2BSXA

Crystal structure of the plasmodium falciparum purine nucleoside phosphorylase complexed with inosine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
241
Chain Sequence
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDELVPHQLENMIKIALGACAKLATKYALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Plasmodium Falciparum Purine Nucleoside Phosphorylase Complexed with Sulfate and its Natural Substrate Inosine
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 70
structure length 241
sequence length 247
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bsxA00
2I8AA 3BSFA 5F7JA 1TGVA 4LDNA 1V3QE 5JPCA 4JP5A 1ODKA 1PF7E 4OJTA 3LA8A 1JDUA 1JP7A 3FB1A 3UAYA 1I80A 3IOMA 4NSNA 3OOEA 2OC4A 3KU4A 3KVRA 3OPVA 4WKPA 4D8VA 4F2WA 1YBFA 2HN9A 3NBQA 4OGLA 4QEZA 1RCTE 5CCDA 2QTTA 4DA7A 3NM4A 3FOWA 4BN0A 1K3FA 3P0EA 4KN5A 5F73A 1U1EA 4GLJA 4L5YA 1B8OA 4QASA 1RT9A 4M1EA 1PK9A 5IU6A 5CXSA 1T8RA 4JWTA 4PR3A 3NM5A 4EB8A 2OC9A 2PGAA 1RSZA 4YJKA 5KB3A 2ON6A 1ECPA 1K9SA 4D8YA 4DARA 1OTYA 1U1DA 1T8WA 3EEIA 1RXSA 3E9ZA 4TXNA 1OU4A 4BMYA 4TXMA 1NW4A 5F78A 3QPBA 4FFSA 3O4VA 1V2HE 1ULBA 3FNQA 1LX7A 2HSWA 1A9RA 5ETJA 1OTXA 5CYFA 3UT6A 1A9QA 1VHJA 2A0XA 3TL6A 2AI1A 4U2KA 3EMVA 3UAZA 3DDOA 1SQ6A 2A0WA 4YMLA 4F1WA 1A69A 3SCZA 4ECEA 1Z33A 3ENZA 1JDZA 3KUKA 1YQUA 4NY1A 1PR5A 1U1CA 3D1VA 2QPLA 3PHBE 3C74A 1B8NA 5EPUA 1V41E 1V48A 3ODGA 5CXQA 2HWUA 4DA8A 4TTIA 1A9PA 1Z5OA 4M3NA 4RJ2A 1Y6RA 1NC3A 4D98A 1Q1GA 3O6VA 2B94A 1FXUA 3DJFA 2QSUA 4GMHA 4TXJA 4DA0A 1Z39A 3LGSA 1Z35A 1Y1SA 3OZBA 4OF4A 5EFOA 1V4NA 1PK7A 3MB8A 2P4SA 3GGSA 1OVGA 1T8YA 1T0UA 4M7WA 4DANA 3ONVA 4LZWA 5C80A 4MARA 4TTAA 3BJEA 1PR6A 4L5CA 4LKRA 1LVUA 1OUMA 3UAXA 3E0QA 3KHSA 4H1TA 4MCHA 1SD2A 4WKNA 1PR2A 5B7PA 5DK6A 2A8YA 1M73E 4IP0A 1CB0A 4TTJA 1SD1A 1JYSA 2AI3A 5B7GA 5F7ZA 4D8XA 3BL6A 3DP9A 5K1ZA 1Z37A 3K8QA 4G89A 2HRDA 1A9OA 1RFGE 5FAKA 4QATA 1Y6QA 4GLFA 3MMSA 1NC1A 2OXFA 1V45E 2ISCA 4UC0A 3K8OE 2RJ3A 5CYGA 4BMXA 3KVYA 5IFKA 1TD1A 1A9TA 1ULAA 4NS1A 1RR6A 3OCCA 4LNHA 1C3XA 5EUBA 1TCVA 4WKOA 1Z5PA 4TS3A 4R2XA 1ZL2A 1TGYA 1ODJA 3DF9A 3PNPA 4QAQA 1XE3A 2GUWA 2AC7A 4L0MA 3UAVA 1JDTA 5I3CA 1K27A 4OY3A 2XRFA 1Z36A 4JOSA 1ODLA 3OOHA 4DABA 4YO8A 1QE5A 1Z34A 3FUCA 2A0YA 1YR3A 3NM6B 4DA6A 2QTGA 4PNPA 2IQ5A 4F3CA 3U40A 1VHWA 4R31A 1JDSA 3FWPA 5F77A 3EUEA 1PR1A 3KVVA 1ZOSA 1Z5NA 2H8GA 1ODIA 1JE0A 3PNSA 1T8SA 1U1FA 1JE1A 1VMKA 1OV6A 1RYZA 1YQQA 4G8JA 5F76A 4R2WA 1PBNA 4OGKA 4E1VA 2QDKA 4TXHA 1RXUA 4OEHA 1Z38A 3OF3A 4L6IA 1PR4A 4X24A 1WTAA 3LBAA 5F7XA 4DAOA 1A9SA 5F7OA 3OZEA 1U1GA 3IEXA 1RXCA 2AI2A 1YRYE 4P54A 3DPSA 2Q7OE 1Y1RA 5B7QA 1N3IA 4TXLA 4YNBA 1JDVA 3PHCA 3T94A 1PWYE 4LNAA 4QARA 3OZCA 1TCUA 3E9RA 5B7NA 4F3KA 5CCEA 2I4TA 1VFNA 2BSXA 3GB9A 4WKBA 4DAEA 3F8WA 4QFBA 3EUFA 4K6OA 3BGSA 4GKAA 1CG6A 3FAZA 3P0FA 4L5AA 1SJ9A 4D9HA 4G41A 3INYA 1LV8A 3OZDA 1PW7A 4F2PA 1JPVA 1G2OA 4BMZA 1PR0A 4I2VA 1Y1TA 4TS9A 1PKEA 4WKCA 2OECA 4MCIA 4EARA 3UAWA 1Y1QA 1RXYA 4TYMA
chains in the Genus database with same CATH superfamily
2I8AA 1CT9A 5F7JA 1CK4A 3UYLA 3RVMA 2CCGA 4OQXA 1RYFA 2QMOA 4U8GA 2W2MA 3E9MA 1QP0A 3H6GA 1W1IA 1XPJA 3D3WB 4UU8A 2LKCA 3H2SA 4B7ZA 5J2UF 3OPMA 5ALKA 2F2TA 2WIBA 1VG8A 3KJQA 7GPBA 4LBZA 2ZTMA 1M2VA 3UOAB 2QM7A 3RABA 1XZBA 4AG3A 3IB3A 5JSFA 4DR2B 1HY3A 2CJWB 2XUFA 2YWJA 3DVRX 2BKUA 2DPLA 2PA3A 1STOA 3IQXA 3PGLA 4HXEB 5KAPA 4RDCA 1XMOB 3WYAA 1WBDA 1EVKA 3LKBA 2PZKA 2OHIA 2Q4BA 1M5RA 1JZQA 1DBQA 1E8NA 5KKNB 1D5WA 2ODTX 2E9SA 5JAOA 3H6KA 4RK6A 2WWHA 5IXJA 1BSVA 2ZI7A 1Q3HA 2Z83A 4EQZA 1HL3A 1XGKA 3KWJA 4IDGA 4D96A 1EJ0A 4URUR 1IOWA 4JT2A 3G79A 4NV3A 3ZGZA 1IVYA 4IINA 3KQKA 3LMKA 4GF5A 5EIHA 4XWAA 3R7AA 4LC9A 4QDZA 1G5RA 4XX0A 3HXOA 3WJ2A 1NR1A 3INTA 3TDNA 1LSUA 3UWKA 3SOZA 4PSVA 3OFKA 3IUQA 3RFXA 2EZUA 3WMXA 3L46A 4OH1A 1QFJA 1VJGA 2SCUA 1VGQA 4DY6A 5AW1A 1VI6A 4OQNA 1E59A 4GUDA 1X1QA 1GNSA 3AESB 3CLSC 5IUNC 1PV1A 1Z5VA 3AVQA 4I66A 3WGYA 4J75A 7REQB 1QF9A 1EUQA 4FE7A 3MJRA 1U99A 4K6CA 4KB5A 1LWNA 3DDCA 1AMOA 5JSHA 2IEBA 4CI9A 1DCFA 2PS0A 1JHYA 3P7MA 4WN9B 2QJOA 3E3MA 4QZVA 5K0ZA 4MS3B 1VCOA 6YASA 2O3JA 1L7RA 2VXOA 1XDDA 1CJBA 1I2MA 4MHSA 8OHMA 1FYFA 2CVQA 1ZGBA 3A4LA 3D1LA 4I5FA 4QASA 3WKAA 3WLLA 4F3RA 3QX3A 3MOGA 1LPBB 1BFUA 3RS5A 3MRTA 4PIVA 4BMSA 3IPYA 4HSEA 1Y8RA 4BUJA 1QYIA 2VR1A 2NV0A 2W6JD 4XPIB 3Q7PA 1XNHA 4O4IA 3NM5A 4RKEA 1NN1A 2WPDA 3DPIA 5J9FA 4B1FA 3WBKA 1UWVA 3DE2X 2AHOA 2IWHA 4KMMA 5CXXA 1VPWA 4IGFA 4QJ5A 4NYMR 3UCXA 4X1YB 4YUZA 3CLTC 2ZM6B 4L6CA 1VIVA 2DWOA 3Q0TA 3BFXA 3MJVA 2C78A 1GGFA 1N5JA 2GAFA 5EIWA 3W8FA 1Y8ZA 1F5SA 5F5NA 1QVWA 1LDMA 2IE0A 4WW0A 1YE5A 2C5GA 3WRYC 5LWQA 4MWOA 2YJGA 4H59A 1W0KA 2IL1A 4N8EA 4E5MA 1QRAA 4EF5A 3D0RA 3K92A 1UXIA 5GV7A 1WA5A 3E0XA 4G0PA 5F1PA 3FNQA 2EBUA 3HV0A 3U7RA 1U7ZA 3ILVA 4QPCA 5FWNA 5HP4A 1SCUA 3W7VA 4EY5A 2O2YA 2ZE8A 3K4QA 2ZYIA 2Q5EA 3ABIA 1O5IA 4WLOA 4R8RA 4CIXA 1IY9A 2C4KA 1NUAA 4PZEA 4Q05A 2C57A 1V8FA 4ZP1A 1E6MA 5E4YA 4E3WA 4HYYA 3WB0A 5AYVA 4CR8A 4BFZA 1W4BA 1FPQA 2AIRA 3U31A 2YZNA 3H13A 4CWAA 5DCUA 2I2DA 3K53A 2WKWA 3BWEA 3SDSA 3THWA 4I1VA 1COZA 3QEOA 4JI1B 1QIGA 4IF6A 1CHNA 2X6RA 4WUVA 4D7AA 3NDBB 2O8NA 4ZYZA 4ZT6A 1Z33A 5EP4A 3EQZA 4IIEA 4L7QA 1QIHA 3GGDA 4TN1A 2NV6A 5IJ9B 3PXXA 1Q44A 2Q8PA 3C3EA 4CHGA 4DJJA 3L8CA 3I5AA 3A6KA 3H2BA 5IZCC 1JT2A 1TA9A 3EEBA 2V5VA 2YQ5A 2WVHA 4OQZA 2QGFA 3BFVA 4RABA 1Z75A 1DADA 4LYGA 5EFZA 2IODA 1FP4A 2JI8A 3EFOA 3QEKA 3TOCA 4IDPA 4A23A 4BMOB 4IJWA 1NUPA 1FFHA 2BEUA 2DLDA 1N6PA 2Q46A 3LVQE 3URKA 1H2BA 4RCVA 5AOBA 4ENQA 4JB8A 5IXYA 4BRUA 1T5HX 3G1WA 1P9RA 2O1WA 3KYBA 4EVRA 1KJ9A 5FA5A 4ZTUB 2CEAA 2J0VA 2UZAA 5HNKA 1KYZA 3FH0A 2ERYA 3VX4A 3B9RA 3T7EA 2QA5A 2I4MA 2C2WA 4Q34A 1WXHA 4J4BA 1E1MA 1H6AA 2FG7C 4DQXA 1WXGA 2ZJ2A 3ZHCA 3PXBA 2BM8A 1RBZA 2LNDA 4OXNA 4QOFA 4RXTA 3TIIA 1GTG1 4X5OA 3BCHA 1ODCA 1NV8A 4ERNA 1B41A 5ABPA 4ZVLA 1YWGO 3GROA 4OHBA 1L1QA 4TVOA 1XD2A 4UVEA 5DTQA 2RGDA 2B5OA 4GMHA 5FNVA 3ONEA 2XCSB 5ER9A 3WJ1A 4BMDA 5IT9A 3ZE1B 5GADl 1IZYA 1O6ZA 4M83A 2HLNA 1O57A 1EXMA 3DEFA 4ZQHA 2CC2A 3AR3A 4LZJA 2PWAA 4E5VA 4FB4A 1PG2A 5BSGA 2JGFA 4PFJA 4LXUA 1KH1A 1TU0A 1IK4A 1J9GA 1XJ5A 1Z7EA 2ZP1A 3FWNA 3HJCA 2A3NA 4MQ4A 1C81A 2RHBA 2Z2IA 2Q0QA 1AK9A 2JAPA 3BWYA 3NW9A 2RC6A 4N49A 4U7TB 1URPA 3AG5A 2JDIA 4PG7A 2GCEA 3T3NA 5GWXA 1VYTA 3H84A 4EA9A 1Y5IA 1CRPA 4RTPA 2CFTA 3SSNA 3L2OB 1YBHA 3MTQA 4JUDX 3HYSA 2CLMB 4ZGGA 2HJGA 4EFKA 4QBGB 3DFMA 2YJ5A 1VBKA 3FBGA 2JLAA 2COEA 1V8OA 2JHGA 4DWWA 4ER3A 3PXCX 4GM1A 1I5EA 1MJFA 4ZJPA 5I51A 5B58C 2FOXA 4OCZA 2R66A 3BH7A 3SS8A 4G4SP 1FNNA 2WNSA 3A1EA 3IUBA 4FYXA 4N5DA 4Y9SA 2FDCA 1I0IA 2CK3A 2Q5FA 5BUCA 1W4RA 1WVIA 3BXFA 3IDZA 2R1TA 4CM1A 1T1SA 4BX8A 2JVKA 2UYQA 4Z9BA 3ZKWA 1OPXA 2GF2A 2GVDC 4BQSA 3BRQA 4C2TA 4KNVA 1SD1A 4UNIA 2QD3A 1HMPA 3BRSA 3REOA 5JLAA 1CX9B 4C7OB 3CW8X 3B1XA 1CUHA 4J2HA 4FGJA 3ELYA 4ERXA 1N2BA 4H3HB 1T5BA 4PGMA 2D1FA 3Q8LA 2YIMA 4JVNA 3BVPA 3U7GA 1EG2A 4H0NA 4C2BA 3V48A 1E58A 5HVNA 2VIIA 4HVLA 1E20A 2PLNA 3OFJA 4E07A 3P2IA 2RCNA 2CVOA 5TEVA 2I66A 4G89A 2IOFK 3T4UA 1DKOA 3LKDA 1JV2B 1RFGE 2C83A 1E9BA 5CBKA 5A7GA 3AQ4A 1DOAA 1GV1A 5E6UA 2J3EA 5K8TA 2ZJBA 1DAEA 1KY4A 2FEPA 2PX8A 2EEPA 4NZOA 2ROQA 4WCDA 4RCZA 5A9RA 1PFUA 2RHDA 3LW7A 2GJ9A 2QRMA 1KO1A 1Z4JA 2FWBA 2H4WA 1O5OA 2HTFA 5JNTA 1G3IA 2R4TA 5L7TA 3CUKA 2HSEA 4RH1A 1EBFA 2YFYA 1XU4A 1E7QA 4HFMA 4RZSA 4WNAA 2XZLA 1BN6A 5JO9A 3SBDA 3E05A 3QEBZ 4JEHA 2TMKA 2K7ZA 2OA0A 4YR7A 5HYVA 1H2YA 4BMXA 1FQKA 3LGAA 3L7BA 1Q7EA 1VA5A 2IITA 2ZYGA 3F71A 4JMPA 4Q1CA 4RZ3A 4EG3A 1Q17A 5FBQB 2VDWA 2UZ0A 1L1RA 3BRWA 1B14A 4B31A 5IF3A 4REQB 1TJYA 4ZHQF 4B3RB 1C7EA 1KYQA 1TF2A 3HJUA 4JA2A 1EAMA 1Z4MA 5JQGA 3FYCA 2FW6A 2PAAA 4MITA 1GZUA 1NUUA 3D8TA 3TTUA 2PGIA 3ANNA 3IMEA 3WLRA 1XK7A 3ZG6A 2VDUE 5LXTB 4PNHA 4Q02A 3EPHA 1H9CA 1NE2A 5KOHA 5BYKA 2AYXA 1DG9A 3GAMA 2CJWA 3UHOA 3VVCA 3F0TA 4PANA 2HEIA 4BGEA 4EMSA 4QTYA 2IP4A 2H7CA 3OQVA 4NCNA 3KFVA 3PNLA 4HWSA 1LPOA 1XP8A 2C96A 1C2YA 1ZJ5A 1P0FA 2FSVC 2EJTA 4PLFA 1Q12A 3TRIA 2IXFA 3OJLA 5A2QA 2H7XA 1RPNA 4K9NA 1TYBE 4D3XA 1R64A 2N0SA 3UWDA 1RZ3A 4NESA 1USVA 3N05A 1OZAA 5DPMA 3UAVA 4BATA 3L9WA 4LCEA 4PYMA 4RU1A 2VFAA 5IULC 1C2TA 2PMDA 1K5DA 3ZDCA 4LSMA 5C3UA 3DOCA 5LQUA 4ZCQA 2OFPA 2XA1A 3VR3D 4EHIA 1I4DD 2EGGA 2HWYA 4RDIA 1XZAA 1EGMB 2XMPA 2Z1DA 5NULA 2OZEA 1LY1A 4HC4A 2O0JA 2GZSA 3TQIA 3WTBA 3HXMA 4WY2A 3AWDA 1EXNA 4G4IA 4AU1A 4M1QA 3C8DA 3U3XA 4PBRA 1T8UA 1FNMA 3B5JA 5E6SA 5I7HA 1YASA 4KQKA 3T8YA 1IMOA 1BFDA 4PLCA 5IM4F 3F6RA 4B2LA 3AVOA 3TPCA 3U40A 4R31A 2X9LA 2OR3A 4JI6B 2CLSA 4RGVA 4TV8A 3NTVA 5HCUA 5K3AA 3FLEA 4KO8A 4MKHA 1I7SB 1KY3A 1V35A 4KRGA 4RTNA 2WB2A 2UZ1B 3U7QA 4RHUA 4RORA 2FJ0A 3VHXA 1QIKA 2EWVA 1JDJA 1QHXA 5DJ5A 3RROA 2VCYA 3WDMA 4B3XA 3ORSA 2W5UA 4JYBA 3T7DA 2WA1A 1CZOA 1G17A 5DGCA 1NYTA 4XDYA 1NMSA 3FCSB 5FHRA 4CCSA 3B5EA 1PRYA 3EVGA 2WT8A 2G63A 3NEYA 2F3TA 2ENWA 5KNBA 3L05A 4YAWA 1L4UA 2J8ZA 5FA6A 1GPDG 4I5DA 3VZDA 1MDBA 1OVMA 2GN2A 5E4FA 5CVJA 1Z5GA 3MQ4A 4GR9A 5DBGA 2CMGA 2LGJA 3IT2A 5DM4A 4YIKA 4Q7KA 4Z8YA 4H6XA 1PK8A 5AXDA 3CUVA 4U7DA 2GZMA 1D7OA 1G21E 4RQBA 1BGXT 4IQ0A 3TMAA 4A2CA 2RGWA 4PX2A 5JYDA 4HN9A 1LCIA 1KC1A 5JCJA 1DMRA 2YHBA 3ZWMA 5AWFC 5TGDA 3LWDA 5CGZA 2BBOA 5F7XA 1JIKA 1LUAA 4HQ0A 4MDEA 2HU2A 2P7IA 4D80A 1R0YA 1UDWA 1NZDA 1M0SA 1JFRA 1PD1A 1SOMA 1VFPA 1G4HA 1XLUA 3G0GA 5AKXA 1EDDA 3F98A 1NXPA 2WK1A 1EB8A 5JAHA 4MMXB 4QQKA 3WLSA 3K0CC 1GG9A 2C4VA 1KTVA 4ZCRA 1G2IA 5F3RA 5BVGA 3CWZA 2PKRA 3OLCX 3F5SA 4Q3BA 4UHFA 1TIPA 1WSWA 3AFNA 4GM0A 1CD5A 4QOEA 5B36A 2Q2VA 4W5HA 5C8DA 2DERA 2XJ9A 2AF3C 3TAXA 2C8JA 5TLSA 3PFGA 2OD9A 3H4IA 1F3LA 3ENVA 4ZI5A 3WHKA 4E30A 2IP2A 4EJSB 3SIRA 3BK2A 4RNCA 3T3IA 1EMDA 1XU9A 1EVLA 1S2IA 3JSXA 3FCAA 1YDEA 4KHPB 4Q3LA 3OZCA 2EFGA 4V2IA 2PDAA 1Y8AA 3I01A 2JAWA 1I8TA 2IKSA 3BD9A 2I4TA 2A86A 1VFNA 4LJ6A 3RS4A 3V1KA 4DLUA 4P80A 4PLPA 5A7FA 2UYOA 1R8SA 3I9LA 1QFZA 1D4AA 1G9SA 2X0JA 3BC1A 5A3JA 5K01A 5H8WA 2P6PA 4NE7A 3RBAA 3U26A 3T1TA 5ICCA 4HQRA 4KSCA 1ES9A 2W22A 4CMHA 1T1JA 1X7DA 3KL2A 4P0PB 2F43A 5J2UB 5AOVA 3KZCA 4CF5A 4L5AA 2P9GA 1NJ6A 3O3OB 4EHLA 3ISTA 4WK4B 5K3FB 5DX1A 1UPAA 3CZ9A 3FHCB 3M4JA 5KU1A 2B61A 2CZCA 2FZVA 3IAAA 3THSA 2PQ2A 3LT4A 1O95C 1OKKD 3RVBA 1NR7A 2Z0MA 4W9RA 2O2DA 4PXSA 4GMDA 1OAOA 5EQTA 3P26A 3KOWA 4GMKA 1H4QA 2H1VA 1XNRB 4ZI7B 1NQAO 3A1DA 4QPZA 2CFRA 3CVWA 3OC6A 3K7EA 2OOSA 1OJ7A 1YJQA 2ZPUA 4RMJA 4R7GA 1RP1A 2Y76A 3EODA 4CLHA 3HY3A 1X1EA 3EG5A 2O8BA 1RYBA 5FBRB 1GTVA 3OU2A 4EVSA 1YBMA 4JS0A 4M76B 3D7RA 4MIEA 4N3GA 2D0OB 2IY7A 3KOMA 4F93B 1DIBA 1M2JA 1KZ9A 1FOEB 1SZPA 1WHTA 2B9EA 2W58A 1T4DA 1MH9A 3ZHYA 1FX0A 1EWTA 4I8IA 2AZMA 4RPLA 5AW9A 2TS1A 3ZHBA 3P9SA 2C59A 4FFDA 2D5LA 4FN4A 1C30B 2D7JA 3E6AA 4YRBA 2JCBA 4B43A 3BD7A 4MYSA 1T26A 2ODEA 4BQPA 3G3EA 2C9OA 3BE8A 4WHMA 4D9MA 3G8AA 4G0ZA 3IHKA 1LPSA 1QRSA 1EFCA 1TW3A 4W82A 5KINB 2J09A 1MQ9A 5ECGC 3IUNA 3GLKA 4JC0A 4Z0TA 2ALJA 4URFA 4CLEA 2NSHA 1CUGA 3BSWA 1PYDA 1XD8A 3IIMA 5HGJA 4B82A 4HRYA 1IM5A 2PT9A 4C5BA 6ADHA 4XVQA 4Q03A 1OB2A 4J0IA 2OCKA 5F4BA 3RC7A 3LUHA 4DT1A 2ZROA 3S81A 2JFWA 3DM5A 4N8DA 2B4RO 3X3HA 1S1CA 4BNJA 3FR8A 5IC5A 2HNKA 3RUPA 2A35A 3JD3A 3R5KA 1Z2DA 1W4CA 5K0FA 4P3XA 3S29A 4MUIA 4XUEA 3AXTA 2C9ZA 2JBHA 2QAIA 4BNKA 5A06A 3PFHA 2ZUTA 5BYJA 3ZLTA 3D59A 2IPXA 3ENWA 3ZIAA 2PVPA 4XD7A 1T8TA 1JNXX 3UJBA 3W1EA 4YRZA 1SH7A 1VJ1A 1YT5A 4MAAA 3W34A 3VC7A 4KO2S 2J0SA 1VP9A 3R7SA 5C51B 2UVQA 2LRHA 5LXTA 3I0ZA 4M0FA 5LYYA 3AETA 4MKXA 4NATA 3UT5B 1TZBA 1DNPA 5K0SA 4V24A 3LPMA 5CHYA 3QPAA 3U6KA 1GL7A 1JTEA 3GDOA 5JVDB 4M9UA 5KPJA 1WO8A 2UAGA 1E1DA 1K8QA 1ZISA 1YHZA 3CZPA 3VTFA 2QTTA 1ZEJA 3ZQJA 3A3NA 4Z3OA 2XOXA 3HKEB 2GPYA 4LCJA 4AZ0A 4EO9A 4KGDA 4TV8B 3GVPA 3N6VA 1EX9A 2I9KA 1JL3A 1R8XA 5DI9A 3N6XA 2G8NA 3L6BA 4FHEA 4HNRA 4ZT5A 3GRKA 5GJVC 1YZVA 2YXBA 1U0GA 3HU5A 4NH4A 1AB6A 1Y9EA 2YCLA 2O5CA 1MJHA 4MVCA 4UDYX 1XXHA 1RADA 3UFXA 5B6IA 3A1NA 3WGLA 4BXOB 4KFSA 3OPYB 2P1DA 4QLBA 1YRAA 1C9NA 1US8A 1VIMA 2FR8C 2NXEA 2C7OA 4QBHA 4ZTBA 4PYIA 4H3VA 1NUHA 4XSHA 5LJLA 4I9HA 2HRRA 2YMPA 3HKCA 1H1TA 4K03A 1TPZA 1RZRA 3F6YA 4NJMB 2DQYA 1D1QA 4IJUA 1NBAA 1W5EA 2HA5A 1KXZA 4EHBA 3B9BA 5BN5A 3U2QA 3K70C 1R15A 4KHZA 1P4AA 2ZZKA 3HVHA 4LGMA 3OLYA 3QIVA 3QVVA 3KE9A 4HQOA 5CT5A 3WYFA 2YS6A 1OBCA 2P3LA 4FEEA 3U19A 1FIUA 1KVSA 5DLYA 1EBBA 3PV0A 3SEZA 4DG5A 1EXVA 2CW5A 5IAGA 1QIMA 5BSWA 5HQJA 4BO0A 3NRJA 1X1BA 2WWVD 3RFUA 1XZKA 1FTSA 1R0CA 5G4KA 1UAYA 4LXGA 2V7QD 2DG2A 3ZK8A 1LRJA 1DQSA 3CZCA 4GWGA 4AVYA 3M7IA 4Z4HA 4NE9A 1BMFA 1H1LB 3WNZA 3KJIA 1YGYA 5AW6A 1P72A 3L82B 2E6UX 1AKUA 3OU7A 1NW4A 4AWXA 4EFDA 1NXQA 4WJKB 1BEEA 3KQPA 4ZVMA 3ZIAD 2W48A 2VSFA 3O4VA 4KO4S 4TV9B 1C1DA 2QUJA 3V8QA 2O8FB 4RTOA 1C4OA 3G0DA 3EG9B 5CM2Z 1A1VA 4I5GA 2CDCA 3ZNPA 4BVAA 3Q3CA 2GKGA 1U0BB 3D6JA 3FNEA 4JEUA 2ZZMA 3RODA 3SHWA 2I8CA 1ZD4A 2NUPA 4AMYA 4HEJA 4B74A 4YP6A 4YT2A 4EJ0A 3EMVA 3G2KA 3P32A 3W8DA 5LZ9A 5LXTF 4ETMA 1A7UA 3ZW7A 4LE1A 5CLQA 4QTZA 2N47A 3KT8A 1XBTA 1FRVA 3RI3A 3SK0A 2BT4A 1QOZA 1YZLA 3U1TA 1JWBB 2A5FA 4M0UA 1VIYA 4TKMA 4Y0NA 5K2MA 2ZQ5A 1VL1A 4BNDA 1SPXA 4AQ7A 1CFJA 2OLKA 3AINA 3ONDA 4HPXB 1V3TA 1X9HA 1PDWA 3OJ0A 3QG5A 4M9CA 3WGMA 5IDWA 2R8EA 4Z53A 1A9ZA 3NJRA 2E21A 3PLNA 4O3FA 3SC3A 1T25A 4IVQA 4M88A 1ABBA 1RLMA 2XZPA 1NSTA 2J0EA 2CLLB 4B8ZA 5AVJA 3M3DA 4B4OA 2WHRA 2FOLA 3HXQA 1PJBA 3DO8A 4DWJA 4G97A 3R9WA 1SKYB 3M6XA 1W36D 3DFZA 1OFVA 3PD7A 3U3MA 10MHA 5DTRA 3VYUB 3NONA 1CZRA 5EXPA 2WT4A 3I1FA 2YZ2A 1FCJA 5LLDA 5KNLA 1F0NA 4GHWA 2HJVA 3F9IA 3FW1A 3ICOA 4BO8A 4DDWA 3HLTA 4XYGA 1ZJZA 2MINB 4NBKA 4RJ2A 2AMFA 4AZ0B 3S2IA 4N3AA 4O5OA 1CWUA 3RSCA 4BLOA 2MSKA 3S2SA 4R3WA 2B94A 3QLTA 1CF4A 5DMXA 4AMVA 3G5UA 1QO0D 4Q4HA 2Q2OA 5I6DA 5HSGA 4D99A 1XQWA 2FPIA 2PRYA 3WA7A 2NO7A 3UOWA 2IHNA 1B3BA 4ILEA 2BELA 5HJ2A 3LGSA 1SC1A 4CKWA 3UZUA 3GLGA 3UJNA 2H29A 1GL6A 3GA0A 4R8LA 3IJEB 1QG2A 5I7VA 1V4NA 3L4BC 3LX8A 1FUUA 3C1UA 3TSZA 3UKJA 4INJA 4MI1A 1Y8CA 4Q3DA 5TMPA 1JVSA 2YZMA 5K0NA 4XM1A 4H7JA 1T8YA 1T0UA 4L4UA 5HDQA 3H7AA 2P9JA 2X2PA 3ZHTA 2RGRA 4FLEA 1WW2A 1YS7A 2ZVDA 5HM6A 4M21A 3LUFA 3EDCA 3TVYA 3O94A 3V5NA 5ITWA 5JJIA 2AK2A 3ZJ4A 3ROTA 4FMBB 1TAUA 4L7VA 3LE8A 2Q3MA 2FSVA 1KMCA 3I6ZA 4LKRA 1E3EA 4V39A 3UG7A 1JAIA 5DXFA 3WXMA 3GEDA 3PUJA 3ZD6A 5F2NA 4FEAA 2O3QA 1U2EA 2OV2A 2IS6A 4XR4A 1VLLA 4KXLA 1OWLA 3L8MA 2AYZA 2HBZA 5KJFA 3ZLUA 2EW2A 3E7DA 2A9QA 4R8MA 2ATEA 1YA4A 3K9HA 2H2GA 4PO9A 2B4TO 2GZRA 2PFSA 1OWPA 1N6LA 1GRNA 1KEVA 4XEUA 4V2UA 5ELMA 4QRIA 1DC3A 5IDQA 3OT4A 3WQSB 5ALSA 4TYYA 2X22A 3V1LA 4Y9RA 3FRJA 1ECBA 1FDUA 5CCBA 3WWCA 3WY9A 2LBPA 1OLSA 3G0IA 1XZEA 5ESDA 4QL3A 4PYKA 4NONA 4JLUA 1QQTA 3DYVA 3E61A 1Z5ZA 3PUVA 4FZ5A 1IEWA 1HNWB 4ALIA 1IUOA 2NN3C 1N78A 1L5WA 2PRSA 4D56A 3T9FA 5AK5A 5E7JA 5JWHA 3W8EA 3N8NA 2P2YA 2A7QA 2C00A 3CUSA 4HNAA 4F9GA 4ZRMA 4MQFA 1HLFA 3PQ2A 4I8XA 1OZGA 1Q77A 2OP0A 1K06A 5CBPA 2ZWIA 1DHRA 1U0JA 3W8NA 3DYBA 2H51A 4K8OA 5FULA 2DPHA 2EBWA 3EBOA 3M6WA 2IXDA 3A1UA 3AILA 1TIKA 3COZA 1V1RA 5B55A 5FOUA 3TINA 3A4IA 1ACJA 1U7DA 3EGIA 1JQ5A 3NHSA 4J16C 1PR3A 2V3WA 1M6WA 1IPHA 2WWTA 3IBYA 4FTWA 2X5NA 2PLFA 5SY9A 3UMVA 1R9GA 4AJLA 4QUHA 4C6RA 4LJKA 4U0JA 5A4DA 3R74A 2HPHA 4BTEA 2O8DA 1TD1A 1MB0A 1WPGA 2GBGA 4UULA 3SQXA 1SXJA 1Y8QA 3CYFA 3VMMA 1EGQA 1SCUB 3DAPA 4QO7A 4WRRA 2J4FA 4IGAA 4FUTA 1NNEA 2H48A 5CLIA 1PQPA 4A0QA 4JUAA 2M32A 1ZINA 3Q2KA 4RPGA 1G4UR 4QOJA 1QHYA 5JBIA 4X94A 5FTKA 1WXFA 1SBHA 2ZSFA 2PHZA 4L15A 4L4XA 1NVUQ 2XYQA 1B73A 3KSUA 5CFOA 1U0LA 3FHJA 2A0UA 3STVA 4B71A 1WM1A 2V55B 3TLKA 1P62B 3E9YA 5AKHA 1M8GA 3PWSA 1ZVKA 3D4PA 5EIAA 3K70D 4JLSA 5DMHA 2Y4NA 2ZVPX 3HJRA 3PDHA 1LFDB 1OLOA 2DWPA 4JJGA 4JT4A 3FMPB 4UM8B 4KC0A 5ENZA 1VCMA 2OBMA 1WDWB 4FMCF 3RUHA 2XUQA 3R5FA 2Y0CA 3TNYA 5A03A 3GJQA 2XOEA 4OQ4A 2BGIA 4Y7DA 3WLKX 2IUEA 1X80A 1OXBB 3R09A 1U8UA 4R7TA 1MOZA 1XNQB 3S2YA 2XCQA 2WDPA 3QJGA 3CC8A 3PE3A 3UXEA 2DU8A 1OA1A 4C0LA 4BCBA 1Y3BE 4FDMA 5BWMA 3CB4A 3HJTA 4BL5A 3AVXA 1I36A 4TKLA 4E21A 2EJWA 3QFCA 2B2CA 1VYHA 4U1RA 3H2IA 4UXIA 5HCIA 3VSAA 3YASA 3DO5A 3FSGD 2UYYA 1E6KA 3BYZA 3FUCA 1QYWA 1JIIA 1XMXA 1G5QA 1RWNA 2A5DA 2BFCA 3L0OA 4BAGA 4DEXA 2FX5A 1QQBA 1TXGA 1ZESA 1H5UA 3FMGA 4ZC1A 4ZYYA 4JGBA 1EEHA 4RIIA 1SD5A 1YF3A 3O4FA 5F77A 4IY1A 2VBFA 4NIMA 1P4JA 5A05A 2WJPA 1ZM4A 1G6OA 1PR1A 2FHSA 5K2OA 1RPZA 1JFLA 1N0UA 4ID3A 3JQAA 4C4OA 3HB9A 4ZZIA 1C8VB 1U1FA 1EFTA 2I4RA 3NHYA 1GU1A 4Y2VA 5MGBA 1Q83A 5EZYA 3BZUA 2ZR8A 2PZJA 4Q3KA 4S1OA 2TECE 1XG5A 2YZKA 3HSKA 1MPTA 2WE8A 1GD1O 4HTFA 1A5TA 4MLCA 4YJ2B 4ZCSA 5D00A 4ARZA 4M0EA 2W83A 2BHLA 4CM9D 1GAJA 3GU3A 2ACVA 3GX1A 1TLLA 4HDKB 1NF8A 1R6XA 1N6KA 2QJRA 4US1R 5AICA 5AXAA 5BN5B 2OHHA 3OT1A 2ZULA 3ZUPA 5AVUA 3TOSA 1V6CA 3E7WA 4BO4A 3LH5A 3RUCA 4GYJA 2R00C 1I32A 1QG4A 1X80B 2FN7A 4NFSA 3PXGA 3H8VA 4RQAA 5CJ2A 3GJ4A 3TJZA 5C1PA 2C7QA 1NMYA 5JZMA 5AH0A 3ETNA 4OEHA 1H6BA 2JD1A 3KQMA 1HFWA 1PR4A 2FLKA 2H92A 2II6A 3A7DA 4DC1A 1OXUA 2WM8A 3GLRA 2JIOA 2QUBA 1GP2A 3E2IA 3H11A 3HRHA 2HFKA 2AFRA 4PFKA 1OU0A 1L8OA 1LKZA 2G4LA 2OVBA 2ZJ8A 2Y8EA 3QW4B 2FW9A 1OFHA 4TKZA 1S3IA 3UA4A 5IHPA 1QMPA 3NDIA 4OSOA 2QL5A 4BP8A 4G85A 5ALWA 1RW4A 4LZZA 2FG6C 1TM7E 3N6RA 4JOQA 3G2NA 1C0KA 4PNEA 1ECCA 1ZWLA 1DC8A 4E0BA 4PWZA 1WG8A 2JCXA 4R83A 3QWFA 3P9KA 5LBUA 3UK7A 3V7WA 2PV7A 4GAEA 2W4QA 2Y1CA 2F64A 3NQ41 5CM8B 2HF7A 5D7NA 3OX2A 1GZSA 2J9GA 2WUWE 1X7WA 4F4UA 3KUUA 4IL5A 2IKQA 1S89A 4MOWA 4XEHA 2DEUA 1QO0A 2G1AA 1BROA 3DLBA 1DBVO 1XA4A 1H8HD 1JHQA 4QARA 3RWBA 2V7BA 4A2WA 5G2OA 1Z6ZA 1E69A 2I3GA 2YZGA 4XJVA 2PX5A 2RGNC 2BFMA 5F2EA 3T52A 5SZJA 4XYLA 4HI0E 1VJTA 1ZM3A 2PM8A 4QUIA 4UEWA 3V2IA 2KWIA 1RP7A 2EP7A 1Z07A 2NVUA 2FMKA 4HFJA 5DBFA 2WUFA 2GPTA 4GR4A 3S2UA 1NN0A 2PGOA 1HE5A 4BO2A 2F7SA 3SZMA 1NTRA 3V8NA 4O08A 4ZI7F 1LBEA 4EGSA 3CX6A 1XRLA 4RIHA 2PTGA 4FYVA 5IJWA 2PJUA 1WXQA 4WADA 1P18A 4W8HA 1P75A 3BCSA 4WOKA 1RWQA 1QHSA 5LB2A 3TBHA 4LBYA 1L4EA 4GEKA 3H6HA 1AQ6A 2VQDA 4Z3DA 1SBQA 3HJGA 3S99A 3EMKA 5ELLA 1JBQA 4JLPA 3IPCA 3U48A 4LSWA 2P4EA 3CS3A 3I5UA 4J7CA 1L4MA 2DFDA 3RVKA 1PCXA 1YR7A 2AQKA 2R6R1 4ZDWA 5I5EA 2PJDA 2CL6X 1M34B 3AR9A 4M9QA 521PA 4OMCA 1FRZA 4P84A 4PAMA 2ERXA 2PUHA 2IS1A 1QC5A 2H0RA 1CUIA 3EAQA 5FNVF 1E99A 4KWTA 1AGRA 5M04A 4UTVA 2F67A 2R8RA 4BHTA 3KOZA 2EF1A 2E1PA 4LHEA 3QM1A 1NW8A 1U5AA 2NXNA 3K16A 4WKCA 1O9BA 4EUEA 3IOBA 2UXDB 2DB3A 2UXCB 2ZJ0A 2C7PA 1SGWA 4KSBA 1KEPA 2WAYA 4WNYA 3HB7A 1DC7A 5A6SA 1N2SA 2Q21A 4H77A 2JFZA 4FC6A 4L27A 4RZUA 4UU1A 1D07A 3IT0A 2G6TA 5KSOA 4H18A 2OD2A 4H7FA 4LZAA 4NBWA 4D9JA 1EIZA 3FYDA 3USZA 4F3NA 2QPAA 1E1QD 4N82A 1DWQA 1QDUA 2PIAA 2AZTA 4M55A 2I7XA 4NAVA 4BUCA 2V96A 4KPYA 3Q7EA 3FOBA 2ISQA 3DL0A 4GI1A 4NJOA 2X0DA 3FTPA 4TPKA 1JIVA 2HA2A 4UM9B 1SAYA 4WQMA 1GQ2A 3EZ2A 2PX3A 1LS1A 2X7XA 1XVAA 2ZGVA 5CT4A 5ALXA 5E2AA 5IP5A 2IPMA 4GOXA 4GYKA 4PGFA 2ACEA 1A2KC 1PF7E 4B75A 4MCJA 3EBLA 1O6BA 3DKKA 3HU2A 4BWYA 5IXSA 4DUYB 5EKXA 1SC3A 1NLYA 2GNAA 4B3HA 4N8SA 3UKDA 4ESEA 2VCEA 1CJCA 3P2YA 2AB0A 3BBPA 3R7WA 3FPKA 2ZJ6A 2O3RA 2R8XA 4TLDA 4HR7A 1WHSA 2HPAA 2B8TA 2JVIA 2VO1A 3LD9A 1YQWA 1ZK0A 5IZ4A 4OBWA 3RREA 2IYEA 4DNOA 1GYPA 4HWTA 3UUEA 3ZPXA 3PWZA 4A6PA 1Q22A 2C03A 3M6MD 5AHXA 2J6IA 3IQHX 4LOIA 1ZD9A 2EP5A 3MSCA 1F7UA 2J0QA 3GEBA 4M60A 2PKXA 1KJJA 1UFOA 1FXWA 4DSUA 3WL8A 4GGPA 4KCGA 2F8MA 4MV4A 1KWGA 3EISA 2G70A 4JH0A 1GPMA 4OLJA 1SRRA 2ZI4A 1XFDA 1C3VA 3MINB 1NR5A 1UBCA 4KZKA 4XQGA 4AY3A 2LIVA 1F60A 2Q8NA 3ZCVA 3JQGB 4NHOA 4RXMA 5DOZA 3H2KA 4AF7A 2WFLB 2AW5A 2FOIA 1W73A 2HWXA 3LCCA 4MQFB 1NAHA 1RXIA 2XIQA 3OQIA 4BLPA 2ONJA 1J07A 1L5SA 2D2VA 2W2PA 3CNHA 3D81A 2G28A 3DT8A 2XGSA 3RJZA 3SX2A 4D1YA 4KITB 4HDKA 3T3HA 2AUMA 4PC3A 1YIDA 4IJ6A 1AHPA 3IAXA 4QUEA 1RHRA 3QJYA 4MQ6A 2Z9CA 5ALMA 3RC9A 4P38A 1GAXA 1BCSB 3GH1A 1S8OA 2FEOA 2V4MA 2W2OA 1H69A 3AI1A 4BKRA 2GARA 2GBFA 5CVTA 4FKZA 5AVOA 1T9GR 1QGUB 4IVPA 1U0FA 2UZIR 4AJOA 1V11A 5AUNB 2AZDA 2EOAA 4YI5A 3UO8B 1JAZA 4LDQA 1K9SA 3OTIA 4REOA 1UMBA 1OTYA 2B1IA 2ZAGA 3NAZA 4GXQA 2GNOA 5AVVA 4N6NA 2QTFA 3FN4A 2PU7A 4ESHA 3BXEA 4B6SA 3G2QA 1TO2E 1LPNA 4UU0A 3WKEA 5KVSA 3KETA 1EH5A 2YNMC 2FP4B 3R3XA 3H17A 1N8KA 4CFZA 5CFNA 3UMBA 3R8FA 1EUYA 5IANA 2O1XA 4G65A 4LCBA 2Z57A 1KEKA 4PPGA 3G85A 3UFBA 4YRKA 4ROSA 3F4KA 1U8EA 2M98A 4I9UA 2OCIA 4IIJB 2F4VB 4PPQA 4UNQA 1E0DA 4XTCS 3DEKA 5IH7A 2B98A 4NHEA 5KHOC 1NFRA 3CEMA 2FFQA 4A6XA 3LSTA 1IZ0A 2QM3A 4R3NA 1YZGA 3D8HA 1GO2A 2NO0A 2DQSA 1DDOA 3DMRA 5EWMA 3H5VA 3B8HA 4IIFA 2HF8A 1UK8A 3O8QA 3R5SA 5AJZA 1K8XB 4OOEA 5BN1A 2AZXA 1NTOA 2B4KA 1CQIA 1V7CA 4JGGA 3CZ5A 4UTXA 3R75A 2FQQA 4X6YA 3KYIB 3M2TA 3E18A 5E6UB 5CX1B 1T29A 1R9NA 3GD7A 3PC8A 1W87A 2EKLA 3HJBA 4N3CA 1PHRA 3C6XA 4TGLA 3BILA 1C7ZA 1H2WA 1NQWA 1XVUA 3A9UA 3IMCA 3OC0A 4HK4A 4IJQA 5EIBC 2P4UA 4QJIA 1U1CA 3AJDA 1QIJA 4DADA 4ND8B 1ACLA 1XIVA 3CX8A 2FF5A 5F1KA 4EPXA 4GVLA 3HTXA 3Q88A 1ARZA 1WHTB 1CY4A 4HLUA 4KDEA 2RI6A 3DXXA 4UAVA 3AEQB 4HYTA 4AQYB 2O8DB 1X39A 3E23A 3SC6A 3TQCA 2FF7A 4LFBB 1LB1B 1ODSA 4LJYA 5K09A 5CU7A 3SE0A 2XMCA 1Q91A 1R4MA 2DUUA 5DTIA 5MN6A 2O2JA 3QXSA 2BOVA 2YVAA 3LKZA 1S5PA 4XB6B 2SCUB 3CN9A 2Z1NA 2G17A 1NC3A 4IVRA 1Q0RA 3AP2A 1YE8A 2WOOA 2QRGA 4JXXA 3R6WA 1IBCA 1LF5A 4LGVA 5K3DA 3A0UA 4GC9A 3BH0A 1Z13A 3PEUA 4GECA 1ZXXA 3PFKA 1X7YA 1KFKB 5AKYA 3OIVA 5JJKA 4PPYA 2VHWA 1RMQA 2G88A 5TV2A 1Z39A 5EP2A 1KJQA 1NDHA 1D4FA 2E49A 3JQ8B 1QGED 1JSLA 3JD4A 4I9FA 2W6OA 1H4VB 1T3TA 2YCBA 1QO9A 4ZAXA 5EVCA 4JODA 3ZWDA 3I2IA 3BXGA 3PCTA 1UK6A 3PUKA 4IJMA 4RV9A 3FKSD 1BVHA 5KTNA 1G5HA 1OFTA 3MB8A 3CMCO 4G5OA 2P4SA 3STWA 4R7ZA 3ZWYA 5BOSA 3E22A 1OVGA 2HQ1A 1KHTA 4JHXA 1N2OA 3HGMA 3H2YA 4MDHA 2AZ4A 1FF9A 4E3ZA 3ONVA 2FN8A 2BTEA 3ADOA 2XUOA 1FNCA 1KH3A 2ZYVX 2ZJ1A 1CJTC 2ETXA 2GXQA 1N5OX 1H22A 3H4MA 5JHGB 2F3PA 2PD3A 4NMXB 3WR5A 1C1DB 1T1IA 4AY4A 3NWBA 1CJUC 2H1WA 3AM4A 4KVFA 1RABA 3TRJA 4MVXA 1W76A 2R1VB 2XQFA 2RK6A 4MK4A 1LVUA 3VZRA 4MV6A 5JASA 2GGSA 3GUUA 3DTVD 1KXJA 3F2IA 3IYLW 2FSSA 4RF5A 4I6EA 4BNYA 3BX1A 5MHTA 4I36A 1KP3A 3D6UA 4L8FA 1O89A 1PR2A 1YRQA 2GASA 2JW5A 4IGIA 4EITA 1FTWA 2QP3A 1C80A 3KV1A 3KXDA 5ECDA 5CDGA 4TTJA 1YFZA 4UEQA 2IH5A 4PX9A 4WE3A 3G2LA 4GOJA 3W9SA 821PA 2JLYA 1M1UA 5BNWA 4Q9JA 3LXUX 1GFZA 1ZFNA 1T36B 2V8OA 4YPVA 3CEPB 2WYVA 5FADA 3H11B 1DWPA 1CULC 4A2PA 2GK3A 4LDJA 1VIAA 3C6BA 4HL6A 3WMFA 2BI4A 3ENNA 2VJCA 2RARA 3QEMA 1Z37A 4HPWA 3JQQA 3P9XA 3LQ2A 2DOKA 2J9YB 3FOFC 1LQTA 1EHCA 1Y6JA 1EX1A 2C1ZA 2WWWA 3LVRE 4HLCA 4B7CA 3LUKA 2QN3A 2XT0A 3Q9SA 1YL6A 4X60A 1E5VA 2I8LA 1CZHA 4ZAZA 4ZVUA 5T8KA 5KSPA 3S27A 3ZHQA 3G6KA 1JVNA 2C4MA 4JJ8A 5K45A 1AMUA 1GZHB 5FEMA 1WKVA 1CUFA 4X1KA 2ZDQA 4Y7CA 2O0LA 5DOVA 4ZRDA 1CERA 2NXCA 1PSWA 5HCNA 3RT1A 3KELA 3L0DA 4CUJA 4MW6A 1FA9A 2X0FA 2WEKA 4MYCA 1NC1A 3OX4A 3HH8A 2YIJA 1EWQA 3CINA 1FK8A 1N75A 1KK2A 4BB0A 3I4FA 1E3JA 3RC2A 5JAZA 3JZFA 4OP1A 4JSTA 4AUKA 1T8PA 2R8OA 1S96A 2JIRA 4TRJA 5ALQA 2ESRA 2FNAA 1WXEA 2WB4A 4U3JB 5BSVA 2UZ1A 1FMCA 2G04A 3JCZA 4O4HA 1A97A 2C4UA 4HNSA 2I3ZA 2COUA 4LMRA 4RKQA 5CB4A 1RZUA 3T12A 4PPNA 5M29A 3EZ9A 4EJSA 1YS1X 4TM7A 3I73A 2GAIA 3L3BA 3BWBA 1L5KA 1C3XA 1U5BA 1W2HA 4FDLA 5JCPA 3RRNA 3ZHSA 3IGFA 1P1HA 4QHSA 3FDFA 1OIXA 4KOAA 5EIBD 4RQUA 3W9BA 4BNGA 3PUIA 1YKSA 5AUPB 1HQCA 4KUGA 5E1DA 4NYIQ 5I7AA 3B5IA 2OFFA 2NAPA 1NW6A 4FI3F 2H4ZA 2IYRA 1QNFA 2R6AA 4X20A 4EX6A 2Y1XA 1Z8HA 4GOMD 5LLSA 4ZEXA 3KXPA 5TGZA 3PDCA 3THOA 1KAEA 1S9HA 1NULA 1ZSVA 1DGQA 3UGQA 4EJMA 3A2KA 1GCAA 4YCSA 1XRMA 4EPYA 3ONFA 3BICA 3DYIA 4PN7A 1T2FA 1PL6A 3STHA 3V9AA 3WMEA 1JR4A 3WGKA 3HJHA 2X1LA 3SYLA 1XALA 1Z2OX 4RIEA 5LQNA 3PGKA 1V5WA 1RQ2A 2JZNA 3AZPA 2Z2ZA 1XRRA 3BMXA 3SHOA 2E4YA 3LBFA 2VSXA 1Y8RB 1U0HC 3NAMA 4KAAA 4ZD6A 3V6MA 1Y3HA 2BP7A 4DJAA 1R0SA 1CUVA 3GRAA 4B6PA 4JLOA 2GUGA 4FMCB 3OJXA 5JD4A 1RE1A 1C9MA 1C30A 3M89A 2XITA 4US0R 3VZBA 3FTEA 1G6Q1 1N2CE 2W42A 1Z2EA 4CRWB 4JGIA 4EGAA 4ENRA 5BW5A 1E6WA 4FOOA 4OL0A 4E22A 1YDMA 4MEAA 2W00A 1HX7A 1B2RA 2Q50A 4L6AA 4QODA 4DA6A 1GZ7A 1LFAA 4O2AF 5JE8A 2V0NA 2X9GA 2P2ZA 4U2DA 4JOBA 5K7SA 4R1TA 4OGWA 1BAPA 4R84A 4F92B 4LTDA 2XE6A 1J5PA 3HMQA 4XJXA 2W70A 1T1EA 2RGXA 3I72A 5SYAA 2XT6A 2H8GA 1P2TA 4F91B 4TTPA 1XL1A 1VSUA 2NNLD 3STUA 2WYHA 1T10A 4MNTA 1GDDA 4MVJM 2EW1A 2I7TA 4E32A 4EKNB 3SYRA 5LNK6 1Y4ZA 1SUWA 1R00A 1GZVA 1JQEA 1C9KA 1K9VF 4RETA 1E2MA 3N1UA 5B3LA 1P0CA 3CWCA 2IYTA 1WD5A 3GLQA 5JFTA 3TUJC 3C7DB 1C0EA 4YJGA 2CL0X 2NT3A 1H0HA 3GHHA 3RVPA 4E13A 4JJFA 1R50A 3KCNA 4M1WA 3OZXA 4QJBA 5E2BA 3P0IA 1RXUA 4X8MA 1E5DA 3AVWA 3ZS9A 4YDHB 2WIFA 4QBKA 1Z0KA 1SKYE 1JU4A 3A6LA 4AIRA 1M2GA 2QE6A 2R7NA 4E5YA 1IZ8A 2CNDA 3U9TA 3FFBA 5K9ZA 3A6GA 3EQ8A 2GFQA 4B44A 1WZUA 1UQTA 5I3ZA 2QP4A 1Z2AA 3C3BA 3ETCA 5D6OA 3T5MA 4X7MA 1ZQ1A 1L7PA 2QMQA 5KOHB 2CXTA 4L07A 3HMKA 3O26A 1U1GA 4MUGA 1XN1A 1IAQA 4WECA 1G63A 5IJ0A 1VBFA 1PUIA 2ASEA 4AW9A 3UYKA 1TQDA 5GY7A 4DDMA 2V7QA 4ZV7A 3ZE6A 2WZBA 5KYVA 4EG8A 1Y1RA 4HZIA 2BLNA 2DPMA 1MNQA 1OAAA 4C04A 2OZKA 4NFYA 1R9JA 1N3IA 2QQ5A 3FUUA 3O74A 4UUPA 4WN3A 4XJSA 3VR3A 2VWHA 5C46F 4DMLA 1IWOA 3DTTA 3FJOA 2JFFA 1YJXA 4GPEA 1MFZA 3AWIA 2O9JA 3S1LA 1I6LA 1PGNA 4KBYA 4MUHA 1RKQA 1SC6A 4EKGA 1CE8B 3GR6A 2QL7A 2XT9A 3KV3O 4Z7NB 3FI0A 4CBVA 2XGJA 1OQAA 5TQ0A 2P9CA 4CYMA 2A88A 3ZDQA 1FSPA 1YR9A 3GFVA 1AN0A 3VPDA 3VR6A 2QLLA 3NPMA 4L73A 3M4YA 1AC5A 1X8LA 2KBFA 3OEHA 1BDJA 1BRTA 3BGSA 3RSSA 2ZPAA 1VDZA 4LHYA 3RU3A 3R9XA 4X71A 3ICCA 3VPBA 3EZLA 2DHDA 2ZT8A 3E9EA 4FMDF 3G5TA 3GRCA 1KO8A 3X2SA 3QF4A 3MFYA 2OV3A 5C2JB 1KHHA 4EG4A 5C9ZA 3VXKA 3LLMA 4E1AA 2PBZA 2PEZA 2ZIEA 3CV3A 3GFOA 1M0WA 3H0CA 4X7RA 4ZT4A 4QU8A 1L5MA 4F2PA 1FNBA 2GF9A 721PA 1W2GA 2ES4A 2VSYA 2IEIA 2SKEA 2W2TA 2D3WA 2G5CA 4G9GA 4OIFA 4Z4FA 1DPFA 1G2OA 4NMHA 1CUJA 3UMGA 4UOQA 6LDHA 1L5FA 4RGQA 5ARBA 1JG7A 3AYZB 2C2YA 2AT1A 4AF8A 4F2HA 2BW0A 3ZNNA 1RBYA 2CY0A 3HUTA 2AW3A 4BFCA 1BKDR 4MUXA 4EUSA 4KKVA 1G59A 3PNKA 2VPIA 1IJEA 3AI2A 1RYHA 2GM3A 4KK4A 5BXYA 3I64A 4N4AA 2QP9X 3PITA 4BE9A 2ARKA 1Y7LA 3C48A 4UFOA 4MO2A 2GCNA 4A0RA 1TMGE 1D3AA 1MHPA 4IQFA 4Q7EA 3S8EA 4KN9S 3V8RA 1NV9A 1GPYA 1NSYA 4G01B 2GTPA 3PUXA 4NU6A 5SZIA 1IHUA 2AJLI 4JJAA 1FFWA 1QTNA 3WK4A 1KE1A 4LWZA 2PXHA 2ZR7A 2CEKA 2F8LA 2C0CA 6REQA 1L4BA 1WMEA 2PTHA 1EINA 3HGQA 5M7EA 1WUJS 4W8GA 1G3MA 4PZCA 4RL6A 2JASA 1QAQA 3BIWA 3IVGA 3WVNA 1UFVA 4BVLA 4F45A 4XLZA 2HWKA 3D2LA 3Q0IA 4XWGA 3T5CA 4BTLA 2VNIA 3K1TA 4XQEA 4U2GA 1DL5A 3I2GA 1U7OA 4F3YA 1U2SA 4C6TB 1EM8A 1X42A 4L0QA 4EJ2A 2H2WA 3F7NA 1JDUA 1O94A 3NC0C 1GHTA 4WBNB 5EUQB 1L8QA 3CUTA 4PAWA 4TLEA 4PBTA 5FBHA 3RIHA 3NYQA 4CCWA 2JFUA 1INLA 4CM7A 1QU2A 5GONB 2O2ZA 1DS6A 3PNYA 1AHHA 5KKAA 5KSZA 2J33A 3UWOA 5GIPE 4F2WA 2AUTA 3TR0A 4QXQA 4AN1A 5EL0A 3HEBA 1PO7A 3PC4A 2C04A 1HKUA 3W6UA 4ZJZA 3QE3A 4X3PA 5AT1A 3KTOA 1M6VB 4A0HA 4BZWA 1V25A 4MS1B 1II8A 4UAGA 4YFYA 5IF9A 4XUGB 2GAOA 3PIIA 1L5OA 1MVLA 2Q4OA 2Q6KA 3MWDB 3I2KA 4DA7A 3OI7A 4RH0A 2Y92A 5HG0A 1RI2A 3ZZ0A 4MS4A 5LD2C 4QXRA 5BWCA 1YAHA 3HHEA 2QR3A 3NCHA 4BVFA 3FRIA 1ILEA 3ASVA 1R4ZA 5LA6A 3HLKA 1XVIA 5ALRA 4LX8A 1WXXA 3HFSA 3TNLA 3PQ8A 4ZEMA 1FVOA 5BQPA 2H5LA 1H5QA 1TA4A 5AOAA 3V97A 1V95A 4GR5A 1ILWA 3M33A 1GRRA 1JG1A 4YRJA 5LPNA 1QVAA 1JHRA 1KQOA 2UXBB 3IMFA 4M1EA 4R5HA 4U6SA 3RVJA 1NXTA 1L1EA 3ESBA 1JTFA 2X19A 1P2GA 3BIOA 2NQ8A 1YJAA 3DC7A 3SNHA 4KX5A 2A6PA 5KYNA 3ITEA 3W5BA 1G8GA 1U5CA 4O2LA 3VR0A 4GZMA 1ZD1A 2A67A 2ZCUA 3QUCA 4HDNA 2DH6A 1P61B 5D5HA 3WIOA 4CKEB 1XLVA 4MS3A 3FNHA 5ELXA 1JIQA 2YWRA 1XKQA 3JQRA 4JWTA 1VJ0A 3B89A 2VJKA 3MJHA 4XQ9A 2E55A 1ZGGA 2OZVA 3LS2A 3WNVA 2O1SA 4JB3A 4Y2PA 4D92A 1W5AA 3S2EA 2WJHA 1QOPB 1P80A 2ZJYA 3FKQA 5J2TF 5HRAA 4IDFA 2KB0A 4RVUA 2AG0A 2B2NA 1P7CA 3K0KA 3JRWA 3CPEA 3SYKA 2DWUA 1A8IA 2R25B 4PLGA 1O97C 4GKBA 4BQNA 4BBAA 2JK1A 1BE6A 1UJ4A 3K1AA 4GRAA 5DNAA 1A82A 2GQ0A 1Q2XA 2VJQA 4DCVA 4A5SA 2EYUA 2NTEA 4G4GA 3U9SA 2GN4A 4PYOA 4CCAA 5BN3B 2ID7A 2IQIA 2P6RA 1XCBA 1Y9AA 1ZRMA 2XQIA 2ZU6A 3USCS 5L3SA 2YY5A 2H59A 3H8JA 1JYEA 2NM0A 1JJBA 2NTVA 3SE7A 1GZ3A 1B3RA 1YDHA 1NY6A 1VJ5A 4JXKA 5IH3A 3ZWQA 1CLUA 5FKJA 1V7PC 3WLFA 3UT6A 1GQRA 3CN7A 3FA2A 1U9IC 3RS3A 3FPSA 4FFWA 4JC5A 1SVUA 4W6QA 4C14A 4ZHSA 4N76A 3UC9A 1FLDA 2EBHX 3U4DA 4PYQA 4ESOA 3ESQA 3RVNA 3WK7A 1P45A 2JLQA 1TTPB 5C8YF 2B78A 1JDPA 5G53C 2ZUUA 1TDJA 3GZNB 5JCJD 3PA6A 1YZTA 4JVMA 4PZAA 3CNLA 1NKSA 1JG3A 1IYZA 2NZWA 2PL1A 4NULA 5AKKA 3WKBA 3C3CA 3H2HA 3KRTA 4C4YA 2C84A 2WVGA 3J81k 4XXHA 4RKWA 4MLPA 1OKKA 4NMWA 4GVXA 1PU2A 4EDFA 4WESB 3RYHA 1AZTA 2PT6A 1Y5RA 2H63A 2WJVA 2YASA 4L85A 4MRAA 5AJTA 2ASVA 2WBLC 4NTZA 4J9UE 5BWBA 2HSZA 5IDXA 1SWWA 4NH0A 3KUKA 1G1AA 1ONNA 1YQUA 4M1MA 1MZPA 2WINI 2VSQA 3IP9A 4MR7A 1PTKA 4BBPA 2J9FA 4QJ3A 4FCWA 5I4KA 4A1OA 3C3JA 3ZE9A 1O87A 5JH7B 3H8SA 1ZQ9A 1N2ZA 3C1TA 5JFOA 3U16A 1E79D 2B2XA 1MX5A 1UC5B 4ILKA 1XRJA 1NX9A 4FDVA 3SXJA 4DCGA 3NTXA 5F2KA 4FJ2A 2BGMA 1H9BA 2IDJA 1WPQA 2HK9A 4MS1A 4ARCA 3OE7D 1HXHA 3PL1A 3VMFA 4OU4A 1MIOB 1YOBA 3ROPA 3LX6A 4K9QA 2HHHB 1DXHA 1ZG3A 2C2HA 4JKIA 5EHXA 3F8SA 1GRVA 1L4FA 3VOBA 5IVIA 4ND3A 4O4JA 2XWJI 4AJPA 2Q5JA 1ZD5A 4CMIA 4AO8A 2AYYA 2O0MA 4C0AC 3A1VA 2QSUA 2ZSUA 4NYIR 3NS7A 2XMDA 1DARA 1QAOA 3R44A 1FYWA 1EFLA 2VDRB 2BCEA 4RHCA 4QAJA 3W1WA 4HEHA 3ZCXA 1HDCA 4B34A 4OVKA 4DTCA 1QE3A 3F5DA 1LU9A 3EGWA 4D3YA 2JH3A 4EKYA 2DETA 4OXYA 5HEKA 5EZ6B 3EBPA 1QB7A 1PV4A 2OPBA 4OHXA 3VDNB 3TPFA 1C7JA 2HH9A 3GBSA 3L5OA 1UKAA 3IQGX 4MI6A 2I6QA 4Q3EA 3NG1A 4RK4A 3IBSA 3MWKA 4M46A 2AKYA 4JJ4A 5FPHA 4BVJA 3L8FA 4OB7A 3QVGA 2P2LA 4FBMA 4LDAA 4L9SA 5HMLA 1XHEA 2E85A 3R41A 5SV2A 3SSOA 1GTMA 2XUIA 3C41J 3D8UA 4GYWA 3WISA 2W0SA 5CH5A 1TX4B 2HK6A 1VPVA 1I5RA 2XE7A 4UCXA 3DT6A 4WAUA 4XGRA 2ZSAA 4IEEA 4YQFA 1C4WA 2P9EA 2G5GX 1NRXA 3AO0B 5ALPA 4YRFA 1MRZA 3OLQA 1UINA 2H1IA 4ZOCA 2AVDA 1UZLA 3AR8A 2UV8A 3TLBA 4AROA 1T9ZA 3E5HA 1SQ0A 2JI6A 3N7UA 2C31A 2Q1YA 4U9IS 4WLUA 3WK8A 4PIMA 4E4RA 1IL0A 4O6VA 1SHTX 1UP6A 4KIFA 4UHHA 3JARA 1ZGAA 1FMJA 2ZIZA 1UEXC 5CB4B 5LU8A 1XQYA 4PLTA 1JWLA 5ITSA 1FJ2A 5KREA 1ZNQO 4YTEA 4Q7JB 1FTNA 2PAFA 2PZEA 2XNCA 2Y2UA 3K8QA 3LC7O 3EZFA 3QNWA 4NU5A 3DFFA 3FHLA 4KXNA 4CMBA 1XTQA 3OT5A 4I1PA 1SBZA 4O59O 3V55A 3AUFA 4PCLA 2GF0A 2WKSA 1ZVQA 1RWOA 4O4LB 5K6AA 4KR6A 3FFWA 2X8WA 3DT9A 4OYHA 3TZEA 3RIGA 4MX8A 3VAYA 5B6PA 3FYSA 3GLTA 2IBTA 3MUEA 3B12A 2OB2A 4OAPA 1Y6QA 1KH2A 2ZXUA 1JHVA 3DFIA 5DHFA 4F5DA 4BE7B 2O2XA 3SF8B 3O4IA 1HMYA 4Y6GB 2FR8A 1JA0A 1V16A 4CDNA 5T4FA 4Q37A 3R6GA 1PGPA 3FWKA 1K92A 1OJLA 2EX1A 3QKUA 1S02A 3K09A 4NP6A 3UXMA 1XHFA 4XUDA 3CNNA 3G2IA 4XW2A 5J3JA 1U2GC 2GSDA 3SLKA 2GSWA 2V5UA 1X1CA 3H5AA 2BJHA 3Q98A 3AL3A 3FJ1A 2FZKA 4XX0B 2FRDA 5U1PA 3SEQA 3ZQKA 4ENSA 3K3PA 1P6XA 3K6RA 1DQPA 2RGGA 4TTRA 1IC6A 1TQ8A 5KTKA 2Q9AA 3WIVA 3OCCA 4YJ3A 3T38A 3DE6X 1VJCA 4B6FA 3L8GA 2X6QA 1L4GA 2X77A 3A1WA 3P8ZA 4BGIA 1Z5PA 1XTSA 5T6BA 2BR4A 1NLUA 3W2EA 2V9PA 2IDKA 5LMUB 3RANA 2H5EA 2HYIC 2CGEA 1QH8B 1KAOA 4Q9LA 1VPTA 4QDTA 4KQXA 3LYUA 4H27A 1Q6YA 3CO0S 3HUUA 2Q0HA 4PZYA 4R1QA 5CMLA 4Y6QA 5AFSA 1ODJA 4UHCA 1HZJA 4EJSC 1GOTA 2ZU0C 3MK31 3DQQA 3CISA 3QYPA 5BNTA 3QLJA 3RU9A 1ORRA 3A3OA 1JHMA 2XTMA 3TZKA 4IUYA 1P19A 4LHZA 4NJEA 5J4YA 1K6MA 4D2IA 1CDOA 1GLNA 1Y3FE 2AC7A 2YHIA 3FCYA 4UREA 2AMJA 4B3CA 4XVUA 3DLTA 2Y1WA 2WLTA 4Q4LA 4FZJA 2E3JA 3Q8WA 3LHFA 4YJGB 2X1MA 4LYAA 2PJRA 4YRIA 1RAHA 1VI2A 3N3AC 1SWVA 1KZHA 5KYGA 5DCWA 1KY5A 3C6KA 3K6SB 2ACKA 2ZFUA 3M6UA 2DTEA 4QU0A 1UBLS 3GFSA 3L06A 4LYFA 3WA6A 1W25A 4TWBA 1JQKA 3GBVA 3W7AA 1VE1A 4QYTA 4QYIB 4WOJA 3VYTB 1PEKE 4JBYA 1BTOA 4DCMA 5F3DA 3IAEA 3R3YA 3WC4A 3FJYA 5COBA 4DLKA 5GONF 2HB6A 2Q5CA 3T1QA 3N58A 4G9EA 4D4IA 3E9DA 4OQDA 3VC2A 2BSQA 2YICA 1E77A 1YCDA 4BEVA 4D5EA 1J21A 3M8KA 4WV3A 1F9EA 4EB6B 3HLYA 1XQXA 2L18A 3GCDA 1XTJA 2RHJA 3LUPA 4LMPA 3IEVA 2NG1A 1NXWA 3R4VA 4NENA 1F0KA 3AC0A 4HMOA 5AI6A 3SDZA 4O1IA 5DHQA 3OPXA 4ZICA 1YHNA 2WHQA 3U1BA 1G38A 1VHLA 5HF5A 4J29A 1XMSA 5FEUA 4N5NA 2ZETA 1R4NA 4AS1A 2OXEA 1U2GA 5HW0A 2X2OA 1PJ4A 3W05A 1G6HA 1Z6YA 4RS3A 3S68A 1CDEA 1SKUA 3KKOA 5LZ5A 3ZCRA 4US2R 1QG6A 5A04A 1RRKA 1ISJA 1DRKA 2BP7B 3I2YX 4D0SA 3WGVA 4CLXA 1OI4A 1QB8A 2QE7A 4CM4A 2IYVA 2FWPA 2G09A 4GD3Q 4AAYA 3C87A 1IXKA 2HCBA 3BUSA 5AQEA 2BR3A 1Z9BA 3O8OB 1U8CB 4UBOA 1XTRA 1NBWB 4WN9A 2WYUA 2C82A 3L43A 4GPIB 1NLMA 1M1NB 4WX2B 3CPHA 1E5LA 4CGZA 3QKSA 3ND6A 1X3SA 2NACA 3Q6IA 4KI7A 3GLHE 3I28A 3DV9A 1ABFA 2QN6A 1IE3A 2MSWA 5LA6B 2V58A 4FDAA 1KDTA 3MINA 3KC2A 3T06B 2H9IA 4BMNA 4PN3A 5CEFA 2DF8A 4R2MA 3NH6A 5L3QB 3ZCTA 3I6BA 1NG9A 5A02A 4WFJA 4YUYA 4KNYA 1MRNA 3J81A 3UMFA 3VVBA 3H5OA 1Q7RA 3ELDA 5CNMA 2EF0A 1JKFA 5JNSA 1PYGA 3KVNA 5B7QA 4MJXA 2WOJA 4OHMA 2QGNA 3HR7A 4EUHA 4HH3C 4IZHA 4C07A 2I91A 2GMWA 5LKRA 1ND5A 2NTYC 4PXAA 4RMNA 3T94A 2HKIA 4YUXA 4M1SA 1B0ZA 1NDUA 4OTZA 5F51A 1HDZA 1R5OA 1QH1A 3AM5A 3WWZA 7ABPA 5BSFA 2V7TA 5AK3A 4JI5B 3W7BA 2RHGB 3EVDA 3LLSA 1RPTA 4KZPA 5LOVA 1GFIA 4BMCA 1J0CA 1JPJA 2Q4RA 4RTMA 3FCEA 1GFWA 3NNSA 2J32A 1E1CB 1KTIA 2J3LA 1TJ4A 4WZBE 1V3VA 3T7AA 4EP1A 1KIMA 2MYTA 2NU6A 4FCCA 4OB6A 4EW2A 3J7AC 2A33A 4Z1MA 2DUNA 1YJ8A 4AJEA 1T3ZA 4NCHA 1LC0A 3QBJA 4KODA 3V2HA 4P98A 2EFEB 3INRA 2TYSB 2OMKA 1VHTA 3B2EA 3R3SA 4ZT2A 1N7HA 4JQCA 3S28A 1U9ZA 1YUBA 1TZCA 2P65A 2ZVQX 3LQ4A 1VMIA 3ZYCA 2NPOA 4LJ5A 1QMGA 5KOYA 1MBZA 5FFFA 1CXZA 3DOJA 4PAGA 4MYHA 5FUYA 5LBIA 5CA1B 3KQNA 4ME6A 1REQB 4ALMA 4FWBA 3B1ZA 1F20A 1LC3A 2NZXA 3KSMA 2JHPA 2YVLA 1QFMA 2DMRA 3EVFA 4I6GA 5KMGA 1QM5A 1M76A 4WFIA 3MGCA 4MIYA 1ESDA 3PENA 3LP6A 5TPWA 221PA 3NBZC 2R4QA 1TUBA 1E5TA 4EY4A 4PU0A 4IICA 3C5VA 3DE3X 4EZIA 3C3YA 1H2XA 3B9PA 3A14A 4C0XA 1HV8A 5EMJA 5AW3A 1KORA 1NM5A 1WV0A 4R40A 5TS2A 2CL7X 2VN8A 2XX3A 4EARA 1JJIA 5I01A 4GX1A 4GQBA 2BTOA 3H1EA 5IJ9A 2KPOA 2VWPA 2DP4E 4UZFA 1TW2A 4KVZA 3TLGA 3HK2A 3PIDA 4X44A 3WOHA 3PQDA 4CIYA 4KGXA 2GPJA 5TJ9A 1CF2O 3VR4D 3QVGB 2VCHA 5DEIA 5CFLA 1LTKA 3EXIA 4S24A 1U3GA 4KO1S 2V1UA 2IXEA 3VSDA 5FB3A 3UMRA 5DM1A 4D0NA 2YVUA 4ZZ2A 5ITZB 3JWGA 3VR5D 2XJ4A 1GDTA 4ZU1X 2BFFA 1E2JA 4DIMA 4K9MA 1ZKDA 1P91A 1U8XX 3OURA 1HDGO 1QGOA 3THRA 3HV2A 3T4EA 3WRXC 3CO5A 2PZAA 3C14C 2PMBA 2W8BB 3FBWA 3V7UA 3BZWA 3V42A 4EYGA 2B0CA 3DW1X 1E96A 2QRPA 3FSGA 2ID9A 3IOMA 2Q07A 1AM4D 2K87A 1IHOA 2VF8A 4IOLA 5KDDA 2QG4A 3F1KA 3B48A 5A4IS 3I3SR 3M49A 4MXDA 2NNWB 1K5PA 1K6EA 3AR7A 3M9LA 1YZQA 1QQ5A 2WVJA 2FPIB 1TK9A 3LDUA 4J49A 1HLDA 1WXWA 2HUPA 4NFHA 1LDNA 2AOXA 3VR1A 5KTRA 5EMKA 1UBTS 1UJBA 5IJAA 1MAAA 2EZ9A 3NP7A 4MRNA 4HAUA 4JYZA 5CCDA 3PT5A 3I5XA 1KQNA 3WYBA 1T5LA 3FUXA 3WL4A 2V98A 3L02A 5KYUA 4B6GA 2LR0A 1UBRS 3SMQA 1D2AA 1I7DA 1R4MB 5ALVA 5D86A 1ZM2A 1LX6A 3B8EA 3HEAA 5IBRA 4V0KA 2BZGA 3F7MA 2E4XA 3OHSX 5I7SA 4WJLA 1K97A 3X1DA 3MWLA 2R00A 1IQUA 1EDOA 5EIEA 3N86A 1ZHOA 3SJBA 4N39A 4PINA 4AN0A 2BY4A 2P5UA 3RG8A 2CNLA 4TVSA 1UMCB 1GJRA 1M34A 1E98A 1YQ9A 4DY4A 4ZDKA 4I1RA 3H04A 3WK9A 5F9HA 3K9LA 2YJTD 2I6FA 5T3YA 2Q5OA 1N34B 1RFLA 3R0ZA 4YAJA 1D6MA 2N1MA 4I1SA 2BL4A 4CM8A 9LDTA 5HRUA 3PTAA 1DTWA 4BU1A 1Z56C 3S8MA 1G2QA 3A4VA 3MQFA 4UE3S 4UUMA 3UPUA 3NYIA 1QHEA 4UVHA 1XWWA 4MV7A 1I1HA 2BYTA 4PR3A 2X42A 5AW7A 3ZZNA 5K3BA 2PGAA 3OLVA 4ZA2A 4ZK6A 2ZUFA 2IBSA 5DULA 3AZOA 2BFOA 4YPOA 1NJGA 4LYJA 5TMDA 3RUIA 3ZE0B 1R0XA 1V1MB 2OEPA 3TL3A 2EHJA 1GKLA 4CCYB 1QP7A 1T8WA 4BCDA 1BD4A 2O3SA 2QUIA 2V7EA 1P8JA 3JYLA 3NYRA 3OZFA 4O2BA 3VFDA 3W2GA 1UAAA 1PL0A 2UVDA 5NLLA 1YU9A 3GOQA 4YLGA 1N5IA 3WWEA 3MRXA 4K5QA 4GGMX 2MMGA 2W6MA 4LQLA 1DXQA 1XP5A 3E4CA 4NK4A 3L0BA 4JU8A 5F78A 3AM1A 1D2CA 1ZN9A 3RIMA 3ROEA 3VX3A 3FPFA 2ORIA 1SVOA 3ETLA 2JGIA 2OENG 4MQLA 4X84A 3TOVA 4I50B 1SCIA 1HRKA 1RWBA 4E03A 1RAEA 2C94A 1KMIY 1M2OA 2CSUA 2UDPA 2VPTA 3ND7A 2Y9MB 8ATCA 1TADA 2XCIA 3TSAA 1HGXA 1GKUB 2ZBEA 3AGPA 5JV5A 1IIBA 1VE3A 5TQ2A 4OFWA 1G66A 4X1IB 4FM9A 2OZPA 1T9KA 3UJ8A 1U4SA 3BHNA 1T2NA 4CR6A 1FS6A 3G9ZA 3KEMA 4CKEA 1DAIA 5I47A 4PGGA 2DBYA 5ECYA 4AJ1A 5HZKA 3WAGA 4AYWA 5LBTA 1YC5A 5LWHA 1CY6A 2X41A 3MERA 1ZGHA 2IU0A 3VJKA 3O90A 4Y9DA 2A1TR 3L4EA 1A2QA 2UYCA 4UMEA 3LCUA 4U9UA 4D4JA 1GARA 1I6KA 1Y4AE 2XWPA 3EGXB 1O97D 2VPXA 3EZXA 5TVKA 3HKBA 1SBIA 5DYWA 2JGDB 1GNTA 2YL2A 3D1JA 3LRXA 5G0UA 2BZSA 5DEOA 2PO5A 1HLPA 3ZBTA 3QRWA 2PZ8A 4WT7A 2VRCA 1XTVA 3JQFA 3MCVA 3CVYA 2XUDA 2CUZA 2NXWA 3U3DA 1A5SB 1E0JA 2BMWA 2OKGA 4ZQGA 1PD0A 4C2AA 1H93A 5K3SA 2KJQA 3TRHA 1ND6A 4UVIA 5AOCA 1A9PA 5B64A 1F2TB 5KZMB 4KQHA 4MGZR 2V0CA 1T6YA 2CNWD 1SUAA 2QJFA 1CR4A 1AIPA 3R0JA 2JJMA 4FGUA 4Z1OA 1S0UA 1UM9A 1VCIA 3D4LA 4UTNA 3EXHA 1AKEA 2EJCA 4R4JA 1TVKB 3O82A 4YRTA 1E1QA 4XOIA 5HIMA 2OGZA 2WFAA 4KJZA 1MGPA 2F3QA 3EPKA 4HDNB 1X9GA 3C39A 2L0XA 5IYZF 2PT7A 4PS0A 2MDTA 4ZIRA 1ZUIA 1JS1X 3SFTA 1ZDMA 1QZXA 5FUXA 2IC5A 3ESZA 4WI1A 1O94C 1NSFA 1GT91 1QWSA 3EJ6A 5CJPA 5JSZA 3ZLJA 3C5EA 3N3BC 1EM8B 2NOAA 1Q1NA 1EDBA 3K2IA 1QLWA 3ZIUA 2R87A 3KSRA 1XOIA 3L7JA 2ONYA 1JIJA 1B4DA 3LO8A 4OJQA 4R41A 5DE3A 5EKSA 4ZU3A 1N3YA 3SJCA 2G3YA 5I4IA 1H5NA 1NWCA 1T35A 2CXOA 1GQSA 1IDN1 1K2WA 1G41A 4G4JA 4DANA 1ZOLA 3NFRA 4YMHA 3GLGE 3VJLA 1P1RA 1YCFA 3I0NA 3JX9A 4I14A 5F35A 4D6PA 4E5UA 2O8CB 2OZLA 1RC8A 2VKTA 4WVLA 1OPRA 2EW8A 2REXB 2ZBUA 2XV1A 3A26A 1PR6A 3U62A 4YT8A 5MF6A 1R8YA 3GLSA 3F4BA 3G0HA 2ZRLA 3ZZUA 4M1YA 4L4SA 3BK1A 4LZPA 5D5QA 4AY2A 3R3UA 1F7VA 5TARA 4CUZA 3COJA 3H2ZA 4WXHA 1VMAA 2P69A 3NVKI 1MFPA 4FD3A 2Z6UA 4YECA 4FBGA 3SLRA 5B7PA 4H08A 1Q0ZA 2OFXA 1CVIA 1HT0A 2K2WA 2XMGA 2A58A 3ZXIA 2RBGA 5BPHA 3RAGA 5KKCA 1L5NA 3W4JA 1SFRA 2RKWA 4BY9E 4U7GA 2BGKA 1J8MF 1JH8A 3BTOA 2FPPA 1JSRA 3N70A 3H18A 1DO8A 4BWFB 4HAVA 4RJIA 2YYZA 3HA2A 1VKZA 1F2UA 3TW6A 3AUJB 2B25A 1USIA 4MW9A 2X86A 5SZHB 2R8PA 4CMKA 3GLIA 4WXYB 2CYBA 4AZ3B 1E6UA 2VRCD 3F9RA 2BKLA 1VLVA 3NVMB 4KFRA 2MR5A 4Q1VA 1FP6A 2Q3CA 1M1XB 1YH3A 2AXEA 3OQMA 1NA5A 5JAMA 3D3KA 3RV4A 2HI0A 1VXOA 4PQFA 1DINA 3UW1A 3I12A 1UBMS 3ELBA 3HKDB 4HH4A 4HDRA 4KV7A 5IX8A 3EB9A 2W4MA 4UM5A 1P2SA 5F33A 2Z2XA 4X1KB 3QU4A 1MV8A 1NE7A 4Q82A 5CFPA 2LUOA 4FS3A 5HKBA 2HCTA 2A57A 4HEA1 1JAYA 4X54A 1AXGA 4ZJUA 1BHQ1 4YAKA 1P1FA 1J6UA 3R6TA 1YQDA 2J9RA 1Y37A 1I7LA 3K6JA 4ZXFA 3RTCA 2J07A 4YRAA 1Y48E 3KJNA 1RLJA 3ESXA 1G6KA 5ILGA 1NHGA 2ZTHA 1L5RA 2JI4A 3LU1A 1AB5A 4H7DA 1LSOA 1YJBA 4FNAA 4GT1A 4UHEA 2C42A 3NGLA 4TMXA 3JQAB 2BHSA 3GL9A 1MW9X 2IOHA 1FLAA 4OKSA 2E5LB 1SUFA 3KXIA 2I34A 3FNGA 1ULAA 5E8RA 1JFSA 2HF9A 3FSRA 3NTOA 3WV4A 4Y8VA 3GJXC 2XEDA 1D9ZA 4RPCA 4YAEA 2WV7A 5ALDA 5TC4A 4OHWA 3OO0A 4HN4B 1VL8A 4C7XA 4TWJA 4KMRA 4M98A 2GEKA 1AGYA 3V1TC 4FK8A 1FSZA 4JBHA 1R5JA 4RWZA 3QFSA 1Q6ZA 3RYFB 3IODA 2DT5A 1WP4A 1P4RA 1TGYA 2O2CA 2XBUA 3IDSA 3F67A 3LCJA 4GS5A 3GGPA 4ZQFA 2J67A 2JS7A 3TQHA 1GTSA 1JMVA 1I0LA 4H1HA 3CM0A 3IVAA 1IVNA 1YI1A 4RXUA 5CX1A 5B3AA 2XH8A 4MA0A 4F3TA 2ZBVA 4HB3A 2ECKA 1GSIA 2QDXA 3BAZA 9LDBA 4BQIA 2JLXA 5DT9A 1QHIA 5K0CA 3JVEA 1QHNA 3F5MA 1G5IA 3KWFA 4AICA 4P86A 4DSOA 4RQTA 1RYDA 1PV2A 4X45A 2V74B 3EVAA 2GI4A 3HG7A 3QE0A 5C18A 2ODPA 4BX2A 1GNLA 5TEWA 5B1EA 4DSNA 4TMYA 1UKCA 2VP9A 4ZOAA 5ER6A 4II2A 2G25A 4TL6A 3SXUA 2O48X 2VDPB 3IO5A 3R0VA 1LNSA 2X5JO 2FZ5A 4WNCA 5AI0A 1IBSA 3TOXA 4DLVA 5DVZA 3IOCA 4HNHA 1AF7A 3M4NA 3N53A 5GJBA 4YO8A 1GZ6A 4GZ3A 5KIAA 3G8CA 4DIFA 1QE5A 4RHFA 4FSHA 2BEVA 4KQCA 4Y2QA 4M1ZA 3Q6MA 4P53A 4YWJA 3TB4A 3X1MA 4BJ1A 1R0ZA 1YS6A 1Z15A 3P4XA 4KIUA 5EJ2A 2QJWA 4J1NA 3LUDA 4BLTA 3H99A 3TZ6A 4G9BA 4DNFA 1LLFA 4WCFA 1OC2A 1M10A 3DVSX 1BQ3A 2PRJA 3ZHUA 5CD1A 2POQX 3GDFA 3U7QB 1GEGA 2UUBB 4M1KA 4E51A 3L6CA 4RLQA 5DM70 2OO5A 4FYJA 4CZ2A 2OHVA 4FLMA 2WRZA 1YONA 2B3TA 2D2EA 2PH1A 5B12A 3C45A 2NPIA 1G9TA 4C43A 5LMZA 5GQSA 4OHKA 1CUWA 1JE1A 3V3TA 1W4ZA 3C6MA 1M2HA 2E87A 4C7BA 2BEVB 1H0RA 1XROA 1OT3A 3WYDA 1TOAA 1JR2A 3OFVA 4X3OA 2YW9A 4UBJA 1XF9A 1J4AA 4O4HF 3CVOA 3OP4A 1V5GA 1NP7A 4E6EA 2JGDA 4HWPA 3DNFA 4R2WA 4CEIB 4XIGS 5CIQA 2QV7A 2FETA 2SNIE 3IAS6 4CIVA 2YJ3A 5IAJA 2VTDA 3BZBA 4MJ7A 3P0RA 5H83A 4EI7A 3S1SA 1T4CA 4YXFA 1WTAA 4M0PA 4JVOA 1NATA 3B3JA 1KYTA 3IOYA 4R05A 5EGSA 5A7HA 4MWEA 4DOMA 3NTLA 3L7MA 1KYWA 2BZ1A 4ICIA 2AC2A 3KOOA 1DAFA 4DAOA 1IRXA 1G7TA 5K3EA 2CF5A 1AA6A 4OX9B 2J9ZB 3A6FA 3TMYA 3OZEA 3RVSA 2BAGA 1R6AA 4X1IA 3DMNA 4IM7A 1VE6A 4RZ2A 2ZXFA 4DHEA 4LY3A 4WEOA 1SG6A 4OP3A 4Q21A 3IT3A 3PQEA 4Z4GA 3DPSA 2C2BA 4LJ9A 3PX7A 2W6CX 2HHAA 3JZAA 2RHOA 3R6DA 1W4LA 4N7JA 1ZA2A 4FFOA 4TYNA 1UK9A 2C9YA 1U7UA 1Z6QA 2QUHA 1JFTA 1OCEA 5G0TA 3GJYA 2CFCA 3PRYA 1KVUA 2VDKB 2BFEB 4MV3A 4B4UA 4J7XA 1ZCFA 2OGWA 5EE5B 1WW3A 4Q4CA 3I42A 5EKDA 5GTDA 4QGGA 5E3IA 2QL6A 5KYTA 2IY9A 1E9EA 3DEAA 3I52A 3KX2A 1AS3A 4FNOA 3RRJA 1P0PA 1U8AA 1KARA 1OMOA 2NVOA 5ARCA 5I9MA 4C7KA 1U94A 1V11B 3VVMA 4XQ0A 4MQEA 4QFBA 3ZWBA 5HOEA 4MH0R 2VJMA 1UDCA 3JD2A 5EAIA 3VYRB 2JVJA 5KQPA 1XZHA 5EG5A 2HQBA 2C9CA 1ZZEA 5B4UA 5E1BA 1XQ6A 1FSGA 5K8CA 4IO1A 4EO4A 5EJ4A 1ORWA 1W49A 1WUTA 1ID1A 2Z95A 2AOTA 1UBHS 1MVOA 5IT0A 3PEYA 2MSEB 4RYDA 1IY0A 2JFQA 2C8KA 3HBAA 3L7NA 3SQLA 1DIHA 1PJLA 1VQ1A 2IYAA 3K1JA 4RELA 2V1XA 1K7CA 3FF1A 3RFVA 4OJKA 3K4PA 3TLEA 5IPFA 1Z4OA 2XE8A 4WOBA 1R8JA 1HYHA 1KO5A 3OM9A 5C5IA 2W6ID 3B85A 3OPYA 2VOJA 3R3HA 1N5KA 5KI6A 3THYB 3ZHOA 5JSUA 4ND7A 4ZCPA 1XJQA 2B5VA 4GIBA 1BXGB 1SXGA 5LVAA 1JKI