2BT6A

Ru(bpy)2(mbpy)-modified bovine adrenodoxin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN 1
publication title Light-Induced Reduction of Bovine Adrenodoxin Via the Covalently Bound Ruthenium(II) Bipyridyl Complex: Intramolecular Electron Transfer and Crystal Structure.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 28
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bt6A00
1N61A 1FM0D 4ITKA 1NI3A 4HROA 3VR9B 1UWMA 1ZUD2 3AEAB 1FRRA 2BS2B 3AM9A 4WQMA 5H92C 4ZHOA 1XLPA 2PVGC 1XLQA 2W3RA 1FMAD 1QOFA 3HRDD 2LEKA 1RWSA 3LB8C 4YTPB 5EE1A 5AUIA 4YT0B 4ZOHC 2H89B 2WDVB 1QT9A 1VDVA 3W9CB 3AE2B 1WRIA 1JWBD 5EE3A 1FXIA 4IDIA 2BS3B 4N59A 1NYRA 3AE6B 1YJJA 4A9AA 4WWMA 4HRSA 1AYFA 4KX6B 2WDQB 1NVID 2WP9B 3NVZA 2WDRB 4US8A 1L6VA 1F0ZA 1TKYA 3P4SB 4US9A 5EE9A 1NENB 2CU3A 1DGJA 1I7HA 2BS4B 1YQ4B 1ROEA 3HVZA 2QIEB 4C7ZA 5C3JB 1FFUA 3SFEB 2AX5A 3NVYA 2JQRB 1TKEA 2K5PA 3ABVB 3AE5B 2WU5B 3B9JA 3P4QB 4C80A 1EWYC 5MPOA 1N63A 1CZPA 1J7AA 1FIQA 2PKOA 1QOGA 2L83A 3DWMA 4P6VF 5G5GA 3ETRA 2MH7A 1N5WA 2WS3B 4JWSC 3AH7A 3SR6A 1B9RA 2K22A 1SF0A 3NRZA 1DOIA 2W3SA 4N58A 1R7SA 4USAA 1NEKB 3BIID 3FAHA 3VR8B 3AE4B 3AN1A 1JW9D 1DOXA 5G5HA 2EKIA 1XO3A 3B2FA 3AEBB 4YXDB 2W55A 1L5PA 1JALA 1OQRA 2CJOA 2H88B 3AEFB 1N62A 3AEGB 1FRDA 3HUIA 1YJIA 1JWAD 2Q5WD 2KMMA 4N6EB 1CJEA 4C7YA 1V8CA 2W54A 4YSZB 1DOYA 3EUB2 4YTMB 3NVWA 1KRHA 3AE1B 5GXGB 2MJDA 1XLOA 1ZXIA 3AEDB 4LTUA 3W5VB 1FXAA 1OFFA 1PUTA 2OHFA 1E6EB 2MJ3A 1PDXA 3KWLA 1RYJA 1N5XA 1OQQA 1QOAA 3AE3B 1KFYB 3AV8A 1FFVA 3DWGC 1GAQB 3AE7B 1V97A 4FXCA 3CWIA 2BT6A 1E0ZA 1JQ4A 3AE8B 2PVOD 2M19A 2ACZB 3SFDB 3AMZA 1QF6A 3FC4A 3PO0A 2WQYB 1E7PB 1J7CA 2MJEA 3L4PA 1WGKA 1GPXA 2PIAA 2QJLA 3AE9B 4YSYB 1SIJA 2DBYA 2CJNA 3NVVA 3RPFC 1L0VB 1A70A 1L6UA 5H8YE 4YSXB 3VRBB 3AEEB 3B2GA 1YQ3B 1JRPA 1SB3C 1QOBA 2B76B 1FO4A 1RFKA 2HTME 2N0SB 3NS1A 1E9MA 3P63A 3P1MA 2JX5A 2M56B 2E3TA 1TJEA 2G1EA 1WXQA 1AWDA 3AB5A 1E10A 1WYGA 2DWQA 1NYQA 2L52A 3LXFA 1VJKA 3WCQA 4JWUC 1J7BA 2FBWB 2KAJA 5EE0A 4ZHPA 1RM6C 1WWTA 4JX1C 1VLBA 1JROA 2WU2B 3CIRB 1XLNA 2K9XA 2Y5CA 1KF6B 5C2TB 1TYGB 1ZP0B 3P4RB 4YTNB 3VRAB 1ZOYB 3W5UB 1IUEA 1PFDA 1QLBB 1TKGA 5AUKA 3ZYYX 3P4PB 2WLBA 1N60A 3AECB 1T3QA
chains in the Genus database with same CATH superfamily
3AEAB 1VRAB 2M17A 4A20A 5DPWA 2LEKA 1A5RA 1GJZA 2HTHA 3AE2B 2E6XA 2ZW0A 2BW2A 4XYCA 4WWPA 3DBSA 1ZXHA 3P2BA 1UBIA 3HVZA 1ROEA 1F9JA 3L17A 4LCDE 4NZLB 1F1HA 2DAFA 2GRIA 1N63A 4ASWC 1MG8A 2RGFA 4P6VF 1YN3A 4K1RB 3QAQA 5G5GA 2HD5B 2M4NA 4LNNA 4AP4C 5BYQA 2AL3A 5G5HA 1C77A 2HDEA 3L0WB 3Q8AA 1BMLC 1EF5A 3L10B 3KW5B 2J7QB 1TBEA 3T9LA 4FULA 2JF5A 4HKQA 4Q2JA 2IO1B 1R4MI 1SBBB 1WGHA 2BT6A 4LNFA 1JQ4A 1WIAA 3EC8A 3GS2A 1MHHE 2QCZA 2K6DB 1HXYD 2CHWA 4ACFA 1NDDA 1T6BX 3VXWA 4B95A 4YSXB 2IDYA 1KJTA 2J53A 2K8HA 4M0WB 3LXFA 3W1YA 2FBWB 1D6EC 1TY2A 3NOBA 1N6ZA 3DHIC 1TS4A 4MGYE 2L32A 1TKGA 2Z0EB 3BY4B 2AQ3B 2WLBA 1T3QA 1NI3A 3AM9A 3K9OB 3B0AA 1XLQA 1QOFA 1VDVA 2DYOA 3MHSD 3TMPB 2XK5B 3ZDMC 2BYFA 2KVZA 3PTFC 4TUUA 2DX5B 4HRSA 1MFWA 2A4ZA 4WURA 2LMCA 1F0ZA 4IM0A 2FUG1 1ENFA 1M94A 3PHXB 1UELA 3AE5B 2KACA 5BMIA 5D3IB 4WIPA 2Y3AA 1SJHD 4KZ0A 1DOIA 3ZGZA 1NEKB 3OG5A 4II2B 3VQIA 4GDKB 1DOXA 4FHJA 3R2IA 4EEWA 2H88B 1WX9A 3AEFB 4ICUA 4A3PA 4QAYA 2KWCA 2BTEA 3WAMA 3NJTA 4EUTA 2XEWA 1XLOA 2KLGA 3W1SA 4YWGG 5HFYA 4M0WA 1QOAA 3R2TA 2NBUA 3KQ4A 3MP9A 4MACA 3UI3A 2EMSA 1RAXA 3I57A 5CHVC 3IVFA 3RN9C 1XT9B 1OEYJ 1EM7A 5CX3A 1J7CA 3L4PA 1V81A 2JT4B 5FR3A 2ON8A 3BK2A 1S1QB 4ZRPA 4FBJB 5JHAA 3U30A 2B76B 3OJ3A 4ARIA 4JQWC 3P63A 3DBRB 2LVOA 4W9FA 3VTVA 2XK5A 4ZYNA 3VH4B 3I5JC 4W9CA 3T3OA 4GMVA 1C3TA 2K9XA 2PE9A 3P4RB 1D4BA 4M8NA 4WQOB 5LLIA 1N61A 1Q5WB 1KTKA 3QHTA 2WXHA 4B9KA 1YIWA 1ZW7A 2BYTA 2K0PA 5DCNA 2RD0A 4GDKA 4CO7A 3NZ3A 1HEZE 3ZQ4A 4HLEA 1YMHE 1V1PB 4IUMB 2BB6A 1STEA 3N1XC 4MH0E 1P7FA 4XDCA 1J7AA 4DHZE 1I4XA 4TSSA 4RM9A 2ZCBA 2BF8B 1WGDA 2WXLA 1R7SA 2QC8A 3AN1A 4WAAA 3BVMA 1UUPA 1FCCC 2O2VB 1C4AA 2KMMA 2B3AA 3ZKJC 1Z2MA 4E74A 2KOXA 4LTUA 1WSPA 1WXMA 2MX2A 1RYJA 4KDLB 2ZNVB 4PYZA 3DQVA 1D5ZC 2VZKD 4DK5A 3AE8B 2PVOD 2M19A 1WYWB 3PGEA 2JY6A 3PO0A 2FE8A 2MJEA 2ZCCA 5BMGA 4JE3B 2GI9A 4L1BA 1VR9A 2MBBB 4ANVA 2WXIA 1QOBA 3KYCD 4I6NB 3PZ7A 2PJHA 3VVWB 2A5UA 4PS3A 3EGRA 2NCNA 1V1PA 2ONQA 1LM8B 2J0MA 1VZ8A 3AECB 3OWEB 2C9WB 1YN5A 2BWFA 2KDFB 2KQ4X 4ANXA 2WXGA 1HA5A 2H89B 4XGAB 5FK9C 1OQYA 1JWBD 2R2QA 1LGRA 2LVPA 1SIFA 3TBLD 3UGBB 2LGYA 2N4FA 2YEPB 4US8A 2O2VA 2SAKA 4OVVA 4XWTA 2V0GA 2QIEB 3Q3FA 4KKIA 1GB1A 5IOIA 2MSED 3WALA 3P4QB 3I63C 4PYUA 1PGXA 4BKGA 2XN9C 2KANA 1WXVA 4NQLB 2IY0B 2IBIB 2K22A 3DVNU 1U4AA 3V61A 3R66C 4HXDA 1ESFA 3B2FA 4YXDB 2N9PC 3GB1A 3U52E 1CMXB 1N62A 4I6PA 2MA9B 4P7IA 2Q5WD 2MP2B 2WXQA 4YTMB 2FCSA 3IFWB 5GXGB 4OVZA 5IP4D 2LGIA 4B6WA 2UYZB 2JZPA 2RDHA 3IT6B 4MDKE 4N9F4 2BWES 3K9PB 3BVGA 3JSVB 2D07B 5KHOA 3H6NA 3TJPA 3V6EB 2VRRB 4YSYB 1EUVB 3L54A 3B2GA 3Q3OC 2ZPNA 3Q3MC 3RNBC 2RMMA 2E3TA 5CHWA 3VUYA 2PTLA 4H2AA 3HHMA 3QK0A 2LUEA 3NHEB 2QEJC 4WJPA 4ANUA 3RI7C 4NAWB 1WF9A 4W9IA 4F8CB 1KF6B 1UZXB 3OAWA 1TYGB 2D5GA 4J6IA 1IUEA 4EZLA 5E6OA 3N30A 4C00A 5HI1A 2WXMA 1IP9A 1ZUD2 4KGSA 1WY8A 4W9EA 1C1YB 3VTWA 2HJ8A 3A4SC 2PVGC 1ACCA 1RWSA 2QHOA 4CYEA 1QT9A 3C8YA 3MFGA 3RNFC 3JVZX 1WMHB 4OVUA 2AQ1B 1I7HA 1ISNA 4WAFA 2MP2A 1TKEA 1QKZA 1TS3A 3E56A 3VUWA 3ETRA 1ET6A 1V80A 1K8RB 5E6NA 2KXJA 3JSVA 4HJGE 1V49A 3AEBB 3EECA 2YLMA 1WH3A 1YX6B 1JWAD 1MVKA 2VZKB 3GE8C 3OLMD 4FLHA 3DVGY 3V3XA 4CQNA 4FXCA 3CWIA 2J52A 2V3PA 2CR5A 3SHQA 2BBCA 1C79A 5KHQA 2DHZA 2L8JA 2ACZB 4NAWA 1XQQA 2INDC 2Y5BB 1WJ4A 1YX5B 1E8XA 2L00B 4AOFA 3AE9B 2JXXA 2J42A 1KOTA 3UF8A 1L4ZB 1L0VB 2KDEB 1GC7A 1JRPA 1FO4A 2FCMA 2JX5A 3ZW3A 4M00A 2JSVX 4W9JA 5EE0A 4FADA 3CIRB 3SDLC 1WMHA 4NQKE 1SEBD 4ITKA 3VR9B 1UWMA 4ZHOA 4B0EA 1V86A 2KDMA 5EE1A 3M63B 4LNKA 1EU4A 4IDIA 5G2NA 1MG4A 1YJJA 5BO4B 4KX6B 2WDQB 2NR2A 2WP9B 2IGHA 4IOIE 1WJUA 1TKYA 2MHJA 3WAOA 1R4MB 5C3JB 4ZRJA 2Z8LA 4GDLB 2WX0A 3DCGA 5DPRA 4RH6A 4HPLB 1MHXA 3M95A 2L83A 2WGSA 2GLSA 2JRHA 2KC2A 3DHGC 4XWWA 1L4DB 5E6PA 4A90A 1ET9A 2KFKA 3HIZA 1TY0A 1OQRA 1YD8U 2MW5A 3IG3A 4KGTA 2W82A 2LI5A 1V8CA 4IKGA 3ZNGC 4OZBA 3PV1A 1ZXIA 1RFAA 2IO3B 2KX0A 2AWTA 5DPSA 1F2RC 4EZKA 2MQJA 1HQRD 3MTNB 3SFDB 2NMQA 2MLBA 1Z5SB 2KZRA 4IG7B 4GGQA 3RT3B 4TQ1A 3U7ZA 3MC0B 5IAAC 2JZZA 4DBGA 3P1MA 1TJEA 2KYWA 1WYGA 1NYQA 3AU5A 4AWJA 3B1LX 3ZLZA 2SEBD 4X57B 2BKRB 2Y5CA 1ZP0B 2KQ7A 3AI5A 2D3AA 4TV3A 4GDLA 4KGRA 3T8MA 1ZGUB 5G55A 4D2KA 4W9KA 3QA8A 1V5TA 4AJYB 3C0RB 3LJ3A 1NYRA 3C19A 4A6QA 4G0NB 2BKFA 1FXTB 5HKHA 5EE9A 1DGJA 5FKAC 2GOWA 2KJ6A 3A1QB 3ML9A 5MPOA 1BUIC 1UWXA 3V60A 3PVLA 3ZXVA 5AEKB 1V6EA 1B9RA 3J9CA 4N58A 5D3DA 1HZ5A 3CF6E 3R3MA 2IY1B 4USAA 4MGZE 2AEHA 2FIFA 4L2YA 4DDGD 1X1MA 3LYYA 2PEAA 4XZ4A 2OOBB 3TUOA 1YJIA 3WIMA 5J17A 4N6EB 3OJ4B 1TTNA 2XNAC 2KWUB 1T0QC 1E7UA 2BGFA 3ZDTA 2AL6A 3RD2A 3KWLA 1OQQA 2Z59B 4FJYA 2ZVOA 4CHKA 2DENB 1PQSA 2I1KA 5CTRC 1MJDA 1L7YA 1I4QA 1E7PB 4HDQA 4BBNF 4TKNA 2JPHA 2AYOB 3HK0A 3ML8A 3PRZA 1SIJA 1ZKHA 2LWPA 2ZJDA 2KC1A 3JW0X 2RPVA 3BZDB 4NJ6A 4HK2A 1FCLA 1WE7A 2M56B 4KDIC 4BKSA 2G1EA 3X23A 1F2RI 5I4DA 4BFRA 1VJKA 2RSUA 3LDZE 1YQBA 4ZHPA 2C5LC 1WWTA 3EHVA 1JROA 1SE4A 1PYWD 2INPE 3PLUA 1QLBB 1XXGA 4L23A 2W9NA 2KQSA 2M0XA 5LXHA 2N9XA 3A1QA 3WA0A 1FRRA 2BS2B 5H92C 2DZKA 1TZ1A 3R7RA 4GSWA 2LHEA 3O13A 3LB8C 1UBQA 2IGGA 1VZ7A 3A4RA 3VTUA 2MWSB 2WXNA 3TCAA 2QILA 4GLSC 4KKJA 4NJ7A 1KM7A 1NVID 1LQBA 1YOVB 1L6VA 1MI0A 1LXDA 1MPEA 3DHHC 4A55A 3B9JA 2DYMA 4HJKA 2WU5B 2ZZPB 4M02A 2KN4A 2GMIC 2NVUI 3APDA 5EDSA 5IKCM 3DOWA 2W3SA 1WE6A 4BZAA 3Q3JA 1P9DU 3FAHA 1I4RA 2X38A 4I6LB 4RF0A 5AZHA 2KO3A 4MM3B 4YSZB 4JL9A 3DVGX 2L0FA 4DXGA 3RZWC 4EZJA 4II3B 3AE3B 4HWIB 2LASA 1BXTA 3R8BA 3IAM1 3SU8X 2CHXA 4LNOA 2YEPF 1QF6A 3FC4A 2WQYB 4ZDVA 4K7UA 3ZJUA 4W9GA 3ONSA 3Q2AC 1L6UA 4UDUC 1YQ3B 2MEKA 3Q8CA 1I35A 3KH0A 1OGWA 1Q10A 2WXPA 2UU7A 5C23A 3PHWB 4GN1A 4NJCA 1ZOYB 1C76A 3MJ5A 3L16A 2J0JA 3ZYYX 1LFDA 4WJNA 5L95C 2M0AA 4FJVB 4IM2A 1P1AA 4WQMA 4XE0A 2K8BA 3NUHB 1WFYA 3ZRFA 1WRIA 1GOZA 1SJED 2DYBA 4AJWA 3GE3C 1PGAA 1TT5B 1WJ6A 2WDRB 4P16A 3PSEB 1WM2A 1YQ4B 4MM3A 4HKZE 3NY5A 4IWOA 2G9HD 2YVCA 1E5WA 3RULA 3MC9A 1EWYC 2N7JA 1V1OA 1WXAA 1UNSA 2LGSA 4P1CC 3SD5A 3D32A 2D3GA 3A9JB 3AU4A 5J2RA 1FPYA 3BIID 3KUCB 3AE4B 3ZJTA 3VH3B 4IM3A 3SEBA 5D2MB 4EE2A 2ASQA 3PREA 4O1NA 3H9DA 1F52A 3H8HA 1RLFA 4ARCA 3ZTDA 1H8CA 2IYDB 3W5VB 1FXAA 2KHWB 4FHKA 2DZJA 1D3ZA 1GNUA 1GAQB 2C7NB 4K7SA 2D3BA 3N9YC 3GZNB 3VHTC 4W9LA 2X8XX 3DPDA 2BQQA 2IZVB 1XCTL 2KD0A 3NVVA 1QILA 2ZEQA 1TS2A 4BOSC 5IA7A 2KX3A 5TSSA 1E9MA 5LNK1 4RGNA 2LGXA 2L52A 1JWMD 3RUIB 4F7ZA 4K81A 1RM6C 5JH5C 1EO6A 3NG0A 5C2TB 3ZXRA 3ALBA 4HPMB 3W2DA 3A33B 1WXSA 4HROA 2JYEA 2GB1A 2CU1A 1WJNA 4ZYSA 3A9JA 3BK1A 1C78A 2REXA 3PS6A 3DBLI 1K51A 3KUDB 2VH1A 4M01A 1AYFA 1C9FA 2K8CA 4LJOB 2LRWA 4US9A 1XEEA 3APFA 1XD3B 5D6JB 2C7HA 4C4VB 1K50A 4C80A 3V62A 4JGHB 4PT5A 1QQRA 2EMTA 1SE9A 3GZNI 1I4PA 2KMCA 2MRPA 2AQ2B 2G45B 3RYTA 5D7GA 4BKSD 2DLBA 1L5PA 3ZVVA 2MBHA 1L0YB 3HUIA 4HEA1 3DDCB 5IO9A 5BMHA 2MBQA 2ZW1A 3EUB2 3NVWA 1WRDB 2K39A 3UQAA 5HG2A 1WZ3A 2K6QA 3ZO5B 1V97A 2KTRB 2LGDA 2N7DA 2DZMA 4G50A 5CHFA 3M3JA 2JZ3B 4RGMA 5JZEB 4MGIE 2DBYA 3Q6BA 4KVGB 3IBEA 4NPNA 4BOZB 1ZDXA 3GOEA 3QCAA 4IWQA 1Y8RC 4PK1A 2CS4A 2C60A 4HPPA 3Q3NC 2MBOA 4YTNB 2NTSA 3VRAB 1PFDA 1WX7A 2JU6X 4K3CA 4C4VA 4HVBA 1IBXB 2IJ0A 1AW7A 1Q1OA 1V9JA 2GBJA 4URKA 2NBWB 2WDVB 5J18A 2L0TA 5EE3A 3HM6X 1TS5A 3QX1A 4PS7A 5AZGA 4RGOS 1UGMA 4TQ0A 5HHDG 2R61A 2KWVB 2M1MA 4NY0A 2JWZA 1H4RA 3ZRCA 2K5PA 2PE6B 3R7QA 3KWVA 3BYYB 3TEWA 2MH7A 1WGYA 1DYQA 1SF0A 4IC7B 2OJRA 1NBFC 1TZOA 1I42A 2NTTA 2KMAA 1HTQA 3VDZA 4K7WA 2W55A 1V2YA 1AARA 1AN8A 3AEGB 1YN4A 2N9LA 4YL8A 2KT7A 2W54A 1K52A 1IGCA 3AE1B 3L13A 1CQVA 1OFFA 1E6EB 1OEYA 4RNAA 1FNVA 1KFYB 3DWGC 4R3DA 4LDTD 2LJ5A 1UD7A 3PZDA 2MBEA 3AMZA 2HE7A 4WWOA 1WI0A 2NBVB 1Y56A 1WGKA 3TL5A 3NS8A 1T5XD 1WX8A 1IBXA 3V05A 3RPFC 3AEEB 1L0XB 2DNFA 4HDOA 2HTME 3RFZB 1E10A 1JCKB 4C56C 2IGDA 3PRPB 4JWUC 2KTFA 1J7BA 2KAJA 3BWUD 5BYSA 4TMAB 1WGRA 1XLNA 2LFIA 3WANA 1RRBA 3W1SC 1P0RA 2EKEC 3A9KB 4A3OA 2QMTA 2PW9A 3RNEC 3Q14C 2ZPYA 2OEDA 4OW0A 1KH0A 1CK1A 1E7VA 3AE6B 4WWMA 3FILB 2RPQA 2WHIA 2K3UA 3NVZA 2LHDA 4FA6A 3RNAC 1T0SC 3RZFA 1T0YA 3H1UA 4DWFA 3ABVB 2WXJA 1M4VA 1CZPA 1FIQA 2CKHB 3DWMA 3U4EG 5JXVA 1L2NA 5D94A 1SE2A 4MSMB 4BAXA 2KWDA 4DHJD 2N9KA 3B08A 2WNMA 2MCNB 3BINA 3PPAA 1HE8A 1D5XC 2KDIA 3N20C 1YJ1A 1SXTA 3RMKC 2DAJA 1KRHA 2MJDA 3N3KB 2OHFA 1D5MC 2MJ3A 2RDBC 4MJSB 1P3QU 3IHPC 4RFBA 3AE7B 3VAWA 4BKTA 1OTRB 2GBKA 1T0RC 3E9SA 4E3CA 3HVDA 2KJRA 2GBRA 5IN7A 1GPXA 2PIAA 3A9KA 2NPTB 1UH6A 1PGBA 5H8YE 3VRBB 1SB3C 3V6CB 1LO5D 2JWUA 2N0SB 2WXFA 2V3SA 2KKCA 4DHZB 3BVZA 3AB5A 2DWQA 4IWPA 1JWUD 1QZEA 4FN2A 1K53A 3H7SA 3FILA 2LRUA 3QQ8B 4MEMA 3MJWA 1E90A 2Y5PA 3UIOB 4GXBA 3U2SC 2LZ6A 2J4XA 3ZNID 2PMVA 2V9HA 2W3RA 3KUZA 2INCC 4ZOHC 3RNGC 2FCQA 2N9EB 3O65B 4A9AA 4HCPB 2WXKA 2DZIA 1KLVA 4LNIA 1EU3A 2QSDA 4KZCA 3GP7A 1NENB 4B0MA 5E6JA 3Q8EA 1FFUA 3SFEB 2K1FA 3N32A 2LJIA 2PKOA 3I3TB 4G11A 4MJSA 3SR6A 1N5WA 4OHJA 2IO0B 4BBNC 3NRZA 2J0KA 2O6VD 3QIJA 1TGZB 2LXCA 3JYUA 4KSKC 1EF1A 1JALA 2IO2B 2G4SA 2NPTA 2BVCA 3ZIMA 3T3NA 3AEDB 3W9CB 1PUTA 1WR1A 4LDTB 2L7RA 2WWZA 4DQOC 2L76A 3PLVA 4MT5A 1E0ZA 4BVUC 1HZ6A 2HJ1A 2JRIB 1C4CA 2QJLA 4JIOU 2ZNVC 2R2OA 4XX5A 4ZRQA 2CJNA 1HTOA 4WWNA 2JYTA 2EELA 3NS1A 3L08A 3AXCA 3MHZA 3WCQA 4GB9A 2L3ZA 4KV2A 4J3OD 4WJQA 3M62B 1JWSD 5GMVA 4OZAA 3AH7A 1YNTE 3QJZA 2KJHB 2WXOA 3U7DA 2K25A 4AUQC 3DVNV 4YTPB 4XDDA 1J0GA 3TEYA 1GUAB 4PS8A 3PT2B 1ZPSA 1SE3A 3X0WA 4EOYA 4OZCA 3MC8A 3P4SB 3DBRI 1KLUD 4C7ZA 2FIDA 4RMAA 1QOGA 1WGGA 4DHJB 1VZ6A 2D3CA 4JWSC 2WS3B 3Q8FA 4MH8A 2N1VA 2NS5A 4DXFA 1Q0WB 1SSNA 2IPKD 1B1ZA 1WR6E 2LXAA 3I9V1 3UINB 4RF1A 4GIVA 2V4IB 2EKIA 2GBMA 1S3SG 1FRDA 1GG3A 4NNJB 2C7MB 2BB5A 3AULA 2M8SA 4MSQB 2LD9A 3CSFA 3TSSA 3UQBA 2BYEA 1N5XA 5LXIB 3AV8A 1FFVA 3IXSA 2ZVNA 1E8WA 2WXRA 4DXAB 5T8IA 1EWCA 2L05A 1I4HA 1SGHA 4KIKB 3EFUA 2LVQA 1ZDVA 3VFKA 3DBLB 4ICVA 1R4NB 1E8ZA 1IPGA 1F77A 3PZ8A 2VH2A 2INNE 4EKUA 1RFKA 1WXQA 1AWDA 4WJOA 3TEZA 4RGTA 4FJZA 3ZNHB 4JX1C 2JUOA 1VLBA 1V5OA 4P1BC 3QC8B 2PLPA 2V1YA 1XLPA 5JHBA 2WDTB 1FMAD 4GU2A 4YT0B 2BPSA 2I38A 5TR5A 4XC2A 1KLGD 5C1ZA 4W9DA 2BS3B 2Z0DB 4DDID 3P42A 2FCNA 4N59A 1UGJA 1WM3A 3BYTB 2CU3A 4NAMA 4K3BA 5BYRA 2AX5A 3NVYA 1FEHA 4G3XB 3ECIA 3RCZA 5L83A 3DBHB 4F1SA 2KVRA 2O6VB 4ZRKA 4ZRIA 3TIXA 4M8MA 3ZTCA 3N1ZC 2GBNA 2JVCA 4RM8A 1FNWA 1R4NI 1VCBA 2LUMA 1JW9D 5FR6A 4KIKA 2TSSA 2WX1A 4GOCA 2D10A 3UIPB 2L1AA 2XBBC 1CJEA 4C7YA 4LK0M 2FAZA 4MGKE 1DOYA 2CHZA 1IYFA 1G6JA 1PDXA 2QDFA 4RCOA 1FD6A 1GC6A 4AQ7A 2G4DB 3CMMB 3ZUNA 2JXTA 4KSLC 1A70A 3Q8BA 2KLCA 2KDBA 2KFJA 2N7EA 1WZ0A 3CSTA 3IAS1 1VD2A 2WYQA 3QARA 3EA6A 2V3NA 3DBHI 2I2YA 4WH4A 4EFOA 3NZUA 1FM0D 4A8XC 4HCNB 3HRDD 2O6VA 5AUIA 2KN5A 1GB4A 3VUXA 1FXIA 1ZE3D 3Q69A 3S2AA 3NZSA 2D11A 1FNUA 4IW0A 2BS4B 3H7PB 4MELA 1NI2A 3KLSX 4JLCA 1BT0A 2KK8A 2JQRB 3TEXA 3FKYA 3URYA 2N1WA 3N1YC 1TIFA 4E71A 2RR9A 3VR8B 3ZJVA 1P98A 2KFKB 4AS1A 1XO3A 3RNCC 1E8YA 1P7EA 2CJOA 2RDGA 4LLGM 2FUHB 4REZA 4S0RA 2V4LA 3QWZB 2FNJB 2PPHA 4ANWA 3APCA 2KTRA 2KNBA 2OJWA 1IGDA 3ZNZB 4S17A 3IT4B 3WAPA 5DPTA 2BYVE 3U8ZA 3HM3A 1UF0A 2ICIA 5AZFA 4LJPB 2G3QB 3PRMB 3ENEA 2I1JA 1J8CA 2UWQA 1JMLA 1I4GA 1JRUA 4W9HA 2D2QA 3KVFB 3KYDD 1XCQL 3EFCA 2WU2B 1XF5L 1J19A 3W5UB 1C4PA 3H7PA 4JPSA 5AUKA 3P4PB 1N60A
chains in the Genus database with same CATH topology
2M0AA 1ZUD2 3AEAB 4KGSA 2PMVA 4WQMA 2PVGC 4XE0A 1VRAB 2W3RA 1ACCA 2LEKA 1RWSA 4ZOHC 3NUHB 1QT9A 3AE2B 3C8YA 1WRIA 3MFGA 1GOZA 1SJED 2E6XA 1PGAA 2ZW0A 4A9AA 2BW2A 2WXKA 1ZXHA 2WDRB 1EU3A 2QSDA 4P16A 3GP7A 1NENB 2AQ1B 1I7HA 3HVZA 1YQ4B 1ROEA 4B0MA 5E6JA 4HKZE 3Q8EA 4WAFA 4NZLB 1FFUA 3SFEB 2G9HD 1TKEA 2GRIA 2LJIA 1EWYC 2N7JA 1N63A 1QKZA 2PKOA 4P6VF 1YN3A 1TS3A 1V1OA 3E56A 1UNSA 5G5GA 3ETRA 3SR6A 1N5WA 4OHJA 1ET6A 3NRZA 5BYQA 3BIID 3AE4B 4HJGE 5G5HA 3ZJTA 1C77A 2HDEA 3Q8AA 1BMLC 3AEBB 1JALA 3SEBA 4EE2A 1JWAD 4O1NA 3H8HA 3T3NA 4ARCA 1MVKA 3AEDB 3W9CB 3W5VB 4Q2JA 2VZKB 1FXAA 1PUTA 4HKQA 3V3XA 4CQNA 4DQOC 1GAQB 4FXCA 3CWIA 2J52A 4MT5A 1SBBB 2BT6A 2V3PA 1E0ZA 1JQ4A 2BBCA 1C79A 3GS2A 1HZ6A 2ACZB 3N9YC 1MHHE 1C4CA 1HXYD 2QJLA 1T6BX 3AE9B 4ZRQA 1XCTL 2J42A 2CJNA 3NVVA 1L4ZB 1L0VB 1QILA 2JYTA 4YSXB 1TS2A 1JRPA 2EELA 1FO4A 3NS1A 5TSSA 1E9MA 5LNK1 2JX5A 4RGNA 2IDYA 2J53A 2L52A 2JSVX 1JWMD 3LXFA 3MHZA 3WCQA 2FBWB 5EE0A 1D6EC 1TY2A 1RM6C 3CIRB 4J3OD 5C2TB 2L32A 1JWSD 1TKGA 4OZAA 2AQ3B 2WLBA 3AH7A 1YNTE 1SEBD 1T3QA 3W2DA 4ITKA 1NI3A 4HROA 3VR9B 1UWMA 4ZHOA 3AM9A 2WXOA 4B0EA 2JYEA 2GB1A 1XLQA 1QOFA 2KDMA 4YTPB 5EE1A 4XDDA 1VDVA 4ZYSA 3BK1A 3TEYA 1C78A 1EU4A 2DYOA 4IDIA 1K51A 1ZPSA 1SE3A 1YJJA 4HRSA 1AYFA 4KX6B 2WDQB 1C9FA 4WURA 2WP9B 2IGHA 4IOIE 4OZCA 2LMCA 1F0ZA 1TKYA 3P4SB 4US9A 2FUG1 1XEEA 1ENFA 1KLUD 4C7ZA 5C3JB 2Z8LA 4GDLB 1K50A 3AE5B 2KACA 4C80A 4RH6A 5BMIA 5D3IB 1MHXA 4WIPA 2Y3AA 1SJHD 4PT5A 1QOGA 2L83A 1QQRA 1VZ6A 1I4PA 4JWSC 2WS3B 2AQ2B 3Q8FA 4MH8A 1DOIA 3ZGZA 4DXFA 1SSNA 1NEKB 2IPKD 4XWWA 1B1ZA 3VQIA 4GDKB 1L4DB 3I9V1 5D7GA 4A90A 1DOXA 1ET9A 4RF1A 2DLBA 2V4IB 2EKIA 3R2IA 1L5PA 1OQRA 1TY0A 2H88B 3AEFB 1FRDA 1L0YB 2W82A 3HUIA 4KGTA 4HEA1 2BB5A 1V8CA 4IKGA 5BMHA 2ZW1A 3EUB2 2BTEA 3NVWA 4OZBA 1XLOA 1ZXIA 3TSSA 5HG2A 3W1SA 4YWGG 5HFYA 1N5XA 4M0WA 1QOAA 3AV8A 1FFVA 3IXSA 1V97A 3R2TA 1F2RC 3KQ4A 3MP9A 4MACA 2WXRA 1HQRD 3UI3A 5T8IA 3I57A 1EWCA 3SFDB 1I4HA 2NMQA 1EM7A 1J7CA 4RGMA 3L4PA 1ZDVA 2DBYA 5FR3A 2ON8A 4TQ1A 1F77A 3BK2A 3MC0B 3PZ8A 3U7ZA 4ZRPA 4ARIA 2B76B 2INNE 1RFKA 3P63A 3P1MA 1TJEA 1WXQA 1AWDA 1ZDXA 1WYGA 1NYQA 3TEZA 4RGTA 2SEBD 4JX1C 1VLBA 3T3OA 3P4PB 2K9XA 2Y5CA 1ZP0B 3P4RB 4YTNB 2NTSA 3VRAB 1D4BA 2PLPA 1PFDA 2JU6X 1N61A 1IBXB 2IJ0A 1AW7A 4KGRA 1XLPA 4D2KA 1FMAD 1KTKA 2WXHA 4YT0B 2WDVB 2I38A 1KLGD 5EE3A 2BYTA 2K0PA 2BS3B 3P42A 4N59A 1NYRA 1TS5A 3NZ3A 1HEZE 4A6QA 3ZQ4A 4RGOS 1UGJA 1YMHE 1V1PB 3BYTB 4TQ0A 5EE9A 5HHDG 2BB6A 2CU3A 1DGJA 4NAMA 5FKAC 2R61A 1STEA 5BYRA 2AX5A 3NVYA 1FEHA 1P7FA 2K5PA 4XDCA 5MPOA 3KWVA 1J7AA 1BUIC 1UWXA 1I4XA 3BYYB 3TEWA 4TSSA 2MH7A 1DYQA 2WXLA 1B9RA 1SF0A 3J9CA 4N58A 5D3DA 1HZ5A 1R7SA 1FNWA 4USAA 1TZOA 2LUMA 2NTTA 3AN1A 1JW9D 4L2YA 3LYYA 3BVMA 1UUPA 2W55A 1FCCC 2TSSA 1AN8A 3AEGB 1YN4A 3TUOA 1YJIA 1C4AA 2KMMA 2N9LA 4N6EB 2L1AA 1CJEA 4C7YA 2XNAC 4LK0M 1DOYA 2W54A 1K52A 1IGCA 3AE1B 4LTUA 1CQVA 1WSPA 1OFFA 1E6EB 4RNAA 1PDXA 3KWLA 1RYJA 1FNVA 1OQQA 4RCOA 1KFYB 1FD6A 3DWGC 4R3DA 1D5ZC 2VZKD 3AE8B 2PVOD 2M19A 3AMZA 1I4QA 3PO0A 4AQ7A 2FE8A 1E7PB 2MJEA 5BMGA 1Y56A 1WGKA 4JE3B 2GI9A 4L1BA 1T5XD 2JXTA 1SIJA 1IBXA 3V05A 3RPFC 1VR9A 1A70A 2RPVA 2WXIA 3AEEB 3BZDB 1QOBA 1L0XB 2HTME 3RFZB 1FCLA 2M56B 2G1EA 3Q8BA 3PZ7A 1JCKB 1E10A 4C56C 1F2RI 2IGDA 5I4DA 1VJKA 3EGRA 4JWUC 1J7BA 2KAJA 3BWUD 4ZHPA 3IAS1 1WWTA 1JROA 5BYSA 1V1PA 1SE4A 3EA6A 2V3NA 1PYWD 4TMAB 1XLNA 2LFIA 2ONQA 2INPE 1VZ8A 2I2YA 1QLBB 1XXGA 4L23A 4WH4A 3AECB 1FM0D 2QMTA 4A8XC 3OWEB 2PW9A 1FRRA 2BS2B 1YN5A 2KQ4X 5H92C 2LHEA 3HRDD 5AUIA 3O13A 2WXGA 3LB8C 1HA5A 2H89B 1GB4A 5FK9C 1JWBD 2IGGA 2OEDA 4OW0A 1FXIA 1KH0A 1VZ7A 1ZE3D 1CK1A 3Q69A 3AE6B 4WWMA 2WXNA 2QILA 3FILB 4GLSC 4KKJA 2YEPB 2K3UA 1NVID 1FNUA 3NVZA 4US8A 1L6VA 2LHDA 2SAKA 1MI0A 2BS4B 4XWTA 2V0GA 3KLSX 1MPEA 2QIEB 4KKIA 1GB1A 4A55A 2JQRB 3ABVB 3B9JA 2DYMA 3TEXA 2WU5B 2WXJA 3P4QB 1M4VA 1CZPA 1FIQA 1PGXA 3DWMA 3U4EG 2XN9C 3URYA 2KN4A 5JXVA 1SE2A 2K22A 2W3SA 2KWDA 2N9KA 3FAHA 2WNMA 1I4RA 3VR8B 3ZJVA 2X38A 1ESFA 4AS1A 1XO3A 3B2FA 4RF0A 4YXDB 3GB1A 1P7EA 2CJOA 1D5XC 2RDGA 3U52E 1N62A 2Q5WD 4LLGM 4MM3B 4REZA 1SXTA 4YSZB 2WXQA 4YTMB 1KRHA 5GXGB 4OVZA 2MJDA 4DXGA 2OHFA 2LGIA 1D5MC 2JZPA 2MJ3A 3AE3B 2RDHA 4RFBA 3IT6B 1BXTA 3AE7B 3R8BA 3IAM1 3BVGA 1IGDA 3E9SA 3IT4B 2YEPF 3HVDA 1QF6A 3FC4A 2WQYB 1GPXA 2PIAA 4YSYB 3ZJUA 2ICIA 1PGBA 1L6UA 5H8YE 3VRBB 3B2GA 1YQ3B 4UDUC 1SB3C 2MEKA 1LO5D 2JWUA 2N0SB 2WXFA 3Q8CA 2RMMA 1JMLA 2E3TA 3BVZA 1I4GA 3AB5A 2DWQA 2PTLA 4H2AA 1JWUD 1Q10A 2WXPA 1K53A 2QEJC 1XCQL 3FILA 2WU2B 4NAWB 2Y5PA 1XF5L 1KF6B 1TYGB 4NJCA 2D5GA 1ZOYB 3W5UB 1IUEA 1C4PA 3U2SC 1C76A 3MJ5A 4JPSA 5AUKA 3ZYYX 1TS4A 1N60A 2J4XA 5HI1A 2WXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N61 A;  1FM0 D;  4ITK A;  1NI3 A;  4HRO A;  3VR9 B;  1UWM A;  1ZUD 2;  3AEA B;  1FRR A;  2BS2 B;  3AM9 A;  4WQM A;  5H92 C;  4ZHO A;  1XLP A;  2PVG C;  1XLQ A;  2W3R A;  1FMA D;  1QOF A;  3HRD D;  2LEK A;  1RWS A;  3LB8 C;  4YTP B;  5EE1 A;  5AUI A;  4YT0 B;  4ZOH C;  2H89 B;  2WDV B;  1QT9 A;  1VDV A;  3W9C B;  3AE2 B;  1WRI A;  1JWB D;  5EE3 A;  1FXI A;  4IDI A;  2BS3 B;  4N59 A;  1NYR A;  3AE6 B;  1YJJ A;  4A9A A;  4WWM A;  4HRS A;  1AYF A;  4KX6 B;  2WDQ B;  1NVI D;  2WP9 B;  3NVZ A;  2WDR B;  4US8 A;  1L6V A;  1F0Z A;  1TKY A;  3P4S B;  4US9 A;  5EE9 A;  1NEN B;  2CU3 A;  1DGJ A;  1I7H A;  2BS4 B;  1YQ4 B;  1ROE A;  3HVZ A;  2QIE B;  4C7Z A;  5C3J B;  1FFU A;  3SFE B;  2AX5 A;  3NVY A;  2JQR B;  1TKE A;  2K5P A;  3ABV B;  3AE5 B;  2WU5 B;  3B9J A;  3P4Q B;  4C80 A;  1EWY C;  5MPO A;  1N63 A;  1CZP A;  1J7A A;  1FIQ A;  2PKO A;  1QOG A;  2L83 A;  3DWM A;  4P6V F;  5G5G A;  3ETR A;  2MH7 A;  1N5W A;  2WS3 B;  4JWS C;  3AH7 A;  3SR6 A;  1B9R A;  2K22 A;  1SF0 A;  3NRZ A;  1DOI A;  2W3S A;  4N58 A;  1R7S A;  4USA A;  1NEK B;  3BII D;  3FAH A;  3VR8 B;  3AE4 B;  3AN1 A;  1JW9 D;  1DOX A;  5G5H A;  2EKI A;  1XO3 A;  3B2F A;  3AEB B;  4YXD B;  2W55 A;  1L5P A;  1JAL A;  1OQR A;  2CJO A;  2H88 B;  3AEF B;  1N62 A;  3AEG B;  1FRD A;  3HUI A;  1YJI A;  1JWA D;  2Q5W D;  2KMM A;  4N6E B;  1CJE A;  4C7Y A;  1V8C A;  2W54 A;  4YSZ B;  1DOY A;  3EUB 2;  4YTM B;  3NVW A;  1KRH A;  3AE1 B;  5GXG B;  2MJD A;  1XLO A;  1ZXI A;  3AED B;  4LTU A;  3W5V B;  1FXA A;  1OFF A;  1PUT A;  2OHF A;  1E6E B;  2MJ3 A;  1PDX A;  3KWL A;  1RYJ A;  1N5X A;  1OQQ A;  1QOA A;  3AE3 B;  1KFY B;  3AV8 A;  1FFV A;  3DWG C;  1GAQ B;  3AE7 B;  1V97 A;  4FXC A;  3CWI A;  2BT6 A;  1E0Z A;  1JQ4 A;  3AE8 B;  2PVO D;  2M19 A;  2ACZ B;  3SFD B;  3AMZ A;  1QF6 A;  3FC4 A;  3PO0 A;  2WQY B;  1E7P B;  1J7C A;  2MJE A;  3L4P A;  1WGK A;  1GPX A;  2PIA A;  2QJL A;  3AE9 B;  4YSY B;  1SIJ A;  2DBY A;  2CJN A;  3NVV A;  3RPF C;  1L0V B;  1A70 A;  1L6U A;  5H8Y E;  4YSX B;  3VRB B;  3AEE B;  3B2G A;  1YQ3 B;  1JRP A;  1SB3 C;  1QOB A;  2B76 B;  1FO4 A;  1RFK A;  2HTM E;  2N0S B;  3NS1 A;  1E9M A;  3P63 A;  3P1M A;  2JX5 A;  2M56 B;  2E3T A;  1TJE A;  2G1E A;  1WXQ A;  1AWD A;  3AB5 A;  1E10 A;  1WYG A;  2DWQ A;  1NYQ A;  2L52 A;  3LXF A;  1VJK A;  3WCQ A;  4JWU C;  1J7B A;  2FBW B;  2KAJ A;  5EE0 A;  4ZHP A;  1RM6 C;  1WWT A;  4JX1 C;  1VLB A;  1JRO A;  2WU2 B;  3CIR B;  1XLN A;  2K9X A;  2Y5C A;  1KF6 B;  5C2T B;  1TYG B;  1ZP0 B;  3P4R B;  4YTN B;  3VRA B;  1ZOY B;  3W5U B;  1IUE A;  1PFD A;  1QLB B;  1TKG A;  5AUK A;  3ZYY X;  3P4P B;  2WLB A;  1N60 A;  3AEC B;  1T3Q A; 
#chains in the Genus database with same CATH topology
 3AEA B;  1VRA B;  2M17 A;  4A20 A;  5DPW A;  2LEK A;  1A5R A;  1GJZ A;  2HTH A;  3AE2 B;  2E6X A;  2ZW0 A;  2BW2 A;  4XYC A;  4WWP A;  3DBS A;  1ZXH A;  3P2B A;  1UBI A;  3HVZ A;  1ROE A;  1F9J A;  3L17 A;  4LCD E;  4NZL B;  1F1H A;  2DAF A;  2GRI A;  1N63 A;  4ASW C;  1MG8 A;  2RGF A;  4P6V F;  1YN3 A;  4K1R B;  3QAQ A;  5G5G A;  2HD5 B;  2M4N A;  4LNN A;  4AP4 C;  5BYQ A;  2AL3 A;  5G5H A;  1C77 A;  2HDE A;  3L0W B;  3Q8A A;  1BML C;  1EF5 A;  3L10 B;  3KW5 B;  2J7Q B;  1TBE A;  3T9L A;  4FUL A;  2JF5 A;  4HKQ A;  4Q2J A;  2IO1 B;  1R4M I;  1SBB B;  1WGH A;  2BT6 A;  4LNF A;  1JQ4 A;  1WIA A;  3EC8 A;  3GS2 A;  1MHH E;  2QCZ A;  2K6D B;  1HXY D;  2CHW A;  4ACF A;  1NDD A;  1T6B X;  3VXW A;  4B95 A;  4YSX B;  2IDY A;  1KJT A;  2J53 A;  2K8H A;  4M0W B;  3LXF A;  3W1Y A;  2FBW B;  1D6E C;  1TY2 A;  3NOB A;  1N6Z A;  3DHI C;  1TS4 A;  4MGY E;  2L32 A;  1TKG A;  2Z0E B;  3BY4 B;  2AQ3 B;  2WLB A;  1T3Q A;  1NI3 A;  3AM9 A;  3K9O B;  3B0A A;  1XLQ A;  1QOF A;  1VDV A;  2DYO A;  3MHS D;  3TMP B;  2XK5 B;  3ZDM C;  2BYF A;  2KVZ A;  3PTF C;  4TUU A;  2DX5 B;  4HRS A;  1MFW A;  2A4Z A;  4WUR A;  2LMC A;  1F0Z A;  4IM0 A;  2FUG 1;  1ENF A;  1M94 A;  3PHX B;  1UEL A;  3AE5 B;  2KAC A;  5BMI A;  5D3I B;  4WIP A;  2Y3A A;  1SJH D;  4KZ0 A;  1DOI A;  3ZGZ A;  1NEK B;  3OG5 A;  4II2 B;  3VQI A;  4GDK B;  1DOX A;  4FHJ A;  3R2I A;  4EEW A;  2H88 B;  1WX9 A;  3AEF B;  4ICU A;  4A3P A;  4QAY A;  2KWC A;  2BTE A;  3WAM A;  3NJT A;  4EUT A;  2XEW A;  1XLO A;  2KLG A;  3W1S A;  4YWG G;  5HFY A;  4M0W A;  1QOA A;  3R2T A;  2NBU A;  3KQ4 A;  3MP9 A;  4MAC A;  3UI3 A;  2EMS A;  1RAX A;  3I57 A;  5CHV C;  3IVF A;  3RN9 C;  1XT9 B;  1OEY J;  1EM7 A;  5CX3 A;  1J7C A;  3L4P A;  1V81 A;  2JT4 B;  5FR3 A;  2ON8 A;  3BK2 A;  1S1Q B;  4ZRP A;  4FBJ B;  5JHA A;  3U30 A;  2B76 B;  3OJ3 A;  4ARI A;  4JQW C;  3P63 A;  3DBR B;  2LVO A;  4W9F A;  3VTV A;  2XK5 A;  4ZYN A;  3VH4 B;  3I5J C;  4W9C A;  3T3O A;  4GMV A;  1C3T A;  2K9X A;  2PE9 A;  3P4R B;  1D4B A;  4M8N A;  4WQO B;  5LLI A;  1N61 A;  1Q5W B;  1KTK A;  3QHT A;  2WXH A;  4B9K A;  1YIW A;  1ZW7 A;  2BYT A;  2K0P A;  5DCN A;  2RD0 A;  4GDK A;  4CO7 A;  3NZ3 A;  1HEZ E;  3ZQ4 A;  4HLE A;  1YMH E;  1V1P B;  4IUM B;  2BB6 A;  1STE A;  3N1X C;  4MH0 E;  1P7F A;  4XDC A;  1J7A A;  4DHZ E;  1I4X A;  4TSS A;  4RM9 A;  2ZCB A;  2BF8 B;  1WGD A;  2WXL A;  1R7S A;  2QC8 A;  3AN1 A;  4WAA A;  3BVM A;  1UUP A;  1FCC C;  2O2V B;  1C4A A;  2KMM A;  2B3A A;  3ZKJ C;  1Z2M A;  4E74 A;  2KOX A;  4LTU A;  1WSP A;  1WXM A;  2MX2 A;  1RYJ A;  4KDL B;  2ZNV B;  4PYZ A;  3DQV A;  1D5Z C;  2VZK D;  4DK5 A;  3AE8 B;  2PVO D;  2M19 A;  1WYW B;  3PGE A;  2JY6 A;  3PO0 A;  2FE8 A;  2MJE A;  2ZCC A;  5BMG A;  4JE3 B;  2GI9 A;  4L1B A;  1VR9 A;  2MBB B;  4ANV A;  2WXI A;  1QOB A;  3KYC D;  4I6N B;  3PZ7 A;  2PJH A;  3VVW B;  2A5U A;  4PS3 A;  3EGR A;  2NCN A;  1V1P A;  2ONQ A;  1LM8 B;  2J0M A;  1VZ8 A;  3AEC B;  3OWE B;  2C9W B;  1YN5 A;  2BWF A;  2KDF B;  2KQ4 X;  4ANX A;  2WXG A;  1HA5 A;  2H89 B;  4XGA B;  5FK9 C;  1OQY A;  1JWB D;  2R2Q A;  1LGR A;  2LVP A;  1SIF A;  3TBL D;  3UGB B;  2LGY A;  2N4F A;  2YEP B;  4US8 A;  2O2V A;  2SAK A;  4OVV A;  4XWT A;  2V0G A;  2QIE B;  3Q3F A;  4KKI A;  1GB1 A;  5IOI A;  2MSE D;  3WAL A;  3P4Q B;  3I63 C;  4PYU A;  1PGX A;  4BKG A;  2XN9 C;  2KAN A;  1WXV A;  4NQL B;  2IY0 B;  2IBI B;  2K22 A;  3DVN U;  1U4A A;  3V61 A;  3R66 C;  4HXD A;  1ESF A;  3B2F A;  4YXD B;  2N9P C;  3GB1 A;  3U52 E;  1CMX B;  1N62 A;  4I6P A;  2MA9 B;  4P7I A;  2Q5W D;  2MP2 B;  2WXQ A;  4YTM B;  2FCS A;  3IFW B;  5GXG B;  4OVZ A;  5IP4 D;  2LGI A;  4B6W A;  2UYZ B;  2JZP A;  2RDH A;  3IT6 B;  4MDK E;  4N9F 4;  2BWE S;  3K9P B;  3BVG A;  3JSV B;  2D07 B;  5KHO A;  3H6N A;  3TJP A;  3V6E B;  2VRR B;  4YSY B;  1EUV B;  3L54 A;  3B2G A;  3Q3O C;  2ZPN A;  3Q3M C;  3RNB C;  2RMM A;  2E3T A;  5CHW A;  3VUY A;  2PTL A;  4H2A A;  3HHM A;  3QK0 A;  2LUE A;  3NHE B;  2QEJ C;  4WJP A;  4ANU A;  3RI7 C;  4NAW B;  1WF9 A;  4W9I A;  4F8C B;  1KF6 B;  1UZX B;  3OAW A;  1TYG B;  2D5G A;  4J6I A;  1IUE A;  4EZL A;  5E6O A;  3N30 A;  4C00 A;  5HI1 A;  2WXM A;  1IP9 A;  1ZUD 2;  4KGS A;  1WY8 A;  4W9E A;  1C1Y B;  3VTW A;  2HJ8 A;  3A4S C;  2PVG C;  1ACC A;  1RWS A;  2QHO A;  4CYE A;  1QT9 A;  3C8Y A;  3MFG A;  3RNF C;  3JVZ X;  1WMH B;  4OVU A;  2AQ1 B;  1I7H A;  1ISN A;  4WAF A;  2MP2 A;  1TKE A;  1QKZ A;  1TS3 A;  3E56 A;  3VUW A;  3ETR A;  1ET6 A;  1V80 A;  1K8R B;  5E6N A;  2KXJ A;  3JSV A;  4HJG E;  1V49 A;  3AEB B;  3EEC A;  2YLM A;  1WH3 A;  1YX6 B;  1JWA D;  1MVK A;  2VZK B;  3GE8 C;  3OLM D;  4FLH A;  3DVG Y;  3V3X A;  4CQN A;  4FXC A;  3CWI A;  2J52 A;  2V3P A;  2CR5 A;  3SHQ A;  2BBC A;  1C79 A;  5KHQ A;  2DHZ A;  2L8J A;  2ACZ B;  4NAW A;  1XQQ A;  2IND C;  2Y5B B;  1WJ4 A;  1YX5 B;  1E8X A;  2L00 B;  4AOF A;  3AE9 B;  2JXX A;  2J42 A;  1KOT A;  3UF8 A;  1L4Z B;  1L0V B;  2KDE B;  1GC7 A;  1JRP A;  1FO4 A;  2FCM A;  2JX5 A;  3ZW3 A;  4M00 A;  2JSV X;  4W9J A;  5EE0 A;  4FAD A;  3CIR B;  3SDL C;  1WMH A;  4NQK E;  1SEB D;  4ITK A;  3VR9 B;  1UWM A;  4ZHO A;  4B0E A;  1V86 A;  2KDM A;  5EE1 A;  3M63 B;  4LNK A;  1EU4 A;  4IDI A;  5G2N A;  1MG4 A;  1YJJ A;  5BO4 B;  4KX6 B;  2WDQ B;  2NR2 A;  2WP9 B;  2IGH A;  4IOI E;  1WJU A;  1TKY A;  2MHJ A;  3WAO A;  1R4M B;  5C3J B;  4ZRJ A;  2Z8L A;  4GDL B;  2WX0 A;  3DCG A;  5DPR A;  4RH6 A;  4HPL B;  1MHX A;  3M95 A;  2L83 A;  2WGS A;  2GLS A;  2JRH A;  2KC2 A;  3DHG C;  4XWW A;  1L4D B;  5E6P A;  4A90 A;  1ET9 A;  2KFK A;  3HIZ A;  1TY0 A;  1OQR A;  1YD8 U;  2MW5 A;  3IG3 A;  4KGT A;  2W82 A;  2LI5 A;  1V8C A;  4IKG A;  3ZNG C;  4OZB A;  3PV1 A;  1ZXI A;  1RFA A;  2IO3 B;  2KX0 A;  2AWT A;  5DPS A;  1F2R C;  4EZK A;  2MQJ A;  1HQR D;  3MTN B;  3SFD B;  2NMQ A;  2MLB A;  1Z5S B;  2KZR A;  4IG7 B;  4GGQ A;  3RT3 B;  4TQ1 A;  3U7Z A;  3MC0 B;  5IAA C;  2JZZ A;  4DBG A;  3P1M A;  1TJE A;  2KYW A;  1WYG A;  1NYQ A;  3AU5 A;  4AWJ A;  3B1L X;  3ZLZ A;  2SEB D;  4X57 B;  2BKR B;  2Y5C A;  1ZP0 B;  2KQ7 A;  3AI5 A;  2D3A A;  4TV3 A;  4GDL A;  4KGR A;  3T8M A;  1ZGU B;  5G55 A;  4D2K A;  4W9K A;  3QA8 A;  1V5T A;  4AJY B;  3C0R B;  3LJ3 A;  1NYR A;  3C19 A;  4A6Q A;  4G0N B;  2BKF A;  1FXT B;  5HKH A;  5EE9 A;  1DGJ A;  5FKA C;  2GOW A;  2KJ6 A;  3A1Q B;  3ML9 A;  5MPO A;  1BUI C;  1UWX A;  3V60 A;  3PVL A;  3ZXV A;  5AEK B;  1V6E A;  1B9R A;  3J9C A;  4N58 A;  5D3D A;  1HZ5 A;  3CF6 E;  3R3M A;  2IY1 B;  4USA A;  4MGZ E;  2AEH A;  2FIF A;  4L2Y A;  4DDG D;  1X1M A;  3LYY A;  2PEA A;  4XZ4 A;  2OOB B;  3TUO A;  1YJI A;  3WIM A;  5J17 A;  4N6E B;  3OJ4 B;  1TTN A;  2XNA C;  2KWU B;  1T0Q C;  1E7U A;  2BGF A;  3ZDT A;  2AL6 A;  3RD2 A;  3KWL A;  1OQQ A;  2Z59 B;  4FJY A;  2ZVO A;  4CHK A;  2DEN B;  1PQS A;  2I1K A;  5CTR C;  1MJD A;  1L7Y A;  1I4Q A;  1E7P B;  4HDQ A;  4BBN F;  4TKN A;  2JPH A;  2AYO B;  3HK0 A;  3ML8 A;  3PRZ A;  1SIJ A;  1ZKH A;  2LWP A;  2ZJD A;  2KC1 A;  3JW0 X;  2RPV A;  3BZD B;  4NJ6 A;  4HK2 A;  1FCL A;  1WE7 A;  2M56 B;  4KDI C;  4BKS A;  2G1E A;  3X23 A;  1F2R I;  5I4D A;  4BFR A;  1VJK A;  2RSU A;  3LDZ E;  1YQB A;  4ZHP A;  2C5L C;  1WWT A;  3EHV A;  1JRO A;  1SE4 A;  1PYW D;  2INP E;  3PLU A;  1QLB B;  1XXG A;  4L23 A;  2W9N A;  2KQS A;  2M0X A;  5LXH A;  2N9X A;  3A1Q A;  3WA0 A;  1FRR A;  2BS2 B;  5H92 C;  2DZK A;  1TZ1 A;  3R7R A;  4GSW A;  2LHE A;  3O13 A;  3LB8 C;  1UBQ A;  2IGG A;  1VZ7 A;  3A4R A;  3VTU A;  2MWS B;  2WXN A;  3TCA A;  2QIL A;  4GLS C;  4KKJ A;  4NJ7 A;  1KM7 A;  1NVI D;  1LQB A;  1YOV B;  1L6V A;  1MI0 A;  1LXD A;  1MPE A;  3DHH C;  4A55 A;  3B9J A;  2DYM A;  4HJK A;  2WU5 B;  2ZZP B;  4M02 A;  2KN4 A;  2GMI C;  2NVU I;  3APD A;  5EDS A;  5IKC M;  3DOW A;  2W3S A;  1WE6 A;  4BZA A;  3Q3J A;  1P9D U;  3FAH A;  1I4R A;  2X38 A;  4I6L B;  4RF0 A;  5AZH A;  2KO3 A;  4MM3 B;  4YSZ B;  4JL9 A;  3DVG X;  2L0F A;  4DXG A;  3RZW C;  4EZJ A;  4II3 B;  3AE3 B;  4HWI B;  2LAS A;  1BXT A;  3R8B A;  3IAM 1;  3SU8 X;  2CHX A;  4LNO A;  2YEP F;  1QF6 A;  3FC4 A;  2WQY B;  4ZDV A;  4K7U A;  3ZJU A;  4W9G A;  3ONS A;  3Q2A C;  1L6U A;  4UDU C;  1YQ3 B;  2MEK A;  3Q8C A;  1I35 A;  3KH0 A;  1OGW A;  1Q10 A;  2WXP A;  2UU7 A;  5C23 A;  3PHW B;  4GN1 A;  4NJC A;  1ZOY B;  1C76 A;  3MJ5 A;  3L16 A;  2J0J A;  3ZYY X;  1LFD A;  4WJN A;  5L95 C;  2M0A A;  4FJV B;  4IM2 A;  1P1A A;  4WQM A;  4XE0 A;  2K8B A;  3NUH B;  1WFY A;  3ZRF A;  1WRI A;  1GOZ A;  1SJE D;  2DYB A;  4AJW A;  3GE3 C;  1PGA A;  1TT5 B;  1WJ6 A;  2WDR B;  4P16 A;  3PSE B;  1WM2 A;  1YQ4 B;  4MM3 A;  4HKZ E;  3NY5 A;  4IWO A;  2G9H D;  2YVC A;  1E5W A;  3RUL A;  3MC9 A;  1EWY C;  2N7J A;  1V1O A;  1WXA A;  1UNS A;  2LGS A;  4P1C C;  3SD5 A;  3D32 A;  2D3G A;  3A9J B;  3AU4 A;  5J2R A;  1FPY A;  3BII D;  3KUC B;  3AE4 B;  3ZJT A;  3VH3 B;  4IM3 A;  3SEB A;  5D2M B;  4EE2 A;  2ASQ A;  3PRE A;  4O1N A;  3H9D A;  1F52 A;  3H8H A;  1RLF A;  4ARC A;  3ZTD A;  1H8C A;  2IYD B;  3W5V B;  1FXA A;  2KHW B;  4FHK A;  2DZJ A;  1D3Z A;  1GNU A;  1GAQ B;  2C7N B;  4K7S A;  2D3B A;  3N9Y C;  3GZN B;  3VHT C;  4W9L A;  2X8X X;  3DPD A;  2BQQ A;  2IZV B;  1XCT L;  2KD0 A;  3NVV A;  1QIL A;  2ZEQ A;  1TS2 A;  4BOS C;  5IA7 A;  2KX3 A;  5TSS A;  1E9M A;  5LNK 1;  4RGN A;  2LGX A;  2L52 A;  1JWM D;  3RUI B;  4F7Z A;  4K81 A;  1RM6 C;  5JH5 C;  1EO6 A;  3NG0 A;  5C2T B;  3ZXR A;  3ALB A;  4HPM B;  3W2D A;  3A33 B;  1WXS A;  4HRO A;  2JYE A;  2GB1 A;  2CU1 A;  1WJN A;  4ZYS A;  3A9J A;  3BK1 A;  1C78 A;  2REX A;  3PS6 A;  3DBL I;  1K51 A;  3KUD B;  2VH1 A;  4M01 A;  1AYF A;  1C9F A;  2K8C A;  4LJO B;  2LRW A;  4US9 A;  1XEE A;  3APF A;  1XD3 B;  5D6J B;  2C7H A;  4C4V B;  1K50 A;  4C80 A;  3V62 A;  4JGH B;  4PT5 A;  1QQR A;  2EMT A;  1SE9 A;  3GZN I;  1I4P A;  2KMC A;  2MRP A;  2AQ2 B;  2G45 B;  3RYT A;  5D7G A;  4BKS D;  2DLB A;  1L5P A;  3ZVV A;  2MBH A;  1L0Y B;  3HUI A;  4HEA 1;  3DDC B;  5IO9 A;  5BMH A;  2MBQ A;  2ZW1 A;  3EUB 2;  3NVW A;  1WRD B;  2K39 A;  3UQA A;  5HG2 A;  1WZ3 A;  2K6Q A;  3ZO5 B;  1V97 A;  2KTR B;  2LGD A;  2N7D A;  2DZM A;  4G50 A;  5CHF A;  3M3J A;  2JZ3 B;  4RGM A;  5JZE B;  4MGI E;  2DBY A;  3Q6B A;  4KVG B;  3IBE A;  4NPN A;  4BOZ B;  1ZDX A;  3GOE A;  3QCA A;  4IWQ A;  1Y8R C;  4PK1 A;  2CS4 A;  2C60 A;  4HPP A;  3Q3N C;  2MBO A;  4YTN B;  2NTS A;  3VRA B;  1PFD A;  1WX7 A;  2JU6 X;  4K3C A;  4C4V A;  4HVB A;  1IBX B;  2IJ0 A;  1AW7 A;  1Q1O A;  1V9J A;  2GBJ A;  4URK A;  2NBW B;  2WDV B;  5J18 A;  2L0T A;  5EE3 A;  3HM6 X;  1TS5 A;  3QX1 A;  4PS7 A;  5AZG A;  4RGO S;  1UGM A;  4TQ0 A;  5HHD G;  2R61 A;  2KWV B;  2M1M A;  4NY0 A;  2JWZ A;  1H4R A;  3ZRC A;  2K5P A;  2PE6 B;  3R7Q A;  3KWV A;  3BYY B;  3TEW A;  2MH7 A;  1WGY A;  1DYQ A;  1SF0 A;  4IC7 B;  2OJR A;  1NBF C;  1TZO A;  1I42 A;  2NTT A;  2KMA A;  1HTQ A;  3VDZ A;  4K7W A;  2W55 A;  1V2Y A;  1AAR A;  1AN8 A;  3AEG B;  1YN4 A;  2N9L A;  4YL8 A;  2KT7 A;  2W54 A;  1K52 A;  1IGC A;  3AE1 B;  3L13 A;  1CQV A;  1OFF A;  1E6E B;  1OEY A;  4RNA A;  1FNV A;  1KFY B;  3DWG C;  4R3D A;  4LDT D;  2LJ5 A;  1UD7 A;  3PZD A;  2MBE A;  3AMZ A;  2HE7 A;  4WWO A;  1WI0 A;  2NBV B;  1Y56 A;  1WGK A;  3TL5 A;  3NS8 A;  1T5X D;  1WX8 A;  1IBX A;  3V05 A;  3RPF C;  3AEE B;  1L0X B;  2DNF A;  4HDO A;  2HTM E;  3RFZ B;  1E10 A;  1JCK B;  4C56 C;  2IGD A;  3PRP B;  4JWU C;  2KTF A;  1J7B A;  2KAJ A;  3BWU D;  5BYS A;  4TMA B;  1WGR A;  1XLN A;  2LFI A;  3WAN A;  1RRB A;  3W1S C;  1P0R A;  2EKE C;  3A9K B;  4A3O A;  2QMT A;  2PW9 A;  3RNE C;  3Q14 C;  2ZPY A;  2OED A;  4OW0 A;  1KH0 A;  1CK1 A;  1E7V A;  3AE6 B;  4WWM A;  3FIL B;  2RPQ A;  2WHI A;  2K3U A;  3NVZ A;  2LHD A;  4FA6 A;  3RNA C;  1T0S C;  3RZF A;  1T0Y A;  3H1U A;  4DWF A;  3ABV B;  2WXJ A;  1M4V A;  1CZP A;  1FIQ A;  2CKH B;  3DWM A;  3U4E G;  5JXV A;  1L2N A;  5D94 A;  1SE2 A;  4MSM B;  4BAX A;  2KWD A;  4DHJ D;  2N9K A;  3B08 A;  2WNM A;  2MCN B;  3BIN A;  3PPA A;  1HE8 A;  1D5X C;  2KDI A;  3N20 C;  1YJ1 A;  1SXT A;  3RMK C;  2DAJ A;  1KRH A;  2MJD A;  3N3K B;  2OHF A;  1D5M C;  2MJ3 A;  2RDB C;  4MJS B;  1P3Q U;  3IHP C;  4RFB A;  3AE7 B;  3VAW A;  4BKT A;  1OTR B;  2GBK A;  1T0R C;  3E9S A;  4E3C A;  3HVD A;  2KJR A;  2GBR A;  5IN7 A;  1GPX A;  2PIA A;  3A9K A;  2NPT B;  1UH6 A;  1PGB A;  5H8Y E;  3VRB B;  1SB3 C;  3V6C B;  1LO5 D;  2JWU A;  2N0S B;  2WXF A;  2V3S A;  2KKC A;  4DHZ B;  3BVZ A;  3AB5 A;  2DWQ A;  4IWP A;  1JWU D;  1QZE A;  4FN2 A;  1K53 A;  3H7S A;  3FIL A;  2LRU A;  3QQ8 B;  4MEM A;  3MJW A;  1E90 A;  2Y5P A;  3UIO B;  4GXB A;  3U2S C;  2LZ6 A;  2J4X A;  3ZNI D;  2PMV A;  2V9H A;  2W3R A;  3KUZ A;  2INC C;  4ZOH C;  3RNG C;  2FCQ A;  2N9E B;  3O65 B;  4A9A A;  4HCP B;  2WXK A;  2DZI A;  1KLV A;  4LNI A;  1EU3 A;  2QSD A;  4KZC A;  3GP7 A;  1NEN B;  4B0M A;  5E6J A;  3Q8E A;  1FFU A;  3SFE B;  2K1F A;  3N32 A;  2LJI A;  2PKO A;  3I3T B;  4G11 A;  4MJS A;  3SR6 A;  1N5W A;  4OHJ A;  2IO0 B;  4BBN C;  3NRZ A;  2J0K A;  2O6V D;  3QIJ A;  1TGZ B;  2LXC A;  3JYU A;  4KSK C;  1EF1 A;  1JAL A;  2IO2 B;  2G4S A;  2NPT A;  2BVC A;  3ZIM A;  3T3N A;  3AED B;  3W9C B;  1PUT A;  1WR1 A;  4LDT B;  2L7R A;  2WWZ A;  4DQO C;  2L76 A;  3PLV A;  4MT5 A;  1E0Z A;  4BVU C;  1HZ6 A;  2HJ1 A;  2JRI B;  1C4C A;  2QJL A;  4JIO U;  2ZNV C;  2R2O A;  4XX5 A;  4ZRQ A;  2CJN A;  1HTO A;  4WWN A;  2JYT A;  2EEL A;  3NS1 A;  3L08 A;  3AXC A;  3MHZ A;  3WCQ A;  4GB9 A;  2L3Z A;  4KV2 A;  4J3O D;  4WJQ A;  3M62 B;  1JWS D;  5GMV A;  4OZA A;  3AH7 A;  1YNT E;  3QJZ A;  2KJH B;  2WXO A;  3U7D A;  2K25 A;  4AUQ C;  3DVN V;  4YTP B;  4XDD A;  1J0G A;  3TEY A;  1GUA B;  4PS8 A;  3PT2 B;  1ZPS A;  1SE3 A;  3X0W A;  4EOY A;  4OZC A;  3MC8 A;  3P4S B;  3DBR I;  1KLU D;  4C7Z A;  2FID A;  4RMA A;  1QOG A;  1WGG A;  4DHJ B;  1VZ6 A;  2D3C A;  4JWS C;  2WS3 B;  3Q8F A;  4MH8 A;  2N1V A;  2NS5 A;  4DXF A;  1Q0W B;  1SSN A;  2IPK D;  1B1Z A;  1WR6 E;  2LXA A;  3I9V 1;  3UIN B;  4RF1 A;  4GIV A;  2V4I B;  2EKI A;  2GBM A;  1S3S G;  1FRD A;  1GG3 A;  4NNJ B;  2C7M B;  2BB5 A;  3AUL A;  2M8S A;  4MSQ B;  2LD9 A;  3CSF A;  3TSS A;  3UQB A;  2BYE A;  1N5X A;  5LXI B;  3AV8 A;  1FFV A;  3IXS A;  2ZVN A;  1E8W A;  2WXR A;  4DXA B;  5T8I A;  1EWC A;  2L05 A;  1I4H A;  1SGH A;  4KIK B;  3EFU A;  2LVQ A;  1ZDV A;  3VFK A;  3DBL B;  4ICV A;  1R4N B;  1E8Z A;  1IPG A;  1F77 A;  3PZ8 A;  2VH2 A;  2INN E;  4EKU A;  1RFK A;  1WXQ A;  1AWD A;  4WJO A;  3TEZ A;  4RGT A;  4FJZ A;  3ZNH B;  4JX1 C;  2JUO A;  1VLB A;  1V5O A;  4P1B C;  3QC8 B;  2PLP A;  2V1Y A;  1XLP A;  5JHB A;  2WDT B;  1FMA D;  4GU2 A;  4YT0 B;  2BPS A;  2I38 A;  5TR5 A;  4XC2 A;  1KLG D;  5C1Z A;  4W9D A;  2BS3 B;  2Z0D B;  4DDI D;  3P42 A;  2FCN A;  4N59 A;  1UGJ A;  1WM3 A;  3BYT B;  2CU3 A;  4NAM A;  4K3B A;  5BYR A;  2AX5 A;  3NVY A;  1FEH A;  4G3X B;  3ECI A;  3RCZ A;  5L83 A;  3DBH B;  4F1S A;  2KVR A;  2O6V B;  4ZRK A;  4ZRI A;  3TIX A;  4M8M A;  3ZTC A;  3N1Z C;  2GBN A;  2JVC A;  4RM8 A;  1FNW A;  1R4N I;  1VCB A;  2LUM A;  1JW9 D;  5FR6 A;  4KIK A;  2TSS A;  2WX1 A;  4GOC A;  2D10 A;  3UIP B;  2L1A A;  2XBB C;  1CJE A;  4C7Y A;  4LK0 M;  2FAZ A;  4MGK E;  1DOY A;  2CHZ A;  1IYF A;  1G6J A;  1PDX A;  2QDF A;  4RCO A;  1FD6 A;  1GC6 A;  4AQ7 A;  2G4D B;  3CMM B;  3ZUN A;  2JXT A;  4KSL C;  1A70 A;  3Q8B A;  2KLC A;  2KDB A;  2KFJ A;  2N7E A;  1WZ0 A;  3CST A;  3IAS 1;  1VD2 A;  2WYQ A;  3QAR A;  3EA6 A;  2V3N A;  3DBH I;  2I2Y A;  4WH4 A;  4EFO A;  3NZU A;  1FM0 D;  4A8X C;  4HCN B;  3HRD D;  2O6V A;  5AUI A;  2KN5 A;  1GB4 A;  3VUX A;  1FXI A;  1ZE3 D;  3Q69 A;  3S2A A;  3NZS A;  2D11 A;  1FNU A;  4IW0 A;  2BS4 B;  3H7P B;  4MEL A;  1NI2 A;  3KLS X;  4JLC A;  1BT0 A;  2KK8 A;  2JQR B;  3TEX A;  3FKY A;  3URY A;  2N1W A;  3N1Y C;  1TIF A;  4E71 A;  2RR9 A;  3VR8 B;  3ZJV A;  1P98 A;  2KFK B;  4AS1 A;  1XO3 A;  3RNC C;  1E8Y A;  1P7E A;  2CJO A;  2RDG A;  4LLG M;  2FUH B;  4REZ A;  4S0R A;  2V4L A;  3QWZ B;  2FNJ B;  2PPH A;  4ANW A;  3APC A;  2KTR A;  2KNB A;  2OJW A;  1IGD A;  3ZNZ B;  4S17 A;  3IT4 B;  3WAP A;  5DPT A;  2BYV E;  3U8Z A;  3HM3 A;  1UF0 A;  2ICI A;  5AZF A;  4LJP B;  2G3Q B;  3PRM B;  3ENE A;  2I1J A;  1J8C A;  2UWQ A;  1JML A;  1I4G A;  1JRU A;  4W9H A;  2D2Q A;  3KVF B;  3KYD D;  1XCQ L;  3EFC A;  2WU2 B;  1XF5 L;  1J19 A;  3W5U B;  1C4P A;  3H7P A;  4JPS A;  5AUK A;  3P4P B;  1N60 A; 
#chains in the Genus database with same CATH homology
 2M0A A;  1ZUD 2;  3AEA B;  4KGS A;  2PMV A;  4WQM A;  2PVG C;  4XE0 A;  1VRA B;  2W3R A;  1ACC A;  2LEK A;  1RWS A;  4ZOH C;  3NUH B;  1QT9 A;  3AE2 B;  3C8Y A;  1WRI A;  3MFG A;  1GOZ A;  1SJE D;  2E6X A;  1PGA A;  2ZW0 A;  4A9A A;  2BW2 A;  2WXK A;  1ZXH A;  2WDR B;  1EU3 A;  2QSD A;  4P16 A;  3GP7 A;  1NEN B;  2AQ1 B;  1I7H A;  3HVZ A;  1YQ4 B;  1ROE A;  4B0M A;  5E6J A;  4HKZ E;  3Q8E A;  4WAF A;  4NZL B;  1FFU A;  3SFE B;  2G9H D;  1TKE A;  2GRI A;  2LJI A;  1EWY C;  2N7J A;  1N63 A;  1QKZ A;  2PKO A;  4P6V F;  1YN3 A;  1TS3 A;  1V1O A;  3E56 A;  1UNS A;  5G5G A;  3ETR A;  3SR6 A;  1N5W A;  4OHJ A;  1ET6 A;  3NRZ A;  5BYQ A;  3BII D;  3AE4 B;  4HJG E;  5G5H A;  3ZJT A;  1C77 A;  2HDE A;  3Q8A A;  1BML C;  3AEB B;  1JAL A;  3SEB A;  4EE2 A;  1JWA D;  4O1N A;  3H8H A;  3T3N A;  4ARC A;  1MVK A;  3AED B;  3W9C B;  3W5V B;  4Q2J A;  2VZK B;  1FXA A;  1PUT A;  4HKQ A;  3V3X A;  4CQN A;  4DQO C;  1GAQ B;  4FXC A;  3CWI A;  2J52 A;  4MT5 A;  1SBB B;  2BT6 A;  2V3P A;  1E0Z A;  1JQ4 A;  2BBC A;  1C79 A;  3GS2 A;  1HZ6 A;  2ACZ B;  3N9Y C;  1MHH E;  1C4C A;  1HXY D;  2QJL A;  1T6B X;  3AE9 B;  4ZRQ A;  1XCT L;  2J42 A;  2CJN A;  3NVV A;  1L4Z B;  1L0V B;  1QIL A;  2JYT A;  4YSX B;  1TS2 A;  1JRP A;  2EEL A;  1FO4 A;  3NS1 A;  5TSS A;  1E9M A;  5LNK 1;  2JX5 A;  4RGN A;  2IDY A;  2J53 A;  2L52 A;  2JSV X;  1JWM D;  3LXF A;  3MHZ A;  3WCQ A;  2FBW B;  5EE0 A;  1D6E C;  1TY2 A;  1RM6 C;  3CIR B;  4J3O D;  5C2T B;  2L32 A;  1JWS D;  1TKG A;  4OZA A;  2AQ3 B;  2WLB A;  3AH7 A;  1YNT E;  1SEB D;  1T3Q A;  3W2D A;  4ITK A;  1NI3 A;  4HRO A;  3VR9 B;  1UWM A;  4ZHO A;  3AM9 A;  2WXO A;  4B0E A;  2JYE A;  2GB1 A;  1XLQ A;  1QOF A;  2KDM A;  4YTP B;  5EE1 A;  4XDD A;  1VDV A;  4ZYS A;  3BK1 A;  3TEY A;  1C78 A;  1EU4 A;  2DYO A;  4IDI A;  1K51 A;  1ZPS A;  1SE3 A;  1YJJ A;  4HRS A;  1AYF A;  4KX6 B;  2WDQ B;  1C9F A;  4WUR A;  2WP9 B;  2IGH A;  4IOI E;  4OZC A;  2LMC A;  1F0Z A;  1TKY A;  3P4S B;  4US9 A;  2FUG 1;  1XEE A;  1ENF A;  1KLU D;  4C7Z A;  5C3J B;  2Z8L A;  4GDL B;  1K50 A;  3AE5 B;  2KAC A;  4C80 A;  4RH6 A;  5BMI A;  5D3I B;  1MHX A;  4WIP A;  2Y3A A;  1SJH D;  4PT5 A;  1QOG A;  2L83 A;  1QQR A;  1VZ6 A;  1I4P A;  4JWS C;  2WS3 B;  2AQ2 B;  3Q8F A;  4MH8 A;  1DOI A;  3ZGZ A;  4DXF A;  1SSN A;  1NEK B;  2IPK D;  4XWW A;  1B1Z A;  3VQI A;  4GDK B;  1L4D B;  3I9V 1;  5D7G A;  4A90 A;  1DOX A;  1ET9 A;  4RF1 A;  2DLB A;  2V4I B;  2EKI A;  3R2I A;  1L5P A;  1OQR A;  1TY0 A;  2H88 B;  3AEF B;  1FRD A;  1L0Y B;  2W82 A;  3HUI A;  4KGT A;  4HEA 1;  2BB5 A;  1V8C A;  4IKG A;  5BMH A;  2ZW1 A;  3EUB 2;  2BTE A;  3NVW A;  4OZB A;  1XLO A;  1ZXI A;  3TSS A;  5HG2 A;  3W1S A;  4YWG G;  5HFY A;  1N5X A;  4M0W A;  1QOA A;  3AV8 A;  1FFV A;  3IXS A;  1V97 A;  3R2T A;  1F2R C;  3KQ4 A;  3MP9 A;  4MAC A;  2WXR A;  1HQR D;  3UI3 A;  5T8I A;  3I57 A;  1EWC A;  3SFD B;  1I4H A;  2NMQ A;  1EM7 A;  1J7C A;  4RGM A;  3L4P A;  1ZDV A;  2DBY A;  5FR3 A;  2ON8 A;  4TQ1 A;  1F77 A;  3BK2 A;  3MC0 B;  3PZ8 A;  3U7Z A;  4ZRP A;  4ARI A;  2B76 B;  2INN E;  1RFK A;  3P63 A;  3P1M A;  1TJE A;  1WXQ A;  1AWD A;  1ZDX A;  1WYG A;  1NYQ A;  3TEZ A;  4RGT A;  2SEB D;  4JX1 C;  1VLB A;  3T3O A;  3P4P B;  2K9X A;  2Y5C A;  1ZP0 B;  3P4R B;  4YTN B;  2NTS A;  3VRA B;  1D4B A;  2PLP A;  1PFD A;  2JU6 X;  1N61 A;  1IBX B;  2IJ0 A;  1AW7 A;  4KGR A;  1XLP A;  4D2K A;  1FMA D;  1KTK A;  2WXH A;  4YT0 B;  2WDV B;  2I38 A;  1KLG D;  5EE3 A;  2BYT A;  2K0P A;  2BS3 B;  3P42 A;  4N59 A;  1NYR A;  1TS5 A;  3NZ3 A;  1HEZ E;  4A6Q A;  3ZQ4 A;  4RGO S;  1UGJ A;  1YMH E;  1V1P B;  3BYT B;  4TQ0 A;  5EE9 A;  5HHD G;  2BB6 A;  2CU3 A;  1DGJ A;  4NAM A;  5FKA C;  2R61 A;  1STE A;  5BYR A;  2AX5 A;  3NVY A;  1FEH A;  1P7F A;  2K5P A;  4XDC A;  5MPO A;  3KWV A;  1J7A A;  1BUI C;  1UWX A;  1I4X A;  3BYY B;  3TEW A;  4TSS A;  2MH7 A;  1DYQ A;  2WXL A;  1B9R A;  1SF0 A;  3J9C A;  4N58 A;  5D3D A;  1HZ5 A;  1R7S A;  1FNW A;  4USA A;  1TZO A;  2LUM A;  2NTT A;  3AN1 A;  1JW9 D;  4L2Y A;  3LYY A;  3BVM A;  1UUP A;  2W55 A;  1FCC C;  2TSS A;  1AN8 A;  3AEG B;  1YN4 A;  3TUO A;  1YJI A;  1C4A A;  2KMM A;  2N9L A;  4N6E B;  2L1A A;  1CJE A;  4C7Y A;  2XNA C;  4LK0 M;  1DOY A;  2W54 A;  1K52 A;  1IGC A;  3AE1 B;  4LTU A;  1CQV A;  1WSP A;  1OFF A;  1E6E B;  4RNA A;  1PDX A;  3KWL A;  1RYJ A;  1FNV A;  1OQQ A;  4RCO A;  1KFY B;  1FD6 A;  3DWG C;  4R3D A;  1D5Z C;  2VZK D;  3AE8 B;  2PVO D;  2M19 A;  3AMZ A;  1I4Q A;  3PO0 A;  4AQ7 A;  2FE8 A;  1E7P B;  2MJE A;  5BMG A;  1Y56 A;  1WGK A;  4JE3 B;  2GI9 A;  4L1B A;  1T5X D;  2JXT A;  1SIJ A;  1IBX A;  3V05 A;  3RPF C;  1VR9 A;  1A70 A;  2RPV A;  2WXI A;  3AEE B;  3BZD B;  1QOB A;  1L0X B;  2HTM E;  3RFZ B;  1FCL A;  2M56 B;  2G1E A;  3Q8B A;  3PZ7 A;  1JCK B;  1E10 A;  4C56 C;  1F2R I;  2IGD A;  5I4D A;  1VJK A;  3EGR A;  4JWU C;  1J7B A;  2KAJ A;  3BWU D;  4ZHP A;  3IAS 1;  1WWT A;  1JRO A;  5BYS A;  1V1P A;  1SE4 A;  3EA6 A;  2V3N A;  1PYW D;  4TMA B;  1XLN A;  2LFI A;  2ONQ A;  2INP E;  1VZ8 A;  2I2Y A;  1QLB B;  1XXG A;  4L23 A;  4WH4 A;  3AEC B;  1FM0 D;  2QMT A;  4A8X C;  3OWE B;  2PW9 A;  1FRR A;  2BS2 B;  1YN5 A;  2KQ4 X;  5H92 C;  2LHE A;  3HRD D;  5AUI A;  3O13 A;  2WXG A;  3LB8 C;  1HA5 A;  2H89 B;  1GB4 A;  5FK9 C;  1JWB D;  2IGG A;  2OED A;  4OW0 A;  1FXI A;  1KH0 A;  1VZ7 A;  1ZE3 D;  1CK1 A;  3Q69 A;  3AE6 B;  4WWM A;  2WXN A;  2QIL A;  3FIL B;  4GLS C;  4KKJ A;  2YEP B;  2K3U A;  1NVI D;  1FNU A;  3NVZ A;  4US8 A;  1L6V A;  2LHD A;  2SAK A;  1MI0 A;  2BS4 B;  4XWT A;  2V0G A;  3KLS X;  1MPE A;  2QIE B;  4KKI A;  1GB1 A;  4A55 A;  2JQR B;  3ABV B;  3B9J A;  2DYM A;  3TEX A;  2WU5 B;  2WXJ A;  3P4Q B;  1M4V A;  1CZP A;  1FIQ A;  1PGX A;  3DWM A;  3U4E G;  2XN9 C;  3URY A;  2KN4 A;  5JXV A;  1SE2 A;  2K22 A;  2W3S A;  2KWD A;  2N9K A;  3FAH A;  2WNM A;  1I4R A;  3VR8 B;  3ZJV A;  2X38 A;  1ESF A;  4AS1 A;  1XO3 A;  3B2F A;  4RF0 A;  4YXD B;  3GB1 A;  1P7E A;  2CJO A;  1D5X C;  2RDG A;  3U52 E;  1N62 A;  2Q5W D;  4LLG M;  4MM3 B;  4REZ A;  1SXT A;  4YSZ B;  2WXQ A;  4YTM B;  1KRH A;  5GXG B;  4OVZ A;  2MJD A;  4DXG A;  2OHF A;  2LGI A;  1D5M C;  2JZP A;  2MJ3 A;  3AE3 B;  2RDH A;  4RFB A;  3IT6 B;  1BXT A;  3AE7 B;  3R8B A;  3IAM 1;  3BVG A;  1IGD A;  3E9S A;  3IT4 B;  2YEP F;  3HVD A;  1QF6 A;  3FC4 A;  2WQY B;  1GPX A;  2PIA A;  4YSY B;  3ZJU A;  2ICI A;  1PGB A;  1L6U A;  5H8Y E;  3VRB B;  3B2G A;  1YQ3 B;  4UDU C;  1SB3 C;  2MEK A;  1LO5 D;  2JWU A;  2N0S B;  2WXF A;  3Q8C A;  2RMM A;  1JML A;  2E3T A;  3BVZ A;  1I4G A;  3AB5 A;  2DWQ A;  2PTL A;  4H2A A;  1JWU D;  1Q10 A;  2WXP A;  1K53 A;  2QEJ C;  1XCQ L;  3FIL A;  2WU2 B;  4NAW B;  2Y5P A;  1XF5 L;  1KF6 B;  1TYG B;  4NJC A;  2D5G A;  1ZOY B;  3W5U B;  1IUE A;  1C4P A;  3U2S C;  1C76 A;  3MJ5 A;  4JPS A;  5AUK A;  3ZYY X;  1TS4 A;  1N60 A;  2J4X A;  5HI1 A;  2WXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...