2BT6A

Ru(bpy)2(mbpy)-modified bovine adrenodoxin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
b'DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN 1
publication title Light-Induced Reduction of Bovine Adrenodoxin Via the Covalently Bound Ruthenium(II) Bipyridyl Complex: Intramolecular Electron Transfer and Crystal Structure.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 28
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bt6A00
1JRPA 1SB3C 2HTME 1GAQB 1QOFA 2KMMA 2PKOA 2WS3B 1T3QA 4ZHOA 3DWMA 2L52A 1ZUD2 4N6EB 1JQ4A 2MJEA 2QIEB 1CZPA 2B76B 3AE6B 1YQ4B 1L5PA 4YSXB 1NYRA 1B9RA 5G5GA 3P1MA 1IUEA 1E10A 1L0VB 3AH7A 4P6VF 3VRAB 1AYFA 2WLBA 3VRBB 3LXFA 5MPOA 2WU5B 1VJKA 3P4RB 3B2GA 1E9MA 3NS1A 4WQMA 1JWAD 3VR9B 1NYQA 2DBYA 3ABVB 2JX5A 1F0ZA 3AE3B 2DWQA 2MJDA 3B9JA 4ZOHC 1FXAA 2PVOD 2M56B 5C2TB 2M19A 1FXIA 4YXDB 1PDXA 1YJIA 3NVZA 5EE3A 2MH7A 1QOGA 1JALA 3AEBB 1WRIA 1ZXIA 4ZHPA 3ETRA 1QOAA 2AX5A 2W3SA 3FAHA 2H88B 1N61A 1JW9D 1R7SA 2FBWB 5EE9A 3KWLA 3NVYA 3AEGB 5AUKA 4US8A 1VDVA 3P4QB 1ROEA 3AB5A 4WWMA 1XO3A 1L6UA 3AN1A 5H92C 1TJEA 1J7BA 1DOXA 4HRSA 1JWBD 3AE4B 4N59A 1FO4A 3DWGC 1PUTA 2WP9B 1FFVA 1DOIA 2ACZB 2JQRB 3EUB2 1NEKB 1L6VA 2G1EA 2PIAA 5C3JB 2BS4B 1JROA 1E6EB 1XLOA 3CIRB 1KRHA 1N62A 1OQQA 3PO0A 1XLQA 2Q5WD 3VR8B 1WGKA 2BT6A 2BS3B 2WU2B 2CU3A 3AEFB 3NRZA 3P4SB 1FFUA 1J7CA 4C7ZA 2MJ3A 2W3RA 4JWUC 3NVVA 2W55A 2OHFA 4YTMB 4YSZB 1DGJA 3BIID 3W9CB 2WQYB 3HVZA 5GXGB 1EWYC 1PFDA 2W54A 4LTUA 1FIQA 3RPFC 3L4PA 4YSYB 4FXCA 1XLNA 2K5PA 3SFDB 1FMAD 1CJEA 1WWTA 3AE1B 3NVWA 1OFFA 2WDRB 3AM9A 1VLBA 1TKGA 1RFKA 4C7YA 1E7PB 1RYJA 3ZYYX 1SF0A 2N0SB 2WDQB 1N5WA 1TKYA 1UWMA 1NENB 3AMZA 2E3TA 4US9A 5G5HA 2K22A 1KF6B 3W5UB 3P63A 3W5VB 2CJOA 5AUIA 1YQ3B 1N60A 1QLBB 2BS2B 3B2FA 3AE8B 1OQRA 3AEEB 3AV8A 1RWSA 2K9XA 4KX6B 4USAA 1WYGA 1FM0D 2H89B 4HROA 1QT9A 4N58A 3LB8C 1FRRA 1N5XA 4JWSC 1SIJA 1I7HA 2PVGC 1FRDA 1TYGB 1TKEA 3AE5B 2CJNA 3AECB 1NI3A 2Y5CA 1J7AA 3AEAB 3WCQA 1N63A 1V8CA 1V97A 2KAJA 1A70A 2LEKA 3AE7B 1ZOYB 3FC4A 4IDIA 4A9AA 1E0ZA 3HRDD 4YT0B 2EKIA 4C80A 4YTNB 5EE1A 1DOYA 3P4PB 4ITKA 1QF6A 3HUIA 5EE0A 3SR6A 1AWDA 3AE9B 1KFYB 4JX1C 1NVID 3SFEB 2WDVB 1WXQA 4YTPB 1XLPA 5H8YE 3CWIA 1RM6C 2QJLA 1GPXA 1ZP0B 3AE2B 3AEDB 1QOBA 1YJJA 2L83A
chains in the Genus database with same CATH superfamily
2WWZA 3BWUD 1WM3A 1T0YA 3HM3A 4P6VF 2MEKA 2ZVNA 1PYWD 3ABVB 2K6DB 2PW9A 1V1PA 1WMHA 2VH2A 1K8RB 2MX2A 4RNAA 2H88B 4W9GA 4NNJB 1IYFA 2L0TA 4TQ1A 1XO3A 3CSFA 2KN5A 3UF8A 2L3ZA 4HXDA 3RT3B 2PLPA 1OQYA 2BW2A 2G1EA 4IC7B 4BVUC 3O65B 3Q3MC 4ZYNA 1IGCA 3NVVA 4S17A 1GB1A 4PS3A 3U30A 3L4PA 1MG4A 1EU4A 1SF0A 3Q3JA 4LDTB 3PZ7A 3EA6A 4KZCA 3T9LA 2L0FA 1U4AA 2BS2B 2GRIA 4TMAB 3B1LX 2K9XA 1CMXB 2ON8A 2FCSA 3EHVA 4P7IA 5BYSA 2M8SA 1I7HA 3WANA 3GE3C 2K0PA 2N7JA 3HK0A 3U4EG 3AEAB 1ZOYB 4GB9A 3APDA 5CX3A 2K39A 3HUIA 2DZMA 2R2OA 4BKSD 1WI0A 2WDVB 4K3CA 4MSMB 1UNSA 2WXIA 1QOFA 2KT7A 2PKOA 1NDDA 4RF0A 4EZJA 5JH5C 1SSNA 4K7SA 4EEWA 2VZKD 3NY5A 3ZIMA 3SD5A 1VZ8A 2KTRB 2N1VA 2WU5B 2WX1A 3A1QB 2ZZPB 4FN2A 4HKZE 1FXIA 3BYTB 1WF9A 1KLVA 4RGOS 5AZFA 1QQRA 4K7WA 4BBNF 1QOAA 3DBRB 2MW5A 5CHVC 3QJZA 2FUHB 3R7RA 2KX3A 2AQ2B 3M62B 1K53A 1ESFA 1WGHA 3CIRB 1QILA 4MGKE 3GOEA 2J53A 1RLFA 3U7ZA 4HPMB 4EZKA 2W3RA 4DXGA 1V49A 2EKEC 2KVZA 2N9EB 1IP9A 3ZXRA 2K5PA 1P9DU 3Q8CA 1TY0A 1SJHD 2IO3B 4A3OA 1I4QA 2IY1B 3Q69A 4B0MA 1HTOA 5G5HA 4DXAB 3RNEC 1Y8RC 4E71A 4URKA 2XN9C 3ZDTA 4FJYA 2PTLA 4N9F4 1OQRA 3IHPC 4F8CB 1STEA 1SIJA 3ZDMC 2RR9A 2BQQA 3X0WA 3C0RB 3KYDD 2K8HA 1NI3A 3Q3NC 2D07B 1A70A 3MHZA 3RZFA 3BY4B 1WGYA 2X38A 4IM2A 3T8MA 5HFYA 3P4PB 4NAMA 3PHXB 3BZDB 4JPSA 2NPTA 3ZNGC 2ASQA 2DLBA 1RM6C 2QSDA 3TMPB 2M4NA 3RI7C 1MJDA 1MPEA 2QHOA 4XDDA 4ZRPA 5TSSA 3QAQA 3R2TA 4OVZA 3A4SC 4DDID 2IGGA 2JRHA 4GDKB 3TJPA 2K1FA 3ZNZB 4B95A 2IPKD 4I6LB 2K25A 2DBYA 3DHHC 4NQLB 1YJIA 5G55A 3GZNB 2J4XA 2XK5A 3ZRFA 5E6OA 4PK1A 2LZ6A 3VUWA 4KGRA 2AQ1B 2NBVB 1WGDA 4HWIB 2V0GA 3KH0A 5DCNA 1WJNA 4IOIE 1E6EB 1N62A 3KUDB 2V3NA 3AI5A 2N1WA 5I4DA 3PRPB 3DHGC 2WXQA 1P98A 2LXCA 4HVBA 3A9KB 4M01A 3SDLC 2IDYA 2LMCA 1J8CA 2G3QB 3I9V1 2DAJA 4MJSB 1TS2A 4XZ4A 3NZ3A 4WAAA 2OJRA 2LJIA 4PT5A 5BMIA 2INCC 3DVNU 2RGFA 2GBJA 2FCNA 3ENEA 1TKEA 2MA9B 3AE5B 3FILB 3RN9C 1UGMA 1V8CA 3S2AA 2M0AA 3U8ZA 2HE7A 2JWUA 3VUXA 2ZVOA 1T5XD 2KLGA 2V4IB 5HI1A 4B9KA 1AWDA 4TUUA 1XLPA 3IAM1 3PHWB 4HK2A 2IJ0A 2KMMA 1RFAA 2KWCA 4ZHOA 1E7VA 3LDZE 1IBXA 2WNMA 3UQAA 2INDC 3UGBB 4OVUA 1N6ZA 5G5GA 2DYBA 2C5LC 3URYA 3H6NA 5BYRA 3EFUA 1JWAD 1I4XA 2KJHB 2QDFA 4ZOHC 4K81A 2RPQA 5J17A 3VQIA 1C3TA 1JALA 2KDIA 3FAHA 1LM8B 2I1JA 3NVYA 2BGFA 1QZEA 1KJTA 4HRSA 3AE4B 4KKJA 1MVKA 4MT5A 2ACZB 3ZVVA 1JROA 2Y5BB 2NCNA 3N30A 1D5MC 5FKAC 2Z0EB 1RRBA 2D5GA 2D3BA 3QQ8B 2GOWA 4YSYB 4FXCA 1P7EA 4KGTA 3ZKJC 1SE2A 4OVVA 1HZ6A 2O6VA 4MH8A 2E3TA 2CHZA 3CF6E 5HG2A 1Q5WB 2GB1A 3W5VB 2K6QA 3KLSX 3K9OB 3DBLI 1QT9A 1UGJA 4M0WA 1MHHE 3VUYA 4EE2A 4XWWA 2PVGC 2KDBA 1TT5B 5LXIB 4A20A 4LNOA 2A4ZA 1SE9A 3KW5B 2KAJA 2RDBC 3N20C 5EE1A 5C23A 1QF6A 4HCNB 4ZRIA 3SFEB 1NVID 1JWUD 2NTTA 4DWFA 4RGMA 1NBFC 3TEXA 4OW0A 3V62A 3OWEB 4RFBA 4WJQA 4YSXB 4JL9A 4LJPB 1WFYA 3V6CB 5EDSA 3KWVA 2J42A 3QWZB 4KIKB 4DHZB 5MPOA 3LYYA 2KHWB 2KK8A 3H8HA 3W1SA 3B9JA 3OAWA 3R2IA 1GNUA 4A3PA 2D3GA 2LHDA 4RF1A 2LUEA 4DQOC 5D2MB 4JIOU 1YN5A 4YL8A 4WWNA 2KANA 2CHWA 3BYYB 4AJYB 1ZPSA 2L32A 1J0GA 1F77A 5JXVA 4G11A 3ZTDA 4YTMB 1T0RC 5FR3A 4HPLB 3I3TB 5BMGA 1R4NI 4K7UA 1EWYC 3M63B 4BOSC 3SFDB 4W9FA 1FMAD 4WJPA 4LJOB 1RFKA 5E6NA 2ZNVB 3I5JC 3OG5A 4GXBA 2K22A 3HIZA 1F52A 3ONSA 4XX5A 2TSSA 2IBIB 3RCZA 3QIJA 3TEWA 1SIFA 3VH4B 1T0QC 3H7PB 4LNFA 3T3OA 3E56A 3AECB 2UYZB 2RDHA 2C7NB 2HJ8A 4FBJB 3T3NA 1LQBA 3HRDD 4YT0B 3DVNV 5EE0A 4DXFA 4JE3B 3NZUA 1GPXA 2PPHA 1FEHA 1JRPA 1SB3C 4C4VB 1WJ6A 4RGNA 4P16A 3UIPB 1NYRA 5E6PA 3W1YA 1E10A 3AH7A 3VRAB 1UWXA 4FJVB 1OTRB 2LVOA 4MDKE 2KOXA 4E74A 1V86A 2BVCA 2W9NA 1JRUA 3PLUA 2M56B 3DCGA 1V2YA 4M02A 4B0EA 3V3XA 3L0WB 2MH7A 1H4RA 2MLBA 4K3BA 4AP4C 3AB5A 4GIVA 1TJEA 4II2B 2FE8A 4IW0A 3A1QA 3R7QA 2LXAA 3ZJTA 1ACCA 2PIAA 4ZRJA 3DQVA 3RNFC 3PO0A 3VR8B 1L4ZB 5FR6A 1V5OA 1TBEA 2L8JA 4TKNA 3RPFC 4RH6A 1FXTB 1L7YA 1YMHE 2WDRB 2KDEB 5IA7A 2V3SA 1E7PB 1RYJA 1E8YA 3C8YA 2RD0A 3JYUA 2MCNB 2WXJA 1KF6B 2DZKA 1I4HA 2OEDA 2E6XA 1ZKHA 2IY0B 4WIPA 2WYQA 1FM0D 2KO3A 1WIAA 2AWTA 1KH0A 3ZGZA 2JT4B 4MELA 3PSEB 4G3XB 3U52E 1J7AA 3Q2AC 3CSTA 4KKIA 1HEZE 2KYWA 4A9AA 4C80A 2FAZA 2NBWB 2I2YA 3M3JA 1NI2A 2N9XA 4YTPB 2AL6A 2O2VA 1ZGUB 2LVPA 2FIFA 1Z2MA 1TS3A 2MBEA 2SEBD 4L23A 4GDLA 3FKYA 1FCLA 2W82A 3AE6B 4MM3B 4MGZE 2N9LA 1IUEA 4FADA 5IKCM 2WLBA 4WQMA 4OHJA 3VR9B 2IO1B 2MBOA 1YX5B 2LJ5A 3VXWA 2PVOD 1WZ0A 1QKZA 2SAKA 2Y5PA 3NZSA 4YXDB 2FCMA 2Z0DB 1WZ3A 1T6BX 2AX5A 2WXFA 3KWLA 4GDKA 1SEBD 1ROEA 2JUOA 2X8XX 2KQSA 3DWGC 3EGRA 1NEKB 1L6VA 3L08A 1TY2A 1FNUA 1VR9A 2C9WB 2GBRA 4XE0A 2WU2B 2WXRA 2YLMA 4ASWC 3DBLB 2OHFA 4IWQA 3W9CB 3ZJVA 1I42A 3NHEB 1LO5D 1SE3A 2MBBB 3ZXVA 4MEMA 4G50A 4C7YA 3PZDA 3TCAA 4IM3A 2AYOB 4BFRA 2ZEQA 4ZDVA 2CR5A 1XD3B 2JWZA 4HROA 3A9KA 4LDTD 4JWSC 3A9JB 2NMQA 4ARIA 2FIDA 4MGYE 4W9LA 2WXHA 4MJSA 2D2QA 5AZGA 1B1ZA 2LEKA 4GMVA 2D3AA 4YTNB 1F9JA 1YJ1A 3SR6A 3AU4A 1D5XC 4KVGB 4GLSC 3KVFB 2DNFA 2BF8B 5LLIA 5H8YE 4LCDE 2GBKA 2C7HA 2ICIA 2JVCA 2YVCA 2MJDA 1YJJA 2L83A 3FILA 4F1SA 4RGTA 2REXA 1JQ4A 4F7ZA 4AOFA 4WAFA 3RYTA 3QARA 1HZ5A 1L0VB 1AYFA 1C77A 3ZQ4A 2WXMA 2FUG1 1C4AA 2R61A 5J18A 2DWQA 2NVUI 1AN8A 1SGHA 1ET9A 5IP4D 1GJZA 1V9JA 1QOGA 1E90A 3RULA 1XCQL 3R3MA 5EE9A 1R4NB 5D3DA 1IPGA 1L6UA 1J7BA 1DOXA 2Y3AA 2MSED 5C3JB 2CS4A 3QHTA 5D94A 4EOYA 1UH6A 3PLVA 1G6JA 4W9IA 3QK0A 4HDOA 2KWUB 2KN4A 3PS6A 3HHMA 1XEEA 4A6QA 1E8ZA 2GBNA 2N4FA 2RSUA 2XEWA 2WXPA 4PYUA 1WWTA 3I63C 4HEA1 3UINB 2GBMA 4P1CC 3A4RA 1YQ3B 3B2FA 5DPWA 2A5UA 3AEEB 2DHZA 4N58A 1C1YB 4LNNA 1N5XA 2V1YA 3MC8A 5D7GA 4J6IA 2LASA 1HE8A 2KD0A 4L2YA 3BK1A 1V97A 2IGDA 2EELA 3TEZA 3IG3A 3IBEA 3OLMD 3HM6X 1DOYA 2KC1A 5J2RA 4NPNA 2KWDA 2LGYA 4KX6B 3M95A 1Z5SB 2WS3B 2B3AA 1KOTA 2L52A 1J19A 2KFKB 2QIEB 5E6JA 4LNIA 1B9RA 3VH3B 3P1MA 3L54A 1AARA 1ZW7A 3P4RB 2LD9A 1FNVA 1K51A 1NYQA 4AQ7A 3H1UA 4AWJA 5C2TB 4W9CA 4ZHPA 3ETRA 1P1AA 2W3SA 3ZW3A 1E8XA 1N61A 3AEGB 4KIKA 2CHXA 4WJNA 2N9PC 1TTNA 5H92C 1JWBD 4S0RA 3QA8A 4JGHB 4EKUA 3C19A 2WXLA 1MG8A 1OQQA 2QCZA 4RCOA 2Q5WD 3RZWC 1XCTL 3B08A 2MJ3A 3H9DA 3E9SA 2WDTB 2D10A 3BIID 4TSSA 4O1NA 2BBCA 1E7UA 4J3OD 2R2QA 1GG3A 1CJEA 1LFDA 4NJCA 4HPPA 3ZYYX 1UZXB 1UWMA 2QMTA 3L13A 1AW7A 2AL3A 4NY0A 3Q3FA 1SBBB 4IM0A 4USAA 3Q8EA 1XQQA 3WALA 3PGEA 1EU3A 2BYFA 3BVMA 4NQKE 1V5TA 1VD2A 2G4SA 2J0MA 3DDCB 3PVLA 1V6EA 2KQ4X 4XGAB 3H7SA 4JX1C 2KTFA 3H7PA 2DZJA 1ZP0B 2MQJA 1ZXHA 3MC9A 2K8BA 5D6JB 2D3CA 2KWVB 2KDMA 2Z59B 2JRIB 2KMAA 1L5PA 5HKHA 3MHSD 3Q14C 3ZNHB 2LWPA 4HDQA 3NG0A 2MHJA 3RD2A 4C4VA 3J9CA 2BKRB 4A90A 3L16A 3AEBB 1TIFA 2D11A 3VVWB 1P3QU 1JW9D 1R7SA 4US8A 3P4QB 2EMSA 3AN1A 2LHEA 4N59A 3PRMB 1DOIA 1JWSD 4XC2A 1WX8A 2WXNA 2WXKA 2DENB 3TSSA 1WGKA 2L05A 1HA5A 1X1MA 3WAOA 3D32A 2KKCA 1DGJA 1SE4A 3DVGY 4CQNA 5GXGB 2EMTA 3B0AA 4LTUA 1EF1A 4FLHA 3IT4B 3AE1B 5DPRA 3WA0A 2JXTA 2FCQA 1WR1A 4MACA 4OZAA 1R4MI 3MJWA 1T0SC 3W5UB 4WH4A 3OJ3A 4PS7A 4UDUC 4HCPB 4GOCA 1FRRA 4BKSA 2MWSB 1FRDA 1TYGB 1E8WA 4JLCA 1HQRD 1H8CA 4OZBA 1TGZB 4L1BA 3UQBA 1LGRA 2GI9A 5DPSA 4AJWA 2DYOA 4G0NB 4M8MA 4DBGA 2LUMA 4ANVA 2FNJB 1WH3A 3W1SC 2ZCBA 2JYTA 2XNAC 5JHBA 4IKGA 1EO6A 2B76B 1BUIC 1SXTA 1FD6A 1P7FA 2GLSA 2VH1A 2BB5A 4K1RB 4PS8A 2L1AA 2LVQA 3UI3A 2PEAA 2KMCA 1HXYD 4MM3A 1LXDA 2JSVX 5AUKA 4AS1A 3GE8C 1D6EC 2IYDB 4LNKA 1FFVA 1D4BA 4HKQA 4HJKA 4REZA 2CU3A 3APCA 3P4SB 4BZAA 3JSVB 2PJHA 3BVZA 1XLNA 2KTRA 4NAWB 2G45B 1OFFA 2BTEA 3DOWA 1TKYA 1WXMA 4US9A 1C9FA 3P63A 2BPSA 3BVGA 2I38A 2JZPA 1YN4A 2H89B 3LB8C 2HJ1A 2KACA 2G4DB 2ZPYA 2WHIA 2O6VD 2HD5B 3VFKA 3ZTCA 1F2RC 2XBBC 1K52A 3FC4A 2JXXA 4NJ6A 3MFGA 5L83A 1KFYB 2AEHA 3A9JA 2VZKB 4ANXA 2HTME 4GN1A 3WAMA 1TZ1A 2DYMA 4N6EB 1ZUD2 3PV1A 3V6EB 1WM2A 3IFWB 1YQ4B 3DHIC 4TV3A 2KC2A 2KQ7A 2LRUA 3Q8AA 2PE6B 1FNWA 2LFIA 1FCCC 2J52A 3ML9A 4M00A 1F0ZA 2ZW1A 1PDXA 4ARCA 4ANUA 5CHWA 4DHZE 1WRIA 4ACFA 4KDIC 3VDZA 2FBWB 4DHJD 2YEPF 1VDVA 3ECIA 3BK2A 5BYQA 1WGRA 1KLUD 2JYEA 2WP9B 1L2NA 2K8CA 1XXGA 2IZVB 2M17A 1WXVA 4ZYSA 3ZJUA 2BT6A 3KUCB 1J7CA 1XF5L 2MP2B 1TS4A 1WSPA 4HJGE 2W54A 1VZ6A 2UWQA 4ICUA 3RNAC 2L00B 4IG7B 3X23A 1K50A 1EM7A 2QILA 3ZUNA 5L95C 2BB6A 4BKGA 4OZCA 1ZE3D 3AV8A 1WYGA 4AUQC 3EC8A 2CU1A 2CJNA 1TZOA 4R3DA 2INNE 4IUMB 1N63A 4W9KA 4E3CA 3DPDA 4B6WA 1VRAB 2ZPNA 3ZLZA 3NUHB 1WXAA 3RFZB 2ZJDA 3CWIA 3AEDB 1V1PB 3IAS1 2Z8LA 1QOBA 4DDGD 1WMHB 3ML8A 4WWPA 3GB1A 4P1BC 1PGAA 1S1QB 1WGGA 4CHKA 3N9YC 4LK0M 3P2BA 5JZEB 1GC7A 3VRBB 2PE9A 1UD7A 3TEYA 3AXCA 4WWOA 3IXSA 2V4LA 2KLCA 1KM7A 1GUAB 4WURA 2IO2B 3NVZA 5D3IB 2KFKA 4C00A 4ICVA 3TUOA 3BINA 3L10B 3VAWA 4JQWC 4ANWA 1WE6A 1CQVA 3DBSA 4KDLB 1MFWA 1BMLC 2HTHA 4EZLA 3DBHI 1XLOA 1R4MB 2BS3B 5AEKB 2GMIC 2V3PA 4YSZB 5HHDG 2O2VB 2KVRA 2M0XA 2WQYB 3EFCA 1PFDA 1FIQA 3NS8A 3IVFA 2KZRA 4GDLB 1TKGA 2BYVE 3N1ZC 2MBHA 1N5WA 1NENB 1YD8U 3ZNID 2JZZA 2J7QB 1MHXA 1WE7A 3W2DA 3RMKC 1N60A 1QLBB 3UIOB 3PT2B 4BBNC 3VTVA 2YEPB 4W9HA 3N32A 4IWOA 2HDEA 1EF5A 1XT9B 1P0RA 2WX0A 1JMLA 1M4VA 2WGSA 3R8BA 1C4PA 1KLGD 3AE9B 1VZ7A 2BYEA 1WXQA 2LI5A 4LLGM 2IO0B 3ZRCA 3L17A 3LJ3A 1C4CA 5JHAA 3DWMA 5BO4B 1BT0A 2L7RA 4YWGG 2KJ6A 1GOZA 1FPYA 4MGIE 3RNBC 1YIWA 1PGXA 3NS1A 1SJED 2I1KA 1UUPA 2JF5A 1HTQA 1Y56A 3NJTA 1CK1A 3MC0B 1VCBA 5EE3A 2N7DA 4MH0E 2J0KA 1WXSA 2NS5A 1YX6B 2LGSA 4KV2A 4GU2A 3JW0X 4XDCA 2BKFA 4X57B 2JQRB 4A55A 3MTNB 3TIXA 3NRZA 3TBLD 1C79A 1GC6A 1I4RA 4C7ZA 3WAPA 1YQBA 3PPAA 4PYZA 3RUIB 5LNK1 3HVZA 4W9DA 5FK9C 1S3SG 2QEJC 3PREA 2RMMA 3NVWA 4XYCA 5IAAC 4EFOA 2BWFA 2N0SB 2WDQB 3AMZA 4C56C 3K9PB 3SHQA 1YN3A 3A33B 5DPTA 1DYQA 1WYWB 2AQ3B 2NPTB 3JVZX 2VRRB 2J0JA 3DVGX 3MJ5A 4HLEA 1E5WA 1PQSA 1UF0A 2KNBA 4IDIA 2MRPA 2EKIA 1Q1OA 3MP9A 2CKHB 2LGIA 4GSWA 2WXGA 1D5ZC 2OOBB 1WY8A 3KUZA 3Q6BA 4H2AA 4Q2JA 3VHTC 4GGQA 2RDGA 3AULA 3AU5A 1F2RI 2MJEA 2NBUA 1CZPA 2XK5B 1V81A 1L4DB 3VTUA 5C1ZA 3LXFA 3ALBA 1BXTA 2KDFB 2JX5A 3AE3B 3Q8BA 4W9EA 2BWES 3V60A 3N1YC 1ZXIA 2LGDA 2M1MA 2JZ3B 4KZ0A 4WQOB 4CO7A 4W9JA 4WWMA 3U7DA 2JY6A 5BMHA 2K3UA 1UBIA 2ONQA 3APFA 4NZLB 1PUTA 1GB4A 5KHOA 3OJ4B 3SEBA 2LRWA 3PTFC 3Q8FA 3AEFB 2DZIA 2W55A 3EECA 3SU8X 4I6NB 3DBRI 2KXJA 5AZHA 3Q3OC 2NR2A 1Q10A 4CYEA 3TL5A 1JCKB 1F1HA 1OGWA 5CHFA 1I4GA 1EUVB 4NJ7A 2DAFA 5T8IA 2ZNVC 2C60A 4D2KA 4FA6A 1D3ZA 5AUIA 5LXHA 3KYCD 4KSLC 1WRDB 3JSVA 1RWSA 1UBQA 3N3KB 3GP7A 2KX0A 1ET6A 4RMAA 1L0XB 4NAWA 1TS5A 4FULA 3V05A 1ZDXA 2Y5CA 3WCQA 2KFJA 1IBXB 3AE7B 3PRZA 4TQ0A 1WX7A 4M8NA 1A5RA 2UU7A 5TR5A 1I35A 3VTWA 4FJZA 1KTKA 3V61A 1WX9A 4I6PA 2ZCCA 3RNGC 2MBQA 2RPVA 1GAQB 1T3QA 1Q0WB 2KJRA 1EWCA 3CMMB 5G2NA 2OJWA 3WIMA 5IO9A 1VJKA 1YOVB 1E9MA 3B2GA 2L76A 3DBHB 1C76A 1PGBA 4RM9A 5IOIA 1UELA 4WJOA 1FXAA 2IGHA 2M19A 1WJUA 5KHQA 3GS2A 1ISNA 1RAXA 1IGDA 2BYTA 1JWMD 5GMVA 1ZDVA 4BOZB 3RNCC 3I57A 2N7EA 1FO4A 3EUB2 2BS4B 1KRHA 2G9HD 2JPHA 3HVDA 1XLQA 2O6VB 4RM8A 3QX1A 2PMVA 1FFUA 3N1XC 4QAYA 1WR6E 2JU6X 2DX5B 5IN7A 3PZ8A 4JWUC 3GZNI 4EUTA 1C78A 2V9HA 1MI0A 3R66C 2WXOA 4M0WB 1YNTE 4MSQB 3AM9A 1V1OA 4FHKA 4KSKC 5CTRC 1VLBA 3QC8B 4XWTA 2ZW0A 3KQ4A 2MP2A 3QCAA 2CJOA 1WJ4A 4KGSA 3AE8B 4A8XC 1OEYJ 4DK5A 1M94A 3NOBA 3IT6B 1I4PA 4ZRQA 3U2SC 3ZO5B 1V80A 2LGXA 4IWPA 4BAXA 2C7MB 4FHJA 4ZRKA 1L0YB 2QC8A 1E0ZA 1ENFA 4II3B 4ITKA 2INPE 4DHJB 2N9KA 3P42A 1OEYA 2NTSA 3O13A 2QJLA 3AE2B 4BKTA
chains in the Genus database with same CATH topology
3TEXA 2WS3B 3GB1A 4OW0A 1PGAA 2L52A 2QIEB 3BWUD 5E6JA 3OWEB 4RFBA 3N9YC 4LK0M 4YSXB 1B9RA 3P1MA 4P6VF 2MEKA 3VRBB 3KWVA 2J42A 5MPOA 3P4RB 3TEYA 3LYYA 1PYWD 1FNVA 1K51A 1NYQA 3IXSA 3ABVB 4AQ7A 3H8HA 2PW9A 1V1PA 3W1SA 3B9JA 5C2TB 3R2IA 4WURA 3NVZA 2LHDA 4RF1A 5D3IB 4DQOC 4ZHPA 4RNAA 3ETRA 2W3SA 2H88B 1N61A 3TUOA 1YN5A 3AEGB 4TQ1A 1XO3A 5H92C 1CQVA 1JWBD 2PLPA 3BYYB 1BMLC 2BW2A 1ZPSA 2G1EA 2WXLA 2L32A 1XLOA 1OQQA 4RCOA 2Q5WD 2BS3B 1XCTL 1F77A 5JXVA 2MJ3A 1IGCA 3NVVA 4YTMB 2V3PA 3E9SA 5HHDG 4YSZB 3BIID 5FR3A 4TSSA 4O1NA 5BMGA 2WQYB 1GB1A 2BBCA 1EWYC 1PFDA 4J3OD 1FIQA 3L4PA 3SFDB 1FMAD 1CJEA 4GDLB 4RGMA 4NJCA 1TKGA 1RFKA 1EU4A 1SF0A 3ZYYX 1N5WA 1UWMA 1NENB 2K22A 2QMTA 3PZ7A 3EA6A 1AW7A 3W2DA 1MHXA 2TSSA 1SBBB 1N60A 1QLBB 2BS2B 2GRIA 4TMAB 2K9XA 4USAA 3Q8EA 3TEWA 2ON8A 2YEPB 5BYSA 1EU3A 3T3OA 1I7HA 3BVMA 3E56A 2K0PA 2HDEA 2N7JA 3AECB 2RDHA 3U4EG 3AEAB 1ZOYB 3T3NA 3HRDD 4YT0B 1JMLA 1M4VA 3R8BA 1C4PA 2KQ4X 3HUIA 5EE0A 1KLGD 3AE9B 4JX1C 4DXFA 1VZ7A 2WDVB 1WXQA 4JE3B 4LLGM 1GPXA 1ZP0B 1FEHA 1UNSA 1JRPA 1SB3C 2WXIA 1QOFA 1ZXHA 2PKOA 1C4CA 2KDMA 3DWMA 4RF0A 1SSNA 4RGNA 4P16A 1L5PA 1NYRA 2VZKD 4YWGG 1GOZA 1VZ8A 1E10A 3AH7A 3VRAB 1UWXA 2WU5B 1PGXA 3NS1A 1SJED 1UUPA 1Y56A 4HKZE 1CK1A 2M56B 3MC0B 1FXIA 3BYTB 3J9CA 4B0EA 4A90A 3V3XA 4RGOS 5EE3A 2MH7A 3AEBB 1QQRA 1QOAA 1JW9D 1R7SA 4US8A 3P4QB 3AB5A 3AN1A 4XDCA 1TJEA 2FE8A 2LHEA 4N59A 3ZJTA 1DOIA 2JQRB 1ACCA 4A55A 1JWSD 2PIAA 2AQ2B 1K53A 1ESFA 3CIRB 2WXNA 1QILA 2WXKA 3PO0A 1L4ZB 3VR8B 3TSSA 1WGKA 3NRZA 2J53A 1C79A 3U7ZA 1HA5A 1I4RA 4C7ZA 2W3RA 4DXGA 5LNK1 1DGJA 1SE4A 4CQNA 5GXGB 3HVZA 5FK9C 2QEJC 4LTUA 3RPFC 4RH6A 2K5PA 2RMMA 3Q8CA 1TY0A 1YMHE 3IT4B 3AE1B 1SJHD 2WDRB 3NVWA 1I4QA 3Q69A 1E7PB 1RYJA 2N0SB 2WDQB 3C8YA 4B0MA 3AMZA 2JXTA 4MACA 5G5HA 4OZAA 2WXJA 4C56C 1KF6B 3W5UB 2XN9C 1I4HA 2OEDA 4WH4A 2E6XA 2PTLA 1YN3A 1OQRA 4WIPA 4UDUC 1FM0D 1STEA 1DYQA 1FRRA 2AQ3B 1SIJA 1FRDA 1TYGB 1HQRD 1KH0A 3MJ5A 3ZGZA 4OZBA 1NI3A 3U52E 1J7AA 4L1BA 1A70A 2GI9A 3MHZA 4IDIA 4KKIA 1HEZE 4A9AA 2EKIA 3MP9A 2LGIA 2X38A 4C80A 2WXGA 1D5ZC 5HFYA 3P4PB 2I2YA 4NAMA 3BZDB 2DYOA 4JPSA 4YTPB 2DLBA 2LUMA 1RM6C 2QSDA 4H2AA 4Q2JA 2JYTA 1MPEA 2XNAC 2RDGA 4XDDA 4ZRPA 4IKGA 1TS3A 2SEBD 5TSSA 1F2RI 2MJEA 3R2TA 4L23A 1CZPA 1FCLA 4OVZA 2B76B 2W82A 3AE6B 4MM3B 1BUIC 2IGGA 2N9LA 1IUEA 1SXTA 1L4DB 1FD6A 4GDKB 1P7FA 2WLBA 3LXFA 4WQMA 4OHJA 2IPKD 3VR9B 1BXTA 2DBYA 2JX5A 3AE3B 2PVOD 3Q8BA 2BB5A 1QKZA 2SAKA 2Y5PA 4YXDB 1YJIA 2L1AA 3UI3A 1ZXIA 1HXYD 2J4XA 1T6BX 2AX5A 2WXFA 2JSVX 5AUKA 3KWLA 4AS1A 1SEBD 1ROEA 4KGRA 4WWMA 2AQ1B 5BMHA 1D6EC 2K3UA 3DWGC 2V0GA 2ONQA 4NZLB 1PUTA 1FFVA 1GB4A 3EGRA 1D4BA 1NEKB 1L6VA 4HKQA 4IOIE 1E6EB 1TY2A 1FNUA 1N62A 1VR9A 4XE0A 2V3NA 3SEBA 2WU2B 3Q8FA 4REZA 2CU3A 3AEFB 2WXRA 3P4SB 2W55A 2OHFA 5I4DA 2WXQA 3W9CB 3ZJVA 1LO5D 1SE3A 1Q10A 3BVZA 1XLNA 2IDYA 1JCKB 2LMCA 4NAWB 1I4GA 1OFFA 4C7YA 3I9V1 2BTEA 1TS2A 5T8IA 1TKYA 4US9A 1C9FA 3NZ3A 4D2KA 3P63A 2LJIA 3BVGA 5AUIA 2I38A 2JZPA 4PT5A 5BMIA 1RWSA 1YN4A 4KX6B 2H89B 4HROA 3GP7A 3LB8C 1ET6A 2KACA 1L0XB 4JWSC 2NMQA 4ARIA 1TS5A 3V05A 1TKEA 3AE5B 2WXHA 3FILB 1ZDXA 2Y5CA 1F2RC 3WCQA 1B1ZA 1K52A 1V8CA 2LEKA 3FC4A 1IBXB 2M0AA 3AE7B 4TQ0A 2JWUA 4YTNB 1T5XD 2V4IB 5HI1A 3SR6A 3MFGA 1AWDA 1D5XC 1KFYB 4GLSC 1KTKA 1XLPA 5H8YE 2VZKB 3IAM1 2ICIA 2MJDA 1YJJA 2IJ0A 2L83A 2RPVA 3FILA 2HTME 1GAQB 2KMMA 4ZHOA 1T3QA 4RGTA 2DYMA 4N6EB 1EWCA 1ZUD2 1IBXA 1JQ4A 2WNMA 1YQ4B 4WAFA 5G5GA 3Q8AA 1HZ5A 1L0VB 1FNWA 1AYFA 1C77A 3URYA 2LFIA 3ZQ4A 1FCCC 2WXMA 5BYRA 1VJKA 2J52A 3B2GA 1E9MA 2FUG1 1JWAD 1C4AA 1I4XA 2R61A 1C76A 1PGBA 1F0ZA 2ZW1A 2DWQA 4ZOHC 1AN8A 1FXAA 1ET9A 2IGHA 2M19A 3VQIA 3GS2A 1PDXA 4ARCA 1IGDA 2BYTA 1QOGA 1JALA 1WRIA 1JWMD 3FAHA 1XCQL 2FBWB 5EE9A 2YEPF 3NVYA 1ZDVA 1VDVA 5D3DA 3BK2A 5BYQA 1L6UA 1J7BA 1DOXA 1KLUD 4HRSA 3I57A 3AE4B 2Y3AA 1FO4A 2JYEA 4KKJA 2WP9B 1MVKA 4MT5A 2ACZB 3EUB2 5C3JB 1XXGA 2BS4B 1JROA 4ZYSA 1KRHA 2G9HD 3HVDA 1XLQA 3ZJUA 2BT6A 2PMVA 1FFUA 1J7CA 1D5MC 5FKAC 2JU6X 1XF5L 3PZ8A 4JWUC 2KN4A 1TS4A 2D5GA 1C78A 1WSPA 4HJGE 2W54A 1VZ6A 1XEEA 4YSYB 4FXCA 4A6QA 1MI0A 2WXOA 2WXPA 1YNTE 1P7EA 1WWTA 4KGTA 3AM9A 1V1OA 1K50A 1EM7A 1SE2A 1VLBA 4HEA1 1HZ6A 4XWTA 4MH8A 2E3TA 2QILA 2ZW0A 5HG2A 2GB1A 3KQ4A 3W5VB 2BB6A 2CJOA 1YQ3B 3B2FA 4KGSA 3KLSX 3AE8B 4A8XC 4OZCA 1ZE3D 3AEEB 3AV8A 3IT6B 1WYGA 4N58A 1QT9A 1I4PA 1UGJA 1N5XA 4ZRQA 3U2SC 4M0WA 1MHHE 4EE2A 4XWWA 2PVGC 5D7GA 2CJNA 1TZOA 4R3DA 4L2YA 2INNE 3BK1A 1N63A 2KAJA 1V97A 2IGDA 2EELA 1L0YB 3TEZA 1E0ZA 1ENFA 1VRAB 5EE1A 1DOYA 4ITKA 1QF6A 2INPE 2N9KA 3NUHB 3SFEB 1NVID 1JWUD 3RFZB 2NTTA 3P42A 2NTSA 3CWIA 3O13A 2KWDA 2QJLA 3AE2B 3AEDB 1V1PB 3IAS1 2Z8LA 1QOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRP A;  1SB3 C;  2HTM E;  1GAQ B;  1QOF A;  2KMM A;  2PKO A;  2WS3 B;  1T3Q A;  4ZHO A;  3DWM A;  2L52 A;  1ZUD 2;  4N6E B;  1JQ4 A;  2MJE A;  2QIE B;  1CZP A;  2B76 B;  3AE6 B;  1YQ4 B;  1L5P A;  4YSX B;  1NYR A;  1B9R A;  5G5G A;  3P1M A;  1IUE A;  1E10 A;  1L0V B;  3AH7 A;  4P6V F;  3VRA B;  1AYF A;  2WLB A;  3VRB B;  3LXF A;  5MPO A;  2WU5 B;  1VJK A;  3P4R B;  3B2G A;  1E9M A;  3NS1 A;  4WQM A;  1JWA D;  3VR9 B;  1NYQ A;  2DBY A;  3ABV B;  2JX5 A;  1F0Z A;  3AE3 B;  2DWQ A;  2MJD A;  3B9J A;  4ZOH C;  1FXA A;  2PVO D;  2M56 B;  5C2T B;  2M19 A;  1FXI A;  4YXD B;  1PDX A;  1YJI A;  3NVZ A;  5EE3 A;  2MH7 A;  1QOG A;  1JAL A;  3AEB B;  1WRI A;  1ZXI A;  4ZHP A;  3ETR A;  1QOA A;  2AX5 A;  2W3S A;  3FAH A;  2H88 B;  1N61 A;  1JW9 D;  1R7S A;  2FBW B;  5EE9 A;  3KWL A;  3NVY A;  3AEG B;  5AUK A;  4US8 A;  1VDV A;  3P4Q B;  1ROE A;  3AB5 A;  4WWM A;  1XO3 A;  1L6U A;  3AN1 A;  5H92 C;  1TJE A;  1J7B A;  1DOX A;  4HRS A;  1JWB D;  3AE4 B;  4N59 A;  1FO4 A;  3DWG C;  1PUT A;  2WP9 B;  1FFV A;  1DOI A;  2ACZ B;  2JQR B;  3EUB 2;  1NEK B;  1L6V A;  2G1E A;  2PIA A;  5C3J B;  2BS4 B;  1JRO A;  1E6E B;  1XLO A;  3CIR B;  1KRH A;  1N62 A;  1OQQ A;  3PO0 A;  1XLQ A;  2Q5W D;  3VR8 B;  1WGK A;  2BT6 A;  2BS3 B;  2WU2 B;  2CU3 A;  3AEF B;  3NRZ A;  3P4S B;  1FFU A;  1J7C A;  4C7Z A;  2MJ3 A;  2W3R A;  4JWU C;  3NVV A;  2W55 A;  2OHF A;  4YTM B;  4YSZ B;  1DGJ A;  3BII D;  3W9C B;  2WQY B;  3HVZ A;  5GXG B;  1EWY C;  1PFD A;  2W54 A;  4LTU A;  1FIQ A;  3RPF C;  3L4P A;  4YSY B;  4FXC A;  1XLN A;  2K5P A;  3SFD B;  1FMA D;  1CJE A;  1WWT A;  3AE1 B;  3NVW A;  1OFF A;  2WDR B;  3AM9 A;  1VLB A;  1TKG A;  1RFK A;  4C7Y A;  1E7P B;  1RYJ A;  3ZYY X;  1SF0 A;  2N0S B;  2WDQ B;  1N5W A;  1TKY A;  1UWM A;  1NEN B;  3AMZ A;  2E3T A;  4US9 A;  5G5H A;  2K22 A;  1KF6 B;  3W5U B;  3P63 A;  3W5V B;  2CJO A;  5AUI A;  1YQ3 B;  1N60 A;  1QLB B;  2BS2 B;  3B2F A;  3AE8 B;  1OQR A;  3AEE B;  3AV8 A;  1RWS A;  2K9X A;  4KX6 B;  4USA A;  1WYG A;  1FM0 D;  2H89 B;  4HRO A;  1QT9 A;  4N58 A;  3LB8 C;  1FRR A;  1N5X A;  4JWS C;  1SIJ A;  1I7H A;  2PVG C;  1FRD A;  1TYG B;  1TKE A;  3AE5 B;  2CJN A;  3AEC B;  1NI3 A;  2Y5C A;  1J7A A;  3AEA B;  3WCQ A;  1N63 A;  1V8C A;  1V97 A;  2KAJ A;  1A70 A;  2LEK A;  3AE7 B;  1ZOY B;  3FC4 A;  4IDI A;  4A9A A;  1E0Z A;  3HRD D;  4YT0 B;  2EKI A;  4C80 A;  4YTN B;  5EE1 A;  1DOY A;  3P4P B;  4ITK A;  1QF6 A;  3HUI A;  5EE0 A;  3SR6 A;  1AWD A;  3AE9 B;  1KFY B;  4JX1 C;  1NVI D;  3SFE B;  2WDV B;  1WXQ A;  4YTP B;  1XLP A;  5H8Y E;  3CWI A;  1RM6 C;  2QJL A;  1GPX A;  1ZP0 B;  3AE2 B;  3AED B;  1QOB A;  1YJJ A;  2L83 A; 
#chains in the Genus database with same CATH topology
 2WWZ A;  3BWU D;  1WM3 A;  1T0Y A;  3HM3 A;  4P6V F;  2MEK A;  2ZVN A;  1PYW D;  3ABV B;  2K6D B;  2PW9 A;  1V1P A;  1WMH A;  2VH2 A;  1K8R B;  2MX2 A;  4RNA A;  2H88 B;  4W9G A;  4NNJ B;  1IYF A;  2L0T A;  4TQ1 A;  1XO3 A;  3CSF A;  2KN5 A;  3UF8 A;  2L3Z A;  4HXD A;  3RT3 B;  2PLP A;  1OQY A;  2BW2 A;  2G1E A;  4IC7 B;  4BVU C;  3O65 B;  3Q3M C;  4ZYN A;  1IGC A;  3NVV A;  4S17 A;  1GB1 A;  4PS3 A;  3U30 A;  3L4P A;  1MG4 A;  1EU4 A;  1SF0 A;  3Q3J A;  4LDT B;  3PZ7 A;  3EA6 A;  4KZC A;  3T9L A;  2L0F A;  1U4A A;  2BS2 B;  2GRI A;  4TMA B;  3B1L X;  2K9X A;  1CMX B;  2ON8 A;  2FCS A;  3EHV A;  4P7I A;  5BYS A;  2M8S A;  1I7H A;  3WAN A;  3GE3 C;  2K0P A;  2N7J A;  3HK0 A;  3U4E G;  3AEA B;  1ZOY B;  4GB9 A;  3APD A;  5CX3 A;  2K39 A;  3HUI A;  2DZM A;  2R2O A;  4BKS D;  1WI0 A;  2WDV B;  4K3C A;  4MSM B;  1UNS A;  2WXI A;  1QOF A;  2KT7 A;  2PKO A;  1NDD A;  4RF0 A;  4EZJ A;  5JH5 C;  1SSN A;  4K7S A;  4EEW A;  2VZK D;  3NY5 A;  3ZIM A;  3SD5 A;  1VZ8 A;  2KTR B;  2N1V A;  2WU5 B;  2WX1 A;  3A1Q B;  2ZZP B;  4FN2 A;  4HKZ E;  1FXI A;  3BYT B;  1WF9 A;  1KLV A;  4RGO S;  5AZF A;  1QQR A;  4K7W A;  4BBN F;  1QOA A;  3DBR B;  2MW5 A;  5CHV C;  3QJZ A;  2FUH B;  3R7R A;  2KX3 A;  2AQ2 B;  3M62 B;  1K53 A;  1ESF A;  1WGH A;  3CIR B;  1QIL A;  4MGK E;  3GOE A;  2J53 A;  1RLF A;  3U7Z A;  4HPM B;  4EZK A;  2W3R A;  4DXG A;  1V49 A;  2EKE C;  2KVZ A;  2N9E B;  1IP9 A;  3ZXR A;  2K5P A;  1P9D U;  3Q8C A;  1TY0 A;  1SJH D;  2IO3 B;  4A3O A;  1I4Q A;  2IY1 B;  3Q69 A;  4B0M A;  1HTO A;  5G5H A;  4DXA B;  3RNE C;  1Y8R C;  4E71 A;  4URK A;  2XN9 C;  3ZDT A;  4FJY A;  2PTL A;  4N9F 4;  1OQR A;  3IHP C;  4F8C B;  1STE A;  1SIJ A;  3ZDM C;  2RR9 A;  2BQQ A;  3X0W A;  3C0R B;  3KYD D;  2K8H A;  1NI3 A;  3Q3N C;  2D07 B;  1A70 A;  3MHZ A;  3RZF A;  3BY4 B;  1WGY A;  2X38 A;  4IM2 A;  3T8M A;  5HFY A;  3P4P B;  4NAM A;  3PHX B;  3BZD B;  4JPS A;  2NPT A;  3ZNG C;  2ASQ A;  2DLB A;  1RM6 C;  2QSD A;  3TMP B;  2M4N A;  3RI7 C;  1MJD A;  1MPE A;  2QHO A;  4XDD A;  4ZRP A;  5TSS A;  3QAQ A;  3R2T A;  4OVZ A;  3A4S C;  4DDI D;  2IGG A;  2JRH A;  4GDK B;  3TJP A;  2K1F A;  3ZNZ B;  4B95 A;  2IPK D;  4I6L B;  2K25 A;  2DBY A;  3DHH C;  4NQL B;  1YJI A;  5G55 A;  3GZN B;  2J4X A;  2XK5 A;  3ZRF A;  5E6O A;  4PK1 A;  2LZ6 A;  3VUW A;  4KGR A;  2AQ1 B;  2NBV B;  1WGD A;  4HWI B;  2V0G A;  3KH0 A;  5DCN A;  1WJN A;  4IOI E;  1E6E B;  1N62 A;  3KUD B;  2V3N A;  3AI5 A;  2N1W A;  5I4D A;  3PRP B;  3DHG C;  2WXQ A;  1P98 A;  2LXC A;  4HVB A;  3A9K B;  4M01 A;  3SDL C;  2IDY A;  2LMC A;  1J8C A;  2G3Q B;  3I9V 1;  2DAJ A;  4MJS B;  1TS2 A;  4XZ4 A;  3NZ3 A;  4WAA A;  2OJR A;  2LJI A;  4PT5 A;  5BMI A;  2INC C;  3DVN U;  2RGF A;  2GBJ A;  2FCN A;  3ENE A;  1TKE A;  2MA9 B;  3AE5 B;  3FIL B;  3RN9 C;  1UGM A;  1V8C A;  3S2A A;  2M0A A;  3U8Z A;  2HE7 A;  2JWU A;  3VUX A;  2ZVO A;  1T5X D;  2KLG A;  2V4I B;  5HI1 A;  4B9K A;  1AWD A;  4TUU A;  1XLP A;  3IAM 1;  3PHW B;  4HK2 A;  2IJ0 A;  2KMM A;  1RFA A;  2KWC A;  4ZHO A;  1E7V A;  3LDZ E;  1IBX A;  2WNM A;  3UQA A;  2IND C;  3UGB B;  4OVU A;  1N6Z A;  5G5G A;  2DYB A;  2C5L C;  3URY A;  3H6N A;  5BYR A;  3EFU A;  1JWA D;  1I4X A;  2KJH B;  2QDF A;  4ZOH C;  4K81 A;  2RPQ A;  5J17 A;  3VQI A;  1C3T A;  1JAL A;  2KDI A;  3FAH A;  1LM8 B;  2I1J A;  3NVY A;  2BGF A;  1QZE A;  1KJT A;  4HRS A;  3AE4 B;  4KKJ A;  1MVK A;  4MT5 A;  2ACZ B;  3ZVV A;  1JRO A;  2Y5B B;  2NCN A;  3N30 A;  1D5M C;  5FKA C;  2Z0E B;  1RRB A;  2D5G A;  2D3B A;  3QQ8 B;  2GOW A;  4YSY B;  4FXC A;  1P7E A;  4KGT A;  3ZKJ C;  1SE2 A;  4OVV A;  1HZ6 A;  2O6V A;  4MH8 A;  2E3T A;  2CHZ A;  3CF6 E;  5HG2 A;  1Q5W B;  2GB1 A;  3W5V B;  2K6Q A;  3KLS X;  3K9O B;  3DBL I;  1QT9 A;  1UGJ A;  4M0W A;  1MHH E;  3VUY A;  4EE2 A;  4XWW A;  2PVG C;  2KDB A;  1TT5 B;  5LXI B;  4A20 A;  4LNO A;  2A4Z A;  1SE9 A;  3KW5 B;  2KAJ A;  2RDB C;  3N20 C;  5EE1 A;  5C23 A;  1QF6 A;  4HCN B;  4ZRI A;  3SFE B;  1NVI D;  1JWU D;  2NTT A;  4DWF A;  4RGM A;  1NBF C;  3TEX A;  4OW0 A;  3V62 A;  3OWE B;  4RFB A;  4WJQ A;  4YSX B;  4JL9 A;  4LJP B;  1WFY A;  3V6C B;  5EDS A;  3KWV A;  2J42 A;  3QWZ B;  4KIK B;  4DHZ B;  5MPO A;  3LYY A;  2KHW B;  2KK8 A;  3H8H A;  3W1S A;  3B9J A;  3OAW A;  3R2I A;  1GNU A;  4A3P A;  2D3G A;  2LHD A;  4RF1 A;  2LUE A;  4DQO C;  5D2M B;  4JIO U;  1YN5 A;  4YL8 A;  4WWN A;  2KAN A;  2CHW A;  3BYY B;  4AJY B;  1ZPS A;  2L32 A;  1J0G A;  1F77 A;  5JXV A;  4G11 A;  3ZTD A;  4YTM B;  1T0R C;  5FR3 A;  4HPL B;  3I3T B;  5BMG A;  1R4N I;  4K7U A;  1EWY C;  3M63 B;  4BOS C;  3SFD B;  4W9F A;  1FMA D;  4WJP A;  4LJO B;  1RFK A;  5E6N A;  2ZNV B;  3I5J C;  3OG5 A;  4GXB A;  2K22 A;  3HIZ A;  1F52 A;  3ONS A;  4XX5 A;  2TSS A;  2IBI B;  3RCZ A;  3QIJ A;  3TEW A;  1SIF A;  3VH4 B;  1T0Q C;  3H7P B;  4LNF A;  3T3O A;  3E56 A;  3AEC B;  2UYZ B;  2RDH A;  2C7N B;  2HJ8 A;  4FBJ B;  3T3N A;  1LQB A;  3HRD D;  4YT0 B;  3DVN V;  5EE0 A;  4DXF A;  4JE3 B;  3NZU A;  1GPX A;  2PPH A;  1FEH A;  1JRP A;  1SB3 C;  4C4V B;  1WJ6 A;  4RGN A;  4P16 A;  3UIP B;  1NYR A;  5E6P A;  3W1Y A;  1E10 A;  3AH7 A;  3VRA B;  1UWX A;  4FJV B;  1OTR B;  2LVO A;  4MDK E;  2KOX A;  4E74 A;  1V86 A;  2BVC A;  2W9N A;  1JRU A;  3PLU A;  2M56 B;  3DCG A;  1V2Y A;  4M02 A;  4B0E A;  3V3X A;  3L0W B;  2MH7 A;  1H4R A;  2MLB A;  4K3B A;  4AP4 C;  3AB5 A;  4GIV A;  1TJE A;  4II2 B;  2FE8 A;  4IW0 A;  3A1Q A;  3R7Q A;  2LXA A;  3ZJT A;  1ACC A;  2PIA A;  4ZRJ A;  3DQV A;  3RNF C;  3PO0 A;  3VR8 B;  1L4Z B;  5FR6 A;  1V5O A;  1TBE A;  2L8J A;  4TKN A;  3RPF C;  4RH6 A;  1FXT B;  1L7Y A;  1YMH E;  2WDR B;  2KDE B;  5IA7 A;  2V3S A;  1E7P B;  1RYJ A;  1E8Y A;  3C8Y A;  2RD0 A;  3JYU A;  2MCN B;  2WXJ A;  1KF6 B;  2DZK A;  1I4H A;  2OED A;  2E6X A;  1ZKH A;  2IY0 B;  4WIP A;  2WYQ A;  1FM0 D;  2KO3 A;  1WIA A;  2AWT A;  1KH0 A;  3ZGZ A;  2JT4 B;  4MEL A;  3PSE B;  4G3X B;  3U52 E;  1J7A A;  3Q2A C;  3CST A;  4KKI A;  1HEZ E;  2KYW A;  4A9A A;  4C80 A;  2FAZ A;  2NBW B;  2I2Y A;  3M3J A;  1NI2 A;  2N9X A;  4YTP B;  2AL6 A;  2O2V A;  1ZGU B;  2LVP A;  2FIF A;  1Z2M A;  1TS3 A;  2MBE A;  2SEB D;  4L23 A;  4GDL A;  3FKY A;  1FCL A;  2W82 A;  3AE6 B;  4MM3 B;  4MGZ E;  2N9L A;  1IUE A;  4FAD A;  5IKC M;  2WLB A;  4WQM A;  4OHJ A;  3VR9 B;  2IO1 B;  2MBO A;  1YX5 B;  2LJ5 A;  3VXW A;  2PVO D;  1WZ0 A;  1QKZ A;  2SAK A;  2Y5P A;  3NZS A;  4YXD B;  2FCM A;  2Z0D B;  1WZ3 A;  1T6B X;  2AX5 A;  2WXF A;  3KWL A;  4GDK A;  1SEB D;  1ROE A;  2JUO A;  2X8X X;  2KQS A;  3DWG C;  3EGR A;  1NEK B;  1L6V A;  3L08 A;  1TY2 A;  1FNU A;  1VR9 A;  2C9W B;  2GBR A;  4XE0 A;  2WU2 B;  2WXR A;  2YLM A;  4ASW C;  3DBL B;  2OHF A;  4IWQ A;  3W9C B;  3ZJV A;  1I42 A;  3NHE B;  1LO5 D;  1SE3 A;  2MBB B;  3ZXV A;  4MEM A;  4G50 A;  4C7Y A;  3PZD A;  3TCA A;  4IM3 A;  2AYO B;  4BFR A;  2ZEQ A;  4ZDV A;  2CR5 A;  1XD3 B;  2JWZ A;  4HRO A;  3A9K A;  4LDT D;  4JWS C;  3A9J B;  2NMQ A;  4ARI A;  2FID A;  4MGY E;  4W9L A;  2WXH A;  4MJS A;  2D2Q A;  5AZG A;  1B1Z A;  2LEK A;  4GMV A;  2D3A A;  4YTN B;  1F9J A;  1YJ1 A;  3SR6 A;  3AU4 A;  1D5X C;  4KVG B;  4GLS C;  3KVF B;  2DNF A;  2BF8 B;  5LLI A;  5H8Y E;  4LCD E;  2GBK A;  2C7H A;  2ICI A;  2JVC A;  2YVC A;  2MJD A;  1YJJ A;  2L83 A;  3FIL A;  4F1S A;  4RGT A;  2REX A;  1JQ4 A;  4F7Z A;  4AOF A;  4WAF A;  3RYT A;  3QAR A;  1HZ5 A;  1L0V B;  1AYF A;  1C77 A;  3ZQ4 A;  2WXM A;  2FUG 1;  1C4A A;  2R61 A;  5J18 A;  2DWQ A;  2NVU I;  1AN8 A;  1SGH A;  1ET9 A;  5IP4 D;  1GJZ A;  1V9J A;  1QOG A;  1E90 A;  3RUL A;  1XCQ L;  3R3M A;  5EE9 A;  1R4N B;  5D3D A;  1IPG A;  1L6U A;  1J7B A;  1DOX A;  2Y3A A;  2MSE D;  5C3J B;  2CS4 A;  3QHT A;  5D94 A;  4EOY A;  1UH6 A;  3PLV A;  1G6J A;  4W9I A;  3QK0 A;  4HDO A;  2KWU B;  2KN4 A;  3PS6 A;  3HHM A;  1XEE A;  4A6Q A;  1E8Z A;  2GBN A;  2N4F A;  2RSU A;  2XEW A;  2WXP A;  4PYU A;  1WWT A;  3I63 C;  4HEA 1;  3UIN B;  2GBM A;  4P1C C;  3A4R A;  1YQ3 B;  3B2F A;  5DPW A;  2A5U A;  3AEE B;  2DHZ A;  4N58 A;  1C1Y B;  4LNN A;  1N5X A;  2V1Y A;  3MC8 A;  5D7G A;  4J6I A;  2LAS A;  1HE8 A;  2KD0 A;  4L2Y A;  3BK1 A;  1V97 A;  2IGD A;  2EEL A;  3TEZ A;  3IG3 A;  3IBE A;  3OLM D;  3HM6 X;  1DOY A;  2KC1 A;  5J2R A;  4NPN A;  2KWD A;  2LGY A;  4KX6 B;  3M95 A;  1Z5S B;  2WS3 B;  2B3A A;  1KOT A;  2L52 A;  1J19 A;  2KFK B;  2QIE B;  5E6J A;  4LNI A;  1B9R A;  3VH3 B;  3P1M A;  3L54 A;  1AAR A;  1ZW7 A;  3P4R B;  2LD9 A;  1FNV A;  1K51 A;  1NYQ A;  4AQ7 A;  3H1U A;  4AWJ A;  5C2T B;  4W9C A;  4ZHP A;  3ETR A;  1P1A A;  2W3S A;  3ZW3 A;  1E8X A;  1N61 A;  3AEG B;  4KIK A;  2CHX A;  4WJN A;  2N9P C;  1TTN A;  5H92 C;  1JWB D;  4S0R A;  3QA8 A;  4JGH B;  4EKU A;  3C19 A;  2WXL A;  1MG8 A;  1OQQ A;  2QCZ A;  4RCO A;  2Q5W D;  3RZW C;  1XCT L;  3B08 A;  2MJ3 A;  3H9D A;  3E9S A;  2WDT B;  2D10 A;  3BII D;  4TSS A;  4O1N A;  2BBC A;  1E7U A;  4J3O D;  2R2Q A;  1GG3 A;  1CJE A;  1LFD A;  4NJC A;  4HPP A;  3ZYY X;  1UZX B;  1UWM A;  2QMT A;  3L13 A;  1AW7 A;  2AL3 A;  4NY0 A;  3Q3F A;  1SBB B;  4IM0 A;  4USA A;  3Q8E A;  1XQQ A;  3WAL A;  3PGE A;  1EU3 A;  2BYF A;  3BVM A;  4NQK E;  1V5T A;  1VD2 A;  2G4S A;  2J0M A;  3DDC B;  3PVL A;  1V6E A;  2KQ4 X;  4XGA B;  3H7S A;  4JX1 C;  2KTF A;  3H7P A;  2DZJ A;  1ZP0 B;  2MQJ A;  1ZXH A;  3MC9 A;  2K8B A;  5D6J B;  2D3C A;  2KWV B;  2KDM A;  2Z59 B;  2JRI B;  2KMA A;  1L5P A;  5HKH A;  3MHS D;  3Q14 C;  3ZNH B;  2LWP A;  4HDQ A;  3NG0 A;  2MHJ A;  3RD2 A;  4C4V A;  3J9C A;  2BKR B;  4A90 A;  3L16 A;  3AEB B;  1TIF A;  2D11 A;  3VVW B;  1P3Q U;  1JW9 D;  1R7S A;  4US8 A;  3P4Q B;  2EMS A;  3AN1 A;  2LHE A;  4N59 A;  3PRM B;  1DOI A;  1JWS D;  4XC2 A;  1WX8 A;  2WXN A;  2WXK A;  2DEN B;  3TSS A;  1WGK A;  2L05 A;  1HA5 A;  1X1M A;  3WAO A;  3D32 A;  2KKC A;  1DGJ A;  1SE4 A;  3DVG Y;  4CQN A;  5GXG B;  2EMT A;  3B0A A;  4LTU A;  1EF1 A;  4FLH A;  3IT4 B;  3AE1 B;  5DPR A;  3WA0 A;  2JXT A;  2FCQ A;  1WR1 A;  4MAC A;  4OZA A;  1R4M I;  3MJW A;  1T0S C;  3W5U B;  4WH4 A;  3OJ3 A;  4PS7 A;  4UDU C;  4HCP B;  4GOC A;  1FRR A;  4BKS A;  2MWS B;  1FRD A;  1TYG B;  1E8W A;  4JLC A;  1HQR D;  1H8C A;  4OZB A;  1TGZ B;  4L1B A;  3UQB A;  1LGR A;  2GI9 A;  5DPS A;  4AJW A;  2DYO A;  4G0N B;  4M8M A;  4DBG A;  2LUM A;  4ANV A;  2FNJ B;  1WH3 A;  3W1S C;  2ZCB A;  2JYT A;  2XNA C;  5JHB A;  4IKG A;  1EO6 A;  2B76 B;  1BUI C;  1SXT A;  1FD6 A;  1P7F A;  2GLS A;  2VH1 A;  2BB5 A;  4K1R B;  4PS8 A;  2L1A A;  2LVQ A;  3UI3 A;  2PEA A;  2KMC A;  1HXY D;  4MM3 A;  1LXD A;  2JSV X;  5AUK A;  4AS1 A;  3GE8 C;  1D6E C;  2IYD B;  4LNK A;  1FFV A;  1D4B A;  4HKQ A;  4HJK A;  4REZ A;  2CU3 A;  3APC A;  3P4S B;  4BZA A;  3JSV B;  2PJH A;  3BVZ A;  1XLN A;  2KTR A;  4NAW B;  2G45 B;  1OFF A;  2BTE A;  3DOW A;  1TKY A;  1WXM A;  4US9 A;  1C9F A;  3P63 A;  2BPS A;  3BVG A;  2I38 A;  2JZP A;  1YN4 A;  2H89 B;  3LB8 C;  2HJ1 A;  2KAC A;  2G4D B;  2ZPY A;  2WHI A;  2O6V D;  2HD5 B;  3VFK A;  3ZTC A;  1F2R C;  2XBB C;  1K52 A;  3FC4 A;  2JXX A;  4NJ6 A;  3MFG A;  5L83 A;  1KFY B;  2AEH A;  3A9J A;  2VZK B;  4ANX A;  2HTM E;  4GN1 A;  3WAM A;  1TZ1 A;  2DYM A;  4N6E B;  1ZUD 2;  3PV1 A;  3V6E B;  1WM2 A;  3IFW B;  1YQ4 B;  3DHI C;  4TV3 A;  2KC2 A;  2KQ7 A;  2LRU A;  3Q8A A;  2PE6 B;  1FNW A;  2LFI A;  1FCC C;  2J52 A;  3ML9 A;  4M00 A;  1F0Z A;  2ZW1 A;  1PDX A;  4ARC A;  4ANU A;  5CHW A;  4DHZ E;  1WRI A;  4ACF A;  4KDI C;  3VDZ A;  2FBW B;  4DHJ D;  2YEP F;  1VDV A;  3ECI A;  3BK2 A;  5BYQ A;  1WGR A;  1KLU D;  2JYE A;  2WP9 B;  1L2N A;  2K8C A;  1XXG A;  2IZV B;  2M17 A;  1WXV A;  4ZYS A;  3ZJU A;  2BT6 A;  3KUC B;  1J7C A;  1XF5 L;  2MP2 B;  1TS4 A;  1WSP A;  4HJG E;  2W54 A;  1VZ6 A;  2UWQ A;  4ICU A;  3RNA C;  2L00 B;  4IG7 B;  3X23 A;  1K50 A;  1EM7 A;  2QIL A;  3ZUN A;  5L95 C;  2BB6 A;  4BKG A;  4OZC A;  1ZE3 D;  3AV8 A;  1WYG A;  4AUQ C;  3EC8 A;  2CU1 A;  2CJN A;  1TZO A;  4R3D A;  2INN E;  4IUM B;  1N63 A;  4W9K A;  4E3C A;  3DPD A;  4B6W A;  1VRA B;  2ZPN A;  3ZLZ A;  3NUH B;  1WXA A;  3RFZ B;  2ZJD A;  3CWI A;  3AED B;  1V1P B;  3IAS 1;  2Z8L A;  1QOB A;  4DDG D;  1WMH B;  3ML8 A;  4WWP A;  3GB1 A;  4P1B C;  1PGA A;  1S1Q B;  1WGG A;  4CHK A;  3N9Y C;  4LK0 M;  3P2B A;  5JZE B;  1GC7 A;  3VRB B;  2PE9 A;  1UD7 A;  3TEY A;  3AXC A;  4WWO A;  3IXS A;  2V4L A;  2KLC A;  1KM7 A;  1GUA B;  4WUR A;  2IO2 B;  3NVZ A;  5D3I B;  2KFK A;  4C00 A;  4ICV A;  3TUO A;  3BIN A;  3L10 B;  3VAW A;  4JQW C;  4ANW A;  1WE6 A;  1CQV A;  3DBS A;  4KDL B;  1MFW A;  1BML C;  2HTH A;  4EZL A;  3DBH I;  1XLO A;  1R4M B;  2BS3 B;  5AEK B;  2GMI C;  2V3P A;  4YSZ B;  5HHD G;  2O2V B;  2KVR A;  2M0X A;  2WQY B;  3EFC A;  1PFD A;  1FIQ A;  3NS8 A;  3IVF A;  2KZR A;  4GDL B;  1TKG A;  2BYV E;  3N1Z C;  2MBH A;  1N5W A;  1NEN B;  1YD8 U;  3ZNI D;  2JZZ A;  2J7Q B;  1MHX A;  1WE7 A;  3W2D A;  3RMK C;  1N60 A;  1QLB B;  3UIO B;  3PT2 B;  4BBN C;  3VTV A;  2YEP B;  4W9H A;  3N32 A;  4IWO A;  2HDE A;  1EF5 A;  1XT9 B;  1P0R A;  2WX0 A;  1JML A;  1M4V A;  2WGS A;  3R8B A;  1C4P A;  1KLG D;  3AE9 B;  1VZ7 A;  2BYE A;  1WXQ A;  2LI5 A;  4LLG M;  2IO0 B;  3ZRC A;  3L17 A;  3LJ3 A;  1C4C A;  5JHA A;  3DWM A;  5BO4 B;  1BT0 A;  2L7R A;  4YWG G;  2KJ6 A;  1GOZ A;  1FPY A;  4MGI E;  3RNB C;  1YIW A;  1PGX A;  3NS1 A;  1SJE D;  2I1K A;  1UUP A;  2JF5 A;  1HTQ A;  1Y56 A;  3NJT A;  1CK1 A;  3MC0 B;  1VCB A;  5EE3 A;  2N7D A;  4MH0 E;  2J0K A;  1WXS A;  2NS5 A;  1YX6 B;  2LGS A;  4KV2 A;  4GU2 A;  3JW0 X;  4XDC A;  2BKF A;  4X57 B;  2JQR B;  4A55 A;  3MTN B;  3TIX A;  3NRZ A;  3TBL D;  1C79 A;  1GC6 A;  1I4R A;  4C7Z A;  3WAP A;  1YQB A;  3PPA A;  4PYZ A;  3RUI B;  5LNK 1;  3HVZ A;  4W9D A;  5FK9 C;  1S3S G;  2QEJ C;  3PRE A;  2RMM A;  3NVW A;  4XYC A;  5IAA C;  4EFO A;  2BWF A;  2N0S B;  2WDQ B;  3AMZ A;  4C56 C;  3K9P B;  3SHQ A;  1YN3 A;  3A33 B;  5DPT A;  1DYQ A;  1WYW B;  2AQ3 B;  2NPT B;  3JVZ X;  2VRR B;  2J0J A;  3DVG X;  3MJ5 A;  4HLE A;  1E5W A;  1PQS A;  1UF0 A;  2KNB A;  4IDI A;  2MRP A;  2EKI A;  1Q1O A;  3MP9 A;  2CKH B;  2LGI A;  4GSW A;  2WXG A;  1D5Z C;  2OOB B;  1WY8 A;  3KUZ A;  3Q6B A;  4H2A A;  4Q2J A;  3VHT C;  4GGQ A;  2RDG A;  3AUL A;  3AU5 A;  1F2R I;  2MJE A;  2NBU A;  1CZP A;  2XK5 B;  1V81 A;  1L4D B;  3VTU A;  5C1Z A;  3LXF A;  3ALB A;  1BXT A;  2KDF B;  2JX5 A;  3AE3 B;  3Q8B A;  4W9E A;  2BWE S;  3V60 A;  3N1Y C;  1ZXI A;  2LGD A;  2M1M A;  2JZ3 B;  4KZ0 A;  4WQO B;  4CO7 A;  4W9J A;  4WWM A;  3U7D A;  2JY6 A;  5BMH A;  2K3U A;  1UBI A;  2ONQ A;  3APF A;  4NZL B;  1PUT A;  1GB4 A;  5KHO A;  3OJ4 B;  3SEB A;  2LRW A;  3PTF C;  3Q8F A;  3AEF B;  2DZI A;  2W55 A;  3EEC A;  3SU8 X;  4I6N B;  3DBR I;  2KXJ A;  5AZH A;  3Q3O C;  2NR2 A;  1Q10 A;  4CYE A;  3TL5 A;  1JCK B;  1F1H A;  1OGW A;  5CHF A;  1I4G A;  1EUV B;  4NJ7 A;  2DAF A;  5T8I A;  2ZNV C;  2C60 A;  4D2K A;  4FA6 A;  1D3Z A;  5AUI A;  5LXH A;  3KYC D;  4KSL C;  1WRD B;  3JSV A;  1RWS A;  1UBQ A;  3N3K B;  3GP7 A;  2KX0 A;  1ET6 A;  4RMA A;  1L0X B;  4NAW A;  1TS5 A;  4FUL A;  3V05 A;  1ZDX A;  2Y5C A;  3WCQ A;  2KFJ A;  1IBX B;  3AE7 B;  3PRZ A;  4TQ0 A;  1WX7 A;  4M8N A;  1A5R A;  2UU7 A;  5TR5 A;  1I35 A;  3VTW A;  4FJZ A;  1KTK A;  3V61 A;  1WX9 A;  4I6P A;  2ZCC A;  3RNG C;  2MBQ A;  2RPV A;  1GAQ B;  1T3Q A;  1Q0W B;  2KJR A;  1EWC A;  3CMM B;  5G2N A;  2OJW A;  3WIM A;  5IO9 A;  1VJK A;  1YOV B;  1E9M A;  3B2G A;  2L76 A;  3DBH B;  1C76 A;  1PGB A;  4RM9 A;  5IOI A;  1UEL A;  4WJO A;  1FXA A;  2IGH A;  2M19 A;  1WJU A;  5KHQ A;  3GS2 A;  1ISN A;  1RAX A;  1IGD A;  2BYT A;  1JWM D;  5GMV A;  1ZDV A;  4BOZ B;  3RNC C;  3I57 A;  2N7E A;  1FO4 A;  3EUB 2;  2BS4 B;  1KRH A;  2G9H D;  2JPH A;  3HVD A;  1XLQ A;  2O6V B;  4RM8 A;  3QX1 A;  2PMV A;  1FFU A;  3N1X C;  4QAY A;  1WR6 E;  2JU6 X;  2DX5 B;  5IN7 A;  3PZ8 A;  4JWU C;  3GZN I;  4EUT A;  1C78 A;  2V9H A;  1MI0 A;  3R66 C;  2WXO A;  4M0W B;  1YNT E;  4MSQ B;  3AM9 A;  1V1O A;  4FHK A;  4KSK C;  5CTR C;  1VLB A;  3QC8 B;  4XWT A;  2ZW0 A;  3KQ4 A;  2MP2 A;  3QCA A;  2CJO A;  1WJ4 A;  4KGS A;  3AE8 B;  4A8X C;  1OEY J;  4DK5 A;  1M94 A;  3NOB A;  3IT6 B;  1I4P A;  4ZRQ A;  3U2S C;  3ZO5 B;  1V80 A;  2LGX A;  4IWP A;  4BAX A;  2C7M B;  4FHJ A;  4ZRK A;  1L0Y B;  2QC8 A;  1E0Z A;  1ENF A;  4II3 B;  4ITK A;  2INP E;  4DHJ B;  2N9K A;  3P42 A;  1OEY A;  2NTS A;  3O13 A;  2QJL A;  3AE2 B;  4BKT A; 
#chains in the Genus database with same CATH homology
 3TEX A;  2WS3 B;  3GB1 A;  4OW0 A;  1PGA A;  2L52 A;  2QIE B;  3BWU D;  5E6J A;  3OWE B;  4RFB A;  3N9Y C;  4LK0 M;  4YSX B;  1B9R A;  3P1M A;  4P6V F;  2MEK A;  3VRB B;  3KWV A;  2J42 A;  5MPO A;  3P4R B;  3TEY A;  3LYY A;  1PYW D;  1FNV A;  1K51 A;  1NYQ A;  3IXS A;  3ABV B;  4AQ7 A;  3H8H A;  2PW9 A;  1V1P A;  3W1S A;  3B9J A;  5C2T B;  3R2I A;  4WUR A;  3NVZ A;  2LHD A;  4RF1 A;  5D3I B;  4DQO C;  4ZHP A;  4RNA A;  3ETR A;  2W3S A;  2H88 B;  1N61 A;  3TUO A;  1YN5 A;  3AEG B;  4TQ1 A;  1XO3 A;  5H92 C;  1CQV A;  1JWB D;  2PLP A;  3BYY B;  1BML C;  2BW2 A;  1ZPS A;  2G1E A;  2WXL A;  2L32 A;  1XLO A;  1OQQ A;  4RCO A;  2Q5W D;  2BS3 B;  1XCT L;  1F77 A;  5JXV A;  2MJ3 A;  1IGC A;  3NVV A;  4YTM B;  2V3P A;  3E9S A;  5HHD G;  4YSZ B;  3BII D;  5FR3 A;  4TSS A;  4O1N A;  5BMG A;  2WQY B;  1GB1 A;  2BBC A;  1EWY C;  1PFD A;  4J3O D;  1FIQ A;  3L4P A;  3SFD B;  1FMA D;  1CJE A;  4GDL B;  4RGM A;  4NJC A;  1TKG A;  1RFK A;  1EU4 A;  1SF0 A;  3ZYY X;  1N5W A;  1UWM A;  1NEN B;  2K22 A;  2QMT A;  3PZ7 A;  3EA6 A;  1AW7 A;  3W2D A;  1MHX A;  2TSS A;  1SBB B;  1N60 A;  1QLB B;  2BS2 B;  2GRI A;  4TMA B;  2K9X A;  4USA A;  3Q8E A;  3TEW A;  2ON8 A;  2YEP B;  5BYS A;  1EU3 A;  3T3O A;  1I7H A;  3BVM A;  3E56 A;  2K0P A;  2HDE A;  2N7J A;  3AEC B;  2RDH A;  3U4E G;  3AEA B;  1ZOY B;  3T3N A;  3HRD D;  4YT0 B;  1JML A;  1M4V A;  3R8B A;  1C4P A;  2KQ4 X;  3HUI A;  5EE0 A;  1KLG D;  3AE9 B;  4JX1 C;  4DXF A;  1VZ7 A;  2WDV B;  1WXQ A;  4JE3 B;  4LLG M;  1GPX A;  1ZP0 B;  1FEH A;  1UNS A;  1JRP A;  1SB3 C;  2WXI A;  1QOF A;  1ZXH A;  2PKO A;  1C4C A;  2KDM A;  3DWM A;  4RF0 A;  1SSN A;  4RGN A;  4P16 A;  1L5P A;  1NYR A;  2VZK D;  4YWG G;  1GOZ A;  1VZ8 A;  1E10 A;  3AH7 A;  3VRA B;  1UWX A;  2WU5 B;  1PGX A;  3NS1 A;  1SJE D;  1UUP A;  1Y56 A;  4HKZ E;  1CK1 A;  2M56 B;  3MC0 B;  1FXI A;  3BYT B;  3J9C A;  4B0E A;  4A90 A;  3V3X A;  4RGO S;  5EE3 A;  2MH7 A;  3AEB B;  1QQR A;  1QOA A;  1JW9 D;  1R7S A;  4US8 A;  3P4Q B;  3AB5 A;  3AN1 A;  4XDC A;  1TJE A;  2FE8 A;  2LHE A;  4N59 A;  3ZJT A;  1DOI A;  2JQR B;  1ACC A;  4A55 A;  1JWS D;  2PIA A;  2AQ2 B;  1K53 A;  1ESF A;  3CIR B;  2WXN A;  1QIL A;  2WXK A;  3PO0 A;  1L4Z B;  3VR8 B;  3TSS A;  1WGK A;  3NRZ A;  2J53 A;  1C79 A;  3U7Z A;  1HA5 A;  1I4R A;  4C7Z A;  2W3R A;  4DXG A;  5LNK 1;  1DGJ A;  1SE4 A;  4CQN A;  5GXG B;  3HVZ A;  5FK9 C;  2QEJ C;  4LTU A;  3RPF C;  4RH6 A;  2K5P A;  2RMM A;  3Q8C A;  1TY0 A;  1YMH E;  3IT4 B;  3AE1 B;  1SJH D;  2WDR B;  3NVW A;  1I4Q A;  3Q69 A;  1E7P B;  1RYJ A;  2N0S B;  2WDQ B;  3C8Y A;  4B0M A;  3AMZ A;  2JXT A;  4MAC A;  5G5H A;  4OZA A;  2WXJ A;  4C56 C;  1KF6 B;  3W5U B;  2XN9 C;  1I4H A;  2OED A;  4WH4 A;  2E6X A;  2PTL A;  1YN3 A;  1OQR A;  4WIP A;  4UDU C;  1FM0 D;  1STE A;  1DYQ A;  1FRR A;  2AQ3 B;  1SIJ A;  1FRD A;  1TYG B;  1HQR D;  1KH0 A;  3MJ5 A;  3ZGZ A;  4OZB A;  1NI3 A;  3U52 E;  1J7A A;  4L1B A;  1A70 A;  2GI9 A;  3MHZ A;  4IDI A;  4KKI A;  1HEZ E;  4A9A A;  2EKI A;  3MP9 A;  2LGI A;  2X38 A;  4C80 A;  2WXG A;  1D5Z C;  5HFY A;  3P4P B;  2I2Y A;  4NAM A;  3BZD B;  2DYO A;  4JPS A;  4YTP B;  2DLB A;  2LUM A;  1RM6 C;  2QSD A;  4H2A A;  4Q2J A;  2JYT A;  1MPE A;  2XNA C;  2RDG A;  4XDD A;  4ZRP A;  4IKG A;  1TS3 A;  2SEB D;  5TSS A;  1F2R I;  2MJE A;  3R2T A;  4L23 A;  1CZP A;  1FCL A;  4OVZ A;  2B76 B;  2W82 A;  3AE6 B;  4MM3 B;  1BUI C;  2IGG A;  2N9L A;  1IUE A;  1SXT A;  1L4D B;  1FD6 A;  4GDK B;  1P7F A;  2WLB A;  3LXF A;  4WQM A;  4OHJ A;  2IPK D;  3VR9 B;  1BXT A;  2DBY A;  2JX5 A;  3AE3 B;  2PVO D;  3Q8B A;  2BB5 A;  1QKZ A;  2SAK A;  2Y5P A;  4YXD B;  1YJI A;  2L1A A;  3UI3 A;  1ZXI A;  1HXY D;  2J4X A;  1T6B X;  2AX5 A;  2WXF A;  2JSV X;  5AUK A;  3KWL A;  4AS1 A;  1SEB D;  1ROE A;  4KGR A;  4WWM A;  2AQ1 B;  5BMH A;  1D6E C;  2K3U A;  3DWG C;  2V0G A;  2ONQ A;  4NZL B;  1PUT A;  1FFV A;  1GB4 A;  3EGR A;  1D4B A;  1NEK B;  1L6V A;  4HKQ A;  4IOI E;  1E6E B;  1TY2 A;  1FNU A;  1N62 A;  1VR9 A;  4XE0 A;  2V3N A;  3SEB A;  2WU2 B;  3Q8F A;  4REZ A;  2CU3 A;  3AEF B;  2WXR A;  3P4S B;  2W55 A;  2OHF A;  5I4D A;  2WXQ A;  3W9C B;  3ZJV A;  1LO5 D;  1SE3 A;  1Q10 A;  3BVZ A;  1XLN A;  2IDY A;  1JCK B;  2LMC A;  4NAW B;  1I4G A;  1OFF A;  4C7Y A;  3I9V 1;  2BTE A;  1TS2 A;  5T8I A;  1TKY A;  4US9 A;  1C9F A;  3NZ3 A;  4D2K A;  3P63 A;  2LJI A;  3BVG A;  5AUI A;  2I38 A;  2JZP A;  4PT5 A;  5BMI A;  1RWS A;  1YN4 A;  4KX6 B;  2H89 B;  4HRO A;  3GP7 A;  3LB8 C;  1ET6 A;  2KAC A;  1L0X B;  4JWS C;  2NMQ A;  4ARI A;  1TS5 A;  3V05 A;  1TKE A;  3AE5 B;  2WXH A;  3FIL B;  1ZDX A;  2Y5C A;  1F2R C;  3WCQ A;  1B1Z A;  1K52 A;  1V8C A;  2LEK A;  3FC4 A;  1IBX B;  2M0A A;  3AE7 B;  4TQ0 A;  2JWU A;  4YTN B;  1T5X D;  2V4I B;  5HI1 A;  3SR6 A;  3MFG A;  1AWD A;  1D5X C;  1KFY B;  4GLS C;  1KTK A;  1XLP A;  5H8Y E;  2VZK B;  3IAM 1;  2ICI A;  2MJD A;  1YJJ A;  2IJ0 A;  2L83 A;  2RPV A;  3FIL A;  2HTM E;  1GAQ B;  2KMM A;  4ZHO A;  1T3Q A;  4RGT A;  2DYM A;  4N6E B;  1EWC A;  1ZUD 2;  1IBX A;  1JQ4 A;  2WNM A;  1YQ4 B;  4WAF A;  5G5G A;  3Q8A A;  1HZ5 A;  1L0V B;  1FNW A;  1AYF A;  1C77 A;  3URY A;  2LFI A;  3ZQ4 A;  1FCC C;  2WXM A;  5BYR A;  1VJK A;  2J52 A;  3B2G A;  1E9M A;  2FUG 1;  1JWA D;  1C4A A;  1I4X A;  2R61 A;  1C76 A;  1PGB A;  1F0Z A;  2ZW1 A;  2DWQ A;  4ZOH C;  1AN8 A;  1FXA A;  1ET9 A;  2IGH A;  2M19 A;  3VQI A;  3GS2 A;  1PDX A;  4ARC A;  1IGD A;  2BYT A;  1QOG A;  1JAL A;  1WRI A;  1JWM D;  3FAH A;  1XCQ L;  2FBW B;  5EE9 A;  2YEP F;  3NVY A;  1ZDV A;  1VDV A;  5D3D A;  3BK2 A;  5BYQ A;  1L6U A;  1J7B A;  1DOX A;  1KLU D;  4HRS A;  3I57 A;  3AE4 B;  2Y3A A;  1FO4 A;  2JYE A;  4KKJ A;  2WP9 B;  1MVK A;  4MT5 A;  2ACZ B;  3EUB 2;  5C3J B;  1XXG A;  2BS4 B;  1JRO A;  4ZYS A;  1KRH A;  2G9H D;  3HVD A;  1XLQ A;  3ZJU A;  2BT6 A;  2PMV A;  1FFU A;  1J7C A;  1D5M C;  5FKA C;  2JU6 X;  1XF5 L;  3PZ8 A;  4JWU C;  2KN4 A;  1TS4 A;  2D5G A;  1C78 A;  1WSP A;  4HJG E;  2W54 A;  1VZ6 A;  1XEE A;  4YSY B;  4FXC A;  4A6Q A;  1MI0 A;  2WXO A;  2WXP A;  1YNT E;  1P7E A;  1WWT A;  4KGT A;  3AM9 A;  1V1O A;  1K50 A;  1EM7 A;  1SE2 A;  1VLB A;  4HEA 1;  1HZ6 A;  4XWT A;  4MH8 A;  2E3T A;  2QIL A;  2ZW0 A;  5HG2 A;  2GB1 A;  3KQ4 A;  3W5V B;  2BB6 A;  2CJO A;  1YQ3 B;  3B2F A;  4KGS A;  3KLS X;  3AE8 B;  4A8X C;  4OZC A;  1ZE3 D;  3AEE B;  3AV8 A;  3IT6 B;  1WYG A;  4N58 A;  1QT9 A;  1I4P A;  1UGJ A;  1N5X A;  4ZRQ A;  3U2S C;  4M0W A;  1MHH E;  4EE2 A;  4XWW A;  2PVG C;  5D7G A;  2CJN A;  1TZO A;  4R3D A;  4L2Y A;  2INN E;  3BK1 A;  1N63 A;  2KAJ A;  1V97 A;  2IGD A;  2EEL A;  1L0Y B;  3TEZ A;  1E0Z A;  1ENF A;  1VRA B;  5EE1 A;  1DOY A;  4ITK A;  1QF6 A;  2INP E;  2N9K A;  3NUH B;  3SFE B;  1NVI D;  1JWU D;  3RFZ B;  2NTT A;  3P42 A;  2NTS A;  3CWI A;  3O13 A;  2KWD A;  2QJL A;  3AE2 B;  3AED B;  1V1P B;  3IAS 1;  2Z8L A;  1QOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...