2BT6A

Ru(bpy)2(mbpy)-modified bovine adrenodoxin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-Induced Reduction of Bovine Adrenodoxin Via the Covalently Bound Ruthenium(II) Bipyridyl Complex: Intramolecular Electron Transfer and Crystal Structure.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
molecule keywords ADRENODOXIN 1
total genus 28
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2bt6A00
3P4SB 2DWQA 1N63A 1OQRA 4WWMA 1V97A 2OHFA 3SFDB 2H89B 2PVOD 4YTNB 3AE4B 3AEGB 2WLBA 3AEAB 2WS3B 5C2TB 4YTMB 1SB3C 1TKYA 1SF0A 1UWMA 1B9RA 1XLNA 1ZOYB 1JRPA 5EE3A 2WP9B 1J7AA 1QOBA 4C7ZA 1VDVA 2B76B 1FXIA 1FO4A 3B2GA 1L6VA 1NI3A 4JWSC 4ZHPA 1FXAA 1N60A 3VRAB 1WXQA 4US9A 3ZYYX 3AM9A 3NVWA 2KMMA 3FC4A 1YJJA 2M56B 1L0VB 1WYGA 4ITKA 4N58A 2PIAA 1KFYB 1QLBB 2LEKA 4USAA 3VRBB 1DOIA 1TYGB 1XLQA 1FIQA 1TJEA 1RM6C 3AMZA 3P1MA 4YTPB 4FXCA 4YSYB 4A9AA 3ABVB 1ZXIA 2WU5B 1E7PB 3AV8A 2FBWB 1R7SA 2M19A 1JALA 2CJOA 2Q5WD 3AEBB 5G5HA 1L5PA 4JWUC 1JWBD 4JX1C 3AEEB 4N59A 5AUKA 1CZPA 3NVZA 4HRSA 2CU3A 5GXGB 1I7HA 1OQQA 1WGKA 3AE6B 1SIJA 4P6VF 4LTUA 1FFUA 1NVID 1XO3A 1EWYC 1NYRA 2BS4B 2BS2B 1AWDA 3VR8B 3AE7B 2MJEA 1QOFA 4YXDB 3CWIA 1JROA 1L6UA 3B9JA 1QOAA 1FRRA 1N61A 1QOGA 4N6EB 2BT6A 3W5UB 3AE5B 3HRDD 3AE2B 4IDIA 1FFVA 1N5XA 2W54A 3NS1A 1XLOA 1DGJA 3AH7A 5EE0A 3AEDB 1QF6A 2E3TA 3NVYA 1JQ4A 3B2FA 2WQYB 3KWLA 1E6EB 3SFEB 1KRHA 3AECB 3P4RB 3P63A 1AYFA 2WU2B 3DWMA 3AE8B 3AE3B 1PUTA 1V8CA 1WRIA 1PDXA 3BIID 3HUIA 5H92C 4KX6B 1IUEA 1ROEA 5MPOA 2ACZB 1XLPA 4ZHOA 1ZUD2 2WDVB 1VLBA 1YQ4B 2CJNA 1OFFA 3WCQA 3FAHA 2QJLA 3LXFA 2H88B 3PO0A 5G5GA 1RFKA 2PVGC 1JWAD 1N5WA 2W3RA 2WDRB 2K9XA 1DOYA 3AEFB 4C80A 1JW9D 3DWGC 2WDQB 3AN1A 2W3SA 1NYQA 5EE9A 2DBYA 1VJKA 4US8A 1F0ZA 1J7CA 1TKEA 1RYJA 5AUIA 2G1EA 2AX5A 1ZP0B 1TKGA 2HTME 3EUB2 3ETRA 2BS3B 3L4PA 3NRZA 3P4QB 3W9CB 2PKOA 1E10A 1GPXA 1FRDA 2K22A 2EKIA 1T3QA 1E9MA 3SR6A 1RWSA 3NVVA 1DOXA 1WWTA 1NENB 4YT0B 1YQ3B 1FM0D 3AE9B 2W55A 5H8YE 1N62A 3AB5A 2L83A 1PFDA 1YJIA 1E0ZA 2MH7A 2K5PA 4YSXB 2JQRB 2L52A 2Y5CA 2QIEB 3AE1B 1KF6B 4YSZB 4WQMA 1NEKB 2MJ3A 3W5VB 1QT9A 1GAQB 1A70A 3CIRB 2KAJA 3LB8C 4ZOHC 1FMAD 2JX5A 3VR9B 5C3JB 2N0SB 3HVZA 2MJDA 3RPFC 5EE1A 4HROA 1J7BA 4C7YA 3P4PB 1CJEA
chains in the Genus database with same CATH superfamily
4A3PA 1V97A 4YTNB 3AU5A 3ENEA 4HJKA 2O6VD 4GLSC 3I5JC 5TR5A 2IYDB 1L6VA 2GLSA 3AI5A 3ZTDA 2LVQA 3BVMA 2BB5A 1S1QB 4M0WA 2R2QA 2RPQA 4WQOB 4HKQA 2HE7A 1ZGUB 5DPWA 1HEZE 4MH8A 1WF9A 3HK0A 1WJ6A 2KD0A 4M00A 3VXWA 3EHVA 1KOTA 3QA8A 2KK8A 3SHQA 2IO1B 1VCBA 2QC8A 4IDIA 4K7WA 3PZ8A 4IKGA 4KSLC 1XLOA 3UGBB 4ZDVA 1TS4A 1I4HA 3PLVA 2K1FA 3KWLA 3RULA 1I4QA 2MBHA 1F77A 4M8MA 2IY0B 1IUEA 1R4MI 1E7VA 2X38A 4A8XC 2NCNA 1JW9D 3U2SC 2W3SA 1F9JA 5GMVA 3VQIA 1TT5B 1FD6A 4BAXA 2PMVA 3VUXA 3TEYA 1NENB 1V49A 2HDEA 2E6XA 2ZNVC 2XBBC 4JGHB 4WQMA 1L2NA 1Y56A 2FCMA 4HK2A 3N9YC 4RM8A 3WAPA 2JX5A 4F1SA 5EE1A 3V3XA 3EFCA 3W1YA 2LASA 2L00B 2D3BA 2NVUI 3DBRI 5BO4B 1LO5D 1VDVA 2J0KA 4CYEA 4KZ0A 3R8BA 3WAMA 4HJGE 2N7JA 2NBUA 4NJCA 1R4NI 1UNSA 4ANUA 1BXTA 4LDTD 1UBQA 3L08A 4GU2A 1C76A 3CMMB 3PT2B 4KSKC 4B9KA 4HDQA 1IBXB 1JCKB 1J8CA 1R7SA 2JYEA 4MGYE 2IJ0A 1TS5A 4ANXA 2OJWA 2CS4A 1C4CA 4HKZE 1MHXA 4LNKA 1I7HA 3NHEB 2FCNA 1ESFA 2BVCA 2PE6B 3ZXVA 3KLSX 4A55A 3DHGC 2VH1A 1E8XA 2BGFA 2N7EA 2E3TA 1V1OA 1E6EB 2MBEA 3T9LA 4RNAA 1GB1A 4KGSA 1G6JA 4A90A 1IYFA 3IAM1 4OVUA 4EOYA 2MRPA 1VLBA 1YQ4B 2BB6A 1SE2A 2V3PA 3URYA 3VTUA 3O13A 1RYJA 1LFDA 2JYTA 2JZPA 4XWWA 4G11A 2YVCA 5IA7A 3SR6A 1E9MA 5D3IB 1PGXA 2IZVB 2D10A 3A33B 3AE1B 1SE4A 4MEMA 3A9KB 2MJ3A 3PGEA 4NAWA 3U7DA 4MACA 2L32A 4NNJB 2DYBA 3UQBA 2R2OA 2D3GA 2MX2A 2WX1A 3U30A 3TUOA 4AS1A 1UWMA 3LJ3A 1JRPA 2K8HA 1YN5A 4IG7B 1NI3A 2WX0A 2WXMA 4WWOA 4ZHPA 3ZRFA 3NZUA 1QKZA 1WX9A 3MJWA 2WXJA 5JZEB 1T0RC 1TY2A 4M01A 1V80A 3SD5A 1FIQA 2DLBA 3ABVB 4AJYB 3UF8A 2FBWB 4G0NB 1CZPA 3NVZA 3PSEB 1U4AA 1SIJA 2WGSA 1NYRA 3TBLD 2J52A 2K39A 4EZLA 3PRPB 1F1HA 2GOWA 4EZJA 5EE0A 4HWIB 3B2FA 2N9LA 2WXRA 2FCSA 2FIDA 3M95A 4JIOU 4WWNA 3WALA 5IP4D 3DQVA 4E74A 1WZ0A 3EGRA 4J6IA 1HE8A 3V61A 4XDDA 4C00A 3FAHA 2GBRA 3H6NA 2PVGC 1N5WA 3RFZB 2KLGA 3BYYB 1WGYA 5D3DA 4LNNA 2AWTA 4YL8A 2AL6A 1WR1A 2ZW1A 2ZPNA 3HM3A 4DHZE 4HEA1 4IM3A 2LRWA 4RF0A 3TMPB 4REZA 4AOFA 3AB5A 3R66C 1D5MC 1L7YA 2INCC 1ZDVA 3ONSA 3X0WA 1GAQB 2J7QB 4IW0A 1FMAD 2CHZA 3Q8FA 3IVFA 2X8XX 3TL5A 2KFJA 1SXTA 1ZW7A 3VH3B 2H89B 3AEGB 2WLBA 2GI9A 4FULA 2BYEA 1JRUA 3MC8A 2SEBD 2KJRA 1FXAA 5LXHA 1KH0A 3PZ7A 5DPRA 2MBBB 4TQ1A 1MG4A 3ZTCA 4TQ0A 1A5RA 3DBRB 2HD5B 3ALBA 2K6DB 3CF6E 3N20C 5G5HA 1TGZB 4P7IA 1FEHA 2KJHB 4HRSA 1TZOA 4TV3A 3KH0A 3ZDTA 1ACCA 3VR8B 1QOFA 2WXKA 1Q1OA 2LUMA 5EDSA 2RR9A 1AYFA 5G55A 3AE3B 4KDLB 2BW2A 4GSWA 2INPE 4NJ6A 3BZDB 4K1RB 2K9XA 2V4LA 3NUHB 4RGTA 2C7MB 2M4NA 2N7DA 2QHOA 4US8A 2MW5A 1FNWA 4BKGA 3EUB2 3P4QB 2KWDA 4DQOC 2A4ZA 2W82A 4GIVA 4CQNA 1YQ3B 1FM0D 4HDOA 4I6NB 2N1WA 1WY8A 4MGIE 1L4DB 1EF1A 1ZE3D 2L05A 3KYCD 4DXFA 1E8ZA 2LHEA 2KQ4X 3RNCC 2MA9B 3RN9C 1D3ZA 3I63C 1J7BA 2WNMA 4MT5A 3A1QB 4E3CA 2XNAC 2N4FA 1YNTE 4DHJB 2G3QB 2LGXA 3RT3B 4PS3A 4FHJA 4ICUA 5AZHA 2V1YA 3Q8CA 3Q6BA 4IC7B 3H7PA 4LNFA 2JPHA 4B6WA 2LGYA 1TZ1A 2RD0A 4W9JA 1NDDA 2WWZA 2MBQA 2BKFA 3HM6X 2MHJA 4BOSC 2RGFA 3BK2A 4JX1C 2KDMA 3N3KB 2EMSA 5KHQA 2V9HA 4ZYSA 4IM0A 1AN8A 1FFUA 1HZ5A 2NBVB 2MBOA 4MGKE 4DHJD 3L13A 1IP9A 1X1MA 1JROA 3B9JA 4OZBA 2WXGA 1I35A 4GXBA 3PV1A 3SEBA 4LJPB 1WX7A 2KDEB 5AZGA 1VD2A 1EM7A 4GDKB 4QAYA 1WM3A 2ICIA 1EU3A 1IBXA 4MDKE 2K3UA 1E8WA 2WXLA 4GGQA 4ZRJA 2ZPYA 4OW0A 4AP4C 4MGZE 5EE9A 3LDZE 3UIPB 1SBBB 2UU7A 4KVGB 4II2B 4KKIA 3Q3FA 3NVVA 2JRHA 4X57B 3Q3MC 2L83A 4JE3B 4XC2A 1D5XC 1V6EA 1DYQA 4NJ7A 2IY1B 2PPHA 4DXAB 4LJOB 1JMLA 3T8MA 2ZW0A 1Y8RC 1CJEA 1T0YA 1VRAB 2JVCA 3KVFB 5CHFA 2WS3B 5C2TB 4OZAA 2WP9B 3N1XC 1TS3A 5DCNA 3B2GA 2KC2A 4TKNA 3APDA 1N60A 3AM9A 2CR5A 3WAOA 5FR3A 4EZKA 4WJQA 1MVKA 2BKRB 3LYYA 1ZKHA 2LEKA 1DOIA 1SIFA 1GOZA 1WMHB 1YQBA 3GZNI 4KV2A 1C1YB 1F52A 2Y5PA 2WXHA 4K3CA 1GNUA 3ZO5B 3B1LX 2REXA 1STEA 2CU3A 3AE6B 2MCNB 3B08A 3QAQA 2ONQA 4ZRQA 1K8RB 3IHPC 4EFOA 1QOGA 4NAWB 5JHAA 3AH7A 5I4DA 3T3NA 2KANA 4C4VA 2JXXA 2WU2B 4ACFA 3BIID 1GG3A 3C8YA 3DBLB 3Q3OC 5IKCM 1IPGA 4L1BA 3A9JB 2IDYA 1ZUD2 3EFUA 1MG8A 3RZFA 2KX0A 3LXFA 1T6BX 3PO0A 1RFKA 2DNFA 1C4AA 3W1SA 3VHTC 5BYSA 4LNIA 1I4RA 1DOXA 1RWSA 2FUG1 2KTRB 4W9LA 1I4PA 4PS8A 2DYMA 3PRZA 1YJIA 2ON8A 3VTVA 3SDLC 2QIEB 1J0GA 1VZ6A 2D3AA 4NZLB 5J17A 1WJUA 4B0EA 1C3TA 1IGDA 1P7EA 1L0YB 4DBGA 1D6EC 2FCQA 2D5GA 1UWXA 4HCNB 4PS7A 2KKCA 1UH6A 2PEAA 5FKAC 3MJ5A 1WM2A 3NVWA 2LZ6A 5CTRC 3M62B 4MJSB 5T8IA 2KWUB 1RM6C 1D5ZC 2LVPA 1EWCA 4A9AA 4WURA 1WXAA 3VFKA 2Y3AA 4GB9A 4AWJA 2QMTA 4I6LB 1P7FA 1WGKA 3L0WB 2D2QA 1LXDA 3U8ZA 1SE3A 1FCCC 3V62A 3NS1A 4W9HA 3UQAA 4DK5A 2W9NA 3OJ3A 2LGSA 3AECB 1HA5A 1AARA 2I38A 4KX6B 1ROEA 4KIKB 3VDZA 2CJNA 4RGMA 2JF5A 3N1YC 4C80A 4CHKA 4WIPA 1F0ZA 1J7CA 3ML9A 2O2VA 2G1EA 1TKGA 4MH0E 5C1ZA 1FRDA 2IGDA 2KYWA 2PJHA 1N62A 1E0ZA 4DDID 1E90A 2MH7A 2ZJDA 2L52A 3GP7A 1NEKB 4L2YA 2QDFA 1RFAA 3DVNV 2KAJA 2KZRA 1RAXA 3RPFC 2J4XA 2KNBA 3SFDB 3N1ZC 2WXFA 1MJDA 3AEAB 4YTMB 4CO7A 2KMAA 5FK9C 3TIXA 4IWQA 3Q8BA 1FXIA 4F7ZA 3Q8EA 2CHWA 4R3DA 1XT9B 4DWFA 4XDCA 3DVGY 3U52E 2PIAA 1YJ1A 5AZFA 4BZAA 4USAA 1L4ZB 3TJPA 2DZJA 4FXCA 2C60A 1XQQA 1ZXIA 2ZZPB 1E7PB 1GUAB 2NBWB 2UWQA 3OLMD 4XWTA 1UF0A 3B0AA 1GC7A 2BYVE 1SGHA 1OQQA 5CHVC 4P6VF 4LLGM 1NVID 1WMHA 2BS4B 4IUMB 2JSVX 4W9IA 2J53A 3CWIA 2J0JA 2AYOB 1N61A 2C9WB 2V3SA 2VZKB 3J9CA 3QWZB 1WFYA 1ET9A 2HJ1A 4WAAA 1KRHA 2D07B 1R4NB 1NBFC 1PDXA 2KN5A 2M1MA 2D11A 3R7QA 1C78A 2H88B 5IAAC 2L0TA 3V6CB 4GDLA 1BMLC 1TY0A 1WXMA 2DZMA 3H7PB 3VUWA 1TKEA 2NMQA 3RNFC 2AX5A 3FILA 4HXDA 2WXPA 3QK0A 3RNGC 1KM7A 3KYDD 4LCDE 2LWPA 3IT6B 4MELA 1MHHE 1WYWB 3RYTA 3QX1A 3JSVB 2LFIA 2HJ8A 4MM3B 2I1KA 3ZJUA 1K53A 3ZLZA 3CIRB 2M0AA 2DHZA 1BT0A 2JU6X 3JSVA 3NJTA 4J3OD 5C3JB 3HVZA 2NTSA 4FLHA 3P4PB 1OQRA 4HCPB 1FXTB 3PTFC 4K3BA 2DAFA 2C7NB 4EUTA 1XLNA 3Q3NC 1J7AA 1F2RC 1XCQL 2AL3A 2KWCA 3APCA 2LXCA 4JWSC 3PRMB 3BY4B 3PPAA 3P1MA 4YTPB 1CQVA 4YSYB 1PGBA 1P0RA 3ZQ4A 3AV8A 3Q14C 4W9DA 1JALA 1C77A 1L5PA 3ZKJC 5BMIA 2WDTB 5GXGB 1WX8A 2LVOA 1GB4A 2PE9A 4ANVA 1IGCA 2L76A 4LK0M 3PS6A 3NVYA 4TMAB 4JL9A 3DBSA 3PLUA 2KDIA 3ZUNA 3AE8B 1PUTA 2C5LC 2AEHA 2JUOA 4E71A 3DVGX 1V2YA 1E8YA 2I2YA 5D94A 4ZHOA 4KGTA 3RNAC 1OFFA 2Y5BB 3QHTA 1UBIA 2W3RA 1JWAD 2UYZB 2AQ1B 2IGGA 5AUIA 4II3B 1UELA 2LGIA 3APFA 3ZXRA 1K51A 4MM3A 1WJNA 1B1ZA 3A4RA 5IN7A 2M17A 5JXVA 2BYFA 3BK1A 2W55A 1M94A 1C4PA 2QEJC 2XN9C 4ZRIA 2SAKA 4M0WB 1QT9A 4G3XB 3QJZA 3Q3JA 4EKUA 1YX5B 1T0SC 4M02A 3BVGA 4W9KA 2LRUA 2PVOD 1QQRA 3GS2A 2B3AA 2EKEC 1SB3C 1JWUD 1B9RA 3EA6A 4DDGD 2B76B 3ZDMC 3IAS1 3KW5B 2N9EB 3R2IA 1WIAA 3ZYYX 3OJ4B 1QILA 2M56B 3T3OA 2ZVOA 1ZPSA 1CMXB 5DPSA 4XYCA 4LDTB 2K0PA 2WU5B 4WWPA 2KACA 2M19A 1WI0A 3EC8A 2G4SA 2Q5WD 3AEBB 4OHJA 4OVVA 5AUKA 3A1QA 3DBLI 3K9OB 2IO3B 1EWYC 2WXOA 3GB1A 2RDBC 1QOAA 1UZXB 4C56C 3W1SC 1WGDA 3L54A 3CSFA 4K7UA 1GC6A 1V1PB 4XGAB 2BBCA 3P63A 4RGNA 3HVDA 5BMHA 2GBKA 1XCTL 4FJVB 4EEWA 2J0MA 2WDVB 1FCLA 1XXGA 1UGMA 4FHKA 2IGHA 3KUDB 2WDRB 3OWEB 4O1NA 1KTKA 3RD2A 4P1CC 1OTRB 3KUCB 5L95C 2MLBA 5IO9A 2ZNVB 1EU4A 2PTLA 3QARA 1T3QA 2LGDA 1WWTA 2KHWB 3AE9B 3IFWB 3O65B 3A4SC 3BYTB 5JHBA 1KF6B 2RDHA 2Z59B 1WR6E 1I4GA 3PVLA 3N32A 1XD3B 5E6JA 3UIOB 2LMCA 4RCOA 2MJDA 3A9KA 1OEYA 4C4VB 3ZJTA 4C7YA 1WE7A 3P4SB 1C79A 1WE6A 5CX3A 1HTQA 3ZVVA 5EE3A 2KDBA 3PHWB 4C7ZA 1C9FA 2LJIA 1L0XB 3GOEA 2KFKA 1Q10A 4NAMA 3RCZA 3L16A 1PYWD 2RMMA 1TJEA 3M3JA 4A6QA 4NY0A 1PQSA 4HLEA 3QCAA 3RZWC 1E5WA 3KQ4A 4RF1A 2CJOA 4PT5A 2Z0DB 3ECIA 1WGGA 3ML8A 4JQWC 5DPTA 3AE2B 1N5XA 1AW7A 2KTRA 1TBEA 4JLCA 3M63B 2WQYB 3SFEB 1T0QC 4NQLB 3WANA 1V8CA 1QZEA 5H92C 3HUIA 4HPPA 3DBHB 2KVZA 2CHXA 3NY5A 2D3CA 5G5GA 3PHXB 3DWGC 4WJPA 2DBYA 3C0RB 2KXJA 4BKTA 5LXIB 3H9DA 1D4BA 2HTME 2BF8B 3IG3A 3L17A 3KWVA 2K6QA 5AEKB 1H4RA 2J42A 3P2BA 3IXSA 1ZXHA 5JH5C 4TSSA 3DBHI 4ANWA 3FKYA 3ZNHB 2WXIA 2JQRB 2Y5CA 1UUPA 3LB8C 2MP2A 5HFYA 3ZNZB 5KHOA 4P16A 3E9SA 1VZ8A 2VRRB 1E7UA 4WWMA 1P3QU 1SF0A 1SJHD 3NS8A 1QOBA 3GE3C 2XK5B 3HIZA 3VRAB 4B0MA 4I6PA 2MEKA 5HI1A 4K7SA 2KN4A 1WYGA 3QQ8B 3K9PB 2XK5A 1OGWA 1SEBD 4ASWC 1KFYB 3Q8AA 3VVWB 2JT4B 2JZ3B 2QSDA 1J19A 1WH3A 3WIMA 3NZ3A 4JWUC 2NPTA 4N59A 2IO0B 2DENB 2MWSB 2YEPB 4YXDB 4BVUC 1L6UA 1FRRA 2IPKD 3W5UB 3AE5B 3HRDD 1FFVA 3MP9A 2IBIB 2JWZA 3P4RB 1LGRA 3QC8B 1WGHA 2KC1A 5C23A 2RDGA 1ET6A 1XLPA 2CU1A 3WCQA 5D2MB 2DZKA 3ZNGC 3AEFB 2NS5A 1XEEA 2VH2A 3DDCB 3V6EB 3H7SA 5BYRA 1KLGD 2OEDA 2EKIA 2OJRA 2ZVNA 3RMKC 1EO6A 4IOIE 3OG5A 3MHZA 2BYTA 3MHSD 5H8YE 2JRIB 2NR2A 4YSXB 4N9F4 4W9EA 3PREA 1ENFA 3ZIMA 2N9KA 2JZZA 2LXAA 3SU8X 3VR9B 2N0SB 2KJ6A 4M8NA 3D32A 1V1PA 2GBNA 2K8CA 4BBNF 2FIFA 2DWQA 1N63A 1S3SG 3GZNB 2L7RA 1ZOYB 3Q69A 2GRIA 1KJTA 2Z0EB 2KOXA 2L3ZA 4US9A 2FE8A 2GB1A 1P9DU 1L0VB 3U4EG 1QLBB 1VR9A 2GBJA 2MQJA 2HTHA 4D2KA 4FADA 1M4VA 4NQKE 4RMAA 3ZJVA 5D7GA 3I3TB 1HTOA 3MTNB 1HZ6A 1YX6B 1N6ZA 3ZGZA 4WJNA 5CHWA 2N9XA 4IWOA 2MSED 2DYOA 4LTUA 1XO3A 4ZRPA 2ASQA 3DHHC 2MJEA 1WRDB 2KDFB 4RM9A 2G4DB 4MSQB 3H8HA 4N6EB 3DVNU 2W54A 5D6JB 4W9FA 1HXYD 4F8CB 1V5TA 2KMCA 3JYUA 3DWMA 4RGOS 5L83A 3V05A 3RUIB 2KWVB 3HHMA 4S17A 2LUEA 1HQRD 5LLIA 3Q2AC 1T5XD 1DOYA 2EMTA 2FNJB 2Z8LA 3AN1A 1VJKA 2WXNA 1YD8U 5E6NA 2GMIC 2CKHB 3NZSA 4KZCA 1FNUA 3NRZA 4LNOA 3I57A 1JWSD 2N9PC 2NPTB 2DX5B 1WJ4A 2O6VB 4FBJB 2JXTA 4GDKA 3QIJA 2INNE 4AUQC 2KX3A 3W5VB 3EECA 2AQ2B 5HKHA 4ARIA 4FJZA 4HROA 2YLMA 3X23A 3TEXA 2DAJA 2OHFA 4KDIC 3RNBC 4BKSA 3JW0X 5G2NA 2K25A 1YIWA 1MFWA 4FA6A 1FO4A 1Z2MA 4ZYNA 1WXQA 1WZ3A 4WJOA 1F2RI 2O6VA 2BPSA 3VRBB 3AMZA 3IT4B 2INDC 2L8JA 3BINA 2OOBB 5IOIA 1Q0WB 1WGRA 4ZRKA 3AEEB 4OZCA 4P1BC 2MP2B 1AWDA 2KO3A 3AE7B 4GN1A 2BT6A 3S2AA 1YOVB 4HPMB 2ZEQA 1QF6A 3A9JA 3AEDB 1VZ7A 3R2TA 3VAWA 3AULA 4K81A 1WRIA 2KVRA 4HVBA 3I9V1 1SJED 5E6OA 3TSSA 1UGJA 4KGRA 1ZDXA 3L10B 1TS2A 3ZRCA 2LD9A 2A5UA 4NPNA 2KQSA 4TUUA 1ZP0B 5HG2A 3ETRA 2BS3B 3L4PA 4GOCA 1E10A 1GPXA 2KQ7A 3R3MA 1OQYA 4YT0B 3H1UA 4BOZB 2KT7A 1PFDA 2XEWA 3E56A 3DHIC 4AJWA 4YSZB 3PZDA 2WHIA 1Z5SB 2L1AA 2I1JA 2BWES 2V0GA 2KLCA 4ARCA 1CK1A 1NI2A 3N30A 3UI3A 2IO2B 1XF5L 2PLPA 4KKJA 3W2DA 3NOBA 2KTFA 4JPSA 4BFRA 1LM8B 2K8BA 5HHDG 4FJYA 3P42A 2YEPF 2EELA 1KLVA 2NTTA 3AXCA 1PGAA 2ZCCA 1YMHE 4N58A 1LQBA 5LNK1 5BMGA 2WXQA 1FNVA 2PW9A 4HPLB 1UD7A 5TSSA 2QCZA 2BS2B 2RPVA 2BTEA 2ZCBA 3IBEA 2L0FA 2M0XA 3KUZA 2FUHB 3DPDA 3MC0B 1SSNA 1TIFA 3GE8C 4S0RA 4WAFA 1V9JA 1V5OA 1EF5A 3DOWA 1SE9A 3TEZA 5MPOA 5J2RA 4OVZA 4XE0A 1Q5WB 4FN2A 1I4XA 3U7ZA 2N1VA 2WDQB 4B95A 3BVZA 4Q2JA 3DCGA 1YN4A 2GBMA 2R61A 2LHDA 2V4IB 1KLUD 3W9CB 2PKOA 4XX5A 3V60A 1YN3A 1RRBA 1H8CA 1K50A 1TTNA 2AQ3B 1MI0A 4RH6A 4PYUA 3FILB 2M8SA 2BQQA 1JWMD 2G45B 1A70A 4GDLB 2BWFA 3JVZX 4ZOHC 4MSMB 3RI7C 4ICVA 4PK1A 5E6PA 1P98A 3AE4B 3TCAA 1V86A 1TKYA 1WSPA 2JWUA 4GMVA 3BWUD 1BUIC 4G50A 3UINB 2FAZA 2KMMA 3FC4A 1YJJA 4IWPA 4ITKA 1OEYJ 1TYGB 1XLQA 4A20A 5FR6A 2LI5A 4RFBA 1WXSA 3RNEC 3WA0A 1V81A 4YWGG 1WXVA 1I42A 4AQ7A 1GJZA 5BYQA 1JWBD 2TSSA 1R4MB 1EUVB 2DZIA 3MC9A 3VUYA 2JY6A 2VZKD 3ZW3A 4XZ4A 3AU4A 4W9CA 2QILA 4PYZA 1DGJA 3VTWA 1ISNA 1JQ4A 1RLFA 4WH4A 2WYQA 4UDUC 4L23A 1P1AA 1MPEA 1FPYA 2O2VB 3R7RA 3VH4B 2ACZB 4A3OA 3MFGA 2C7HA 2QJLA 2G9HD 4EE2A 4MJSA 4KIKA 1NYQA 2LJ5A 3C19A 2KFKB 4IM2A 2V3NA 2K22A 3CSTA 4DHZB 5J18A 4URKA 4DXGA 2RSUA 3TEWA 2K5PA 4W9GA 3NG0A 1K52A 4BBNC 3ZNID 4BKSD 4H2AA 3OAWA
chains in the Genus database with same CATH topology
2DWQA 1N63A 1OQRA 1V97A 4YTNB 2XNAC 1YNTE 1XLNA 1ZOYB 1J7AA 1F2RC 3Q69A 2GRIA 1XCQL 4GLSC 1L6VA 4JWSC 3BVMA 3Q8CA 2BB5A 4US9A 2FE8A 4M0WA 2GB1A 1L0VB 3U4EG 1QLBB 1VR9A 4HKQA 4D2KA 1HEZE 1M4VA 3P1MA 4MH8A 1CQVA 4YTPB 4YSYB 3ZJVA 1PGBA 5D7GA 3ZQ4A 3AV8A 1HZ6A 1JALA 1C77A 1L5PA 3BK2A 4JX1C 2KDMA 5BMIA 3ZGZA 5GXGB 4ZYSA 2DYOA 4LTUA 1AN8A 1FFUA 1HZ5A 1XO3A 4ZRPA 2MJEA 1JROA 3B9JA 4N6EB 3H8HA 4OZBA 4IDIA 1GB4A 2WXGA 3PZ8A 2W54A 4IKGA 1IGCA 1XLOA 3SEBA 4LK0M 1HXYD 1TS4A 1I4HA 3NVYA 1EM7A 4GDKB 4TMAB 3KWLA 3DWMA 4RGOS 3V05A 3AE8B 1PUTA 1I4QA 2ICIA 1EU3A 1IBXA 1F77A 1IUEA 2I2YA 4ZHOA 2K3UA 4KGTA 1OFFA 1HQRD 2WXLA 1T5XD 2X38A 2W3RA 1JWAD 4A8XC 1DOYA 4OW0A 2Z8LA 1JW9D 3U2SC 3AN1A 2AQ1B 2W3SA 5EE9A 1VJKA 2WXNA 2IGGA 1SBBB 5AUIA 3VQIA 2LGIA 1FD6A 1FNUA 3NRZA 1K51A 2PMVA 4KKIA 3TEYA 1B1ZA 3I57A 3NVVA 5JXVA 1NENB 2HDEA 3BK1A 1JWSD 2E6XA 2W55A 2L83A 1C4PA 2JXTA 2QEJC 4JE3B 1D5XC 2XN9C 2INNE 4WQMA 2SAKA 1DYQA 1Y56A 3W5VB 1QT9A 2AQ2B 3N9YC 2JX5A 4ARIA 1JMLA 2ZW0A 3BVGA 4HROA 5EE1A 3V3XA 1CJEA 3TEXA 1VRAB 2OHFA 2PVOD 1QQRA 2WS3B 3GS2A 5C2TB 1SB3C 1JWUD 1B9RA 4OZAA 3EA6A 2WP9B 1LO5D 1VDVA 1TS3A 2B76B 1FO4A 3B2GA 4MT5A 3IAS1 3R8BA 1N60A 3R2IA 1WXQA 4HJGE 3ZYYX 3AM9A 2N7JA 4NJCA 1F2RI 1UNSA 5FR3A 1QILA 1BXTA 2M56B 1MVKA 3T3OA 1C76A 3LYYA 2LEKA 3VRBB 1DOIA 1GOZA 1ZPSA 3AMZA 3IT4B 2K0PA 2Y5PA 2WU5B 2WXHA 1IBXB 1JCKB 1R7SA 2JYEA 2KACA 2M19A 2IJ0A 1TS5A 2Q5WD 3AEBB 1C4CA 3AEEB 4OHJA 4HKZE 4OZCA 5AUKA 1STEA 1MHXA 2CU3A 1I7HA 3AE6B 2ONQA 1EWYC 4ZRQA 1AWDA 1ESFA 2WXOA 3AE7B 3GB1A 1QOAA 1QOGA 4NAWB 2BT6A 3KLSX 4A55A 4C56C 1QF6A 3AH7A 3AEDB 1VZ7A 3R2TA 2E3TA 5I4DA 3T3NA 1V1OA 1V1PB 1E6EB 2BBCA 3P63A 2WU2B 4RGNA 4RNAA 3HVDA 4KGSA 5BMHA 1GB1A 1WRIA 4A90A 3BIID 3C8YA 3I9V1 1XCTL 1SJED 3IAM1 3TSSA 4L1BA 2IDYA 1UGJA 1ZUD2 2WDVB 1VLBA 1YQ4B 2BB6A 1XXGA 1SE2A 1ZDXA 4KGRA 1FCLA 2V3PA 3LXFA 1T6BX 2IGHA 3PO0A 1RFKA 1TS2A 2WDRB 3OWEB 4O1NA 1C4AA 1KTKA 3W1SA 3URYA 3O13A 1RYJA 2JYTA 2JZPA 5BYSA 4XWWA 1ZP0B 5HG2A 1EU4A 2PTLA 2BS3B 3ETRA 3L4PA 1I4RA 1E10A 1GPXA 1T3QA 1E9MA 3SR6A 1RWSA 2FUG1 1DOXA 1WWTA 5D3IB 1PGXA 4YT0B 1I4PA 3AE9B 2DYMA 1PFDA 1YJIA 2ON8A 3BYTB 3E56A 3AE1B 1SE4A 2QIEB 1KF6B 2RDHA 4YSZB 2MJ3A 1I4GA 1VZ6A 2L1AA 5E6JA 4NZLB 2V0GA 4B0EA 4ARCA 2LMCA 1CK1A 4MACA 2L32A 2MJDA 4RCOA 3UI3A 1XF5L 1IGDA 2PLPA 4KKJA 4C7YA 1P7EA 3ZJTA 3P4SB 1C79A 1L0YB 3W2DA 3TUOA 1D6EC 4AS1A 1UWMA 2D5GA 5EE3A 1JRPA 1UWXA 4JPSA 1YN5A 4C7ZA 5HHDG 1C9FA 2LJIA 3P42A 1NI3A 2YEPF 2WXMA 4ZHPA 1L0XB 2EELA 1QKZA 5FKAC 3MJ5A 2WXJA 3NVWA 2NTTA 1PGAA 1TY2A 1YMHE 1Q10A 4NAMA 4N58A 1PYWD 2RMMA 5T8IA 1FIQA 1TJEA 1RM6C 1D5ZC 2DLBA 4A6QA 1EWCA 5LNK1 4A9AA 3ABVB 4WURA 3KQ4A 5BMGA 2WXQA 1FNVA 2FBWB 4RF1A 2CJOA 4PT5A 1CZPA 3NVZA 2Y3AA 2PW9A 2QMTA 5TSSA 1P7FA 1WGKA 1SIJA 2BS2B 1NYRA 2J52A 2RPVA 2BTEA 3AE2B 1SE3A 1FCCC 1N5XA 1AW7A 3MC0B 3NS1A 1SSNA 4WAFA 5EE0A 3B2FA 2N9LA 2WQYB 3SFEB 2WXRA 3AECB 1HA5A 1V8CA 3TEZA 3EGRA 5H92C 3HUIA 2I38A 4KX6B 1ROEA 5MPOA 2CJNA 4XDDA 4OVZA 4XE0A 3FAHA 4RGMA 5G5GA 2PVGC 1I4XA 1N5WA 3RFZB 4C80A 3U7ZA 3DWGC 2WDQB 4WIPA 3BYYB 3BVZA 2DBYA 4Q2JA 5D3DA 1F0ZA 1J7CA 1YN4A 2G1EA 2R61A 2LHDA 1D4BA 1TKGA 2HTME 2V4IB 1KLUD 3W9CB 2PKOA 1FRDA 3KWVA 2ZW1A 1YN3A 2IGDA 2J42A 1K50A 1ZXHA 3IXSA 2AQ3B 1MI0A 4HEA1 4RH6A 4RF0A 4REZA 4TSSA 1N62A 3AB5A 1E0ZA 2MH7A 2WXIA 2JQRB 2L52A 2Y5CA 3GP7A 1D5MC 3FILB 1NEKB 1UUPA 1ZDVA 1JWMD 4L2YA 1GAQB 1A70A 3LB8C 2KAJA 5HFYA 4GDLB 4ZOHC 4P16A 1FMAD 3Q8FA 3E9SA 3RPFC 1VZ8A 2J4XA 1SXTA 4WWMA 3SFDB 2H89B 2WXFA 3AE4B 2WLBA 3AEAB 3AEGB 2GI9A 4YTMB 1TKYA 1SF0A 5FK9C 1SJHD 1QOBA 1WSPA 2JWUA 2SEBD 3Q8BA 1FXIA 3BWUD 1BUIC 3Q8EA 1FXAA 4R3DA 3VRAB 4B0MA 2MEKA 5HI1A 4XDCA 2KMMA 3U52E 1KH0A 3FC4A 1YJJA 3PZ7A 2KN4A 4TQ1A 1WYGA 4ITKA 1SEBD 2PIAA 1KFYB 3Q8AA 4USAA 1L4ZB 1TYGB 1XLQA 4TQ0A 2QSDA 4RFBA 4FXCA 1ZXIA 1E7PB 4XWTA 4YWGG 3NZ3A 4AQ7A 5G5HA 4JWUC 5BYQA 1JWBD 1FEHA 2TSSA 4N59A 4HRSA 1TZOA 2YEPB 1OQQA 4P6VF 4LLGM 2BS4B 1ACCA 1NVID 2JSVX 3VR8B 4YXDB 1QOFA 2J53A 2VZKD 3CWIA 2WXKA 1L6UA 1FRRA 1N61A 2IPKD 3W5UB 3AE5B 3HRDD 1FFVA 2QILA 3MP9A 2VZKB 3J9CA 1DGJA 2LUMA 1ET9A 1JQ4A 4WH4A 1KRHA 4UDUC 3P4RB 1AYFA 4L23A 1MPEA 3AE3B 1PDXA 2BW2A 2RDGA 1ET6A 2ACZB 1XLPA 2INPE 3WCQA 3MFGA 2QJLA 1C78A 2G9HD 2H88B 3BZDB 2K9XA 3NUHB 4EE2A 3AEFB 1BMLC 4RGTA 1TY0A 1XEEA 1NYQA 4US8A 5BYRA 1TKEA 1FNWA 1KLGD 2NMQA 2AX5A 3FILA 2WXPA 2OEDA 3EUB2 2V3NA 3P4QB 2KWDA 4DQOC 2K22A 2EKIA 2W82A 3IT6B 4CQNA 4IOIE 1YQ3B 3MHZA 1FM0D 2BYTA 1MHHE 5H8YE 4DXGA 1L4DB 2K5PA 4YSXB 2LFIA 3TEWA 1ZE3D 4DXFA 4MM3B 1ENFA 1K52A 2LHEA 3ZJUA 1K53A 2KQ4X 2N9KA 3CIRB 2M0AA 2JU6X 4J3OD 3VR9B 5C3JB 2N0SB 3HVZA 1V1PA 4H2AA 2NTSA 1J7BA 2WNMA 3P4PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4S B;  2DWQ A;  1N63 A;  1OQR A;  4WWM A;  1V97 A;  2OHF A;  3SFD B;  2H89 B;  2PVO D;  4YTN B;  3AE4 B;  3AEG B;  2WLB A;  3AEA B;  2WS3 B;  5C2T B;  4YTM B;  1SB3 C;  1TKY A;  1SF0 A;  1UWM A;  1B9R A;  1XLN A;  1ZOY B;  1JRP A;  5EE3 A;  2WP9 B;  1J7A A;  1QOB A;  4C7Z A;  1VDV A;  2B76 B;  1FXI A;  1FO4 A;  3B2G A;  1L6V A;  1NI3 A;  4JWS C;  4ZHP A;  1FXA A;  1N60 A;  3VRA B;  1WXQ A;  4US9 A;  3ZYY X;  3AM9 A;  3NVW A;  2KMM A;  3FC4 A;  1YJJ A;  2M56 B;  1L0V B;  1WYG A;  4ITK A;  4N58 A;  2PIA A;  1KFY B;  1QLB B;  2LEK A;  4USA A;  3VRB B;  1DOI A;  1TYG B;  1XLQ A;  1FIQ A;  1TJE A;  1RM6 C;  3AMZ A;  3P1M A;  4YTP B;  4FXC A;  4YSY B;  4A9A A;  3ABV B;  1ZXI A;  2WU5 B;  1E7P B;  3AV8 A;  2FBW B;  1R7S A;  2M19 A;  1JAL A;  2CJO A;  2Q5W D;  3AEB B;  5G5H A;  1L5P A;  4JWU C;  1JWB D;  4JX1 C;  3AEE B;  4N59 A;  5AUK A;  1CZP A;  3NVZ A;  4HRS A;  2CU3 A;  5GXG B;  1I7H A;  1OQQ A;  1WGK A;  3AE6 B;  1SIJ A;  4P6V F;  4LTU A;  1FFU A;  1NVI D;  1XO3 A;  1EWY C;  1NYR A;  2BS4 B;  2BS2 B;  1AWD A;  3VR8 B;  3AE7 B;  2MJE A;  1QOF A;  4YXD B;  3CWI A;  1JRO A;  1L6U A;  3B9J A;  1QOA A;  1FRR A;  1N61 A;  1QOG A;  4N6E B;  2BT6 A;  3W5U B;  3AE5 B;  3HRD D;  3AE2 B;  4IDI A;  1FFV A;  1N5X A;  2W54 A;  3NS1 A;  1XLO A;  1DGJ A;  3AH7 A;  5EE0 A;  3AED B;  1QF6 A;  2E3T A;  3NVY A;  1JQ4 A;  3B2F A;  2WQY B;  3KWL A;  1E6E B;  3SFE B;  1KRH A;  3AEC B;  3P4R B;  3P63 A;  1AYF A;  2WU2 B;  3DWM A;  3AE8 B;  3AE3 B;  1PUT A;  1V8C A;  1WRI A;  1PDX A;  3BII D;  3HUI A;  5H92 C;  4KX6 B;  1IUE A;  1ROE A;  5MPO A;  2ACZ B;  1XLP A;  4ZHO A;  1ZUD 2;  2WDV B;  1VLB A;  1YQ4 B;  2CJN A;  1OFF A;  3WCQ A;  3FAH A;  2QJL A;  3LXF A;  2H88 B;  3PO0 A;  5G5G A;  1RFK A;  2PVG C;  1JWA D;  1N5W A;  2W3R A;  2WDR B;  2K9X A;  1DOY A;  3AEF B;  4C80 A;  1JW9 D;  3DWG C;  2WDQ B;  3AN1 A;  2W3S A;  1NYQ A;  5EE9 A;  2DBY A;  1VJK A;  4US8 A;  1F0Z A;  1J7C A;  1TKE A;  1RYJ A;  5AUI A;  2G1E A;  2AX5 A;  1ZP0 B;  1TKG A;  2HTM E;  3EUB 2;  3ETR A;  2BS3 B;  3L4P A;  3NRZ A;  3P4Q B;  3W9C B;  2PKO A;  1E10 A;  1GPX A;  1FRD A;  2K22 A;  2EKI A;  1T3Q A;  1E9M A;  3SR6 A;  1RWS A;  3NVV A;  1DOX A;  1WWT A;  1NEN B;  4YT0 B;  1YQ3 B;  1FM0 D;  3AE9 B;  2W55 A;  5H8Y E;  1N62 A;  3AB5 A;  2L83 A;  1PFD A;  1YJI A;  1E0Z A;  2MH7 A;  2K5P A;  4YSX B;  2JQR B;  2L52 A;  2Y5C A;  2QIE B;  3AE1 B;  1KF6 B;  4YSZ B;  4WQM A;  1NEK B;  2MJ3 A;  3W5V B;  1QT9 A;  1GAQ B;  1A70 A;  3CIR B;  2KAJ A;  3LB8 C;  4ZOH C;  1FMA D;  2JX5 A;  3VR9 B;  5C3J B;  2N0S B;  3HVZ A;  2MJD A;  3RPF C;  5EE1 A;  4HRO A;  1J7B A;  4C7Y A;  3P4P B;  1CJE A; 
#chains in the Genus database with same CATH topology
 4A3P A;  1V97 A;  4YTN B;  3AU5 A;  3ENE A;  4HJK A;  2O6V D;  4GLS C;  3I5J C;  5TR5 A;  2IYD B;  1L6V A;  2GLS A;  3AI5 A;  3ZTD A;  2LVQ A;  3BVM A;  2BB5 A;  1S1Q B;  4M0W A;  2R2Q A;  2RPQ A;  4WQO B;  4HKQ A;  2HE7 A;  1ZGU B;  5DPW A;  1HEZ E;  4MH8 A;  1WF9 A;  3HK0 A;  1WJ6 A;  2KD0 A;  4M00 A;  3VXW A;  3EHV A;  1KOT A;  3QA8 A;  2KK8 A;  3SHQ A;  2IO1 B;  1VCB A;  2QC8 A;  4IDI A;  4K7W A;  3PZ8 A;  4IKG A;  4KSL C;  1XLO A;  3UGB B;  4ZDV A;  1TS4 A;  1I4H A;  3PLV A;  2K1F A;  3KWL A;  3RUL A;  1I4Q A;  2MBH A;  1F77 A;  4M8M A;  2IY0 B;  1IUE A;  1R4M I;  1E7V A;  2X38 A;  4A8X C;  2NCN A;  1JW9 D;  3U2S C;  2W3S A;  1F9J A;  5GMV A;  3VQI A;  1TT5 B;  1FD6 A;  4BAX A;  2PMV A;  3VUX A;  3TEY A;  1NEN B;  1V49 A;  2HDE A;  2E6X A;  2ZNV C;  2XBB C;  4JGH B;  4WQM A;  1L2N A;  1Y56 A;  2FCM A;  4HK2 A;  3N9Y C;  4RM8 A;  3WAP A;  2JX5 A;  4F1S A;  5EE1 A;  3V3X A;  3EFC A;  3W1Y A;  2LAS A;  2L00 B;  2D3B A;  2NVU I;  3DBR I;  5BO4 B;  1LO5 D;  1VDV A;  2J0K A;  4CYE A;  4KZ0 A;  3R8B A;  3WAM A;  4HJG E;  2N7J A;  2NBU A;  4NJC A;  1R4N I;  1UNS A;  4ANU A;  1BXT A;  4LDT D;  1UBQ A;  3L08 A;  4GU2 A;  1C76 A;  3CMM B;  3PT2 B;  4KSK C;  4B9K A;  4HDQ A;  1IBX B;  1JCK B;  1J8C A;  1R7S A;  2JYE A;  4MGY E;  2IJ0 A;  1TS5 A;  4ANX A;  2OJW A;  2CS4 A;  1C4C A;  4HKZ E;  1MHX A;  4LNK A;  1I7H A;  3NHE B;  2FCN A;  1ESF A;  2BVC A;  2PE6 B;  3ZXV A;  3KLS X;  4A55 A;  3DHG C;  2VH1 A;  1E8X A;  2BGF A;  2N7E A;  2E3T A;  1V1O A;  1E6E B;  2MBE A;  3T9L A;  4RNA A;  1GB1 A;  4KGS A;  1G6J A;  4A90 A;  1IYF A;  3IAM 1;  4OVU A;  4EOY A;  2MRP A;  1VLB A;  1YQ4 B;  2BB6 A;  1SE2 A;  2V3P A;  3URY A;  3VTU A;  3O13 A;  1RYJ A;  1LFD A;  2JYT A;  2JZP A;  4XWW A;  4G11 A;  2YVC A;  5IA7 A;  3SR6 A;  1E9M A;  5D3I B;  1PGX A;  2IZV B;  2D10 A;  3A33 B;  3AE1 B;  1SE4 A;  4MEM A;  3A9K B;  2MJ3 A;  3PGE A;  4NAW A;  3U7D A;  4MAC A;  2L32 A;  4NNJ B;  2DYB A;  3UQB A;  2R2O A;  2D3G A;  2MX2 A;  2WX1 A;  3U30 A;  3TUO A;  4AS1 A;  1UWM A;  3LJ3 A;  1JRP A;  2K8H A;  1YN5 A;  4IG7 B;  1NI3 A;  2WX0 A;  2WXM A;  4WWO A;  4ZHP A;  3ZRF A;  3NZU A;  1QKZ A;  1WX9 A;  3MJW A;  2WXJ A;  5JZE B;  1T0R C;  1TY2 A;  4M01 A;  1V80 A;  3SD5 A;  1FIQ A;  2DLB A;  3ABV B;  4AJY B;  3UF8 A;  2FBW B;  4G0N B;  1CZP A;  3NVZ A;  3PSE B;  1U4A A;  1SIJ A;  2WGS A;  1NYR A;  3TBL D;  2J52 A;  2K39 A;  4EZL A;  3PRP B;  1F1H A;  2GOW A;  4EZJ A;  5EE0 A;  4HWI B;  3B2F A;  2N9L A;  2WXR A;  2FCS A;  2FID A;  3M95 A;  4JIO U;  4WWN A;  3WAL A;  5IP4 D;  3DQV A;  4E74 A;  1WZ0 A;  3EGR A;  4J6I A;  1HE8 A;  3V61 A;  4XDD A;  4C00 A;  3FAH A;  2GBR A;  3H6N A;  2PVG C;  1N5W A;  3RFZ B;  2KLG A;  3BYY B;  1WGY A;  5D3D A;  4LNN A;  2AWT A;  4YL8 A;  2AL6 A;  1WR1 A;  2ZW1 A;  2ZPN A;  3HM3 A;  4DHZ E;  4HEA 1;  4IM3 A;  2LRW A;  4RF0 A;  3TMP B;  4REZ A;  4AOF A;  3AB5 A;  3R66 C;  1D5M C;  1L7Y A;  2INC C;  1ZDV A;  3ONS A;  3X0W A;  1GAQ B;  2J7Q B;  4IW0 A;  1FMA D;  2CHZ A;  3Q8F A;  3IVF A;  2X8X X;  3TL5 A;  2KFJ A;  1SXT A;  1ZW7 A;  3VH3 B;  2H89 B;  3AEG B;  2WLB A;  2GI9 A;  4FUL A;  2BYE A;  1JRU A;  3MC8 A;  2SEB D;  2KJR A;  1FXA A;  5LXH A;  1KH0 A;  3PZ7 A;  5DPR A;  2MBB B;  4TQ1 A;  1MG4 A;  3ZTC A;  4TQ0 A;  1A5R A;  3DBR B;  2HD5 B;  3ALB A;  2K6D B;  3CF6 E;  3N20 C;  5G5H A;  1TGZ B;  4P7I A;  1FEH A;  2KJH B;  4HRS A;  1TZO A;  4TV3 A;  3KH0 A;  3ZDT A;  1ACC A;  3VR8 B;  1QOF A;  2WXK A;  1Q1O A;  2LUM A;  5EDS A;  2RR9 A;  1AYF A;  5G55 A;  3AE3 B;  4KDL B;  2BW2 A;  4GSW A;  2INP E;  4NJ6 A;  3BZD B;  4K1R B;  2K9X A;  2V4L A;  3NUH B;  4RGT A;  2C7M B;  2M4N A;  2N7D A;  2QHO A;  4US8 A;  2MW5 A;  1FNW A;  4BKG A;  3EUB 2;  3P4Q B;  2KWD A;  4DQO C;  2A4Z A;  2W82 A;  4GIV A;  4CQN A;  1YQ3 B;  1FM0 D;  4HDO A;  4I6N B;  2N1W A;  1WY8 A;  4MGI E;  1L4D B;  1EF1 A;  1ZE3 D;  2L05 A;  3KYC D;  4DXF A;  1E8Z A;  2LHE A;  2KQ4 X;  3RNC C;  2MA9 B;  3RN9 C;  1D3Z A;  3I63 C;  1J7B A;  2WNM A;  4MT5 A;  3A1Q B;  4E3C A;  2XNA C;  2N4F A;  1YNT E;  4DHJ B;  2G3Q B;  2LGX A;  3RT3 B;  4PS3 A;  4FHJ A;  4ICU A;  5AZH A;  2V1Y A;  3Q8C A;  3Q6B A;  4IC7 B;  3H7P A;  4LNF A;  2JPH A;  4B6W A;  2LGY A;  1TZ1 A;  2RD0 A;  4W9J A;  1NDD A;  2WWZ A;  2MBQ A;  2BKF A;  3HM6 X;  2MHJ A;  4BOS C;  2RGF A;  3BK2 A;  4JX1 C;  2KDM A;  3N3K B;  2EMS A;  5KHQ A;  2V9H A;  4ZYS A;  4IM0 A;  1AN8 A;  1FFU A;  1HZ5 A;  2NBV B;  2MBO A;  4MGK E;  4DHJ D;  3L13 A;  1IP9 A;  1X1M A;  1JRO A;  3B9J A;  4OZB A;  2WXG A;  1I35 A;  4GXB A;  3PV1 A;  3SEB A;  4LJP B;  1WX7 A;  2KDE B;  5AZG A;  1VD2 A;  1EM7 A;  4GDK B;  4QAY A;  1WM3 A;  2ICI A;  1EU3 A;  1IBX A;  4MDK E;  2K3U A;  1E8W A;  2WXL A;  4GGQ A;  4ZRJ A;  2ZPY A;  4OW0 A;  4AP4 C;  4MGZ E;  5EE9 A;  3LDZ E;  3UIP B;  1SBB B;  2UU7 A;  4KVG B;  4II2 B;  4KKI A;  3Q3F A;  3NVV A;  2JRH A;  4X57 B;  3Q3M C;  2L83 A;  4JE3 B;  4XC2 A;  1D5X C;  1V6E A;  1DYQ A;  4NJ7 A;  2IY1 B;  2PPH A;  4DXA B;  4LJO B;  1JML A;  3T8M A;  2ZW0 A;  1Y8R C;  1CJE A;  1T0Y A;  1VRA B;  2JVC A;  3KVF B;  5CHF A;  2WS3 B;  5C2T B;  4OZA A;  2WP9 B;  3N1X C;  1TS3 A;  5DCN A;  3B2G A;  2KC2 A;  4TKN A;  3APD A;  1N60 A;  3AM9 A;  2CR5 A;  3WAO A;  5FR3 A;  4EZK A;  4WJQ A;  1MVK A;  2BKR B;  3LYY A;  1ZKH A;  2LEK A;  1DOI A;  1SIF A;  1GOZ A;  1WMH B;  1YQB A;  3GZN I;  4KV2 A;  1C1Y B;  1F52 A;  2Y5P A;  2WXH A;  4K3C A;  1GNU A;  3ZO5 B;  3B1L X;  2REX A;  1STE A;  2CU3 A;  3AE6 B;  2MCN B;  3B08 A;  3QAQ A;  2ONQ A;  4ZRQ A;  1K8R B;  3IHP C;  4EFO A;  1QOG A;  4NAW B;  5JHA A;  3AH7 A;  5I4D A;  3T3N A;  2KAN A;  4C4V A;  2JXX A;  2WU2 B;  4ACF A;  3BII D;  1GG3 A;  3C8Y A;  3DBL B;  3Q3O C;  5IKC M;  1IPG A;  4L1B A;  3A9J B;  2IDY A;  1ZUD 2;  3EFU A;  1MG8 A;  3RZF A;  2KX0 A;  3LXF A;  1T6B X;  3PO0 A;  1RFK A;  2DNF A;  1C4A A;  3W1S A;  3VHT C;  5BYS A;  4LNI A;  1I4R A;  1DOX A;  1RWS A;  2FUG 1;  2KTR B;  4W9L A;  1I4P A;  4PS8 A;  2DYM A;  3PRZ A;  1YJI A;  2ON8 A;  3VTV A;  3SDL C;  2QIE B;  1J0G A;  1VZ6 A;  2D3A A;  4NZL B;  5J17 A;  1WJU A;  4B0E A;  1C3T A;  1IGD A;  1P7E A;  1L0Y B;  4DBG A;  1D6E C;  2FCQ A;  2D5G A;  1UWX A;  4HCN B;  4PS7 A;  2KKC A;  1UH6 A;  2PEA A;  5FKA C;  3MJ5 A;  1WM2 A;  3NVW A;  2LZ6 A;  5CTR C;  3M62 B;  4MJS B;  5T8I A;  2KWU B;  1RM6 C;  1D5Z C;  2LVP A;  1EWC A;  4A9A A;  4WUR A;  1WXA A;  3VFK A;  2Y3A A;  4GB9 A;  4AWJ A;  2QMT A;  4I6L B;  1P7F A;  1WGK A;  3L0W B;  2D2Q A;  1LXD A;  3U8Z A;  1SE3 A;  1FCC C;  3V62 A;  3NS1 A;  4W9H A;  3UQA A;  4DK5 A;  2W9N A;  3OJ3 A;  2LGS A;  3AEC B;  1HA5 A;  1AAR A;  2I38 A;  4KX6 B;  1ROE A;  4KIK B;  3VDZ A;  2CJN A;  4RGM A;  2JF5 A;  3N1Y C;  4C80 A;  4CHK A;  4WIP A;  1F0Z A;  1J7C A;  3ML9 A;  2O2V A;  2G1E A;  1TKG A;  4MH0 E;  5C1Z A;  1FRD A;  2IGD A;  2KYW A;  2PJH A;  1N62 A;  1E0Z A;  4DDI D;  1E90 A;  2MH7 A;  2ZJD A;  2L52 A;  3GP7 A;  1NEK B;  4L2Y A;  2QDF A;  1RFA A;  3DVN V;  2KAJ A;  2KZR A;  1RAX A;  3RPF C;  2J4X A;  2KNB A;  3SFD B;  3N1Z C;  2WXF A;  1MJD A;  3AEA B;  4YTM B;  4CO7 A;  2KMA A;  5FK9 C;  3TIX A;  4IWQ A;  3Q8B A;  1FXI A;  4F7Z A;  3Q8E A;  2CHW A;  4R3D A;  1XT9 B;  4DWF A;  4XDC A;  3DVG Y;  3U52 E;  2PIA A;  1YJ1 A;  5AZF A;  4BZA A;  4USA A;  1L4Z B;  3TJP A;  2DZJ A;  4FXC A;  2C60 A;  1XQQ A;  1ZXI A;  2ZZP B;  1E7P B;  1GUA B;  2NBW B;  2UWQ A;  3OLM D;  4XWT A;  1UF0 A;  3B0A A;  1GC7 A;  2BYV E;  1SGH A;  1OQQ A;  5CHV C;  4P6V F;  4LLG M;  1NVI D;  1WMH A;  2BS4 B;  4IUM B;  2JSV X;  4W9I A;  2J53 A;  3CWI A;  2J0J A;  2AYO B;  1N61 A;  2C9W B;  2V3S A;  2VZK B;  3J9C A;  3QWZ B;  1WFY A;  1ET9 A;  2HJ1 A;  4WAA A;  1KRH A;  2D07 B;  1R4N B;  1NBF C;  1PDX A;  2KN5 A;  2M1M A;  2D11 A;  3R7Q A;  1C78 A;  2H88 B;  5IAA C;  2L0T A;  3V6C B;  4GDL A;  1BML C;  1TY0 A;  1WXM A;  2DZM A;  3H7P B;  3VUW A;  1TKE A;  2NMQ A;  3RNF C;  2AX5 A;  3FIL A;  4HXD A;  2WXP A;  3QK0 A;  3RNG C;  1KM7 A;  3KYD D;  4LCD E;  2LWP A;  3IT6 B;  4MEL A;  1MHH E;  1WYW B;  3RYT A;  3QX1 A;  3JSV B;  2LFI A;  2HJ8 A;  4MM3 B;  2I1K A;  3ZJU A;  1K53 A;  3ZLZ A;  3CIR B;  2M0A A;  2DHZ A;  1BT0 A;  2JU6 X;  3JSV A;  3NJT A;  4J3O D;  5C3J B;  3HVZ A;  2NTS A;  4FLH A;  3P4P B;  1OQR A;  4HCP B;  1FXT B;  3PTF C;  4K3B A;  2DAF A;  2C7N B;  4EUT A;  1XLN A;  3Q3N C;  1J7A A;  1F2R C;  1XCQ L;  2AL3 A;  2KWC A;  3APC A;  2LXC A;  4JWS C;  3PRM B;  3BY4 B;  3PPA A;  3P1M A;  4YTP B;  1CQV A;  4YSY B;  1PGB A;  1P0R A;  3ZQ4 A;  3AV8 A;  3Q14 C;  4W9D A;  1JAL A;  1C77 A;  1L5P A;  3ZKJ C;  5BMI A;  2WDT B;  5GXG B;  1WX8 A;  2LVO A;  1GB4 A;  2PE9 A;  4ANV A;  1IGC A;  2L76 A;  4LK0 M;  3PS6 A;  3NVY A;  4TMA B;  4JL9 A;  3DBS A;  3PLU A;  2KDI A;  3ZUN A;  3AE8 B;  1PUT A;  2C5L C;  2AEH A;  2JUO A;  4E71 A;  3DVG X;  1V2Y A;  1E8Y A;  2I2Y A;  5D94 A;  4ZHO A;  4KGT A;  3RNA C;  1OFF A;  2Y5B B;  3QHT A;  1UBI A;  2W3R A;  1JWA D;  2UYZ B;  2AQ1 B;  2IGG A;  5AUI A;  4II3 B;  1UEL A;  2LGI A;  3APF A;  3ZXR A;  1K51 A;  4MM3 A;  1WJN A;  1B1Z A;  3A4R A;  5IN7 A;  2M17 A;  5JXV A;  2BYF A;  3BK1 A;  2W55 A;  1M94 A;  1C4P A;  2QEJ C;  2XN9 C;  4ZRI A;  2SAK A;  4M0W B;  1QT9 A;  4G3X B;  3QJZ A;  3Q3J A;  4EKU A;  1YX5 B;  1T0S C;  4M02 A;  3BVG A;  4W9K A;  2LRU A;  2PVO D;  1QQR A;  3GS2 A;  2B3A A;  2EKE C;  1SB3 C;  1JWU D;  1B9R A;  3EA6 A;  4DDG D;  2B76 B;  3ZDM C;  3IAS 1;  3KW5 B;  2N9E B;  3R2I A;  1WIA A;  3ZYY X;  3OJ4 B;  1QIL A;  2M56 B;  3T3O A;  2ZVO A;  1ZPS A;  1CMX B;  5DPS A;  4XYC A;  4LDT B;  2K0P A;  2WU5 B;  4WWP A;  2KAC A;  2M19 A;  1WI0 A;  3EC8 A;  2G4S A;  2Q5W D;  3AEB B;  4OHJ A;  4OVV A;  5AUK A;  3A1Q A;  3DBL I;  3K9O B;  2IO3 B;  1EWY C;  2WXO A;  3GB1 A;  2RDB C;  1QOA A;  1UZX B;  4C56 C;  3W1S C;  1WGD A;  3L54 A;  3CSF A;  4K7U A;  1GC6 A;  1V1P B;  4XGA B;  2BBC A;  3P63 A;  4RGN A;  3HVD A;  5BMH A;  2GBK A;  1XCT L;  4FJV B;  4EEW A;  2J0M A;  2WDV B;  1FCL A;  1XXG A;  1UGM A;  4FHK A;  2IGH A;  3KUD B;  2WDR B;  3OWE B;  4O1N A;  1KTK A;  3RD2 A;  4P1C C;  1OTR B;  3KUC B;  5L95 C;  2MLB A;  5IO9 A;  2ZNV B;  1EU4 A;  2PTL A;  3QAR A;  1T3Q A;  2LGD A;  1WWT A;  2KHW B;  3AE9 B;  3IFW B;  3O65 B;  3A4S C;  3BYT B;  5JHB A;  1KF6 B;  2RDH A;  2Z59 B;  1WR6 E;  1I4G A;  3PVL A;  3N32 A;  1XD3 B;  5E6J A;  3UIO B;  2LMC A;  4RCO A;  2MJD A;  3A9K A;  1OEY A;  4C4V B;  3ZJT A;  4C7Y A;  1WE7 A;  3P4S B;  1C79 A;  1WE6 A;  5CX3 A;  1HTQ A;  3ZVV A;  5EE3 A;  2KDB A;  3PHW B;  4C7Z A;  1C9F A;  2LJI A;  1L0X B;  3GOE A;  2KFK A;  1Q10 A;  4NAM A;  3RCZ A;  3L16 A;  1PYW D;  2RMM A;  1TJE A;  3M3J A;  4A6Q A;  4NY0 A;  1PQS A;  4HLE A;  3QCA A;  3RZW C;  1E5W A;  3KQ4 A;  4RF1 A;  2CJO A;  4PT5 A;  2Z0D B;  3ECI A;  1WGG A;  3ML8 A;  4JQW C;  5DPT A;  3AE2 B;  1N5X A;  1AW7 A;  2KTR A;  1TBE A;  4JLC A;  3M63 B;  2WQY B;  3SFE B;  1T0Q C;  4NQL B;  3WAN A;  1V8C A;  1QZE A;  5H92 C;  3HUI A;  4HPP A;  3DBH B;  2KVZ A;  2CHX A;  3NY5 A;  2D3C A;  5G5G A;  3PHX B;  3DWG C;  4WJP A;  2DBY A;  3C0R B;  2KXJ A;  4BKT A;  5LXI B;  3H9D A;  1D4B A;  2HTM E;  2BF8 B;  3IG3 A;  3L17 A;  3KWV A;  2K6Q A;  5AEK B;  1H4R A;  2J42 A;  3P2B A;  3IXS A;  1ZXH A;  5JH5 C;  4TSS A;  3DBH I;  4ANW A;  3FKY A;  3ZNH B;  2WXI A;  2JQR B;  2Y5C A;  1UUP A;  3LB8 C;  2MP2 A;  5HFY A;  3ZNZ B;  5KHO A;  4P16 A;  3E9S A;  1VZ8 A;  2VRR B;  1E7U A;  4WWM A;  1P3Q U;  1SF0 A;  1SJH D;  3NS8 A;  1QOB A;  3GE3 C;  2XK5 B;  3HIZ A;  3VRA B;  4B0M A;  4I6P A;  2MEK A;  5HI1 A;  4K7S A;  2KN4 A;  1WYG A;  3QQ8 B;  3K9P B;  2XK5 A;  1OGW A;  1SEB D;  4ASW C;  1KFY B;  3Q8A A;  3VVW B;  2JT4 B;  2JZ3 B;  2QSD A;  1J19 A;  1WH3 A;  3WIM A;  3NZ3 A;  4JWU C;  2NPT A;  4N59 A;  2IO0 B;  2DEN B;  2MWS B;  2YEP B;  4YXD B;  4BVU C;  1L6U A;  1FRR A;  2IPK D;  3W5U B;  3AE5 B;  3HRD D;  1FFV A;  3MP9 A;  2IBI B;  2JWZ A;  3P4R B;  1LGR A;  3QC8 B;  1WGH A;  2KC1 A;  5C23 A;  2RDG A;  1ET6 A;  1XLP A;  2CU1 A;  3WCQ A;  5D2M B;  2DZK A;  3ZNG C;  3AEF B;  2NS5 A;  1XEE A;  2VH2 A;  3DDC B;  3V6E B;  3H7S A;  5BYR A;  1KLG D;  2OED A;  2EKI A;  2OJR A;  2ZVN A;  3RMK C;  1EO6 A;  4IOI E;  3OG5 A;  3MHZ A;  2BYT A;  3MHS D;  5H8Y E;  2JRI B;  2NR2 A;  4YSX B;  4N9F 4;  4W9E A;  3PRE A;  1ENF A;  3ZIM A;  2N9K A;  2JZZ A;  2LXA A;  3SU8 X;  3VR9 B;  2N0S B;  2KJ6 A;  4M8N A;  3D32 A;  1V1P A;  2GBN A;  2K8C A;  4BBN F;  2FIF A;  2DWQ A;  1N63 A;  1S3S G;  3GZN B;  2L7R A;  1ZOY B;  3Q69 A;  2GRI A;  1KJT A;  2Z0E B;  2KOX A;  2L3Z A;  4US9 A;  2FE8 A;  2GB1 A;  1P9D U;  1L0V B;  3U4E G;  1QLB B;  1VR9 A;  2GBJ A;  2MQJ A;  2HTH A;  4D2K A;  4FAD A;  1M4V A;  4NQK E;  4RMA A;  3ZJV A;  5D7G A;  3I3T B;  1HTO A;  3MTN B;  1HZ6 A;  1YX6 B;  1N6Z A;  3ZGZ A;  4WJN A;  5CHW A;  2N9X A;  4IWO A;  2MSE D;  2DYO A;  4LTU A;  1XO3 A;  4ZRP A;  2ASQ A;  3DHH C;  2MJE A;  1WRD B;  2KDF B;  4RM9 A;  2G4D B;  4MSQ B;  3H8H A;  4N6E B;  3DVN U;  2W54 A;  5D6J B;  4W9F A;  1HXY D;  4F8C B;  1V5T A;  2KMC A;  3JYU A;  3DWM A;  4RGO S;  5L83 A;  3V05 A;  3RUI B;  2KWV B;  3HHM A;  4S17 A;  2LUE A;  1HQR D;  5LLI A;  3Q2A C;  1T5X D;  1DOY A;  2EMT A;  2FNJ B;  2Z8L A;  3AN1 A;  1VJK A;  2WXN A;  1YD8 U;  5E6N A;  2GMI C;  2CKH B;  3NZS A;  4KZC A;  1FNU A;  3NRZ A;  4LNO A;  3I57 A;  1JWS D;  2N9P C;  2NPT B;  2DX5 B;  1WJ4 A;  2O6V B;  4FBJ B;  2JXT A;  4GDK A;  3QIJ A;  2INN E;  4AUQ C;  2KX3 A;  3W5V B;  3EEC A;  2AQ2 B;  5HKH A;  4ARI A;  4FJZ A;  4HRO A;  2YLM A;  3X23 A;  3TEX A;  2DAJ A;  2OHF A;  4KDI C;  3RNB C;  4BKS A;  3JW0 X;  5G2N A;  2K25 A;  1YIW A;  1MFW A;  4FA6 A;  1FO4 A;  1Z2M A;  4ZYN A;  1WXQ A;  1WZ3 A;  4WJO A;  1F2R I;  2O6V A;  2BPS A;  3VRB B;  3AMZ A;  3IT4 B;  2IND C;  2L8J A;  3BIN A;  2OOB B;  5IOI A;  1Q0W B;  1WGR A;  4ZRK A;  3AEE B;  4OZC A;  4P1B C;  2MP2 B;  1AWD A;  2KO3 A;  3AE7 B;  4GN1 A;  2BT6 A;  3S2A A;  1YOV B;  4HPM B;  2ZEQ A;  1QF6 A;  3A9J A;  3AED B;  1VZ7 A;  3R2T A;  3VAW A;  3AUL A;  4K81 A;  1WRI A;  2KVR A;  4HVB A;  3I9V 1;  1SJE D;  5E6O A;  3TSS A;  1UGJ A;  4KGR A;  1ZDX A;  3L10 B;  1TS2 A;  3ZRC A;  2LD9 A;  2A5U A;  4NPN A;  2KQS A;  4TUU A;  1ZP0 B;  5HG2 A;  3ETR A;  2BS3 B;  3L4P A;  4GOC A;  1E10 A;  1GPX A;  2KQ7 A;  3R3M A;  1OQY A;  4YT0 B;  3H1U A;  4BOZ B;  2KT7 A;  1PFD A;  2XEW A;  3E56 A;  3DHI C;  4AJW A;  4YSZ B;  3PZD A;  2WHI A;  1Z5S B;  2L1A A;  2I1J A;  2BWE S;  2V0G A;  2KLC A;  4ARC A;  1CK1 A;  1NI2 A;  3N30 A;  3UI3 A;  2IO2 B;  1XF5 L;  2PLP A;  4KKJ A;  3W2D A;  3NOB A;  2KTF A;  4JPS A;  4BFR A;  1LM8 B;  2K8B A;  5HHD G;  4FJY A;  3P42 A;  2YEP F;  2EEL A;  1KLV A;  2NTT A;  3AXC A;  1PGA A;  2ZCC A;  1YMH E;  4N58 A;  1LQB A;  5LNK 1;  5BMG A;  2WXQ A;  1FNV A;  2PW9 A;  4HPL B;  1UD7 A;  5TSS A;  2QCZ A;  2BS2 B;  2RPV A;  2BTE A;  2ZCB A;  3IBE A;  2L0F A;  2M0X A;  3KUZ A;  2FUH B;  3DPD A;  3MC0 B;  1SSN A;  1TIF A;  3GE8 C;  4S0R A;  4WAF A;  1V9J A;  1V5O A;  1EF5 A;  3DOW A;  1SE9 A;  3TEZ A;  5MPO A;  5J2R A;  4OVZ A;  4XE0 A;  1Q5W B;  4FN2 A;  1I4X A;  3U7Z A;  2N1V A;  2WDQ B;  4B95 A;  3BVZ A;  4Q2J A;  3DCG A;  1YN4 A;  2GBM A;  2R61 A;  2LHD A;  2V4I B;  1KLU D;  3W9C B;  2PKO A;  4XX5 A;  3V60 A;  1YN3 A;  1RRB A;  1H8C A;  1K50 A;  1TTN A;  2AQ3 B;  1MI0 A;  4RH6 A;  4PYU A;  3FIL B;  2M8S A;  2BQQ A;  1JWM D;  2G45 B;  1A70 A;  4GDL B;  2BWF A;  3JVZ X;  4ZOH C;  4MSM B;  3RI7 C;  4ICV A;  4PK1 A;  5E6P A;  1P98 A;  3AE4 B;  3TCA A;  1V86 A;  1TKY A;  1WSP A;  2JWU A;  4GMV A;  3BWU D;  1BUI C;  4G50 A;  3UIN B;  2FAZ A;  2KMM A;  3FC4 A;  1YJJ A;  4IWP A;  4ITK A;  1OEY J;  1TYG B;  1XLQ A;  4A20 A;  5FR6 A;  2LI5 A;  4RFB A;  1WXS A;  3RNE C;  3WA0 A;  1V81 A;  4YWG G;  1WXV A;  1I42 A;  4AQ7 A;  1GJZ A;  5BYQ A;  1JWB D;  2TSS A;  1R4M B;  1EUV B;  2DZI A;  3MC9 A;  3VUY A;  2JY6 A;  2VZK D;  3ZW3 A;  4XZ4 A;  3AU4 A;  4W9C A;  2QIL A;  4PYZ A;  1DGJ A;  3VTW A;  1ISN A;  1JQ4 A;  1RLF A;  4WH4 A;  2WYQ A;  4UDU C;  4L23 A;  1P1A A;  1MPE A;  1FPY A;  2O2V B;  3R7R A;  3VH4 B;  2ACZ B;  4A3O A;  3MFG A;  2C7H A;  2QJL A;  2G9H D;  4EE2 A;  4MJS A;  4KIK A;  1NYQ A;  2LJ5 A;  3C19 A;  2KFK B;  4IM2 A;  2V3N A;  2K22 A;  3CST A;  4DHZ B;  5J18 A;  4URK A;  4DXG A;  2RSU A;  3TEW A;  2K5P A;  4W9G A;  3NG0 A;  1K52 A;  4BBN C;  3ZNI D;  4BKS D;  4H2A A;  3OAW A; 
#chains in the Genus database with same CATH homology
 2DWQ A;  1N63 A;  1OQR A;  1V97 A;  4YTN B;  2XNA C;  1YNT E;  1XLN A;  1ZOY B;  1J7A A;  1F2R C;  3Q69 A;  2GRI A;  1XCQ L;  4GLS C;  1L6V A;  4JWS C;  3BVM A;  3Q8C A;  2BB5 A;  4US9 A;  2FE8 A;  4M0W A;  2GB1 A;  1L0V B;  3U4E G;  1QLB B;  1VR9 A;  4HKQ A;  4D2K A;  1HEZ E;  1M4V A;  3P1M A;  4MH8 A;  1CQV A;  4YTP B;  4YSY B;  3ZJV A;  1PGB A;  5D7G A;  3ZQ4 A;  3AV8 A;  1HZ6 A;  1JAL A;  1C77 A;  1L5P A;  3BK2 A;  4JX1 C;  2KDM A;  5BMI A;  3ZGZ A;  5GXG B;  4ZYS A;  2DYO A;  4LTU A;  1AN8 A;  1FFU A;  1HZ5 A;  1XO3 A;  4ZRP A;  2MJE A;  1JRO A;  3B9J A;  4N6E B;  3H8H A;  4OZB A;  4IDI A;  1GB4 A;  2WXG A;  3PZ8 A;  2W54 A;  4IKG A;  1IGC A;  1XLO A;  3SEB A;  4LK0 M;  1HXY D;  1TS4 A;  1I4H A;  3NVY A;  1EM7 A;  4GDK B;  4TMA B;  3KWL A;  3DWM A;  4RGO S;  3V05 A;  3AE8 B;  1PUT A;  1I4Q A;  2ICI A;  1EU3 A;  1IBX A;  1F77 A;  1IUE A;  2I2Y A;  4ZHO A;  2K3U A;  4KGT A;  1OFF A;  1HQR D;  2WXL A;  1T5X D;  2X38 A;  2W3R A;  1JWA D;  4A8X C;  1DOY A;  4OW0 A;  2Z8L A;  1JW9 D;  3U2S C;  3AN1 A;  2AQ1 B;  2W3S A;  5EE9 A;  1VJK A;  2WXN A;  2IGG A;  1SBB B;  5AUI A;  3VQI A;  2LGI A;  1FD6 A;  1FNU A;  3NRZ A;  1K51 A;  2PMV A;  4KKI A;  3TEY A;  1B1Z A;  3I57 A;  3NVV A;  5JXV A;  1NEN B;  2HDE A;  3BK1 A;  1JWS D;  2E6X A;  2W55 A;  2L83 A;  1C4P A;  2JXT A;  2QEJ C;  4JE3 B;  1D5X C;  2XN9 C;  2INN E;  4WQM A;  2SAK A;  1DYQ A;  1Y56 A;  3W5V B;  1QT9 A;  2AQ2 B;  3N9Y C;  2JX5 A;  4ARI A;  1JML A;  2ZW0 A;  3BVG A;  4HRO A;  5EE1 A;  3V3X A;  1CJE A;  3TEX A;  1VRA B;  2OHF A;  2PVO D;  1QQR A;  2WS3 B;  3GS2 A;  5C2T B;  1SB3 C;  1JWU D;  1B9R A;  4OZA A;  3EA6 A;  2WP9 B;  1LO5 D;  1VDV A;  1TS3 A;  2B76 B;  1FO4 A;  3B2G A;  4MT5 A;  3IAS 1;  3R8B A;  1N60 A;  3R2I A;  1WXQ A;  4HJG E;  3ZYY X;  3AM9 A;  2N7J A;  4NJC A;  1F2R I;  1UNS A;  5FR3 A;  1QIL A;  1BXT A;  2M56 B;  1MVK A;  3T3O A;  1C76 A;  3LYY A;  2LEK A;  3VRB B;  1DOI A;  1GOZ A;  1ZPS A;  3AMZ A;  3IT4 B;  2K0P A;  2Y5P A;  2WU5 B;  2WXH A;  1IBX B;  1JCK B;  1R7S A;  2JYE A;  2KAC A;  2M19 A;  2IJ0 A;  1TS5 A;  2Q5W D;  3AEB B;  1C4C A;  3AEE B;  4OHJ A;  4HKZ E;  4OZC A;  5AUK A;  1STE A;  1MHX A;  2CU3 A;  1I7H A;  3AE6 B;  2ONQ A;  1EWY C;  4ZRQ A;  1AWD A;  1ESF A;  2WXO A;  3AE7 B;  3GB1 A;  1QOA A;  1QOG A;  4NAW B;  2BT6 A;  3KLS X;  4A55 A;  4C56 C;  1QF6 A;  3AH7 A;  3AED B;  1VZ7 A;  3R2T A;  2E3T A;  5I4D A;  3T3N A;  1V1O A;  1V1P B;  1E6E B;  2BBC A;  3P63 A;  2WU2 B;  4RGN A;  4RNA A;  3HVD A;  4KGS A;  5BMH A;  1GB1 A;  1WRI A;  4A90 A;  3BII D;  3C8Y A;  3I9V 1;  1XCT L;  1SJE D;  3IAM 1;  3TSS A;  4L1B A;  2IDY A;  1UGJ A;  1ZUD 2;  2WDV B;  1VLB A;  1YQ4 B;  2BB6 A;  1XXG A;  1SE2 A;  1ZDX A;  4KGR A;  1FCL A;  2V3P A;  3LXF A;  1T6B X;  2IGH A;  3PO0 A;  1RFK A;  1TS2 A;  2WDR B;  3OWE B;  4O1N A;  1C4A A;  1KTK A;  3W1S A;  3URY A;  3O13 A;  1RYJ A;  2JYT A;  2JZP A;  5BYS A;  4XWW A;  1ZP0 B;  5HG2 A;  1EU4 A;  2PTL A;  2BS3 B;  3ETR A;  3L4P A;  1I4R A;  1E10 A;  1GPX A;  1T3Q A;  1E9M A;  3SR6 A;  1RWS A;  2FUG 1;  1DOX A;  1WWT A;  5D3I B;  1PGX A;  4YT0 B;  1I4P A;  3AE9 B;  2DYM A;  1PFD A;  1YJI A;  2ON8 A;  3BYT B;  3E56 A;  3AE1 B;  1SE4 A;  2QIE B;  1KF6 B;  2RDH A;  4YSZ B;  2MJ3 A;  1I4G A;  1VZ6 A;  2L1A A;  5E6J A;  4NZL B;  2V0G A;  4B0E A;  4ARC A;  2LMC A;  1CK1 A;  4MAC A;  2L32 A;  2MJD A;  4RCO A;  3UI3 A;  1XF5 L;  1IGD A;  2PLP A;  4KKJ A;  4C7Y A;  1P7E A;  3ZJT A;  3P4S B;  1C79 A;  1L0Y B;  3W2D A;  3TUO A;  1D6E C;  4AS1 A;  1UWM A;  2D5G A;  5EE3 A;  1JRP A;  1UWX A;  4JPS A;  1YN5 A;  4C7Z A;  5HHD G;  1C9F A;  2LJI A;  3P42 A;  1NI3 A;  2YEP F;  2WXM A;  4ZHP A;  1L0X B;  2EEL A;  1QKZ A;  5FKA C;  3MJ5 A;  2WXJ A;  3NVW A;  2NTT A;  1PGA A;  1TY2 A;  1YMH E;  1Q10 A;  4NAM A;  4N58 A;  1PYW D;  2RMM A;  5T8I A;  1FIQ A;  1TJE A;  1RM6 C;  1D5Z C;  2DLB A;  4A6Q A;  1EWC A;  5LNK 1;  4A9A A;  3ABV B;  4WUR A;  3KQ4 A;  5BMG A;  2WXQ A;  1FNV A;  2FBW B;  4RF1 A;  2CJO A;  4PT5 A;  1CZP A;  3NVZ A;  2Y3A A;  2PW9 A;  2QMT A;  5TSS A;  1P7F A;  1WGK A;  1SIJ A;  2BS2 B;  1NYR A;  2J52 A;  2RPV A;  2BTE A;  3AE2 B;  1SE3 A;  1FCC C;  1N5X A;  1AW7 A;  3MC0 B;  3NS1 A;  1SSN A;  4WAF A;  5EE0 A;  3B2F A;  2N9L A;  2WQY B;  3SFE B;  2WXR A;  3AEC B;  1HA5 A;  1V8C A;  3TEZ A;  3EGR A;  5H92 C;  3HUI A;  2I38 A;  4KX6 B;  1ROE A;  5MPO A;  2CJN A;  4XDD A;  4OVZ A;  4XE0 A;  3FAH A;  4RGM A;  5G5G A;  2PVG C;  1I4X A;  1N5W A;  3RFZ B;  4C80 A;  3U7Z A;  3DWG C;  2WDQ B;  4WIP A;  3BYY B;  3BVZ A;  2DBY A;  4Q2J A;  5D3D A;  1F0Z A;  1J7C A;  1YN4 A;  2G1E A;  2R61 A;  2LHD A;  1D4B A;  1TKG A;  2HTM E;  2V4I B;  1KLU D;  3W9C B;  2PKO A;  1FRD A;  3KWV A;  2ZW1 A;  1YN3 A;  2IGD A;  2J42 A;  1K50 A;  1ZXH A;  3IXS A;  2AQ3 B;  1MI0 A;  4HEA 1;  4RH6 A;  4RF0 A;  4REZ A;  4TSS A;  1N62 A;  3AB5 A;  1E0Z A;  2MH7 A;  2WXI A;  2JQR B;  2L52 A;  2Y5C A;  3GP7 A;  1D5M C;  3FIL B;  1NEK B;  1UUP A;  1ZDV A;  1JWM D;  4L2Y A;  1GAQ B;  1A70 A;  3LB8 C;  2KAJ A;  5HFY A;  4GDL B;  4ZOH C;  4P16 A;  1FMA D;  3Q8F A;  3E9S A;  3RPF C;  1VZ8 A;  2J4X A;  1SXT A;  4WWM A;  3SFD B;  2H89 B;  2WXF A;  3AE4 B;  2WLB A;  3AEA B;  3AEG B;  2GI9 A;  4YTM B;  1TKY A;  1SF0 A;  5FK9 C;  1SJH D;  1QOB A;  1WSP A;  2JWU A;  2SEB D;  3Q8B A;  1FXI A;  3BWU D;  1BUI C;  3Q8E A;  1FXA A;  4R3D A;  3VRA B;  4B0M A;  2MEK A;  5HI1 A;  4XDC A;  2KMM A;  3U52 E;  1KH0 A;  3FC4 A;  1YJJ A;  3PZ7 A;  2KN4 A;  4TQ1 A;  1WYG A;  4ITK A;  1SEB D;  2PIA A;  1KFY B;  3Q8A A;  4USA A;  1L4Z B;  1TYG B;  1XLQ A;  4TQ0 A;  2QSD A;  4RFB A;  4FXC A;  1ZXI A;  1E7P B;  4XWT A;  4YWG G;  3NZ3 A;  4AQ7 A;  5G5H A;  4JWU C;  5BYQ A;  1JWB D;  1FEH A;  2TSS A;  4N59 A;  4HRS A;  1TZO A;  2YEP B;  1OQQ A;  4P6V F;  4LLG M;  2BS4 B;  1ACC A;  1NVI D;  2JSV X;  3VR8 B;  4YXD B;  1QOF A;  2J53 A;  2VZK D;  3CWI A;  2WXK A;  1L6U A;  1FRR A;  1N61 A;  2IPK D;  3W5U B;  3AE5 B;  3HRD D;  1FFV A;  2QIL A;  3MP9 A;  2VZK B;  3J9C A;  1DGJ A;  2LUM A;  1ET9 A;  1JQ4 A;  4WH4 A;  1KRH A;  4UDU C;  3P4R B;  1AYF A;  4L23 A;  1MPE A;  3AE3 B;  1PDX A;  2BW2 A;  2RDG A;  1ET6 A;  2ACZ B;  1XLP A;  2INP E;  3WCQ A;  3MFG A;  2QJL A;  1C78 A;  2G9H D;  2H88 B;  3BZD B;  2K9X A;  3NUH B;  4EE2 A;  3AEF B;  1BML C;  4RGT A;  1TY0 A;  1XEE A;  1NYQ A;  4US8 A;  5BYR A;  1TKE A;  1FNW A;  1KLG D;  2NMQ A;  2AX5 A;  3FIL A;  2WXP A;  2OED A;  3EUB 2;  2V3N A;  3P4Q B;  2KWD A;  4DQO C;  2K22 A;  2EKI A;  2W82 A;  3IT6 B;  4CQN A;  4IOI E;  1YQ3 B;  3MHZ A;  1FM0 D;  2BYT A;  1MHH E;  5H8Y E;  4DXG A;  1L4D B;  2K5P A;  4YSX B;  2LFI A;  3TEW A;  1ZE3 D;  4DXF A;  4MM3 B;  1ENF A;  1K52 A;  2LHE A;  3ZJU A;  1K53 A;  2KQ4 X;  2N9K A;  3CIR B;  2M0A A;  2JU6 X;  4J3O D;  3VR9 B;  5C3J B;  2N0S B;  3HVZ A;  1V1P A;  4H2A A;  2NTS A;  1J7B A;  2WNM A;  3P4P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...