VA 4RHEA 3R3JA 3TAUA 3ETLA 4JKYA 2HW8A 5EA2A 3R20A 4XAQA 5B2EA 1MJFA 5DPMA 5JWHA 2ZB4A 3SZ3A 2PX4A 1PT8A 5L7WA 4N8EA 3KB1A 1GD1O 5BOVA 1QTQA 4MH0R 2DWOA 4CMAA 3PHIA 1NIJA 1YMVA 1E4OA 1Z18A 4IQ4A 3RV4A 3RTCA 5ARCA 4YJ3A 2IU3A 3F9IA 1UMBA 1EMDA 3UMYA 4DEXA 3LGXA 4GOXA 1P45A 2HLNA 3JALA 1R3DA 3JR3A 4YFYA 3TJRA 5LP6F 4BPBA 3PX7A 1A50B 2CD9A 3GJTA 1GLGA 4UQLA 1V3UA 1UJCA 2F4NA 2DKNA 2VDRB 4LK3A 2AXQA 3LHIA 4HNQA 5TEWA 1BE8A 3KQNA 4QKQA 1GEGA 4J3NA 5E4YA 2PS1A 2NXNA 3KX2A 4M88A 2GN9A 1IZYA 1SC9A 4TS1A 13PKA 1LF0A 3U62A 2F55A 1C9JA 1XCGB 1ULUA 2ID8A 3CGGA 3IQEA 5GONF 3DG9A 4GPZA 1VMAA 3T7TA 4RA9A 5BQOA 2FP4B 4R1OA 5L40A 3PHJA 2NU9A 3JAWA 1K5HA 4LC1A 1UANA 3MB8A 1H69A 5CPFA 1YVPA 2NZ2A 4YXWA 1I01A 1FRVA 2RKWA 2CVZA 2NSJA 3E7PA 4XQEA 5E7IA 3ZLVA 5JYDA 2PLWA 4C6SA 3QBDA 5DCLA 2WDZA 4BGEA 3T0IA 2BISA 2ZRDA 4EQ6A 3CEAA 3D02A 5C80A 1Z6PA 4U39A 1FRQA 4X95A 1MX3A 2OILA 2CEAA 4U2DA 3U60B 1GGKA 1U7OA 3BD6A 2BKVA 1RBQA 1UKEA 2DRIA 3FF4A 5EXTA 2O7NA 4DZRA 5G02A 3RS7A 1NN5A 4F6RA 3T38A 3HN2A 3QIAA 1Y1QA 4M0LA 5BUQA 2XBMA 2XB2A 4L3VA 4MV1A 1UKBA 3LSTA 4A8JC 4MMXB 4Q7KA 3SLRA 3PPIA 5BV0A 4UHHA 1G6Q1 3CLRC 3QE4A 1DZIA 1MLDA 2OD7A 3UOGA 2IC5A 1ZSVA 2AV6A 4ND1A 2O8CB 4AIIA 3DAFA 1SC6A 5CD9A 1VP3A 1JKIA 3KQHA 1H5NA 5BNTA 2O1EA 2CDBA 4A23A 3V8QA 1W75A 2EW1A 1HF3A 2WTNA 4E5NA 4EL5A 1SD1A 3AESB 3I04A 3FWYA 4CLRB 4OVKA 3O8QA 3MHPA 1Y3CE 2ERYA 4ZXFA 4O2AF 4KODA 4ERXA 2Q8PA 4IIBA 3T3HA 3VR2D 3K5IA 1B93A 3KEMA 1QFJA 4EJFA 2VHZA 2GAJA 1V7PC 3E5MA 1QYDA 3C3WA 2ZAOA 3D4IA 3PEEA 1K4MA 2O4CA 1D3AA 3BS4A 3MJDA 3ND5A 3OCZA 4OI2A 3AVXA 1K3FA 1I4DD 2BN4A 1PQYA 1DXQA 2V7WA 3CX6A 4LWOA 5JYEA 4MTCA 1L7AA 3D0OA 1V9SA 1K5PA 5CRIA 3WXMA 1UIMA 4XGKA 5KAPA 5SICE 3AKYA 4OYLA 2W70A 2B21A 3KFXA 2CK3A 4F5ZA 1HNXB 5ES4B 3Q1KA 3LPLA 2AMFA 1A9XA 1NVXQ 1DRVA 1OZAA 4F9TA 3FMPB 1WCV1 2JHCA 2D0PB 2H4ZA 2RMKA 2HRBA 1V5WA 2PD6A 2OXEA 3DJFA 4OFWA 4YONB 4JIGA 4E2ZA 3HZOA 1CF4A 4V0KA 5T3UA 4AKHA 2FRVA 1BN6A 5BW6B 3OZWA 2QLFA 1R6VA 4R3UC 4S2UA 3AVOA 5GMOA 4M3NA 2C84A 2RG7A 4G5HA 3C97A 1OBVA 1KEPA 3SZUA 1GGHA 1RRFA 2EDAA 3KAKA 3FOBA 4CIWA 1G8FA 3D7KA 1UXIA 4KK4A 2HDHA 3VX4A 2KW5A 4F4HA 4RETA 1H0SA 3H97A 4MUEA 4Q7MB 1PFWA 4JI2B 1W36B 1CYEA 1Z39A 1K7YA 4JQYA 2I7XA 3COPA 2ZYUX 3WV5A 4AC9A 3TJZA 4I1VA 4K1LA 1QFYA 2ZJZA 4QICA 4GF5A 4B74A 4MQLA 1ZBDA 1KAQA 2YJTD 3I1JA 2PLFA 4ZQBA 4REQA 3BMCA 5FWDA 1R0YA 1TK9A 1YHZA 4ENQA 1LLCA 3K72B 1E5LA 4NJEB 2G1UA 4U2BA 2YL2A 1QWSA 4JI7B 2HEGA 3VZSA 2VWGA 3I8XA 2PO5A 2IZ6A 3DVSX 2JIDA 4PR0A 3QSGA 1GSAA 4DUGA 1WMEA 1GQSA 3GRZA 2P2NA 4GE0A 1U99A 2NV0A 1RP7A 4DV5B 3U3JA 4B46A 1NULA 3L07A 1E5TA 3UV3A 1LPMA 3Q7TA 4HNRA 3VNQA 4C0LA 3RVPA 1VG0B 1PVDA 2NZVG 3OKPA 1TOAA 1UFOA 3FYSA 5EWMB 5BN4B 2ZBEA 3IA7A 1ITZA 3CRQA 4XVUA 3IEKA 1ZRHA 2D1YA 4FYVA 1KI6B 1SBZA 1DTSA 3C45A 1N5MA 3COWA 4RMHA 3TX2A 1N9GA 4Y2GA 1KYVA 4K9NA 4UUMA 2J0EA 2H85A 4PIPA 4BQEA 2ZKIA 4IIYA 2FG6C 3VGJA 1PJSA 4OHPA 1V11A 3DHEA 4ZODA 1NL3A 3M4XA 1UM9B 2HJGA 1WCXA 2XNHA 3AF1A 4HNGA 3O38A 3ZQ6A 3CKLA 3ZU2A 4C43A 4XUCA 4DBLC 1VYTA 1KH2A 2BH9A 4HSGA 4PBSA 4ENWA 5EQTA 4RL6A 3EIHA 3RNLA 3PNBA 4Z1OA 3MJEA 4R2HA 4O4HB 3RU7A 4BNTA 3LP6A 1QRRA 4M0PA 1IQRA 1T35A 2NU8A 4G0OA 2BELA 1RR6A 4GMKA 4Q3LA 4B6QA 4DJAA 2P5YA 4FW8A 3TI9A 4KLCA 3WLEA 4W5OA 3Q8KA 3RWBA 3W9UA 2QT1A 4BVBA 2BM9A 2AFHB 2LD4A 3PR2B 4DLLA 4OB8A 4Q03A 4ZK6A 5JZOA 4IY1A 2XIJA 4N82A 4IRXA 3X3HA 4R71A 1KPIA 3L41A 3WLMA 2XB4A 1FNMA 1BJTA 1H8EA 1E2DA 2AQKA 4L5AA 3OX4A 4XGRA 3V97A 2C0QA 4UAVA 3SOPA 1WL8A 5C8YF 2WSSA 2QF7A 1D2NA 1JE0A 1YDHA 3IDOA 1VIMA 4QAJA 1QQBA 1NHGA 2ZQZA 3ADOA 4M9ZA 5CCXA 3VDRA 2FU5C 3BMNA 3QMMA 1Q7BA 4FDLA 5EG5A 5BMVB 2QROA 4KXLA 2VUHB 2X6RA 1TA4A 2W2KB 1IYZA 1J2JA 1KI1A 2Y1EA 1KQ3A 3GJ8A 1P1KA 3JQ9C 4MCAA 4QBFA 3M6IA 4A1OA 4IDAA 4BV2A 4OYYA 3WMRA 3WL4A 2RG1A 4CNQA 4A4DA 4GX5A 1EBFA 1OR8A 1TL7C 1NUPA 2VXCA 1NN1A 1HL7A 2VDQB 3CRMA 3ISVA 3L6BA 2HA4A 1ZMOA 4HPWA 3V42A 1KDRA 5AXDA 4ES6A 5ERYA 4H1HA 1VPVA 1XAHA 1S2GA 2I7CA 4EOGA 1UXOA 4BO1A 3BWXA 3PE4A 4NHEA 2HYIC 3EXEB 3FLAA 3H4MA 3ZG6A 2UUOA 3OH8A 2HHHB 4LX8A 2PBZA 3MGKA 2J0SA 2AXNA 4MUMA 4AX8A 1SKBA 5FX2A 1NFRA 5JPIA 4TL8A 4FFNA 3BSFA 4BNYA 1U5CA 3KOOA 1S7GA 3DZDA 4ITRC 2AL7A 4TKZA 4BVJA 2Q21A 3RHSA 5C5CA 4F6LA 4AM8A 4ETWA 4C3VA 4DRZA 3S8MA 4M1TA 2PAFA 2JIMA 4P0QB 1HETA 2JLCA 1OI7A 3KV1A 1XMPA 2W83A 4TPKA 4DIMA 1EK1A 2NO6A 1UUFA 4FOLA 1KAEA 2ZSBA 4YRIA 2ZLBA 4CM6A 3GL9A 3CVJA 2GNAA 4R40A 4YMGA 4LF9B 4ER5A 1R10A 3PDUA 4I9UA 4P5DA 3PGMA 2QUAA 4R7GA 1XMQB 1CZLA 4ZQHA 3O4IA 1JWAB 2FMKA 3DEIA 4WJKB 3CRW1 2X77A 4DKJA 3SZOA 2AZXA 3MRVA 5MFPA 3WO0A 3KKPA 2R1UA 1U2SA 3ELDA 4H7EA 3S29A 5KNCA 1QKKA 1T36A 2DSNA 3JTMA 4OQXA 1QMGA 4PLWA 1ZBQA 1ES9A 4RJLA 4EI7A 3K6RA 1X80A 3LE8A 4X8MA 2IUYA 4KI0A 3PPXA 1BS9A 2J5KA 2VPIA 2AVNA 1DAOA 1JEJA 2PZGA 1NXXA 1B73A 2R8EA 1EUQA 3K1ZA 1LU9A 3OWHA 1GRRA 3NHYA 3P2MA 1JR2A 3UJ6A 3N8IA 1QFMA 1DIBA 1L4HA 3T6KA 5AW8A 2XI4A 4NK4A 4QNMA 1ZKMA 3QG5A 4QYSA 3VAZA 3VM6A 2HDNB 3BL6A 1G4AE 3NTQA 1PL0A 3FAKA 2BR5A 1IHOA 1FF9A 1DUIA 3K1YA 5TQVA 1NXWA 1K98A 3D6FA 3IB6A 4YXFA 1NNI1 5AIBA 4OTZA 5KVSA 1P7YA 3NLLA 1YB6A 5B12A 3I2IA 4F8YA 3CF4G 1QH9A 1T3LA 4AJ2A 2FUCA 2H11A 5IDQA 4Z51A 4LRUA 2DHRA 2IPNA 1V47A 3COYA 1Z6YA 3H2BA 3CN9A 1OH5A 4O6VA 3IKMB 1I2BA 3B53X 3P9IA 4XB2A 3QWBA 1I2DA 4U2FA 3P2OA 5EC8A 1TT5B 3IUYA 4Q01A 1Q3TA 2P1DA 5BN5B 2ZE7A 5KHOC 1SM4A 1C9MA 2QTFA 4NPHA 4Y2QA 4Q6WA 5CDGA 1E7WA 2AGVA 4I5EA 4MV4A 5BURA 1E2NA 4FC6A 3ADBA 4WK6A 1FTWA 2QRLA 2WU1A 2W71A 3K09A 4C5BA 4O3MA 1OXSC 3R77A 1NUHA 1ZL2A 2C9BA 4N40A 3KJXA 5EXSA 4BEJA 1Z4KA 4TLAA 1OX4B 3BK7A 3FTQA 1RP1A 2C58A 2H1HA 2ZR9A 3GPCA 3WJ1A 1CEQA 3MS2A 2EJUA 3S27A 1QPBA 1YWGO 3T9CA 5K20A 1B6RA 1SXIA 1FVOA 3A2KA 1O4WA 1KI8A 2H8GA 5H16A 1U1IA 2CCJA 4ZQGA 3WFJA 1KSJA 5LWQA 5IJ0B 1SNYA 4AJNA 5DNUA 2KQUA 4G25A 4ENUA 6YASA 2QL7A 1GU0A 3F1LA 4FXOA 5KTSA 1STOA 5CBPA 1ONNA 1N5LA 2JNWA 4XVHA 3V9AA 4YAGA 2L42A 2NTVA 5GM2A 4AURA 2PUJA 3EPJA 3BQMB 2NO5A 4UE3S 5KHAA 2FR0A 4CDGA 2GBLC 5DNAA 4DV4B 3BHMA 4WADA 1XQ9A 1NJGA 4TVOA 3W5DA 4JLOA 2WZCA 3IDQA 2GD1O 2Y2UA 1U0JA 3B5EA 4K9OA 2A6PA 3AY7A 4ITUA 3USES 1Y8QB 3VU9B 3H11A 5CHYA 4X44A 3HXQA 2RGWA 5FBZA 1PGJA 2QJTA 1H94A 3HCRA 1SXJA 1XC7A 1JVSA 2VWHA 1B23P 2JCSA 2VA8A 2D62A 3MD0A 3TIXB 1DADA 1U2ZA 5FBRB 3ZV6A 3EVZA 5C52B 2M9MA 3E7XA 4FNOA 1JI0A 1LC0A 3UOAB 2QHXA 5AW6A 1LPSA 4J75A 2QMHA 4ODIA 3DWEX 4RD0A 3L8FA 3SHVA 1E3WA 5ESWA 5KJCA 3LW7A 4MRAA 5CBKA 6REQA 5LYYA 2I34A 1OYOA 2W2TA 5FRDA 3RBVA 4CXMA 2N47A 4OA8A 1VKNA 2FLKA 1Z4QA 3P19A 1PDWA 1RACA 1GSIA 3BX1A 3OJXA 3RK0A 3WOHA 1P2GA 4A2CA 1EWQA 3PHCA 4GX2A 3NDJA 2I29A 1ULAA 1PF7E 1OLOA 4U2CA 2JHAA 3K8YA 2O7SA 3CPHA 5B2ZA 1P7PA 5KTNA 5JSZA 3UWPA 1NQ5A 1N7JA 2QLMA 3FDXA 2FSHA 2QDXA 2X8BA 1VECA 1O94C 2A67A 3ZDQA 4LXGA 4Q9HA 3U3ZA 1LBSA 3DTTA 2K7FA 3RAGA 3FSJX 5EMNA 2CY0A 3CA8A 2WFLB 3I2KA 4INPA 2B94A 1US8B 4O02B 4ANFA 4LY6A 4DG8A 4WD3A 2EX1A 2W6JD 2DX7A 4RKFA 3HM2A 3GGDA 1R9MA 1SG6A 1HEIA 1RLJA 4KXUA 1UJ5A 2BGTA 3T5BA 2PZ8A 3PRKE 4OMUA 2ZFUA 4KH0A 1QLHA 8ADHA 1TVMA 3GLHB 3KKKA 4K5QA 4LZLA 4O4IF 1XRQA 3DS8A 4HPXB 1KQFA 1DC7A 2B5VA 4PZLA 1PL7A 3ZBUA 1FU8A 4OBWA 5EKTA 5ADVA 1UDWA 1RVDA 1XCMA 1YZQA 3L0ZA 4MI3A 5BWCA 5AVRA 2CHFA 4G2TA 1NSYA 1GPJA 1T2EA 4ZRMA 2ZT8A 3ZE7A 1P39A 4HMQA 3M0EA 3I2YX 1OYWA 4L4YA 4PXYA 4YCCA 5JROA 5M2QA 5DM70 4U2EA 2O2JA 3A4IA 1ZCFA 1C8LA 3FETA 3OCUA 5HKOA 1FQOA 1BCSB 1NZFA 2HSJA 2WVJA 4TLDA 5C3UA 1BW9B 2PN1A 3ZGLA 2R7LA 3M5CA 3GLFE 2D0IA 3ZOKA 2PAAA 4ABTA 2QVLA 3NAZA 1DAIA 1IBSA 3ABQB 4LRYA 1NOIA 3R5KA 1U5AA 4JYZA 2RHRA 5JMTA 4WOKA 2PWZA 3DM9B 1P5ZB 3KZOA 1ZNYA 1UBNA 4KQEA 3TG2A 2QIPA 2RHJA 2WV9A 3TN7A 5LL6P 4NKRA 4D4KA 1B3BA 2YXBA 4POOA 1T9GS 3N5CA 1L7PA 3V00A 2COUA 1W52X 1PWHA 1W1IA 1C1DA 2HT6A 5E4TA 3EZ9A 4LF4B 1YA4A 5ALTA 1GAEO 4INAA 3V4ZA 1E7MA 4JS0A 4WXRA 1XXHB 2LCQA 2P3QA 3O4VA 1WR8A 3NOXA 4JODA 1JFLA 5HWSA 2MDTA 3CO5A 3DE4X 4X1IA 3GU3A 4LDAA 4R8RA 3H83A 3UHPA 2IEZA 2C1ZA 4O08A 1UM9A 3SHQA 1N0WA 4MCHA 1J0CA 1M9NA 1M66A 1KDPA 1X8KA 1XXLA 2JFQA 2GM4A 1UP7A 3OEED 8ABPA 4HGZA 1XVVA 3O8CA 3O3OB 1TK3A 2V65A 4QU9A 4DDWA 3N7UA 1M6WA 2KS6A 4QPJC 3GX1A 3PIDA 3QVOA 3BBLA 3CX3A 4G8BA 2UVQA 3TWOA 2BCJQ 3BERA 3MMPA 4JI6B 4JGIA 2QTTA 2AFHA 2Y05A 3PD0A 2PX8A 1TJ3A 3QLUC 3QXJA 1XNGA 1N6NA 1N34B 1LLUA 3K9CA 5CCBA 4WCFB 4EW3A 1YAHA 3FUWA 2HPAA 4IUYA 2HI0A 1P33A 4DDHA 1MKYA 1ONSA 4EFMA 3VC2A 2GA8A 2KX7A 5K0ZA 1GARA 3BH7A 3VOSA 3ZH9B 1R37A 4G6ZA 5JJ5A 4I1PA 4D4GA 3BWMA 3SVTA 2GD2A 3DFMA 4JP2A 2GJKA 3S6JA 2ANCA 2GPBA 1BNCA 3KKEA 4I6JA 3QZUA 4B3TB 4OD0A 1GFIA 1PQWA 1FSPA 4GSLA 5DU2A 1AQIA 2BMFA 4NHOA 5M7EA 1XD2A 4CL0A 3UG7A 1EB9A 4C7JA 3C15C 3OOHA 2BDUA 4MVYA 4GM1A 3UGQA 1XRNA 4ZCSA 4E7OA 5DLDA 4D9JA 2CKMA 4D3ZA 5KOJA 1CB7A 3AGPA 5EHZA 1QHHA 4ZQEA 2O0MA 3FCEA 3OF5A 3GY0A 1P0IA 4NBUA 3UMGA 2O0KA 4HFNA 3H2KA 3PWKA 4JLJA 4DRXB 2HK9A 4BKUA 4Q47A 5FLXA 3BCHA 1TEVA 4GC5A 1CQIB 1GN8A 3LFHA 4W8OA 3MRSA 4D8YA 2WQZA 1QIHA 2YJ6A 5I7WA 4UATA 1FP2A 2CHVA 1GTMA 1B26A 1JWBB 1FIUA 1WX1A 4D6PA 1IIBA 2IHTA 4EHIA 3A4NA 5CFPA 2DFKB 1KI3A 3D31A 4L8LA 2FX5A 5F3WB 4MP6A 2MSDB 4GOKA 2WQ7A 4HI0E 4M55A 3F78A 1RAAA 1MX5A 4MW0A 2NPFA 1LBTA 3SHOA 3NORA 3RDPA 3UPUA 2A14A 1SQSA 2L18A 2QPOA 3EWNA 1B8OA 3NC0C 1ODKA 3ORFA 3LCMA 1K75A 3ZWNA 1JFTA 2CJWB 4W9MC 2JH9A 2GB4A 3A1VA 5BWBA 2XWBF 1O95A 3FAZA 1EWVA 3E1KA 3LCJA 4IX1A 5LC1A 3RQIA 2QG4A 4U6NA 2FOIA 1M2VB 5TR9A 4IFBA 1BSVA 4H4DA 4MUHA 1BGVA 2F6RA 3FKQA 1HDEA 5JVDA 1N0HA 4B7CA 1FTYA 2W4QA 1WEKA 5ALKA 1AKUA 3VYVA 1NMZA 4HDRB 2EW8A 4MGHA 4M6WA 3NVDA 5TPWB 1XNQB 3BHJA 5KZMB 3OFKA 3NW9A 2GBCA 1E1YA 1W8IA 2E49A 3CUWA 3PE6A 2ZXUA 5AJXA 3LC0A 3FUCA 1T1IA 3MUNA 1JTFA 3RB8A 4I1SA 3VR4D 3THWA 2IKQA 3AGQA 3GGPA 2QU8A 3WNCA 2CLDX 3VR5A 2QD4A 3UJHA 1EUYA 3OU7A 5I7UA 1DOHA 3NH6A 2HQRA 2VHYA 3G7SA 4URYR 4ZKEA 4W99A 4NG5A 5KC9A 2H6EA 3SJ7A 1G8PA 2ZSKA 3KZKA 3ICVA 3P9PA 2FX3A 1OKKA 2PL9A 3WIEA 2YFQA 1BMFD 3PQ8A 4PG7A 1DC5A 2PMKA 5TPZA 4DCMA 5EHNA 2ZB2A 5CGZA 3LLCA 2AQIA 2W98A 1IY9A 1X1EA 1YBMA 4CMIA 1VSQA 2FI1A 1UOEA 2HZBA 1IOZA 3T34A 3AEQB 4FYWA 1LBEA 3FPEA 4BMDA 2VXBA 1TMGE 3A6FA 3ADKA 3E3LA 2BSQA 2YN4A 5CM2Z 4LFBB 2UXDB 1MRZA 5FUYA 4AJ9A 4RV5A 2E6KA 1TT5A 1DBIA 2DFDA 5JS1A 2AOTA 3KELA 1YCHA 3LQYA 3DAOA 3GMIA 3UWMA 5JCPA 2Z1NA 2W6QA 4BZPA 2UZ1A 1DJLA 3FLEA 1TZCA 3HI4A 5B64A 3M7IA 3O8BA 4AP6A 2C5BA 2QYOA 5K8VA 1H93A 2YHIA 3FNEA 4DG5A 3FNRA 1K8QA 4F84A 3UAGA 2Q3DA 4BTEA 5FLEX 1T1RA 4ZAXA 4R81A 2X86A 2C0CA 3E9MA 2JS7A 2ZYSA 5T6MA 4Y6SA 2NUTA 2PD3A 3T9BA 1L5MA 2Y93A 4WNIA 4D5GA 2ZM5A 1E7QA 2AHRA 3H2GA 2Z5LA 4CFYA 3PDJA 5E7JA 1EDBA 5IJ0A 5A5GA 1AURA 1Q91A 4ZEXA 4OHYA 1BD4A 4F9FA 4Y2HA 2AG5A 4FOOA 3ZTYA 4S0ZA 1WY5A 4PZYA 3RSSA 1Z5GA 2E18A 3FJYA 1EDOA 4FWTA 4ARAA 2C4WA 1UAAA 1Q20A 2CZCA 3PNPA 3WLIA 4YAUA 4K46A 4Y6RA 4OQEA 2QMZA 3NAQA 2BONA 4ZK2A 5J1SB 1REQA 2D2IA 3NALA 4IJKA 3RAJA 2Y4NA 4L51A 1ZM9A 2QN3A 4LOLA 2IYQA 5H3HA 2JLUA 3P9RA 3TXAA 1WOYA 3QHPA 1IULA 4WZAE 2IBMA 2NTYC 1JKFA 2H0QA 1ZY2A 3DWFA 2XGMA 2YJZA 1G64A 2ISSD 2WRZA 2XYPA 3L82B 4GFDA 4EARA 2VKTA 2QRHA 5T8KA 2Q6VA 3VSEA 1T3ZA 1NWHA 2YV2A 3TZHA 4TT3D 2W6PA 3KVYA 1RM0A 2X1VA 3U7RA 1VI5A 3Q3JB 1M1NB 3NYWA 5AHXA 4DRYA 4XE5A 3W7BA 2KLBA 2NIPA 4G81A 2MCFA 4B2IA 4RCZA 2PGIA 821PA 1U28C 1OFIA 2VJBA 3NHWA 1O77A 3KCNA 4L3WA 4PANA 4D46A 5C5DA 1KWKA 1A04A 3C3PA 3N7TA 1R0ZA 1R0BA 2Z2KA 2PS3A 4L22A 4UJ5A 2X9GA 1WY7A 4TKMA 1NRXA 4YCJA 2FGKA 1RI4A 3DVQX 2LE0A 5CB8A 2BM0A 4J07A 1AQNA 1PV2A 2IOHA 4NP6A 3WLAA 4KW7A 2EWWA 4IDNA 3JD2A 1HA3A 1FLNA 2OGTA 4GPIB 4KWHA 3OFND 4EDFA 4US2R 3SWWA 2FZVA 3HGTA 3R3WA 1Z8HA 3BH6A 2F3QA 2B92A 2YVLA 4QU5A 3WV4A 4NH0A 3PXAA 1T3GA 3GVHA 3SD7A 2AC7A 4AY2A 1JFFA 4PLFA 3D3KA 2QDKA 2LPMA 3C3XA 3H0KA 3CKMA 3WB9A 4DWVA 2F8TA 2WFLA 4FSHA 1DAMA 1US8A 2IE0A 3NM5A 3QWHA 4HH0A 1BYUA 1B7GO 3ZWAA 4WLVA 1XTZA 4L7QA 3WLFA 4F4DA 3VYRB 2B82A 2SKEA 2JKYA 5BSGA 4AK9A 3ODPA 4OHWA 1IJFA 2PLAA 2J7PD 1S8AA 3JQ9A 1EI9A 2CBZA 1VLVA 3K94A 1OF1A 2FW8A 1XUOA 3BEOA 1VA5A 4WBSA 4BNHA 4D5EA 1C4KA 4N76A 1DT5A 3RU9A 1VOTA 4LZOA 4NZ9A 1RXSA 4B71A 5CA0B 2VRCA 4JQOA 3GG2A 4S1TA 3JVVA 1NG1A 5CLJA 1CJBA 2XUAA 2NXCA 2P9YA 2FW6A 2ZR0A 4TS9A 4DV3B 2CNBA 4CQNA 4A8HA 1CU1A 1Z0UA 2H5LA 3OX3A 4MEJA 4CM4A 1X42A 2RGCA 2BKUA 3L92A 4I4TA 1TPYA 2HEIA 2R62A 3PI6A 4DG9A 2P1RA 2YUIA 3CUKA 1NP3A 1WHTA 4PRZA 3DUWA 4V0ME 5AT1A 3TLGB 1H2ZA 4BKPA 1IEWA 1SVUA 1OMOA 1LUAA 5KQGA 4IJVA 1T6NA 4PSCA 1GAQA 1R5NA 2C94A 3B3FA 4KE7A 3RVKA 3OJOA 4ZOLB 1L5VA 4BQFA 2FPRA 3QVLA 4D0NA 1PJLA 1GZ3A 1WUKS 3E0QA 4MS3A 4DHEA 5JYCA 1Z6AA 2VWPA 3NJ8A 4NEQA 3NHLA 5FPTA 1ZW1A 3NR2A 1S2IA 1XMVA 2H8KA 4OQNA 3WSTA 1GQRA 2HSWA 3U17A 3AKZA 1EVEA 2QZJA 1GKIA 1G21B 1Z3CA 1J90A 4S1PA 4E70A 2FFQA 3X0DA 4KQ1A 1BXRA 2F1KA 1Y6QA 2BGJA 4QDKA 1AGPA 1JAHA 3CCBA 4U4AA 3SYLA 1PNOA 3VPXA 1RYEA 2NUPB 2OCKA 4CMHA 1S5PA 3TMAA 4B3MB 3WK9A 1C5KA 2ZZNA 1TCVA 4ZC1A 1QTIA 3SXPA 4E5UA 3ADCA 1R74A 1I9CA 1YJBA 3IBSA 3T7SA 4RCYA 4JXZA 3PFBA 1GRQA 1M6EX 5YASA 3AONB 1S4MA 3TVYA 3WA7A 2PUWA 1CKEA 3GC6A 2OD2A 4B3IA 4M21A 4PC2A 5JYBA 1II8A 1G2PA 2ZIUB 3VSAA 1KVTA 2CLFB 1EK0A 2Q5FA 4AO7A 4HDSA 2CCKA 4RF5A 4ARZB 1L7NA 2IXDA 2XXAA 1XJQA 3TF5A 3HWWA 1YJ5A 1MVNA 4C6TB 3RSOA 1D1QA 2JL1A 3GCDA 2WJYA 1HZZC 3OOSA 4MK4A 2PFSA 4RXUA 1WP4A 3MM4A 2HF8A 1PZEA 3KQTA 4H7PA 5AVYA 5F1YA 5HDQA 5HM6A 1EZ4A 4L5YA 1TF5A 1D03A 3OHSX 4KWIA 1VCNA 3T4EA 3TTYA 3H18A 4K03A 5DX0A 1NQAO 1HY3A 1Z8DA 2HCJB 2WYWA 1W76A 2I03A 2VK4A 1J2RA 1L7EA 1Q1QA 2AG6A 2J5XA 3Q4GA 4J49A 4ZOQI 4LVUA 4DR6B 5K5EA 2ZIGA 3UAYA 3H99A 3QEAZ 2VDNB 1Z5OA 3B1XA 1RI2A 2O20A 4LHYA 5KHLB 3L06A 3WKCA 2AFIA 2DCMA 3ZK8A 4DCGA 1MP0A 1G2QA 2QN1A 3GLKA 3NB0A 4HUQB 3DB2A 4LZAA 5EZSA 2ZUUA 1OIXA 4BMYA 3SM3A 2VP3A 4I55F 4F46A 1DHRA 4UNPA 3ZCQA 4FIDA 1AXRA 5AVSA 3QX9A 4IF4A 3HJTA 3ROQA 4NNJA 3WQRA 2PZLA 3KOUA 5GZ1A 3BF8A 4RK6A 4IJQA 4TYYA 4GEKA 2JA2A 4Z7JA 4X6XA 2UUAB 3IGFA 1VLJA 2Q5CA 3H0EA 3GT4A 3LXRA 1ZD3A 4LJ6A 5BMVF 4I4LA 4JCOA 4ALMA 4DB4A 5KC8A 4I50F 4FX5A 5EI5A 1VJ5A 2JZOA 2P65A 3EVEA 4BC1A 1QM5A 4CBVA 3FMIA 4R6WA 4UHBA 4HQOA 1XEFA 4JLMA 1BMTA 2OV4A 5ALWA 1QC5B 5TIIA 3HUTA 2WWFA 1KFJB 3AM5A 4BO4A 5C35A 1XPUA 1KJJA 3ORHA 4KPEC 1Z4JA 4RQUA 3FY4A 3X44A 4CU5A 1XN1A 3CT4A 3BZWA 4C3OB 1UKZA 5K0EA 4JQSA 2AJCA 2C2ZA 1Y8ZA 4PAQA 2VJMB 4BNMA 4L4SA 2QY6A 4B3JA 3RI3A 3WKEA 2QMOA 3GDOA 3O0DA 4JXJA 4P86A 2JD0A 1D4FA 2OFOA 5FKJA 4B8YA 4BNUA 2QV0A 1CY4A 1JQEA 2WM3A 1A9QA 2QJOA 3GROA 3JYLA 4HH4A 3ISJA 3H2YA 4XGIA 2ZZMA 1GIAA 3KSBC 3L7DA 4GYJA 1O89A 4JI3B 3U4CA 4QQNA 4Y98A 3JQGA 1WKCA 4JEUA 4AKSA 4AAYA 1OW3B 3FMGA 1NWCA 5LMNB 5BP7A 2PGXA 4YGYA 3ZY2A 4TYWA 4YCDA 2WTMA 2NYUA 4MS1A 4YR7A 1RABA 3FHJA 3LVRE 4WQMA 5GQSA 3JATA 4A26A 2EF1A 1VYUA 1PJTA 3AEXA 5A4DA 1KFEB 2GXUA 1DXYA 1U02A 2R6HA 3QHQA 4QX6A 4DIBA 4DPKA 5A5EA 1CQXA 3I62A 1HBJA 2O2GA 4Q16A 4FMBB 4IIUA 2ID7A 3V1TC 3BXOA 1ULTA 4P3OA 3QUQA 4IIHA 4OXKA 1YH3A 1WZIA 2FRDA 3PZRA 4GVPA 2OC4A 1KIFA 3PYLA 1G6HA 1G0NA 1PV1A 2XHEA 2EIXA 3DBRA 4TXHA 1FFEA 1UJ2A 2HRCA 2VC2B 1SK8A 4O25A 3TNLA 1A8SA 4JJ7A 4AD8A 2NG1A 1JHUA 4GOND 1UAYA 3ILXA 2GPTA 1BE1A 3PFWO 3RVQA 2GK6A 2WJVA 4U63A 1QYCA 1KJQA 3ZK7A 4B6EA 3OZDA 5JFOA 1PL6A 1QWOA 4AMYA 1V7QA 1HDXA 2YBEA 1XP5A 2FPGA 3FG9A 1E9VA 1GILA 4M1QA 2JJ1D 2RFLA 5LA6A 3H86A 1VG8A 4I1RA 4KACA 2JG3A 2I54A 5JC1A 2PE5A 1T0JB 1ZUD1 3L79A 2XQJA 4ZI3A 3K8OE 2JIQA 3BMQB 2WIAA 1JEOA 5D3MB 2A7XA 2X0RA 1HLGA 4OJMX 1DQRA 2H06A 5J2UA 3W7VA 3LCUA 3PXGA 4NFLA 3JCZA 2Y99A 2TECE 2ZYGA 3EOAI 3MJSA 1G20A 4K8RB 4IXNA 2I4TA 3JVUA 4FUTA 4I6EA 4MQFA 2QTNA 5EUQB 3RFUA 3V2UA 4F2HA 1ZVVA 1LSUA 2Q9UA 4CMEC 2D1RA 1D04A 4R8KA 1TUBA 5MFZA 5ALYA 1KZGB 3CW8X 3ZI4A 1TZMA 3A25A 5ECDA 1XU9A 1A76A 3NZEA 2D59A 2GUGA 4Z0PA 3KSRA 3UTDA 3FLMA 1VE3A 4R9UC 4RVGA 4AQ7A 2ONYA 1H9CA 4RIIA 2V0NA 1AC5A 1OC4A 1O5OA 3H3JA 3LWBA 4Y6OA 2BW0A 2QXUA 2HF9A 4RPHA 3T1QA 3GJ6A 4HLQB 4Y8VA 3GLGA 3OT4A 2RK3A 2C5LA 2HFJA 5IABA 4DWJA 5TE9A 2JLQA 4NDZA 4ZOEA 5K45A 2HRQA 2ZWIA 2VPXA 4G9EA 3FUUA 3W6OA 3AERB 2PMFA 4C78A 3RUCA 2H51A 2QM0A 3PQ6A 1RWQA 1ZD1A 4PQGA 3H5AA 2XE4A 2GHTA 4UBNA 2H92A 1G38A 3A4VA 4Q37A 2BFOA 5DCWA 3SC2B 4C4RA 2EATA 1IAVA 3F4KA 1MRSA 2GF9A 4GSKA 5DNEA 3A05A 5DDIP 2JGEA 2XGSA 3Q6MA 1W59A 3V1YA 1OBHA 3EIWA 1U7TA 1NR7A 2EARA 4IV0A 4DHWA 2XOXA 3EPRA 4CI9A 1JDBC 3VBCA 1FYXA 5HX7A 1CPYA 1TO1E 3WZ2A 2WFZA 1KJZA 5DNCA 4YCBA 1X14A 1LFAA 2QRQA 3AOEC 3OD1A 5JI2E 3RASA 2YWEA 1X38A 4OHOA 2B8EA 2ZBRA 4ND8A 5DSXA 1XQWA 5KKCA 1PJCA 3DV0B 4CIAA 5JATA 3U80A 3ZKAA 2QX6A 1NMYA 3GWGA 3OOWA 3LUAA 1AXEA 2ASVA 3QLUA 4MX8A 4U5XA 5K99A 1FNSA 1Q0UA 1LPOA 4HWSA 5TMBA 1BA2A 1U0LA 4HDQB 2ZRLA 1XL0A 4J6FA 1U3TA 3EVDA 1N6LA 4GMXA 4TV8B 1K1EA 3NCHA 2EU8A 2YV1A 1Y7TA 5CLFA 1Z73A 3NIGB 1Z2OX 3KTDA 3MIIA 3NPAA 5HW0A 3ETDA 5A4IS 1Z0DA 1N6RA 1Z75A 2FF5A 3BWBA 4LMAA 2R47A 4NCHA 4OQFA 3CS3A 4BKOA 1NI5A 4UKDA 4EG7A 1XNJA 2XRMA 3ROMA 3RUIA 5JXJA 3V4OA 5F3RA 3RIMA 4TLMB 3X43A 4P82A 2B0JA 3GAFA 4H6XA 1EWYA 2QNRA 2GN8A 1ZIDA 3G89A 1X2BA 3H5LA 4Z4GA 4ZVSA 3K4PA 2DERA 3PX3A 1XZEA 5KSYA 3WZLA 5KB3A 3BQNB 4G0YA 2ZRHA 4GVLA 4Z3DA 4EF5A 2R4UA 3E15A 4OXXA 4PC6A 5BPHA 2H9IA 5K0TA 1UP6A 1P9WA 1WS6A 3PKJA 3FW1A 1GGVA 4EHDA 2B8NA 1KERA 3QE3A 1Y7PA 5EINA 3U31A 4AQYB 1ZVJA 1EUDB 5CFOA 5JY6A 2W0MA 3KKMA 4I5FA 5AJVB 3Q85A 3GV0A 4CN8A 4KYIB 1VPTA 3SQWA 4Y6GB 4GLLA 3H5IA 5JZVA 3EMKA 4RL4A 2PRSA 1KE2A 1GG8A 3E3OA 4P2BA 3U56A 1ENOA 2NQ8A 4PGAA 3GOQA 4EHFA 4DUYB 2GEFA 4W6QA 1XCLA 221PA 4KBGA 4BBPA 4Z6KA 2DPYA 4YRZA 3G6WA 4MRMB 2WSBA 2ZJ5A 1ANKA 2HCBA 5ER9A 2VEOA 4BO7A 1AO3A 1FSGA 1KYQA 1Z2EA 2B5WA 2CWWA 2WIGA 3C6BA 3AQIA 3MGCA 3VTZA 1YR6A 5L95A 3WAJA 1OHHD 4RHTA 3HKDA 4TMTA 1DJPA 1M75A 1T4BA 4BN0A 1WUJS 2DTDA 2DT5A 4UMVA 5L3QB 2GXAA 1TAHA 4S35A 3SKYA 3RG2A 3D0KA 3AJ9A 1MOQA 5JS2A 3RAFC 1N2SA 3AR3A 3HWX1 1UQUA 2CLKB 4KYVA 2P9FA 2NUPA 1L4BA 1NVVQ 3AETA 2PKCA 4OOEA 3JZIA 1NGSA 2MHCA 3FJ1A 3NM4A 3IURA 2C3OA 1FBTA 3MELA 5CXSA 3RU2A 3WRYA 3QUBA 4Z7NB 2Q4RA 1KKMA 3QV2A 4OQPA 4Y1GA 3CPEA 2Y0BA 2ZWVA 3EOZA 4ALJA 3AR7A 4J4TA 1VGQA 3QSYA 1JG3A 4L2IA 4ENPA 2NW6A 2XQKA 3IAFA 3WWCA 1Z63A 1GUZA 1OWOA 1BEEA 1MT3A 1L7QA 1TIPA 3UFXB 3VR2A 4FKBA 3VH3A 4C6TA 2QUJA 4M8NE 1L5HA 2VK8A 3HCOA 3PBKA 2DPXA 4FGLA 1PFVA 4IILA 3X1MA 3OEWA 5AOAA 1VP9A 3W3AD 2XVAA 1H5UA 4IQFA 1IBKB 2HWUA 4P92A 4RYDA 2WE7A 1T9CA 2WWYA 1MORA 5B57C 3DL0A 4N18A 1SUPA 1Y7LA 2OO7A 3C2QA 2LKCA 2H0RA 3C5HA 3P0EA 4RIFA 2WKWA 3H2JA 5F12A 4PCUA 3ZD8A 1OZFA 4ID3A 3HJGA 2QZZA 3R6GA 2ES4A 3JQ7B 2ZS7A 2IKSA 4Q05A 1CUXA 4BFYA 1MAHA 3VPGA 1DMRA 1Q84A 2C98A 4ESEA 1XQVA 5KQPA 1ESMA 2RGGA 4FFMA 3LDGA 4RAOA 1SIOA 1KK0A 4W8HA 4C7VA 7YASA 4QOJA 3U4DA 1CR2A 4HWGA 3R3UA 1LNZA 3OT1A 5FUWA 3R4VA 2OBMA 5JH7F 1MIOA 3GZNB 4I5DA 1PJ4A 2ZJ0A 3A58B 3OCYA 4OATA 4B3SB 2C2MA 4FEEA 3FJOA 3ZCTA 3ASVA 3JD1A 1TO6A 3GLTA 3PC4A 4PRLA 5C34B 1CNMA 4G0UA 4GKKB 5DGHA 3NRJA 4ZVKA 3I4LA 3WK7A 4CKCA 3GJ5A 2O7RA 3BT7A 2XEDA 3TR0A 1N2GA 2PZMA 2HSEA 2Y2VA 4KMRA 1TU4A 1K88A 4JWKA 1FVXA 4KXMA 1ESCA 1W44A 3P2YA 4IXWA 2J9XB 1G5TA 4RPIA 2O3SA 3OQMA 2ZWAA 2SNIE 1RTKA 1V9LA 5M04A 2HU7A 1G5PA 4KPUA 4QPCA 1HFEL 1QKIA 1XOIA 3ZWKA 4ZGWA 5ITVA 5I7RA 1VLZA 1TJYA 1SUIA 1VCIA 1WCYA 3MLEA 3QKSB 3VTKA 1G42A 2R5NA 3ZHYA 1SHTX 4AIRA 1DWUA 4E5PA 1NDQA 2ZDHA 4FEGA 5T4HA 3Q9SA 2QS9A 2DWCA 3N53A 1Y80A 3ZJ5A 1L6IA 4Z9YA 4L28A 2VUIB 1QS0A 1QK5A 2QUBA 1EINA 2ORVA 4QDXA 1VMDA 2Q6TA 3QF4B 5IEJA 4Y2RA 4HK4A 1ZPDA 4RSHA 1NNEA 1TT7A 1YE5A 1YRYE 2JAHA 5DP1A 5JD3A 1KDYA 2FMXA 3ZY4A 4C4OA 1RNLA 2VXOA 4TQGA 4Y6LA 3RO7A 1LZKA 2XUHA 1IXKA 1C7ZA 4LRTB 3H3XA 1A95A 1RJGA 4PWYA 3OP4A 4GYKA 5U1PA 2D6FA 3B3QA 4LXUA 2BCGY 1KRHA 1V5IA 1MPTA 1N6IA 3HL4A 3O6VA 1KY2A 1GNRA 1N2HA 5AVJA 3HA5A 2H1LA 5IHPA 3UGJA 2VPYA 1KEUA 4HLDA 4FR2A 4B3DA 4HWPA 1W5BA 1XDZA 5T7BA 1IHUA 1QG0A 3I9OA 2RD2A 1JFVA 1SC4A 2A9KA 1ZK1A 2BLLA 1RAFA 1IOWA 4OCZA 4YYZA 1WXQA 5A9SA 1YZGA 2C88A 2J9FB 2Y6VA 2Z95A 4H3VA 4MMZB 3TLCA 2WU3A 1C7JA 1MABA 4FGJA 3RREA 2IIQA 2WHPA 2FXIA 1I24A 3HQ4O 4ZZ2A 2XT9A 1IWBB 4EJ6A 3B5IA 5EJ4A 4TT8A 2BKXA 2FA9A 3S7TA 4EUKA 1SHJA 3SR0A 9ABPA 4CQJA 3B1VA 4ACBA 4B6SA 3I9MA 3AI3A 5B37A 4CV1A 3CVXA 3AEUA 4L73A 4N3BA 1JVNA 2YZKA 3MEQA 4JA0A 1Z6ZA 2C4MA 3NS7A 5E4FA 2FEPA 2Y67A 2JFVA 3C6MA 4IJ5A 3ETNA 3TBKA 4RTLA 3TFQA 4B9AA 5T41A 2AMLA 4O2RA 3SHFA 3QW2A 4OP1A 5C0OE 3BWVA 1E59A 3KWLA 3JX9A 3DFZA 3MQ4A 4MEAA 4A91A 2HU5A 1DDGA 5LQRA 3KKNA 1H8HD 4LYAA 2E9SA 1O6FA 3WDLA 1E2BA 1X92A 1KO5A 4OQZA 4JLWA 3K0EA 3VNUA 4YRSA 1AA6A 3ZHSA 3H9CA 4X90A 5HF5A 3AIOA 1TM7E 2UV8A 2CUTA 3MD9A 1IK4A 2XDQA 1F3LA 2FJPA 2NVUB 4F93B 3O0TA 1ZOOA 3DTYA 4MV9A 4RSRA 1W25A 1ST3A 1NT4A 4AJPA 3G7NA 2Q9AA 3FYUC 3BDIA 5DNVA 3C1OA 3DFIA 5H5JA 2DUWA 3OTGA 1OI3A 1JTVA 3G2LA 2IU0A 1P1FA 1QH1A 3LUKA 1PKEA 4YLYA 4HN2A 1RHMA 3B2QA 3PFKA 3W79A 3A1SA 2C57A 1FSZA 2CL7X 3L46A 4QBGB 1EDZA 2JAOA 3HJRA 1W9MA 2XGJA 3U4GA 1JPJA 1IRIA 1HDOA 4IDHA 5DV9A 2EKDA 3KEFA 5THQA 4P36A 1RWPA 4BFLA 3FX2A 4LVNA 1CVIA 2NZYA 2PZKA 2XRYA 5HJ2A 2BI7A 1YR2A 4FJ1A 5AICA 5HFJA 5BYBA 4UVDA 3V34A 4FKZA 1DS6A 2PA3A 3VU8A 2YCBA 4TN5A 1AGRA 1UEIA 5KYVA 4F7WA 4FE4A 1E1CB 3K9QO 5CCDA 2OHOA 2VHJA 1EFKA 4M1MA 1XHFA 2P9HA 1Z08A 2E5LB 3NDBB 4ZMRA 3AJDA 3AV0B 2W5UA 3DA8A 1R4ZA 1Z07A 3G9TA 3PQCA 4HFJA 4JVNA 4NX2A 3BC1A 3B7GA 3PA6A 4XCQA 3O9MA 1OQAA 4B3GA 3BREA 7AT1A 1CFJA 3A1FA 3KJQA 4MGZR 2BFNA 2GILA 1W1WA 2ODNA 2UYQA 3GGGA 1Q1ZA 3BGDA 3PB3A 3A2MA 3WZMA 5JPDA 2DBQA 5TT0A 3DQZA 2R6AA 2JGJA 1Z2NX 1N5KA 3KT0A 2QJRA 1CRLA 1SPXA 1QX4A 3QLVA 3HWSA 5HKLA 4AKIA 3QFFA 3TLBA 4W5HA 3K6SB 1JIUA 3HNRA 4YI5A 1JLSA 5DWDA 2E4UA 2FFBA 5A9RA 1JEEA 4AMBA 1HZZA 4GECA 4QBKA 4Y2PA 3VZDA 1NQTA 1TTQB 4L07A 4HGQA 2QTLA 3TR5A 1TB4A 2R00C 5LQMA 3L1HA 1A7UA 4NBTA 4QNRA 2VNHA 3UKOA 1WOMA 4G5OA 1U9IA 3MJHA 4B0PA 4B45A 2VSYA 3UAWA 1UBRS 3A3OA 1YFKA 4JLVA 3PVSA 2GEJA 3IMKA 2WZBA 2WSMA 3T5PA 3AF6A 4DV0B 4WXEA 2Q4EA 5FO0A 1EGHA 1IB0A 1RW4A 4LV8B 1RYHA 4TGLA 4ZDJA 1JI3A 1JAIA 1GFSA 2OV3A 1FSFA 4FT4A 1P91A 3OX1A 3W8NA 5C1DA 2QT9A 2C29D 4PCVA 2VJPA 4JBXA 5AM0A 3RR2A 2J4FA 4D81A 4PN3A 5IVKA 1GPH1 1L8OA 5T5QA 3VQTA 1S8FA 4IQGA 3E9DA 4ILEA 5I7HA 1GCUA 2KI5A 3SYTA 4AY4A 2FSVC 3FKSD 3D8TA 5B7GA 4DE5A 1VGVA 3TKLA 2FPUA 3L2OB 4DLZA 2ODQA 2YHBA 3GHYA 4HYTA 1QDEA 3L4KA 3QTLA 3ZDDA 1UEJA 1P1RA 1J20A 1E58A 1NW5A 1XG5A 2VH1A 3T3PB 5U4QA 4NZOA 5IFKA 4OX9Y 4D7AA 5EJIA 5KQRA 5A6SA 4OKSA 5BSTA 3PTAA 4U0KA 2HV9A 1FC0A 2P6RA 4HVLA 1VRVA 2QPTA 5CTJA 1PHRA 2Q46A 2WTAA 3JQAB 3AM4A 4HEA6 3ZI0A 1ZOIA 2AD5A 3L4JA 5E6SB 2BFDB 2Y66A 1AG9A 1TCCA 3ILVA 5G41A 3VSDA 3IE2A 3BH0A 3M83A 4KIJA 4O59O 1IXYA 3ICQB 5B5SA 1NJSA 2CXQA 4KKVA 2HMVA 4PONA 5HF9A 3TNYA 2A9JA 2XCUA 3W2EA 4IH4A 1LW7A 1SVMA 4AU1A 1OSNA 2NOAA 5HQ3A 4Q3OA 4EDHA 1WBDA 3A28A 1AUVA 1F8XA 2BVNA 2LW7A 2QENA 4L5IA 4XCXA 3UJ3X 1KYTA 1E7RA 1JP7A 3IT3A 5AVKA 4YMLA 1RXVA 3WGZA 1UC5B 4FD3A 3HLYA 1CRQA 4OQLA 4QXRA 5KDOA 2WF6A 3EIQA 1DV2A 1S8OA 3IXQA 1ZGGA 3LQKA 1T8UA 1NJ2A 2LDXA 2Q1YA 3NVMB 4FOPA 3DYBA 1JZTA 4PLCA 2GARA 3HP1A 3ZH2A 1XEWY 3U1VA 1T2FA 3ZX4A 1HEUA 1XJWA 2E4XA 4MPRA 4CM1A 1BVUA 1T2VA 2V5AA 3DHNA 3RQSA 3ZGVA 4BFCA 2V7TA 1EVKA 2QE7A 2H59A 4N0PA 5DE3A 3ZZUA 3O3CA 5KQSA 4H15A 5EWJB 5F51A 5TV2A 3M81A 3NRCA 3QFHA 4INOA 4JI8B 4BO5A 1U8TA 3JU3A 4ND6A 2HPVA 5F52A 5DCYA 1U80A 4UARA 3QPWA 1W85A 2IYAA 2Q6OA 4IOMA 3R7NA 1E3LA 4J0CA 4DNPA 1GDTA 1LI4A 3OURA 4WOJA 3NQ41 1SEVA 3L7JA 3CX8A 2OUIA 3R3ZA 1A4RA 1CVRA 5BWMA 4XWWA 4LHZA 2UYGA 3SZGA 1ISGA 3GJXC 1W6UA 2Q4BA 4I08A 1EFPB 1IFXA 1V3VA 3ACCA 1YVUA 3DTNA 3MMNA 4RX1A 2W6JA 3UWDA 2DT8A 4Q3EA 4KOEC 4LXTA 5BV1A 1T8YA 4JC5A 1L5WA 1XMJA 5LQSA 1KARA 2INGX 3PXDA 4QUIA 4GWGA 2UXCB 1CTQA 1F8FA 3X1KA 1N2CA 4MUGA 4FPXA 1D2CA 1LNSA 1RT9A 5CVDA 2BKLA 4JJEA 4LZPA 1P7CA 4F45A 4UUPA 5IVPA 3S81A 1XRRA 3UG6A 1V4VA 2OG1A 4GW3A 3T7JA 5M3BA 1GNPA 1NONA 1T6YA 1W4CA 4FS8A 4MLZA 4V03A 3ZHTA 4FOSA 1DPFA 4J0GA 3QKUA 1PR5A 3GEBA 3MA0A 3GLIB 2XNCA 2HK8A 4OREX 4OUDB 2EZTA 1I2CA 2NZUG 1SU4A 2EF0A 3CPSA 1D7OA 1UZLA 3HBAA 1HE1C 3A4TA 4QPDA 4QYWA 5ALFA 2J09A 3S1AB 4DMCA 3E22A 3RT7A 2O8EA 1HURA 1E1QD 3SIRA 1V0JA 2XJ4A 1ZFNA 4HNTA 2WIKA 2XWSA 2ZB3A 3ABZA 4PZEA 4CG3A 2CDNA 5IZCC 4HQKA 2IHYA 4FK8A 1C8KA 1HDCA 5E8JA 5HQJA 4Q9KA 4X60A 3ANTA 4CCYB 2NNWB 1JQ5A 3DE2X 4PY2A 1RDFA 3ZJVA 3W6PA 1TFRA 1VHDA 4AP5A 2O59A 2GCPA 2RGNC 2WSYB 3P4XA 1WLSA 3PRHA 2RHTA 2N3ZA 3H8SA 2PNJA 4Z1MD 5IG2A 1YA8A 1ZHHA 1OILA 4MGKR 3V6MA 2GCOA 1HQYE 1XD8A 4A8JB 4UNQA 2C99A 1NM5C 1QIGA 2J32A 1N3YA 3EE6A 1A69A 4R16A 1BEUB 4NV3A 3VI4B 1SGWA 1CR0A 2RK4A 3CW2A 4UOZA 3VI3B 3E53A 1TC2A 2VP6A 3IKJA 4B80A 4U7HA 1R0CA 4IZOA 4Q7QA 3CY6A 3E35A 3V80A 4EY6A 5K0GA 3LI2A 4KJZA 1E2EA 2YIMA 3QF4A 2CNOA 4G3XA 5LXTB 1NQVA 3THSA 3TLAA 3P8ZA 5K3EA 3FIUA 1N6KA 2XADA 4U5QA 4FMDB 2DYKA 3OEEA 5C18A 2MSLA 5CFMA 4YRMA 4RZUA 1CY1A 3PEUA 4P4TA 4R1UA 3L8GA 4UD6A 3RTGA 1PT6A 2WWWA 2QUHA 3BXEA 4WKPA 4YJFB 1GU7A 2BM8A 4WVLA 3TZ6A 1EFVB 2NT4A 1PGQA 1ZRMA 3W5CA 3O8RA 1ZEJA 2ORIA 3SAJA 5EE3A 4DT1A 4G86A 2I87A 2QYTA 2IX9A 4KPFC 3W05A 4QFDA 3FKJA 3ZHUA 4Z2YA 1R8JA 1PG2A 5EP3A 5CR9A 1H2YA 2C59A 5HK8A 3VU1A 4MHOA 5BWLA 5AVTA 1RJDA 2H08A 3P9KA 2POCA 3C7CB 3PCXA 4G36A 3BORA 1ABEA 1AN0A 2NTJA 4HC4A 5BXQC 3O73A 4XIFA 5ECYA 1QORA 4IHQA 4CKWA 1UINA 4WK2B 4CLEA 1J97A 2Z4SA 3F5DA 3PD7A 3WWYA 1PX2A 4IIJA 3R5XA 5FUVA 4JJ6A 5HZMA 4URUR 1FP7A 3FDZA 4A7PA 5L6LB 3MWEB 3QVSA 1GLVA 1FDSA 5AK3A 4JX8A 4ZC8A 4PHFA 4W8GA 5FOUA 5FI5A 1RIFA 2FH5B 2FR1A 1E2PA 2QX9A 2Y92A 3GA7A 3I34X 4WZBB 5DFAA 5E4JA 1H4TA 3X1XA 1Y9DA 3G9XA 4YJGB 2A1UB 3DE6X 5KBYA 1Y4DE 2Z8ZA 1LWOA 4HP8A 2CV1A 1U6IA 2BI4A 3BB4A 2YMLA 4RORA 3U39A 1CX9B 3KQQA 1OFVA 3RSFA 2QLLA 3WGHA 1USIA 3RVOA 3I0NA 4MVWA 3ME5A 1POWA 5HFNA 4LMPA 2BWJA 3T1NA 3IODA 2F1IA 4HDAA 2OKGA 1IHYA 4GLFA 4A73A 3VDNB 3DMGA 3CZAA 1X9IA 3DVLA 4NG4A 5B3LA 5K09A 3DYIA 1T0PA 1U98A 3ZD6A 5JJLA 1K27A 3NOOA 3ZQ4A 3AHGA 3ZV3A 2R1TA 1DHTA 3OM9A 1Q92A 4ZCIA 4UXJA 1WNFA 2E87A 3QHAA 3ZVLA 4DDUA 4H60A 4FQ7A 3HPQA 1VCOA 2VYND 5JJCA 4FC7A 1W88A 3DCNA 1Q0TA 1QOZA 1A97A 3OI7A 3H1GA 4OAQA 2QG6A 1GZVA 1IWOA 1NNSA 4GUDA 4OM7A 4FZ3A 3DL4A 4CIBA 5LM3A 2WIFA 3UVEA 1PWEA 2LWIA 1SVSA 3U61B 5DJ5A 1D6SA 4RTKA 1X1AA 2EFYA 4JI1B 1YS1X 1ZM4A 1A3CA 1UMCA 4CVNA 1NJ5A 1LY1A 2J5QA 3ETEA 1U0GA 4LHXA 4M8IA 4DMRA 2I3ZA 3N59A 3UYLA 3OE7D 4HLCA 2GBIA 4MVJP 3QY9A 1Q16A 2P90A 2QTVA 4HQFA 4C76A 2GO7A 4UM9D 4Y0VA 3VR4A 3VKHA 4D9FA 1JR3E 2ZTHA 5TGZA 1IE3A 1LC3A 2I4RA 5EERA 1IHDA 5EXEA 3PFGA 4QIHA 2O2IA 1CLUA 3B1JA 3PV0A 4LJKA 4BNJA 1F3OA 1E1KA 4OHBA 3WBKA 3ROTA 3K6SA 4E94A 2PJZA 2WKSA 3PDHA 2FPIB 2F9FA 1BMFA 3WIOA 1MC4A 3LM8A 5BSEA 4YROA 5JQGB 4YQEA 3BIFA 4N0DA 4XUDA 1ML4A 1OV4A 3F71A 1R18A 1VCHA 3BFKA 1QX3A 4A0RA 1PLJA 3D5QA 4KQCA 1C7FA 1NYRA 1Y1SA 2PIAA 3OJLA 1WB5A 1NVUQ 3H87A 2PMEA 4EYSA 4FMCF 2QRVA 2GO1A 2EBUA 4J0IA 1Z36A 2G3YA 2QVBA 5FFNA 4XFDA 3Q87B 4ZHQA 1XEXB 3COVA 3FRIA 3PGXA 3JW8A 1E0KA 5EJ2A 2JLYA 1TA0A 4GE3A 5H83A 1YI8A 4HZGA 4ARVA 2R8OA 1XA0A 4G8DA 4RKQA 2XMCA 3F6EX 3UAZA 5I51A 1L1EA 4DA4A 3NO4A 4D9BA 3IL2A 3DCIA 1ORHA 2X9VA 3ELUA 4H1TA 4MW6A 5E1BA 4L76A 1GITA 4WNAB 4ZZ1A 1CRWG 1G7RA 1JQ3A 2OOKA 3KHKA 4LV5B 1RIIA 4KCGA 3ZY3A 5HHTA 1O9BA 2Q50A 5KKNB 2R3SA 1QF9A 5AXCA 1I1NA 3BZBA 3ICOA 3B1FA 1EBBA 3ZV4A 1OASA 5E7MA 2P6PA 3DMYA 2H3HA 1KO1A 3FD8A 2A92A 3T41A 3AYXB 4F8JA 1UMDB 3W2TA 1LBIA 1WUHS 2C3PA 3B2NA 1Z68A 3JQBA 4EG8A 5FNVF 6Q21A 2FQYA 2ZCUA 2FAXA 1DC8A 3OQJA 3MS4A 3T0GA 1MN6A 3G0IA 4KSCA 4TRJA 4TTQA 1TJ4A 3LDUA 1EM6A 1HZJA 4WY8A 2OV8A 1KO7A 3MS7A 1FP4A 3D0RA 1ZCBA 4QJ3A 3PJRA 3ZZMA 1VHQA 4ISCA 1PE0A 3PQ7A 4ZT7A 3RYHB 2JPDA 2JLXA 4D42A 3IT1A 4ZP1A 2ZK7A 3HUEA 3UK0A 3A4LA 5J4YA 3L4BA 2YRXA 4IYRA 2XD4A 2V45A 4OXQA 5BOSB 2QLBA 2G04A 2VATA 1KZHA 1JECA 3G17A 4TT3A 1L1FA 1V48A 2EFDB 2CLOB 3AEZA 3DQPA 2BZ0A 4RWEA 2CFRA 4P58A 1EM8A 2FETA 2FN7A 2X42A 3DHVA 3GLSA 4BMOB 2AE2A 5IMSA 3HWRA 3E03A 3LQ4A 4EF4A 1SXJE 3SYMA 1MH9A 3IUJA 3NGXA 1Q7TA 4WHMA 2Y9MB 1LW6E 3IQFA 5EYPB 2OSVA 1YS2X 3L0BA 4H6PA 2BKAA 3CGWA 2GBFA 3ZE6A 2FWNA 4B6PA 2JATA 4DVGA 5A7FA 5GWXA 4DSTA 2WILA 4FILA 2X58A 3NEPX 4K3VA 1KDTA 3RJ9A 3RJTA 3TFOA 2WD9A 4LQ4A 2ZJBA 1ISHA 1L5NA 4NOLA 1F9EA 1FYFA 3ZOZA 1PJZA 2ORWA 1XF9A 3OFNA 5ALMA 1GKKA 1PDVA 4QUAA 4L4UA 3B1WA 4TUYB 1OA0A 3I6YA 4EPYA 1UBCA 2XYGA 3DPIA 3JZAA 1F0YA 1SWWA 1YE8A 4F21A 4ZT4A 2I2BA 4IAOA 4WBNB 1KRWA 3AM1A 5BQ5A 3LW8A 1ZM3A 2P1ZA 4QXPA 2A9FA 5KNDD 5FTWA 4Q24A 3DWIA 1AKYA 2HD4A 2PSSA 3C16C 3KUXA 4GC9A 4LKOA 3WS7A 3QU7A 4B0OA 4P5EA 4D6YA 1MB2A 5HR5A 1AVTA 1TMYA 2NAFA 4RLHA 3I39X 3U3OA 2JHFA 4WINA 2JLAA 5L3VA 4KC0A 1KZ6A 1QIJA 1SKYE 2J7PA 2VAWA 3LA6A 4MKIA 1YE3A 2N42A 1JKJA 2RJOA 4M1ZA 3A4YA 4WFJA 5F98A 3BSWA 3RS5A 2CE7A 2W2XA 4YWHA 4LYEA 1SCAA 1T15A 1L5QA 5JFTA 1ZAYA 5DNDA 4D97A 5KWJA 5FUBA 3R7WB 3M4NA 4UPDA 3STYA 1C1XB 1XMIA 1S9HA 4F86A 1LS1A 1J7JA 4FGUA 4MQBA 4INZA 3H4VA 3OO0A 3PQ3A 4HF7A 1I6KA 1MF7A 1P5FA 2QAJA 3R23A 3O1JC 1EAYA 3QFTA 4IHAA 1SU6A 4TYMA 2WICA 3LYAA 2V1XA 3EYAA 3K9GA 3VO8A 4EI2A 2YVAA 3R7AA 2SCUB 1YACA 3FYUA 3NTOA 4CF4A 3ACBA 1K8XB 1MB4A 4YV1A 1EGVB 1V16A 3BJMA 5IDXA 2QD2A 1A9OA 1ZYUA 1RJEA 2G67A 2IU4A 2WINI 3M6XA 4H9GA 4NMWA 4Q48A 1FNNA 3J81k 2VDWA 1XTKA 1XCPA 4N65A 4Q9IA 3FYCA 5K3FB 3ZU4A 4EBBA 1UPXA 5FUQA 1CUIA 4J2HA 4ZEVA 3OM1A 2I4OA 3ENNA 1NZDA 1JHQA 2KB0A 2VNJA 2XW6A 3E9NA 4PYLA 1KYZA 2OHHA 4ZYTA 4BXOA 1B14A 4JJ8A 1K7XB 4DMLA 3KZVA 4QBIA 4F4IA 2VT2A 1R3UA 3LDAA 4H1WA 3PUVA 1E64A 5FT9A 1JKXA 3GZJA 1A4IA 4XA8A 4M83A 3IQZA 3KVRA 2Y1FA 3K9NA 4HVTA 3WL5A 3L1JA 4CQMB 1QCYA 4G4SO 4O63O 4LJ5A 3K0AA 4M4SA 4PBRA 5K4HA 4U8GA 4TQ9A 5IVHA 1Z4LA 4AROA 1IUOA 4LQCA 3TKAA 1JT9A 3WX0A 4U1RA 1GZSA 2BEUB 4JKOA 3O8NA 4W1PA 5BN3A 3HP4A 4JROA 4W9NA 3LUHA 5CIWA 3ZXYA 9GPBA 2VTBB 2DUJA 4IHJB 2XUDA 2HF2A 4BAUA 4K9SA 2EBHX 3MCAA 4LSZA 4NBSA 3B52X 2GZHA 3AIKA 3PJFA 4YAOA 3AW8A 4R0MA 3ZD9A 4YP5A 3V8MA 1O96A 3GGOA 3I05A 4YCNA 3NETA 1NF9A 2CJXA 2QXYA 3OETA 4ZO4A 1FRZA 3I45A 3SHWA 4PXAA 3EF3A 2G07A 1XPRA 4DYHA 3THYB 3RKRA 4I1UA 5CK4A 3ZR4B 2PUVA 1T24A 2GH1A 3KXLA 4HJXA 1XQ1A 4YYEA 1R4MB 4QJIA 2QN6A 3OG9A 4RHXA 4D9HA 1OXMA 3EVGA 5CT4A 1XP8A 1FUIA 5FR2A 2ONCA 3ABSB 4DWOA 4DLTA 4E5MA 3RVRA 2AFHE 4JOQA 2QAGC 1F7UA 1AD2A 1R9GA 3UHJA 1H1TA 2O1SA 4KKXB 1WDKA 3CIOA 4OBXA 4YN3A 3ZEAA 1ODFA 2F48A 3GBPA 4ME6A 4Q4HB 4EO4A 1D0SA 2JD2A 3I9KA 4KN8A 4MGIR 4UFPA 4WDQA 1HX7A 1ZZEA 1EH5A 1HLFA 4PR3A 4QVIA 4I66A 3PPWA 1TE2A 3BAFA 3GP8A 2AI1A 3REFA 1Z13A 2G28A 2J3DA 1JJAA 4BNGA 4YC7A 2O8DB 1RC8A 3RYCA 3KU4A 1A9ZA 1P0CA 2HIAA 3I6QA 4EMUA 2FSVA 3AJRA 1UBEA 3HPRA 2GVNA 5K0BA 5AXAA 2ODBA 3TTWA 3U6KA 2HXGA 3CF2A 1NC1A 3HEAA 2C2BA 3JARB 4NAUA 5FBKA 1E6EA 5EJ6A 2YICA 4CEIA 5IBQA 3AHDA 3TCNA 2B61A 3DE7X 4IVPA 5E7QA 4A92A 5KPDA 3PUIA 4AFNA 1G5IA 1PK8A 1VJ1A 4LBVA 4BKMA 5JSQA 2QSJA 3KZMA 121PA 4JLBA 5DF1A 1E7YA 1AGXA 3Q0EA 2XAAA 4R69A 1M0EA 3U5ZB 3I92A 4B6GA 5KJ1A 2X3YA 3AUSA 1BJRE 4UM7A 1UJMA 2WD8A 3Q5DA 2FTKE 4JGBA 5FFFA 3S2UA 2C78A 4BX2A 1BROA 4AQDA 3HEMA 2DFTA 1D2HA 1KIMA 2VDUE 1BGXT 2B1JA 3HSKA 4LECA 1Q0RA 5AW3A 1WPXA 2WVHA 3HO6A 2OA0A 1RAGA 1QU3A 4TL7A 1QYRA 3AL3A 2VWQA 1L4LA 2J5BA 2BZSA 2D1SA 4ZOAA 1ODCA 4FFOA 4CKZA 2Q1WA 3C7TA 2MINB 3YASA 4AG3A 3F5MA 2Y1KA 2NPOA 3GCGA 3GMSA 3WNBA 1J21A 3I6IA 2QV7A 5JARA 5FCDA 3WGIA 1L3CA 4G85A 5L45A 1VLHA 4QUEA 4BP9A 1Z2AA 4GP9A 4LCJA 1KQGA 2IK8A 5J59A 3ESZA 1PRYA 2GHRA 1FRNA 4DSNA 5JRJA 5BSFA 5AVVA 1CUAA 3AI7A 2D1TA 4GGMX 4HNAA 4TWIA 3F0TA 5DHPA 1QNFA 2ZJFA 2ZROA 3EBPA 2EXXA 3OC0A 4C9BA 2HNBA 3WDMA 4KR7A 2BEVB 1FFSA 1PYGA 1N32B 1DLJA 1HTTA 3KSDO 3CLKA 3QXHA 1VE1A 3ED1A 5JNWA 1T9BA 3AB8A 4MRPA 3D8NA 4UDYX 3T5MA 5JQGA 2W48A 4KX3A 2H48A 4D4MA 1QIMA 3AEKB 5K6AC 2Y1XA 4XKJA 3INGA 5J2TA 4KAXA 1FY2A 3A9TA 3UH1A 5FWXA 1J70A 4L72A 4RH0A 2DKOA 3BRQA 1GWNA 1OD6A 1NI4B 1CSEE 1L4GA 3OKCA 3PUYA 1K8YB 2TSYB 3UJDA 3H1TA 3UJNA 2LZ0A 4B82A 3VH2A 2PGDA 3GF4A 3OQNA 4EHKA 1YKSA 4DV6B 4R5HA 1NN3A 3F3YA 3K05A 2GVDC 1U8YA 3GT0A 3L7KA 5FAXA 1IJKA 1POXA 3F3MA 3MFYA 4DQXA 1OLXA 4LBWA 2V55B 5LUBA 2JJ1A 2CHQA 1F6WA 4KXQA 4QJBA 1E18A 5J5CA 4TN1A 3OTIA 4PNZA 5PNTA 3ITDA 3STVA 2XSZD 3IFSA 1WMDA 2H2WA 4UM5A 4X97A 2VDOB 1V95A 2VSXA 4L9SA 1RBZA 4C3ZA 1WIWA 1JW9B 1QK4A 3Q7SA 5JSHA 4GOJA 4NU6A 4RDHA 2R5FA 1JG7A 1RRKA 3DOHA 3QLJA 2P4HX 4MQUA 4BX8A 2RH4A 1C8VB 3WAGA 3IP6A 1D9XA 4D98A 1RLMA 1O6ZA 2GK4A 3VPHA 3QUCA 1L7DA 3H1BA 4JUAA 5BT9A 5IUJC 5LN1A 2HHCA 2JLWA 1UBOS 1GNSA 1EHIA 3M9WA 1LPBB 1ODSA 3FOZA 3WNDA 2AOUA 4DMMA 4YA6A 4EG5A 4ZAYA 4MV3A 1W4ZA 4TVBA 2BBWA 2Q6LA 1HDGO 1ZJWA 4PRYA 2C9CA 3AW9A 5DTQA 4EMBA 2ZCJA 1A5BB 2ZVQX 1O7JA 1QANA 3B60A 4JYCA 1DE0A 2DLDA 3Q9LA 8LDHA 4FZJA 5CX1A 1PUJA 3ESAA 5TQ0B 2RGNA 3VKGA 3C4JA 3I1IA 1JAYA 1G8MA 2CL6X 1Q19A 3EJWA 3MB5A 3MTQA 4HADA 1Z38A 1OTHA 2O8BA 1NM5A 2EZUA 1PI3A 4IG9A 5LYJA 4Y7CA 1NUQA 4CMKA 3LOPA 4LY3A 1JLMA 1TMOA 2XRFA 4M1SA 3ZC3A 1ETUA 2FK8A 2G9ZA 3KJNA 4HAYA 2XVMA 4KSBA 4RVFA 2HM7A 3TLXA 1JSRA 2VP9A 3KLOA 3KXDA 4FINA 4R7TA 1SCUA 1R4NB 4KMSA 4PU0A 4GMDA 2CNKA 1H9BA 2MR6A 1SZDA 3DHWC 5B6PA 5KYXB 1ACJA 3P2JA 1RHJA 2B6NA 2QPAA 1USKA 1NUTA 3IS3A 4IGEA 3F6PA 2CBGA 3B1ZA 1R4AA 3OLCX 1YJXA 3FOWA 4QWWA 3CEPB 4CTOA 1BU5A 2QZ9A 1ZISA 1O87A 2LIVA 4UHCA 5CB4B 1LTQA 1M2FA 3ET4A 2C4HA 2SHKA 3PCRB 3KPUA 1TQ4A 4YDRA 5ALUA 4HBGA 2XVYA 1F1BA 3PL5A 4YECA 3WTCA 3KHSA 4IXMA 5EIWA 2RHOA 3KYDB 4PNEA 2EZ4A 3FOEC 5I5EA 3BFPA 1T34A 2IODA 3AF0A 3B6MA 4IIDA 1GXSB 4K05A 4PRKA 5I7OA 1XU7A 4MUXA 1A9TA 3G8DA 3BEDA 3Q41A 4WKCA 3EVBA 3QYFA 2ACKA 4KV9A 3MCWA 4TTJA 3D3JA 4RWZA 3J7TA 5CHEA 1VGRA 5EFOA 4BGDA 3DOOA 3N86A 2A9PA 1YL5A 3Q7RA 3MSXA 3PGVA 4UBMA 3VNSA 1DAEA 1HK7A 5KIAA 2BR4A 5DXJA 3AF2A 4OQ4A 1X77A 3R9XA 1ZK3A 1FTSA 4RH1A 1OREA 1X94A 4WUVA 1I1QB 4EYKA 1SUAA 4QWMA 2IP4A 4YP9A 2BDEA 1OWPA 1PQUA 2VQDA 1RQNA 2VCEA 4S1NA 1NBWB 2OO5A 2C7RA 2IZ1A 3GAAA 2GR9A 2PKYX 1X1TA 4PZAA 3IT0A 2QA5A 1FB5A 5EN4A 2FSSA 4H3HB 1USGA 2UVPA 4FEYA 4JLSA 1AN9A 3MOGA 1XZNA 4Z8XA 2FN3A 5G0WA 5E6RB 1C7IA 1QF6A 3LX8A 2XYQA 1H0RA 2I3GA 1LQUA 1KO8A 4JZYA 3QTTA 4KQKA 5CH8A 5B1SA 1PR1A 4BWGA 3SCZA 3G0GA 4YIKA 3PKIA 3SGLA 5KYTA 2E5FA 3NTLA 5CVJA 3GLUA 4HYYA 2BHNA 1E6KA 1N8KA 2JI4A 2WHXA 1PUXA 2JRLA 4BNFA 3KS9A 5MDHA 2AI2A 4CCWA 3LXUX 3QUTA 4N8SA 3LY8A 2ORED 2Z30A 2IFTA 3F9RA 3H42B 5ELLA 4RF3A 1U6KA 3F6SA 1S3SA 3AY6A 4X6UA 2V4MA 5EPOA 4BTLA 5DN6A 1C0PA 5ALDA 4EW2A 5JMOA 1NXSA 2BFMA 3DE3X 4LY9A 4O1MA 4FHDA 4C21A 4R0VA 4HN4B 5B30A 4KQIA 4C1NA 1OHHA 2CYAA 3WWDA 3BFXA 1XR3A 3KZNA 1IBMB 4XVCA 2ODAA 2H2DA 2AX3A 1FPMA 1YZKA 4NDAA 5THXA 1Q50A 1XEWX 4BLSA 2E4ZA 4OAOA 4EY3A 4P7GA 4BLRA 2GFQA 4MS4A 2BEUA 5CK5A 1M83A 4K87A 1NLFA 4ECAA 1WQ3A 4NS1A 5HMMA 4EB8A 4EENA 1VIAA 2VTBA