2BTCE

Bovine trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor ii)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of three new trypsin-squash-inhibitor complexes: a detailed comparison with other trypsins and their complexes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2btcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2btcE02
5JBAS 4Q80A 1GJAB 3ZVDA 2PKSB 1EPTA 2WINI 3ZVFA 4JK6A 1PPCE 1LVYA 1EOLA 5T6FA 3SI3H 5HM9A 2QGRA 1NROH 1KDQA 6CHAC 2RG3A 3LT3A 1GBAA 3BG4C 1HAXB 2FOHA 3LIWA 3H7OA 3ZV9A 1UVPA 4FUEA 1L1GA 1LVOA 3BF6H 1JIMA 1W0ZU 4H4FA 3A83A 3F1SB 3S9AA 1SGNE 4NA8A 1EPTB 1O2UA 5ESTE 1KXAA 2ZQ1A 1RGQA 1QB1A 5J4QA 3P17H 4AGKA 3A7WA 2AMPA 4K8YA 1DUEA 1YM0A 3EA8A 3W95A 3ODDA 2GCTB 3V3MA 1HJAB 1V2ST 2FWWA 5JB8S 3O8BA 4XSKU 1TLDA 2C93B 5JBBS 3T29A 1A2CH 1ZMLA 3GCNA 4XDEA 4ZH8A 2HNTF 3U98H 5DP4A 1A0LA 2DE9A 1DY9A 2TBSA 1V2WT 3U8TH 1ZRKA 2BDYA 1FPCH 1O33A 5FPTA 3SV9A 1B7XB 1S6HA 1D3PB 1O2KA 2GDDA 1HGTH 4X1RU 4X8TH 1YPEH 1NC6A 5GCHG 1O3GA 3U69H 1WTHD 1NRPH 3GYMA 1ZHRA 4MPUA 4BANB 1A5IA 3HGPA 4NGAH 1F5LA 1GBHA 1O3KA 1ESTA 2VGCC 1GMCG 2RCEA 3STJA 1TMUH 3QTVH 3S0NA 3ATLA 4B74A 3P70B 1Z1IA 3SV7A 1GL0E 1YPGH 2CXVA 4M7GA 1G3CA 4LZ4B 5GCHF 4LZ1H 2ALVA 3M36A 4D7FA 3SV6A 1Z6EA 2CGAA 1C1MA 3D62A 3QN7A 4XFQA 4AGJA 2KAIB 1FY3A 1LHFH 2BYAX 3PV4A 3GY6A 2A0QB 1LQDB 1C5SA 2XWBI 2PUQH 3RXPA 3LJJA 1SL3A 4CRGA 1OX1A 3MI4A 1HRTH 1CBWB 2G51A 1YBWA 1DFPA 3Q00A 3RXRA 1Y3WA 1INCA 3E0PB 1CA0B 1C1TA 1ID5H 1TB6H 3RMOH 2LNCA 4WY3A 1ELDE 1DM4B 1RTKA 3Q3KA 1TGNA 2Z9JA 1C2KA 1C5RA 2VIVA 4ISNA 1LTOA 2BX3A 2HNTC 2GGVB 3M5MA 1UTNA 4UFFH 1XVMA 4CREA 1AY6H 1C1NA 2ZDNA 1BDAA 1O2XA 3SU6A 1F92A 3EE0B 4IMQA 2V6NA 1YGCH 1MU8B 1DDJA 3LJOA 2GMTC 3ZVAA 3KCGH 5DO4H 5C3NA 1TMBH 2PW8H 2OXSA 2AS9A 5L30H 1BB0B 3RM0H 2UUKB 1J8AA 5ABWA 4YT7H 1Y3UA 1BTXA 4NCYA 1CO7E 1ZPCA 2IJOB 3OU0A 4ZKSU 4MNXA 1MKWH 1VJAU 4RN6A 5A2MH 5EPYA 1FY5A 4HZHA 3B23B 2B7DH 1O30A 2FMJA 1DE7H 1ZHMA 2ODPA 3BEIB 4YZUA 1FNIA 2TIOA 3JZ2B 9ESTA 4MNVA 3E6PH 1VITH 4GAWA 1O31A 1Z71A 3M3TA 4WVPE 1SPJA 5E8EH 1ZRBA 5EQRA 4AFQA 4U2WA 1AN1E 1PQ7A 4X1SU 2CJIA 1GJCB 1BITA 3PB1E 3ZVEA 1UTJA 1FONA 1Z7KA 1QQUA 1FZZA 4U01A 1BJVA 5FXLA 5FBIA 3B9FH 2BXTH 2BHGA 2V35A 2QIQA 2HRVA 1YPHE 1EZQA 4K8BA 3GDVA 4KTUA 4CRCA 2ZC9H 3QUMP 2GTBA 2NU3E 1O2GH 1LMWB 1MTUA 2AGIX 5E0JA 1TOCB 2VWNA 2Z3CA 2GCHG 2BB4A 4FU7A 1SC8U 3H7TA 3LC5A 1DXWA 2PUXB 1Y59T 2CV3A 3PLPA 1TNIA 2D8WA 2FS9A 3RLYH 3H5CB 1PJPA 1NESE 1SLWB 3M3SA 2O8LA 3M7UA 1KLIH 1C5VA 1CSOE 2CMYA 1F0UA 3SHCH 1O3DA 8LPRA 5C5NA 1HDTH 2O9QA 1MTVA 4FUGA 1G2MA 1ZJKA 1CHOG 2PR3A 3M5NA 5FPSA 1QNJA 1EZUC 1YKTA 2VIQA 4E06H 3Q3XA 4BAKB 2FO9A 3SZNA 3A86A 4WF8A 2B9LA 1A0JA 1V2JT 3UFAA 2H9TH 2BD3A 4ABIA 3UUZA 2ZHQH 3DD2H 1C4Y2 3SW2B 3TH4H 2O8WA 2BM2A 3SGAE 1EKBB 1Q2WA 5I25A 1D6RA 1JRTA 4H6TA 1DSUA 3BG8A 3RXVA 2H2ZA 5LPRA 3P95A 1O3OA 1CGIE 2G55A 4FVDA 3C27B 3A7XA 4MDSA 3RXCA 1LVMA 1T8MA 2RDLA 1QRZA 4CBOA 4BXSA 3SU1A 1OXGA 2FI5E 2A7JA 4D7GA 3D49H 3PTBA 2ASUB 1F7ZA 2G4TA 5A8YA 1HAYB 4AX9H 3LC3A 1QURH 2IN2A 1E38B 1TYNA 1AFQC 1EJAA 2H5DA 2V0BA 4X8VH 1HAOH 1ZSLA 1A4WH 1Y5AT 1BBRE 4WJG2 4X2VA 4X0WU 2J38A 2JETC 3MHWU 4ZHAA 1T32A 3HATH 4XBCA 1OS8A 2UWPA 4CH2B 4X6PA 1T8NA 4FU8A 2HGTH 2F9PA 5HMAA 3TPIZ 1NRQH 4NA7A 1DICA 1SG8B 3ELAH 3DT0H 1OYQA 2JH6D 4AB9A 1BTHH 4X2YA 3LONA 1T8LA 3E3TA 1NFXA 4XOJA 1QCPA 1AFQB 1GDQA 1LQEA 3GDUA 4ZHLU 1KLJH 1C1WH 4K69A 1SGCA 1Q31A 2ULLA 3IG6B 1P05A 1SR5C 1BRBE 2P94A 5TJXA 3RXUA 2R0LA 4NIYA 1QL9A 1H8IH 3SQEE 1GMDF 3VGCB 2ZFPH 1WCZA 1F0TA 1WBGB 5SGAE 1Z8JB 1SGQE 2K1QA 3P92A 2G8TA 1AWFH 1BCUH 4ZKOU 1C1OA 1O39A 3AASA 1OWJA 1TE0A 2ZCLP 3UTUH 1Z1JA 2HPQH 3UNQA 4A92A 5J4SA 4NWKA 1HFDA 2BDAA 1NRNH 1TGBA 4B2CA 1CQQA 3UY9A 1K28D 3PROA 3ENSB 3AAVA 4SGBE 1J17T 3MYWA 3GOVB 8GCHF 3F68H 1P11E 3IWMA 1YCPK 1GGDB 2Q6GA 5LPFA 1P09A 2WV4A 1VZQH 4ZXXH 1GVZA 1TNKA 5LGOA 4ISLA 2AFQB 1L0ZA 1V2OT 2CF9H 1ZMJA 4R0IA 2PWXA 1O2QA 1EZXC 2Q6FA 1A3BH 1MTWA 3LH3A 3MFJA 2VNTA 4MPVA 1HBTH 3C1KA 1UVSH 2GV7A 1O5AB 2BD2A 3DUXH 3LOXA 4K1TA 4DY7B 3VPKA 2HNTE 4WMEA 2BVRH 2ZCKP 2GCTC 1NO9H 1YLCA 2BZ6H 2A5KA 1GHBG 1FPHH 1TNLA 3UR9A 1W13U 3TNSA 2ZDAH 4DT7B 1P12E 1WQSA 1W11U 3PLKA 1HCGA 5A0AE 2GD4B 4X2WA 2FX4A 5DP5A 2HVXA 1K1IA 1IOEA 5FCKA 4E05H 1MU6B 1O36A 1FN8A 1TIOA 2J34A 4A6LA 2OUAA 1BQYA 1GI9B 1DLEA 1NRRH 1OWIA 3F9GA 1GI0A 4B76A 2F91A 4TWYA 1HJAC 5TCAA 1O2IA 1PPBH 1GBJA 3ZZ4A 1C2JA 2H6MA 2ZEBA 4A1TA 4CR5A 1BRAA 2QXGA 1GI4A 4YESB 5HXFA 3S9BA 1KSNA 2ZU4A 4GVUA 1LKAA 1F5RA 1BT7A 2XNIA 4ABHA 1GHWH 2Y5FA 3LKWA 3TK9A 3SUFA 3T62A 1AKSA 4FUHA 1ESAA 2BOKA 1O5DH 2GDEH 3FVFB 2BVSH 1QHRB 2FYRA 2ZNKH 1D3TB 5C5OA 1VCWA 1MKXK 3MNBA 3CENA 4LK4A 2OC7A 1P2NA 2ZPQA 3W94A 4X6OA 3BV9B 1GJ9B 1KTTB 1HIAB 1HAVB 3A81A 1UCYH 2GT8A 2WV5A 2XCFA 1H9IE 4MG3A 4WH8A 1GJ5H 1PYTD 1EJNA 1TA2A 5AF9H 2UWLA 4O9VA 3VB5A 1MBMA 3VXEH 3MU5A 3NWUA 2WPKS 3TH2H 3Q76A 1MBQA 4O3UA 3FFGA 2SGAA 5C1UA 1HLTH 2VIPA 1SGPE 4AYYB 1AO5A 3FZDA 1GI5A 4NFEA 5DKMA 1UTKA 4Q7ZA 1B0EA 5FAHA 3LU9B 3P8GA 2Z3DA 3PMAB 4AB8A 1O2MA 4D8NA 2FESH 2FOCA 1O2VA 1V2LT 3VB6A 1GJ6A 3RU4T 2YNBA 4Q7XA 4D9QA 1MCVA 1GVKB 2FTLE 1EAXA 1ZOMA 2ZQ2A 1O5GH 1AHTH 2VVUA 5ESBA 4NIXA 3STIA 1K1JA 4DOQA 1DX5M 2Q1JA 1FN6A 4NA9H 4DIIH 1ZGVA 1W3CA 2BXUH 2ZHFH 1TOMH 4UE7H 4B73A 2ANWA 2A45B 3EDXB 3N7OA 4Y7BA 4ZKNU 1OYTH 1C5XB 4O03A 1H9HE 4TY7A 4AFZA 1S84A 4K3JA 1FDPA 4AN7A 4JYTA 1VR1H 4B2AA 1MKWK 5EU8A 3FP8E 4NWLA 1AKSB 2BTCE 2BQ6B 1DWBH 1CGJE 2CHAC 4X6MA 1GBMA 5B6OA 2OINA 4LOYH 5BPEA 1GJ4H 3KQDA 3ATWA 3SU0A 1QRXA 3A84A 4J1YA 3SJKA 4CHAB 4MVNA 1O5BB 4JZEH 2A4QA 5F8ZA 3UOPA 5GPIB 2FYQA 1MTNB 2TGTA 1MTSA 1C2EA 3ZYDA 2SNWA 3G01A 2ZDLA 2OQ5A 3RXQA 3SV2H 3VEQB 1FIZA 1Z8IB 5E0GA 1O2HA 2DUCA 5DG6A 3RLWH 1LPZB 1XUGA 3BTHE 1FUJA 2VWMA 2WPIS 2FS8A 3VB7A 2SGFE 2XRCA 1DWEH 1DITH 3UPEA 1A5HA 4BAOB 4JZFH 3U1JB 2WYGA 4BTTB 3GCTG 2VJ1A 3GY5A 1TQ0B 1JRSA 1W2KH 5EPNA 2Y80A 4E7RG 1SGRE 1P02A 1GVLA 2FOGA 3AVZA 3R0FA 3SUDA 1PPHE 4IS5A 1CT0E 2FOEA 2XBVA 1VGCB 4E7NA 3V13A 3RU4D 4B71A 1TPPA 2QA9E 2VIOA 1AVGH 1EPTC 2ZHDA 3EAJA 4FUJA 4IN2A 4H6SB 1P0SH 7GCHF 4MLFB 1ELGA 3NKKA 4ISOA 1DUAA 4WMFA 2BX4A 1MMJN 2NWNA 2UWOA 1IHTH 2VH0A 3MH5A 3P8OA 4FXGH 2ZGHA 2ZGJA 1IQHA 1NFUA 3V7TA 4PROA 4ZMAH 3DFLA 1PPZA 1A7SA 1EX3A 3SU4A 5AVDA 1C9TA 1V2MT 1C5PA 1DT2A 3JZ1B 4JYVH 1DWCH 2FODA 4OS5A 3O8DA 1GI2A 1O2TA 4JCNA 1UVTH 3FP6E 3CP7A 4CRFA 2XTTB 1FQ3A 2D2DA 1V2RT 1GBIA 5K0HA 1N6YA 2NU0E 2Y81A 3UR6A 2BDBA 5FPYA 4TWWA 2GZ9A 1AQ7A 3T25A 2FDAA 3ZZ5A 3TJVA 3KL6A 1MZDA 5DGJA 2P59A 4YOJA 1P3EA 2G52A 3M61U 1DLKB 2QC2A 1MZAA 1F0SA 4YTAA 1HV7A 2JETB 4FUDA 4OGXA 2ZDMA 2D1JA 3K9XB 2C8WB 2Y7ZA 1O34A 3B8JA 4O97A 5L6NH 2C8YB 1HXFH 4NFFA 3RXTA 1S81A 5EW2H 1GMHF 1CT2E 5DP9A 1BMAA 1TX7A 2P95A 1VCPA 4I7YH 1SQTA 2STAE 3ZZCA 1QGFA 3TH3H 4YM9A 3QGJA 4DG4A 1QRWA 4NIWA 3GCOA 4GCHG 2J9NA 2HPPH 4B75A 1XMNB 2ZP0H 3M7TA 4I8GA 2BD4A 3IITA 5C1XA 2R3UA 2Z9KA 1C5MD 4U30A 3OTJE 4TPYA 3A80A 1KTSB 3MH4A 3PO1B 5CE1A 2B8OH 5H4IB 3ATKA 1FY8E 3OY5U 1YF4A 3BIUH 2XBYA 3RDZA 3LGTA 2GX4A 2QF3A 2H5CA 5AHGH 4VGCB 4QT8C 1SB1H 3MWIU 2FXRA 5FHTA 2G5VA 2XBWA 3BTTE 3HPTB 2ZTYA 1G3EA 1ELVA 1YPLH 1IQIA 1MD7A 2XXLA 1P04A 1YCPH 2SFAA 3QX5H 4YO9A 3EYDA 3PM3A 3GCHC 1D3QB 5A09A 3GY7A 5DJ7A 5A0BA 5I46H 2YNAA 1ELTA 1U6QA 2ZFFH 1D3DB 3TJOA 5F6MA 1ELFA 1GCDA 2G5NA 5EXLA 1G2LA 1G3DA 1OWEA 3LGYA 3M5OA 3RC4A 2BY6X 1GMCF 2QYIA 3SNDA 2AMQA 4OS7A 1WQVH 2ANYA 2DE8A 3A8BA 1UO6A 3OYPA 3P6ZB 1BBRH 1RTFB 2GZ8A 4DCDA 2HALA 2NU2E 3TJNA 3PWBA 1HJ8A 1NFYA 4U32A 5DP6A 2UUJB 3PMHB 1BA8B 1NT1A 2ODQA 1WSSH 4ZKRU 3S7HB 1IHSH 1GBFA 1OOKB 1CHOF 5FX5A 3FP7E 4INLA 4K1EA 2CHAB 4JZIA 3F9EA 1S83A 2FLBH 3I78A 3F6UH 1L1NA 1XUIA 3F9HA 1UTPA 4KKDA 3ZZ6A 1K1PA 4DW2U 1W14U 4Y0ZE 3ZZ8A 2ODYB 3RU4E 3ZZAA 1B5GH 3A82A 3A87A 4UFGH 4HI3A 1GHAF 1FJSA 2ZGXH 2O8UA 1TRMA 2VVVA 3ZZ3A 1UTOA 1O3NA 1FV9A 1V2VT 1V2NT 4KP0A 1SLUB 3RXKA 1V3XA 1SLVB 3ATIA 5EXMA 1Q3XA 1DVAH 5JB9S 2UUYA 1P57B 3BTGE 2ZO3H 1K2I1 3R3GB 1GG6B 3BTEE 2BLWA 2NU4E 1XUKA 4CRAA 2VINA 3VGCC 4DURA 1G30B 2BLQA 2XC0A 5AFYH 3BTDE 1IQKA 3ZZ7A 2FIRH 4TY6A 2FOBA 1QL7A 3T2NA 2GKVE 2A5IA 3ESTA 1UCYK 3O8CA 3M5LA 4WXVA 2VH6A 2OBQA 1TX6A 2YOLA 3MOCA 1EZSC 1FIWA 1L4ZA 3SBKA 3LGIA 1E37B 6GCHF 1HYLA 2ZI2H 2P8OC 5EQQA 2EEKA 2GV6A 4B2BA 2AIQA 1AMHA 1P8VC 1KXCA 3DA9B 1GG6C 1C4U2 2A4GA 3MH7A 3U8OH 3V12A 2BMGB 1G9IE 4MTBA 4XBBA 4YT6H 2TRMA 4X1QU 4IW4E 1K22H 2WPJS 1PFXC 4CH8B 1EUFA 3SOSA 3TGIE 4ISHH 4X8SH 5LH8A 2C3SA 2ZF0H 3SJOA 3BSQA 1AZZA 2A2QH 4X1PU 4AORA 4I32A 4UDWH 2P93A 3RXMA 4WXIA 4Y79A 4YLQH 1BHXB 3UIRA 3NPSA 2BQWB 2AEIH 2ZFRH 1GHXH 1ORFA 1Y3XA 1O2LA 1N6XA 1W7XH 4ISIH 3M37A 3CS7A 4LXBH 5F03A 1O37A 4OS6A 3SORA 2HWLB 4NSVA 4K5ZA 1ZSJA 1ANDA 1TX8A 2Y6TA 1MAXA 3A7TA 4HTCH 2ZG0H 1Z8GA 2QN5T 3QTOH 4X8UH 1CA8B 1SOTA 3BEUA 1SGEE 1SMFE 3KQEA 2XWAA 2JH5D 2OP9A 3ITIA 1UJ1A 3SU5A 5FCRA 2ZDKA 1YPHC 1V2TT 3KIDU 3T5FH 2R2WU 3RXEA 2RA0A 1K1LA 2BY7X 4A1VA 1SGIB 4ZXYH 3RXSA 3RP2A 1L2EA 1UVUH 5K7RA 1FAKH 2BY9X 1NU7B 1CVWH 1X7AC 4ABBA 4NSYA 1SSXA 5A8XA 3SN8A 1THSH 1HPGA 1BTZA 1G36A 2Y5HA 1SLXB 2ZZUH 3PWCA 3OY6U 1WV7H 1Z6JH 3E91A 3K6ZA 1ELCA 3D23A 2IOTA 3VB4A 3EGKH 1W10U 2IPHA 1LHEH 1UVOA 1N1LA 5AFZH 1EQ9A 3SU3A 4MPXA 5HM2A 5C67A 2VIWA 4K2YA 1IQMA 1XX9A 1GMHG 2ESTE 5BRRE 1LKBA 1KIGH 1TNGA 1SFQB 3I77A 1AVXA 3BTQE 2PSYA 3AW0A 4BOHA 3GYLB 1IQLA 1QJ7B 3L3TA 3MMGA 1CBWC 5GJ4B 1O3HA 1O32A 3A8DA 2QV1A 2QXIA 2W7SA 1QB6A 3BTKE 1GBLA 2R0KA 1J15A 1AGJA 1XXFA 4UONA 3A8AA 2TGDA 1GDNA 2SNVA 1UCYE 2ZU1A 4CRDA 4K60A 2P8OB 1LCYA 1AWHB 1JXPA 2V3OH 1TFXA 2ZCHP 2TGAA 2F9UA 4BAQB 1ACBE 1OWHA 4IBLH 1C2MA 1ZHPA 1HJ9A 1FLEE 2GVFA 2UUFB 3ZYEA 1GI1A 1JWTA 2QCYA 2CF8H 1KLTA 1AI8H 1EOJA 2OC8A 4IMZA 4IGDA 1XVOA 3GDSA 2ZFQH 1ARBA 3HGNA 1GBDA 3P8FA 3VFEA 4I33A 2HLCA 1CGHA 1EASA 1JMOH 1P9UA 2B0FA 2ZU3A 1C4V2 1SBWA 1V6DA 1LDTT 3UWIA 1UTLM 1WYKA 1QY6A 4YOGA 1CA0C 1RIWB 1EAWA 1H4WA 1C5QA 1O2ZA 5IYTA 4Y8ZA 1GBTA 2SGDE 5T6DA 2C8ZB 4Z0KA 1TABE 2ZHEH 3TU7H 3M35A 7LPRA 2R3YA 5C2ZA 5DPAA 1HB0B 5L2YH 1O3LA 5TCCA 1VGCC 1GHBF 3BTWE 1LHGH 3M7QA 1C1UH 3TGJE 5JBTA 2PFEA 2OD3B 1OWDA 1W7GH 4XE4A 2OTVA 1QB9A 1GPZA 3FANA 1O3AA 2VWOA 2Z3EA 4DVAU 2D26C 2FX6A 2HOBA 2AGGX 3KN2A 1WAYB 4CBNA 1V2PT 2RA3A 1TA6A 1L1JA 1K21H 1T31A 2EA3A 2ZTXA 2QAAA 1MCTA 1P10A 1QA0A 2BZAA 5HYOA 1UK2A 3ODFA 1S85A 3GCHB 2O8MA 3P8NA 1HAPH 4GHTA 4YOIA 1BJUA 3E8LA 3QZQA 4IC5A 4Q7YA 3MNCA 1J14A 3RXBA 2BY8X 1D9IA 2VWLA 4MNWA 4UEHH 3SNBA 5A8ZA 3UQVA 3E1XB 2NU1E 1C1QA 3O8RA 4Y6DA 4Y71A 1EB2A 1PQ5A 4K1SA 1WOFA 2FI4E 1UHBB 1TWXB 1QBOA 4WWYA 2FLRH 1P2MA 2XC4A 1EB1H 1NU9A 3TGKE 4NIVA 2LPRA 3RXFA 3U8RH 4JK5A 1Y5UT 2PTCE 2PSXA 4INKA 4D9RA 4UFEH 1O3EA 1BRUP 2BDIA 4FVBA 4A1XA 5C20A 3Q77A 2ZECA 3QGNB 2F3CE 4X6NA 1S0QA 4CR9A 1AIXH 4GLYA 1MTNC 1ANEA 1KXEA 1TMTH 3MU8A 3FAOA 3QO6A 3RXIA 3UWJH 1FY4A 4MQAA 3T28A 1W12U 4JZDH 2F9BH 2JH0D 3NUMA 1RIWC 2PTNA 2A32A 2I6QA 6GCHG 3BG4B 4IN1A 2XYAA 2KAIA 2G4UA 1T7CA 1HAZB 3SJ8A 1O2NA 1YCPM 3GY8A 3BN9A 3RMLH 2ZU5A 3QK1A 1ZTJA 4OS1A 1TGTA 3CS0A 3MO9A 1BRCE 2WUCA 5FX6A 3RXHA 3KGPA 2PGBB 2ZGCA 4Z6AH 3TNTA 2R2MB 1HUTH 1GI3A 1BMLA 4FUBA 4I8HA 3TK5A 2ZGBH 1MD8A 7GCHG 3S69A 2W26A 1C5UA 4X2XA 1B0FA 1RXPA 1THRH 1TPAE 1UTQA 6ESTA 1O0DH 3A85A 3LGWA 1AB9B 4BTIB 1Y5BT 1ANCA 3SJ9A 2GP9B 2QY0B 4UFDH 1AB9C 1C2FA 1ZJDA 3SI4H 2CN0H 2J4IA 3S9CA 2Z9GA 1DSTA 1S0RA 1UMAH 5GIBA 3RXOA 3SNAA 2GT7A 1XUJA 1C2DA 1XKAC 2AIPA 2BD9A 2PKAA 3GY2A 3T27A 4ZAEA 3AAUA 3URDA 4D76A 4GPGA 1MH0A 3A88A 5T3HA 1Z8RA 2EC9H 1LO6A 3NCLA 1D6WA 1TALA 1VITF 1C1PA 1ZPBA 1SGTA 3GISB 3F9FA 3KNXA 1G3BA 2QXHA 1A0HB 1AUJA 3GICB 2WPMS 2P16A 3E0NB 1YC0A 2Q6DA 5JDUB 1HAGE 3PMJA 5PTPA 1RRKA 1TRYA 2F9OA 1NY22 2W3IA 1BZXE 1K1OA 1AZ8A 1YPJH 3QWCH 1KYNA 1SQAA 1V2UT 1GDUA 3LH1A 3QZRA 1O5FH 3TLOA 2OCVB 4OGYA 3ZVCA 1HIAA 1O35A 3AW1A 1BUIA 4A7IB 4THNH 1GBCA 1GWAA 1TBZH 1XM1A 1WU1A 1P2JA 2ALPA 1GI6A 5DP7A 2Z9IA 4I8KA 1VCQA 1SHHB 3EA9A 3MO3A 1CT4E 1E0FD 1PPFE 1O2RA 2ZIQH 3SO3A 2WUBA 4DIHH 3A7ZA 5FBEA 1MQ6A 2M5TA 2AYWA 2BDHA 2ZDVH 3OSYA 1P9SA 1C5TA 3DHKH 1S6FA 3ATMA 1SI5H 2ZA5A 1ABIH 1P2QA 1ZYOA 3HK3B 1P06A 1XUHA 1E34B 3ZVGA 2AMDA 3OX7U 3BTME 1SGFG 1J16A 1KY9A 1NM6A 1K1MA 2P3FH 1PPEE 4ABEA 1EAUA 1S5SA 2ZKSA 2FI3E 1G32B 1V2KT 4J2YB 1ZPZA 3MH6A 5CMXH 1MUEB 1GGDC 1GHVH 2VVCA 1O3BA 4OS2A 2EI7A 2FTMA 1KXFA 1HNEE 4CRBA 5L2ZH 2ANMH 2ZTZA 3PYHA 2ZPSA 1O2SA 1O3PB 1C5NH 3LDXH 3EA7A 1XXDA 3NZIA 2AGEX 1AD8H 1EP5A 2W3KA 2R9PA 1GHZA 1DY8A 2XBXA 1PPGE 4Y76A 1RTLA 1TGSZ 1AE8H 1FAXA 2THFB 1THPB 2VU8E 5LPEA 3S7KB 1QR3E 2C90B 1YLDA 1ZTKA 1H8DH 3BIVH 1SOZA 3SU2A 3RMMH 3MNXA 1VJ9U 5EOKA 4AYVB 1WUNH 2FP7B 3MNSA 4UD9H 1GCTB 2A7CA 3SNCA 3GY4A 1LPGB 5CHAB 1P3CA 3QLPH 2FM2A 2FPZA 1KXBA 2F9NA 3A7YA 1VITG 1TGCA 2A31A 4GCHF 1O2OA 3DFJA 1WTGH 1LHDH 2A2XH 1JOUB 1IAUA 1BTWA 1ZLRA 4ASHA 1H9LB 1GJDB 2FOMB 1C1SA 2A7HA 5DP3A 1T8OA 4WMDA 4IC6A 3RXLA 3A89A 4KGAA 1O5CB 2XC5A 3HKIB 1F2SE 1GMDG 2AH4X 4SGAE 1QBNA 1UTMA 4RKOB 3TJUA 5A0CA 2TGPZ 5JBCS 1K1NA 4ZROA 1M9UA 2XCNA 1D4PB 3K2UA 7ESTE 1FXYA 1PYTC 4HFPB 4MNYA 3BEFB 4GUXA 3RUOA 4BNRA 1O3IA 2BD7A 2J2UA 2JKHA 4YLUA 3SUEA 1NS3A 1GBKA 1CE5A 3SGQE 3RC5A 2BY5X 1IQFA 3L33A 3K65B 1UHBA 5G4BA 4ESTE 1C1VH 4ABDA 1FY1A 2BVXH 5E2OA 4ABJA 4Q2KA 2Z6BD 1O2WA 4Y11E 1C2HA 1NTPA 1P2OA 3M3VA 4JZ1A 3GCTF 1OKXA 1A61H 1HXEH 3MTYA 1C5ZB 3PLBA 1ZMNA 2BQ7B 3SQHE 3MU0A 1AFEH 2VIDA 2W7UA 3PTNA 1TPOA 2QF0A 3SNEA 1O5EH 1NRSH 1ZGIA 5DK1A 1OPHB 2QXJA 2A5AA 2BDCA 1XKBC 2OLGA 2OBOA 2H9HA 3RC6A 1OP0A 4A5TS 4R8TB 4B1TA 1KXDA 1ARCA 1Y8TA 1QJ1B 1IQJA 1DXPA 3K6YA 1C2IA 3UNRA 1OP8A 1GBEA 2C8XB 4Y0YE 3SHAH 5E0HA 1AVWA 1ZR0A 1O2PA 1O3FA 3U1IB 2AERH 1TNHA 5EW1H 5HGGA 1DS2E 3EQ0H 2Y7XA 2PLXA 1SFIA 1O3MA 1A1RA 3RXGA 1SVPA 1YYY1 3ZZ9A 1F0RA 1HAHH 1W8BH 2J94A 1C5WB 2BDGA 1QA7A 5F8TA 1EP6A 5EXNA 1A5GH 4FUIA 2ZHWH 4INHA 3HK6B 4AFUA 1N8OB 3TITA 1GHYH 4I8LA 4FU9A 1G37A 3ZVBA 2O8TA 5EG4A 2WPHS 1T4VH 1O2JA 2G00A 1C5LH 1GCTC 2V3HH 1QFKH 1H1BA 1SHYA 7KMEH 5C1YA 1NZQH 2FEQH 4GHQA 1HAIH 2Z9LA 1JBUH 5GXPA 1MKXH 1EXFA 5GDSH 1QQ4A 1GJ8B 2FZZA 2GCHF 4KTCA 3L6PA 5E2PA 1PQAA 4BTUB 2H1UA 3MU4A 1YP9A 3HKJB 4I31A 1Y3YA 2BD8A 3GY3A 4FUFA 2PHBA 3V0XA 4GSOA 4O3TA 1BMMH 4AG2A 3UREA 4DJZB 4ZUHA 1ETTH 4FUCA 3SJIA 5EODA 2ZWLH 3RMNH 4ABGA 1QJ6B 8GCHG 1LVBA 2ANKH 1EJMA 2WYJA 1TAWA 3SV8A 1QBVH 1CU1A 3RXJA 1NFWA 2B5TB 1XUFA 1DOJA 3A7VA 1S82A 4F4OC 2XW9A 4AG1A 3QDZB 4MPWA 3TVJB 4ABAA 1IQNA 1P2KA 4NZLA 3SGBE 4AZ2B 1BTUA 1J9CH 5EQSA 3ZZDA 4RSPA 4AFSA 3NXPA 1A46H 5IDKA 5CHAC 1C5YB 4XBDA 3URCA 3VXFH 3UOUA 3KF2A 1GL1A 1ELEE 1UK3A 1TBRH 2BLVA 4BAMB 3VB3A 2WPLS 1EAIA 2ZFSA 1E35B 2SGEE 3E90B 1YPMH 1L4DA 1ELAA 1YPKH 3LGUA 1GI8B 3BTFE 1ZTLA 1AUTC 1RFNA 4Y8XA 1P2IA 2EI8A 1C1RA 3E16B 3D65E 2PGQB 1N8OC 3WY8A 2OC1A 2P3TB 2ZFTA 4AOQA 3UNSA 4TPIZ 3Q3YA 3LGVA 2SGPE 1E36B 1FI8A 1OWKA 2F9VA 3PMBB 3TIUA 1P03A 2ZU2A 3ZV8A 4ABFA 1OP2A 1PQ8A 1LHCH 2Y5GA 3T26A 4KTSA 4I8JA 4RKJB 1EATA 1TNJA 3RXDA 1W0YH 5F8XA 2BOHB 1CHGA 3UQOA 4ZHMU 1O2YA 1TBQH 3TK6A 2VGCB 8ESTE 1F5KU 2F83A 2SGQE 1ZZZA 4CHAC 2BD5A 1BTPA 4NZQA 1O38A 1DWDH 1C2GA 1QTFA 2PKAB 1BBRK 1GI7B 1UK4A 1Y3VA 1A3EH 4TYDA 6LPRA 2PV9B 1C5OH 3SUGA 5EGMA 1TONA 2GZ7A 4JMYA 1ETSH 2PKSC 2ZPRA 8KME2 1MAYA 1SGYE 5JYIA 1ZSKA 1AU8A 4VGCC 5JPMH 2TPIZ 3RM2H 1O3CA 1BHXF 4DGJA 4H42U 3ZZBA 5GWZA 2Y82A 1JIRA 3KQCA 6CHAB 2BLOA 1OSSA 2OQUA 4Y7AA 2OC0A 2J92A 1TRNA 2Z94A 2W5EA 3PO1C 1LPKB 2H9EH 4X1NU 2G81E 1GJBB 2J95A 1GJ7B 5DP8A 4Y8YA 4F49A 3U9AH 1ANBA 2STBE 1GBBA 3FZZA 2FOAA 3NK8A 3LPRA 4OS4A 2P3UB 1DPOA 1RJXB 3MO6A 1SGDE 2A4RA 2EI6A 3KHVA 1ETRH 4BAHB 1P01A 2I6SA 1ELBA 1BOQA 4BXWA 1TPSA 1SQOA 2GMTB 4JYUH 1O3JA 2A4OA 1HAVA 1NPMA 1V2QT 1IQEA 1DANH 1RD3B 1SGFA 1C9PA 1NN6A 3I29A 3KEEA 2Z7FE 2C4FH 1QIXB 4HGCA 1ESBA 3RXAA 1ABJH 5ETXA 2VB0A 4Y10E 2A1DB 1AE5A 1MQ5A 4WH6A 1TQ7B 1QL8A 1RS0A 1GHAG 1BIOA 1KDQB 1K9OE 3KQBA 1BTYA 2FOFA 3MU1A 9LPRA 1C2LA 2ILNA 1IQGA 1FMGA 1BMNH 1T4UH 4NG9H 3A8CA 4KELA 5T6GA
chains in the Genus database with same CATH superfamily
5JBAS 4Q80A 1GJAB 3ZVDA 2PKSB 1EPTA 2WINI 3ZVFA 4JK6A 1PPCE 1LVYA 1EOLA 5T6FA 3SI3H 5HM9A 2QGRA 1NROH 1KDQA 6CHAC 2RG3A 3LT3A 1GBAA 3BG4C 1HAXB 2FOHA 3LIWA 3H7OA 3ZV9A 1UVPA 4FUEA 1L1GA 1LVOA 3BF6H 1JIMA 1W0ZU 2K0QA 4H4FA 3A83A 3F1SB 3S9AA 1SGNE 4NA8A 1EPTB 1O2UA 5ESTE 1KXAA 2ZQ1A 1RGQA 1QB1A 1WXRA 5J4QA 2WHXA 3P17H 4AGKA 3A7WA 2AMPA 4K8YA 1DUEA 1YM0A 3EA8A 3W95A 3ODDA 2GCTB 3V3MA 1HJAB 1V2ST 2EQNA 2FWWA 5JB8S 3O8BA 4XSKU 1TLDA 2C93B 5JBBS 3T29A 3OFND 1A2CH 1ZMLA 3GCNA 4XDEA 4ZH8A 2HNTF 3U98H 5DP4A 2J5UA 1A0LA 2DE9A 1DY9A 2TBSA 1V2WT 3U8TH 1ZRKA 2BDYA 1FPCH 1O33A 5FPTA 3SV9A 1B7XB 5FL7D 1S6HA 1D3PB 1O2KA 2GDDA 1HGTH 4X1RU 4X8TH 1YPEH 1NC6A 5GCHG 1O3GA 3U69H 1WTHD 1NRPH 1UW7A 3GYMA 1ZHRA 4MPUA 4BANB 2YMSC 1A5IA 3HGPA 4NGAH 1F5LA 1GBHA 1O3KA 5B6LA 1SQRA 3KYGA 1ESTA 2VGCC 1GMCG 2RCEA 3STJA 1TMUH 3QTVH 3S0NA 3ATLA 4B74A 3P70B 1Z1IA 3SV7A 1GL0E 1YPGH 2CXVA 4M7GA 1G3CA 4LZ4B 5GCHF 4LZ1H 2ALVA 3M36A 4D7FA 3SV6A 1Z6EA 2CGAA 1C1MA 3D62A 3QN7A 4XFQA 1YWUA 4AGJA 2KAIB 1FY3A 5C17A 1LHFH 2BYAX 3PV4A 3GY6A 2A0QB 1LQDB 1C5SA 2XWBI 2PUQH 3RXPA 3LJJA 1SL3A 4CRGA 1OX1A 3MI4A 1HRTH 1CBWB 2G51A 1YBWA 1DFPA 3Q00A 3RXRA 1Y3WA 1INCA 3E0PB 1CA0B 1C1TA 1ID5H 1TB6H 3RMOH 2LNCA 4WY3A 1ELDE 1DM4B 1RTKA 3Q3KA 1TGNA 2Z9JA 1C2KA 1C5RA 2VIVA 4ISNA 1LTOA 2BX3A 2HNTC 2GGVB 3M5MA 1UTNA 4UFFH 2AHME 1XVMA 3FOAA 1AY6H 4CREA 1C1NA 2ZDNA 1BDAA 1O2XA 3SU6A 1F92A 3EE0B 4IMQA 2V6NA 1YGCH 1MU8B 1DDJA 3KYFA 3LJOA 2GMTC 3ZVAA 3KCGH 5DO4H 5C3NA 1TMBH 2PW8H 2OXSA 2AS9A 5L30H 1BB0B 3RM0H 2UUKB 1J8AA 5ABWA 4YT7H 1Y3UA 1BTXA 4NCYA 1CO7E 1ZPCA 2IJOB 3OU0A 4ZKSU 4MNXA 1MKWH 1VJAU 4RN6A 5A2MH 5EPYA 1FY5A 4HZHA 3B23B 2B7DH 1O30A 2FMJA 3F2FA 1DE7H 1ZHMA 2ODPA 3BEIB 4YZUA 1FNIA 2TIOA 3JZ2B 9ESTA 4MNVA 3E6PH 1VITH 4GAWA 1O31A 1Z71A 3M3TA 4WVPE 1SPJA 5E8EH 1ZRBA 5EQRA 4AFQA 4U2WA 1AN1E 1PQ7A 4X1SU 2CJIA 3WWBA 1GJCB 1BITA 1BMFD 3PB1E 3ZVEA 1UTJA 1FONA 1Z7KA 1QQUA 1FZZA 4U01A 1BJVA 5FXLA 5FBIA 3B9FH 2BXTH 2BHGA 2V35A 2QIQA 3MQKC 2HRVA 1YPHE 1EZQA 4K8BA 3GDVA 4KTUA 5KECA 4CRCA 2ZC9H 3QUMP 2GTBA 2NU3E 1O2GH 1LMWB 1MTUA 2AGIX 5E0JA 1TOCB 2VWNA 2Z3CA 2GCHG 1K0HA 2BB4A 4FU7A 4AC9A 1SC8U 3H7TA 3LC5A 1DXWA 2PUXB 1Y59T 2CV3A 3PLPA 1TNIA 2D8WA 2FS9A 3RLYH 3H5CB 1PJPA 1NESE 1SLWB 3M3SA 2O8LA 3M7UA 1KLIH 1C5VA 1CSOE 2CMYA 1F0UA 3SHCH 1O3DA 8LPRA 5EIYA 5C5NA 1HDTH 2O9QA 1MTVA 4FUGA 1G2MA 1ZJKA 5DSFA 1CHOG 2PR3A 3M5NA 5FPSA 1QNJA 3UAIC 1EZUC 1YKTA 4RT0A 2VIQA 4E06H 3Q3XA 4BAKB 2FO9A 3SZNA 3A86A 4WF8A 2B9LA 1A0JA 1V2JT 3UFAA 2H9TH 2BD3A 4ABIA 3UUZA 5HIYA 2ZHQH 3DD2H 1C4Y2 3SW2B 3TH4H 2O8WA 3DSGA 2BM2A 3SGAE 1EKBB 1Q2WA 5I25A 1D6RA 2CK3D 1JRTA 4H6TA 1DSUA 3BG8A 3RXVA 2H2ZA 5LPRA 3P95A 3GS9A 1O3OA 1CGIE 2G55A 4FVDA 3C27B 3A7XA 4MDSA 3RXCA 1LVMA 1T8MA 2RDLA 1QRZA 4CBOA 4BXSA 3SU1A 3OAAD 5C0TA 1OXGA 2FI5E 2A7JA 4D7GA 3D49H 3PTBA 2ASUB 1F7ZA 2G4TA 5A8YA 1HAYB 4AX9H 3LC3A 1QURH 2IN2A 1E38B 1TYNA 1AFQC 1EJAA 2V0BA 1QZ8A 2H5DA 4X8VH 1HAOH 1ZSLA 1A4WH 1Y5AT 1BBRE 4WJG2 4X2VA 4X0WU 2J38A 2JETC 3MHWU 4ZHAA 1T32A 3HATH 4XBCA 1OS8A 4TSFD 2UWPA 4CH2B 4X6PA 1T8NA 4FU8A 2HGTH 2F9PA 5HMAA 3TPIZ 1NRQH 4NA7A 1DICA 1SG8B 3ELAH 3DT0H 1OYQA 2JH6D 4AB9A 1BTHH 4X2YA 3LONA 1T8LA 3E3TA 1NFXA 4XOJA 1QCPA 1AFQB 1GDQA 1LQEA 2WZQA 3GDUA 2KZ4A 4ZHLU 1KLJH 1C1WH 4K69A 1SGCA 1Q31A 2ULLA 3IG6B 1P05A 1SR5C 1BRBE 2P94A 2KR7A 5TJXA 3RXUA 2R0LA 4NIYA 1QL9A 4XD7D 1H8IH 3SQEE 1GMDF 3VGCB 2ZFPH 1WCZA 1F0TA 1WBGB 5SGAE 1Z8JB 1SGQE 2K1QA 3P92A 2G8TA 1AWFH 1BCUH 4ZKOU 1C1OA 1O39A 3AASA 1OWJA 1TE0A 2ZCLP 3UTUH 1Z1JA 2HPQH 3UNQA 4A92A 5J4SA 4NWKA 1HFDA 3F2HA 2BDAA 1NRNH 1TGBA 4B2CA 1CQQA 3UY9A 2GJGA 1K28D 2QF4A 3PROA 3ENSB 3AAVA 4SGBE 1J17T 3MYWA 3GOVB 8GCHF 3F68H 1P11E 3IWMA 1YCPK 1GGDB 2Q6GA 5LPFA 1OHHD 1P09A 2WV4A 1VZQH 4ZXXH 1GVZA 1TNKA 5LGOA 4ISLA 2AFQB 1L0ZA 1V2OT 2CF9H 1ZMJA 4R0IA 2PWXA 1O2QA 1EZXC 2Q6FA 1A3BH 1MTWA 4I86A 3LH3A 3MFJA 2VNTA 4MPVA 1HBTH 3C1KA 1UVSH 2GV7A 1O5AB 2BD2A 3DUXH 3LOXA 4K1TA 4DY7B 3VPKA 2HNTE 4WMEA 2BVRH 2ZCKP 1SKYE 2GCTC 1NO9H 1YLCA 2BZ6H 2A5KA 1GHBG 1FPHH 1TNLA 3UR9A 1W13U 3TNSA 2ZDAH 4DT7B 3NRLA 1P12E 1WQSA 1W11U 5EJ1A 3PLKA 1HCGA 5A0AE 2GD4B 4X2WA 2FX4A 5DP5A 2HVXA 1K1IA 1IOEA 5FCKA 4E05H 1MU6B 1O36A 1FN8A 1TIOA 2J34A 2WV9A 4A6LA 2OUAA 1BQYA 1GI9B 1DLEA 1NRRH 1OWIA 3F9GA 1GI0A 4B76A 2F91A 4TWYA 1HJAC 5TCAA 1O2IA 1PPBH 1GBJA 3ZZ4A 1C2JA 2H6MA 2ZEBA 4HG6A 4A1TA 4CR5A 1BRAA 2QXGA 1GI4A 3CNRA 4YESB 5HXFA 3S9BA 1KSNA 2ZU4A 4GVUA 1LKAA 1F5RA 1BT7A 2XNIA 4ABHA 1GHWH 2Y5FA 3LKWA 3TK9A 3SUFA 3T62A 1AKSA 4FUHA 1ESAA 2BOKA 1O5DH 2GDEH 3FVFB 2BVSH 1QHRB 2FYRA 2ZNKH 2QE7D 1D3TB 2W6JD 1VCWA 5C5OA 1MKXK 3MNBA 3CENA 4LK4A 5IK2D 2OC7A 1P2NA 2ZPQA 3W94A 4X6OA 3BV9B 1GJ9B 1KTTB 1HIAB 1HAVB 3A81A 1UCYH 2GT8A 2WV5A 2XCFA 1H9IE 4MG3A 4WH8A 1GJ5H 1PYTD 1EJNA 1TA2A 5AF9H 2UWLA 4O9VA 3VB5A 1MBMA 3VXEH 3MU5A 3NWUA 2EY4C 2WPKS 3TH2H 3Q76A 1MBQA 4O3UA 3FFGA 2SGAA 5C1UA 1HLTH 2VIPA 1SGPE 4AYYB 1AO5A 3FZDA 1GI5A 4NFEA 5DKMA 1UTKA 4Q7ZA 1B0EA 5FAHA 3LU9B 3P8GA 2Z3DA 3PMAB 4AB8A 1O2MA 4D8NA 2FESH 2FOCA 1O2VA 1V2LT 3VB6A 1GJ6A 3RU4T 2YNBA 4Q7XA 4D9QA 1MCVA 1GVKB 1H8ED 2FTLE 1EAXA 1ZOMA 2ZQ2A 1O5GH 1AHTH 2VVUA 5ESBA 4NIXA 3STIA 1K1JA 4DOQA 1DX5M 2Q1JA 1FN6A 4NA9H 4DIIH 1ZGVA 3OEHD 1W3CA 2BXUH 2ZHFH 1TOMH 4UE7H 4B73A 2ANWA 3EE7A 2A45B 3EDXB 3N7OA 4Y7BA 4ZKNU 1OYTH 1C5XB 4O03A 1H9HE 4TY7A 4AFZA 1S84A 4K3JA 1FDPA 4AN7A 4JYTA 1VR1H 4B2AA 1MKWK 5EU8A 3FP8E 4FOUC 1S6LA 4NWLA 1AKSB 2BTCE 2BQ6B 1DWBH 1CGJE 2CHAC 4X6MA 1GBMA 5B6OA 2OINA 4LOYH 2L6OA 5BPEA 1GJ4H 3KQDA 3ATWA 3SU0A 1QRXA 3A84A 4J1YA 3SJKA 4CHAB 4MVNA 1O5BB 4JZEH 2JIZD 2A4QA 5F8ZA 3UOPA 5GPIB 3U28C 2FYQA 1MTNB 2TGTA 4ZCNA 1MTSA 1C2EA 3ZYDA 2SNWA 3G01A 1YY3A 2ZDLA 2OQ5A 3RXQA 5CDFE 3SV2H 3VEQB 1FIZA 1Z8IB 5E0GA 2PP6A 1O2HA 1W0JD 2DUCA 5DG6A 3RLWH 4YXWD 1LPZB 1XUGA 3BTHE 1FUJA 2VWMA 3OEED 2WPIS 2FS8A 3VB7A 2SGFE 2XRCA 1DWEH 1DITH 3UPEA 1A5HA 2YMSB 4BAOB 4JZFH 3U1JB 2WYGA 4BTTB 3GCTG 2VJ1A 3GY5A 1TQ0B 1JRSA 1W2KH 5EPNA 2Y80A 4E7RG 1SGRE 1P02A 1GVLA 2FOGA 3AVZA 3R0FA 3SUDA 1PPHE 4IS5A 1CT0E 2FOEA 2XBVA 1VGCB 4E7NA 3V13A 3RU4D 4B71A 1TPPA 2QA9E 2VIOA 1AVGH 1EPTC 2ZHDA 3EAJA 4FUJA 4IN2A 4H6SB 1P0SH 7GCHF 4MLFB 1ELGA 3NKKA 4ISOA 1DUAA 4WMFA 2BX4A 1MMJN 2NWNA 2UWOA 1IHTH 2VH0A 3MH5A 3P8OA 4FXGH 4B6EA 2ZGHA 2ZGJA 1IQHA 1NFUA 3V7TA 4PROA 4ZMAH 3DFLA 1PPZA 1A7SA 1EX3A 3SU4A 5AVDA 1C9TA 1V2MT 1C5PA 1DT2A 3JZ1B 4JYVH 1DWCH 2FODA 4OS5A 3O8DA 1GI2A 1O2TA 4JCNA 1UVTH 3FP6E 3CP7A 4CRFA 2XTTB 1FQ3A 2D2DA 1V2RT 1GBIA 5K0HA 1N6YA 2NU0E 2Y81A 3UR6A 2BDBA 5FPYA 4TWWA 1E79D 2GZ9A 1AQ7A 3T25A 2J97A 2QF5A 2FDAA 3ZZ5A 3TJVA 3KL6A 1MZDA 5DGJA 2P59A 4YOJA 1P3EA 2G52A 3M61U 1DLKB 2QC2A 1MZAA 1F0SA 4YTAA 1HV7A 2JETB 4FUDA 4OGXA 2ZDMA 2D1JA 3K9XB 1W0KD 2C8WB 2Y7ZA 1O34A 3B8JA 4O97A 5L6NH 2C8YB 1HXFH 4NFFA 3RXTA 1S81A 5EW2H 1GMHF 1CT2E 5DP9A 1BMAA 1TX7A 2P95A 1VCPA 4I7YH 1SQTA 4M9FA 2STAE 3ZZCA 1QGFA 3TH3H 4YM9A 3QGJA 4DG4A 1QRWA 4NIWA 3GCOA 4GCHG 2J9NA 2HPPH 4B75A 2J98A 1XMNB 3KQ5A 2ZP0H 3M7TA 4I8GA 2BD4A 3IITA 5C1XA 2R3UA 2Z9KA 1C5MD 4U30A 3OTJE 4TPYA 3A80A 1KTSB 3MH4A 3PO1B 3FO8D 5CE1A 2B8OH 5C94A 5H4IB 3ATKA 1FY8E 3OY5U 1YF4A 3BIUH 2XBYA 3RDZA 3LGTA 2GX4A 2QF3A 2H5CA 5AHGH 4VGCB 4QT8C 1SB1H 3MWIU 2FXRA 5FHTA 2G5VA 2XBWA 3BTTE 3HPTB 2ZTYA 1G3EA 1ELVA 1YPLH 1IQIA 1MD7A 2XXLA 1P04A 3FKSD 1YCPH 2SFAA 3QX5H 4YO9A 3EYDA 3PM3A 3GCHC 1D3QB 2F43B 5A09A 3GY7A 5DJ7A 5A0BA 5I46H 2YNAA 1ELTA 1U6QA 2ZFFH 1D3DB 3TJOA 5F6MA 1ELFA 1GCDA 2G5NA 5EXLA 1G2LA 1G3DA 1OWEA 3LGYA 3M5OA 3RC4A 2BY6X 1GMCF 2QYIA 3SNDA 2AMQA 4OS7A 1WQVH 2ANYA 2DE8A 3A8BA 1UO6A 3OYPA 3P6ZB 1BBRH 1RTFB 2GZ8A 4DCDA 2HALA 2NU2E 3TJNA 3PWBA 1HJ8A 1NFYA 4U32A 5DP6A 2UUJB 3PMHB 1BA8B 1EFRD 1NT1A 2ODQA 1WSSH 4ZKRU 3S7HB 1IHSH 1GBFA 1OOKB 1CHOF 5FX5A 3FP7E 4INLA 4XRNA 4K1EA 2CHAB 4JZIA 3F9EA 1S83A 2FLBH 3I78A 3F6UH 1L1NA 1XUIA 3F9HA 1UTPA 4KKDA 3ZZ6A 1K1PA 4DW2U 1W14U 4Y0ZE 3ZZ8A 2ODYB 3RU4E 3ZZAA 2WPDD 1B5GH 3A82A 3A87A 4UFGH 4HI3A 1GHAF 1FJSA 2ZGXH 2O8UA 1TRMA 2VVVA 3ZZ3A 1UTOA 1O3NA 1YLNA 5C0UA 1FV9A 1V2VT 1V2NT 4KP0A 1SLUB 3RXKA 1V3XA 1SLVB 3ATIA 5EXMA 4Q4LA 1Q3XA 1DVAH 5JB9S 2UUYA 1P57B 3BTGE 2ZO3H 1K2I1 3R3GB 1GG6B 3BTEE 2BLWA 2NU4E 1XUKA 4CRAA 2VINA 3VGCC 4DURA 1H8HD 1G30B 2BLQA 2XC0A 5AFYH 3BTDE 1IQKA 1KMHB 3ZZ7A 2FIRH 2M2AA 4TY6A 2FOBA 1QL7A 3T2NA 2GKVE 2A5IA 3ESTA 1UCYK 3O8CA 3M5LA 4WXVA 2VH6A 2OBQA 1TX6A 2YOLA 3MOCA 1EZSC 1FIWA 1L4ZA 3SBKA 3LGIA 4B6FA 1E37B 6GCHF 1HYLA 2ZI2H 2P8OC 5EQQA 2EEKA 2GV6A 4B2BA 2AIQA 1AMHA 3H09A 1P8VC 1KXCA 3DA9B 1GG6C 1C4U2 2A4GA 3MH7A 3U8OH 3V12A 2BMGB 1G9IE 4MTBA 4XBBA 4YT6H 2TRMA 4X1QU 4IW4E 1K22H 2WPJS 1PFXC 4CH8B 4TT3D 1EUFA 3SOSA 3TGIE 4ISHH 4X8SH 2LELA 5LH8A 2C3SA 2ZF0H 3SJOA 3BSQA 1AZZA 2A2QH 4X1PU 4AORA 4I32A 4UDWH 2P93A 3RXMA 4WXIA 4Y79A 4YLQH 1BHXB 3UIRA 3NPSA 2BQWB 2AEIH 2ZFRH 1GHXH 1ORFA 5T1VA 1Y3XA 1O2LA 1N6XA 1W7XH 4ISIH 3M37A 3CS7A 4LXBH 5F03A 1O37A 2V3MA 4OS6A 3SORA 2HWLB 4NSVA 4K5ZA 1ZSJA 1ANDA 1TX8A 3ZIAD 2Y6TA 1MAXA 3A7TA 4HTCH 2ZG0H 1Z8GA 2QN5T 3QTOH 4X8UH 1CA8B 1SOTA 5EJLA 3BEUA 1SGEE 1SMFE 3KQEA 2XWAA 2JH5D 2OP9A 3ITIA 1UJ1A 3SU5A 5FCRA 2ZDKA 1YPHC 1V2TT 3KIDU 3T5FH 2R2WU 3RXEA 2RA0A 1K1LA 2BY7X 2XNDD 4A1VA 1SGIB 4ZXYH 3RXSA 3RP2A 1L2EA 3WWFA 1UVUH 5K7RA 1FAKH 2BY9X 1NU7B 1CVWH 1X7AC 4ABBA 4NSYA 1SSXA 5A8XA 3SN8A 1THSH 1HPGA 1BTZA 1G36A 2Y5HA 1SLXB 2ZZUH 3PWCA 4ASUD 3OY6U 1WV7H 1Z6JH 3E91A 3K6ZA 1ELCA 3D23A 2IOTA 3VB4A 3EGKH 3F0PA 1W10U 1E1RD 2IPHA 1LHEH 1UVOA 1N1LA 5AFZH 1EQ9A 3SU3A 4MPXA 5HM2A 5C67A 2VIWA 4K2YA 1IQMA 1XX9A 1GMHG 2ESTE 5BRRE 1LKBA 1KIGH 1TNGA 1SFQB 3I77A 1AVXA 3BTQE 2PSYA 3AW0A 4BOHA 3GYLB 1IQLA 1QJ7B 3L3TA 3MMGA 1CBWC 5GJ4B 1O3HA 1O32A 3A8DA 2QV1A 2QXIA 2W7SA 1QB6A 3BTKE 5CHBA 1GBLA 2J98B 2R0KA 1J15A 1AGJA 1XXFA 4UONA 3A8AA 2TGDA 1GDNA 2SNVA 1UCYE 2ZU1A 4CRDA 4K60A 2P8OB 1LCYA 1AWHB 1JXPA 2RFKC 2V3OH 1TFXA 2ZCHP 2TGAA 4Z1MD 2F9UA 4BAQB 1ACBE 1OWHA 4IBLH 1C2MA 1ZHPA 1HJ9A 1FLEE 2GVFA 2UUFB 3ZYEA 1GI1A 1JWTA 2QCYA 2CF8H 1KLTA 1AI8H 1EOJA 2OC8A 4IMZA 4IGDA 1XVOA 3GDSA 2ZFQH 1ARBA 3HGNA 1GBDA 3P8FA 3VFEA 4ACBA 4I33A 2HLCA 1CGHA 1EASA 1JMOH 1P9UA 2B0FA 2ZU3A 1C4V2 1SBWA 1V6DA 1E1QD 1LDTT 3UWIA 1UTLM 1WYKA 1QY6A 4YOGA 1CA0C 5DN6D 1RIWB 1EAWA 1H4WA 1C5QA 1O2ZA 5IYTA 4Y8ZA 2L74A 1GBTA 2SGDE 5T6DA 2C8ZB 4Z0KA 1TABE 2ZHEH 3TU7H 3VG8A 3M35A 7LPRA 2R3YA 5C2ZA 5DPAA 1HB0B 5L2YH 1O3LA 3N7DA 5TCCA 1VGCC 1GHBF 3BTWE 1LHGH 3M7QA 1C1UH 3TGJE 5JBTA 2PFEA 2OD3B 1OWDA 1W7GH 4XE4A 2OTVA 1QB9A 1GPZA 4RT1A 3FANA 1O3AA 2VWOA 2Z3EA 4DVAU 2D26C 2FX6A 2HOBA 2AGGX 3KN2A 1WAYB 4CBNA 1V2PT 2RA3A 1TA6A 1L1JA 1K21H 1T31A 2EA3A 2ZTXA 2QAAA 1MCTA 1P10A 1QA0A 2BZAA 2W6ID 5HYOA 1UK2A 2KCOA 3ODFA 1S85A 3GCHB 2O8MA 3P8NA 1HAPH 4GHTA 4YOIA 1BJUA 3E8LA 3QZQA 4IC5A 4Q7YA 3MNCA 1J14A 3RXBA 2BY8X 1D9IA 2KCPA 2VWLA 4MNWA 4UEHH 3SNBA 5A8ZA 3UQVA 3E1XB 2NU1E 1C1QA 3O8RA 4Y6DA 4Y71A 1EB2A 1PQ5A 4K1SA 1WOFA 2FI4E 1UHBB 1TWXB 1QBOA 4WWYA 2FLRH 1P2MA 2XC4A 1EB1H 1NU9A 3TGKE 4NIVA 2LPRA 3RXFA 3U8RH 4JK5A 1Y5UT 2PTCE 2PSXA 4INKA 4D9RA 4UFEH 1O3EA 1BRUP 2BDIA 4FVBA 4A1XA 5C20A 5HKKD 3Q77A 2ZECA 3N99A 3QGNB 2F3CE 4X6NA 1S0QA 4CR9A 1AIXH 5GNDA 4F55A 4GLYA 1MTNC 1ANEA 1KXEA 1TMTH 3MU8A 3FAOA 3QO6A 3RXIA 3UWJH 1FY4A 4MQAA 3T28A 1W12U 4JZDH 2F9BH 2JH0D 3NUMA 1RIWC 2PTNA 2A32A 2JJ1D 2I6QA 6GCHG 3BG4B 4IN1A 2XYAA 2KAIA 2G4UA 1T7CA 1HAZB 3SJ8A 1O2NA 1YCPM 3GY8A 3BN9A 3RMLH 2ZU5A 3QK1A 1ZTJA 4OS1A 1TGTA 3CS0A 3MO9A 1BRCE 2WUCA 5FX6A 3RXHA 3DSPA 3KGPA 2PGBB 2RDEA 2ZGCA 4Z6AH 3TNTA 2R2MB 1HUTH 1GI3A 1BMLA 4FUBA 4I8HA 3TK5A 2ZGBH 1MD8A 7GCHG 3S69A 2W26A 1C5UA 4X2XA 1B0FA 1RXPA 2WSSD 1MABB 1THRH 1TPAE 1UTQA 6ESTA 1O0DH 3A85A 3LGWA 1AB9B 4BTIB 1Y5BT 1ANCA 3SJ9A 2GP9B 2QY0B 4UFDH 2YMSD 4RI0A 1AB9C 4Q63A 1C2FA 1ZJDA 3SI4H 2CN0H 2J4IA 2KX4A 3S9CA 2Z9GA 1DSTA 1S0RA 1UMAH 5GIBA 3RXOA 3SNAA 2GT7A 4FETA 1XUJA 1C2DA 1XKAC 2AIPA 2BD9A 2PKAA 3GY2A 3T27A 4ZAEA 2HLDD 3AAUA 3URDA 4D76A 4GPGA 1MH0A 3A88A 5T3HA 1Z8RA 2EC9H 1LO6A 3NCLA 1D6WA 1TALA 1VITF 1C1PA 1ZPBA 1SGTA 3GISB 3F9FA 3KNXA 1G3BA 2QXHA 1A0HB 1AUJA 3GICB 4ACAA 2WPMS 2P16A 3E0NB 1YC0A 2Q6DA 5JDUB 1HAGE 3PMJA 5PTPA 1RRKA 1TRYA 2F9OA 1NY22 2W3IA 1BZXE 1K1OA 1AZ8A 1WDIA 1YPJH 3QWCH 1NBMD 1KYNA 1SQAA 1V2UT 1GDUA 3LH1A 3QZRA 1O5FH 3TLOA 2OCVB 4OGYA 3ZVCA 3OE7D 1HIAA 1O35A 3AW1A 1BUIA 4A7IB 4THNH 1GBCA 1GWAA 1TBZH 1XM1A 1WU1A 1P2JA 2ALPA 1GI6A 5DP7A 2Z9IA 4I8KA 1VCQA 1SHHB 3EA9A 3MO3A 1CT4E 1E0FD 1PPFE 1O2RA 2ZIQH 3SO3A 2WUBA 4DIHH 3A7ZA 5FBEA 1MQ6A 2M5TA 2AYWA 2BDHA 2ZDVH 3OSYA 1P9SA 1C5TA 3DHKH 1S6FA 3ATMA 1SI5H 2ZA5A 1ABIH 1P2QA 1ZYOA 3HK3B 1P06A 1XUHA 1E34B 3OTPA 3ZVGA 2AMDA 3OX7U 3BTME 1SGFG 1J16A 1KY9A 1NM6A 1K1MA 2P3FH 1PPEE 5KGOA 4ABEA 1EAUA 1S5SA 2ZKSA 2FI3E 1G32B 1V2KT 4J2YB 1ZPZA 3MH6A 5CMXH 1MUEB 1GGDC 2LP6A 1GHVH 2VVCA 1O3BA 4OS2A 2EI7A 2FTMA 1KXFA 1HNEE 4CRBA 5L2ZH 2ANMH 2ZTZA 3PYHA 2ZPSA 1O2SA 1O3PB 1C5NH 3LDXH 3EA7A 1XXDA 3NZIA 2AGEX 3WW7A 1AD8H 1EP5A 2W3KA 2R9PA 1GHZA 1DY8A 2XBXA 1PPGE 4Y76A 1RTLA 1TGSZ 1AE8H 1FAXA 2THFB 1THPB 2VU8E 5LPEA 3S7KB 1QR3E 2C90B 1YLDA 1ZTKA 1H8DH 3BIVH 1SOZA 3SU2A 3RMMH 3MNXA 1VJ9U 5KEDA 5EOKA 4AYVB 1WUNH 2FP7B 3MNSA 4UD9H 1GCTB 2A7CA 3SNCA 3GY4A 1LPGB 5CHAB 1P3CA 3AK5A 3QLPH 2FM2A 2FPZA 1KXBA 2F9NA 1VKYA 3A7YA 1VITG 1TGCA 2A31A 4GCHF 3F0OA 1O2OA 3DFJA 2VBCA 1WTGH 1LHDH 2A2XH 1JOUB 1IAUA 1BTWA 1ZLRA 4ASHA 1H9LB 1GJDB 2FOMB 1C1SA 2A7HA 5DP3A 1T8OA 4WMDA 4IC6A 3RXLA 3A89A 4KGAA 1O5CB 2XC5A 3HKIB 3DCLA 1F2SE 1GMDG 2K8IA 2AH4X 4SGAE 1QBNA 1UTMA 4RKOB 3TJUA 5A0CA 2TGPZ 5JBCS 1K1NA 4ZROA 1M9UA 2HVYB 2XCNA 1D4PB 2JJ2D 3K2UA 7ESTE 1FXYA 1PYTC 4HFPB 4MNYA 3BEFB 4GUXA 3RUOA 4BNRA 1O3IA 2BD7A 2J2UA 2JKHA 4YLUA 3SUEA 1NS3A 1GBKA 1CE5A 3SGQE 3RC5A 2BY5X 1IQFA 3L33A 3K65B 1UHBA 5G4BA 4ESTE 1C1VH 4ABDA 1FY1A 2BVXH 3PRDA 5E2OA 4ABJA 4Q2KA 2Z6BD 1O2WA 4Y11E 1C2HA 1NTPA 1P2OA 3M3VA 4JZ1A 3GCTF 1OKXA 1A61H 1HXEH 3MTYA 1C5ZB 3PLBA 1ZMNA 2BQ7B 3SQHE 3MU0A 1AFEH 2VIDA 2W7UA 3PTNA 1TPOA 2QF0A 3SNEA 1O5EH 2V7QD 1NRSH 1ZGIA 5DK1A 1OPHB 2QXJA 2A5AA 2BDCA 1XKBC 2OLGA 2OBOA 2H9HA 3RC6A 1OP0A 4A5TS 4R8TB 4B1TA 1KXDA 1ARCA 1Y8TA 2IJD1 1QJ1B 1IQJA 1DXPA 3SZEA 3K6YA 1C2IA 3UNRA 1OP8A 1GBEA 2C8XB 4Y0YE 3SHAH 5E0HA 1AVWA 1ZR0A 1O2PA 1O3FA 3U1IB 2AERH 1TNHA 5EW1H 5HGGA 1DS2E 3EQ0H 2Y7XA 2PLXA 1SFIA 1O3MA 3N7EA 4OM9A 1A1RA 3RXGA 1SVPA 1YYY1 3ZZ9A 1F0RA 1HAHH 1W8BH 2J94A 1C5WB 2BDGA 1QA7A 5F8TA 1EP6A 5EXNA 1FX0B 1A5GH 4FUIA 2ZHWH 4INHA 3HK6B 4AFUA 1N8OB 3TITA 1GHYH 4I8LA 4FU9A 1G37A 3ZVBA 2O8TA 5EG4A 2WPHS 1T4VH 1O2JA 2G00A 1C5LH 1GCTC 2V3HH 1QFKH 1H1BA 1SHYA 7KMEH 5C1YA 1NZQH 2FEQH 4GHQA 1HAIH 2Z9LA 1JBUH 5GXPA 1MKXH 1EXFA 5GDSH 2KFWA 1QQ4A 4DT4A 1GJ8B 2FZZA 2GCHF 4KTCA 3L6PA 5E2PA 1PQAA 4BTUB 2H1UA 3MU4A 1YP9A 3HKJB 4I31A 1Y3YA 2BD8A 3GY3A 4FUFA 2F4LA 2PHBA 3V0XA 4GSOA 4O3TA 1BMMH 4AG2A 3UREA 4DJZB 4ZUHA 1ETTH 4FUCA 3SJIA 5EODA 2ZWLH 3RMNH 4ABGA 1QJ6B 8GCHG 1LVBA 2ANKH 1EJMA 2WYJA 1TAWA 3SV8A 1QBVH 1CU1A 3RXJA 1NFWA 2B5TB 4F48B 2KCAA 3PV2A 1XUFA 1DOJA 3A7VA 1S82A 4F4OC 2XW9A 4AG1A 3QDZB 4MPWA 3TVJB 4ABAA 1IQNA 1P2KA 4NZLA 3SGBE 3UB0A 4AZ2B 1BTUA 1J9CH 5EQSA 3ZZDA 4RSPA 4AFSA 3NXPA 1A46H 5IDKA 5CHAC 1C5YB 4XBDA 3URCA 3VXFH 3UOUA 3KF2A 1GL1A 1ELEE 3PRBA 1UK3A 3PV5A 1TBRH 2BLVA 4BAMB 2XOKD 3VB3A 1COWD 2WPLS 1EAIA 2ZFSA 1E35B 2SGEE 3E90B 1YPMH 1L4DA 1ELAA 1YPKH 3LGUA 4P02A 1GI8B 3BTFE 1ZTLA 1AUTC 1RFNA 4Y8XA 1P2IA 2EI8A 1C1RA 3E16B 3D65E 2PGQB 1N8OC 3WY8A 2OC1A 2P3TB 2ZFTA 4AOQA 3UNSA 3F2GA 4TPIZ 3F3BA 3Q3YA 3LGVA 2SGPE 2IPQX 1E36B 1FI8A 1OWKA 2F9VA 3PMBB 3TIUA 1P03A 2ZU2A 3ZV8A 4ABFA 1OP2A 1PQ8A 1LHCH 2Y5GA 3T26A 2OK5A 4KTSA 4I8JA 4RKJB 1EATA 1TNJA 3RXDA 1W0YH 5F8XA 2BOHB 1CHGA 3UQOA 4ZHMU 1O2YA 1TBQH 3TK6A 2VGCB 8ESTE 1F5KU 1NBME 2F83A 2SGQE 1ZZZA 4CHAC 2BD5A 1BTPA 4NZQA 1O38A 1DWDH 1C2GA 1QTFA 2PKAB 1BBRK 1GI7B 1UK4A 1Y3VA 1A3EH 4TYDA 6LPRA 2PV9B 1C5OH 3SUGA 5EGMA 1TONA 2GZ7A 4JMYA 1ETSH 2PKSC 2ZPRA 8KME2 3FN8A 1MAYA 1SGYE 5JYIA 1ZSKA 1AU8A 4VGCC 5JPMH 2TPIZ 2KM0A 3RM2H 1O3CA 5F53A 1BHXF 4DGJA 4H42U 3ZZBA 5GWZA 2Y82A 1JIRA 3KQCA 6CHAB 4P00A 2BLOA 1OSSA 2OQUA 4Y7AA 2OC0A 2J92A 1TRNA 2Z94A 2W5EA 3PO1C 1LPKB 2H9EH 2JDID 4X1NU 2G81E 1GJBB 2J95A 1GJ7B 5DP8A 4Y8YA 4F49A 3U9AH 1ANBA 2STBE 1GBBA 2KCYA 3FZZA 2FOAA 3NK8A 3LPRA 4OS4A 2P3UB 1DPOA 1RJXB 3MO6A 1SGDE 2A4RA 2EI6A 3KHVA 1ETRH 4BAHB 5HIZA 1P01A 2I6SA 1ELBA 1BOQA 4BXWA 1TPSA 1SQOA 2GMTB 4JYUH 1O3JA 2A4OA 1HAVA 1NPMA 3DSOA 1V2QT 1IQEA 3SYJA 1DANH 1RD3B 1SGFA 1C9PA 1NN6A 3I29A 3KEEA 2Z7FE 2C4FH 1QIXB 4HGCA 1ESBA 3RXAA 1ABJH 5ETXA 3W1EA 2VB0A 4Y10E 2A1DB 1AE5A 1MQ5A 4WH6A 1TQ7B 1QL8A 1RS0A 1GHAG 1BIOA 1KDQB 1K9OE 3KQBA 1BTYA 2FOFA 3MU1A 9LPRA 1C2LA 2ILNA 1IQGA 1FMGA 1BMNH 5EJZA 1T4UH 4NG9H 3A8CA 4KELA 5T6GA
chains in the Genus database with same CATH topology
5JBAS 4Q80A 1GJAB 3ZVDA 2PKSB 1EPTA 2WINI 3ZVFA 4JK6A 1PPCE 1LVYA 1EOLA 5T6FA 3SI3H 5HM9A 2QGRA 1NROH 1KDQA 6CHAC 2RG3A 3LT3A 1GBAA 3BG4C 1HAXB 2FOHA 3LIWA 3H7OA 3ZV9A 1UVPA 4FUEA 1L1GA 1LVOA 3BF6H 1JIMA 1W0ZU 4H4FA 3A83A 3F1SB 3S9AA 1SGNE 4NA8A 1EPTB 1O2UA 5ESTE 1KXAA 2ZQ1A 1RGQA 1QB1A 5J4QA 3P17H 4AGKA 3A7WA 2AMPA 4K8YA 1DUEA 1YM0A 3EA8A 3W95A 3ODDA 2GCTB 3V3MA 1HJAB 1V2ST 2FWWA 5JB8S 3O8BA 4XSKU 1TLDA 2C93B 5JBBS 3T29A 1A2CH 1ZMLA 3GCNA 4XDEA 4ZH8A 2HNTF 3U98H 5DP4A 1A0LA 2DE9A 1DY9A 2TBSA 1V2WT 3U8TH 1ZRKA 2BDYA 1FPCH 1O33A 5FPTA 3SV9A 1B7XB 1S6HA 1D3PB 1O2KA 2GDDA 1HGTH 4X1RU 4X8TH 1YPEH 1NC6A 5GCHG 1O3GA 3U69H 1WTHD 1NRPH 3GYMA 1ZHRA 4MPUA 4BANB 1A5IA 3HGPA 4NGAH 1F5LA 1GBHA 1O3KA 1ESTA 2VGCC 1GMCG 2RCEA 3STJA 1TMUH 3QTVH 3S0NA 3ATLA 4B74A 3P70B 1Z1IA 3SV7A 1GL0E 1YPGH 2CXVA 4M7GA 1G3CA 4LZ4B 5GCHF 4LZ1H 2ALVA 3M36A 4D7FA 3SV6A 1Z6EA 2CGAA 1C1MA 3D62A 3QN7A 4XFQA 4AGJA 2KAIB 1FY3A 1LHFH 2BYAX 3PV4A 3GY6A 2A0QB 1LQDB 1C5SA 2XWBI 2PUQH 3RXPA 3LJJA 1SL3A 4CRGA 1OX1A 3MI4A 1HRTH 1CBWB 2G51A 1YBWA 1DFPA 3Q00A 3RXRA 1Y3WA 1INCA 3E0PB 1CA0B 1C1TA 1ID5H 1TB6H 3RMOH 2LNCA 4WY3A 1ELDE 1DM4B 1RTKA 3Q3KA 1TGNA 2Z9JA 1C2KA 1C5RA 2VIVA 4ISNA 1LTOA 2BX3A 2HNTC 2GGVB 3M5MA 1UTNA 4UFFH 1XVMA 4CREA 1AY6H 1C1NA 2ZDNA 1BDAA 1O2XA 3SU6A 1F92A 3EE0B 4IMQA 2V6NA 1YGCH 1MU8B 1DDJA 3LJOA 2GMTC 3ZVAA 3KCGH 5DO4H 5C3NA 1TMBH 2PW8H 2OXSA 2AS9A 5L30H 1BB0B 3RM0H 2UUKB 1J8AA 5ABWA 4YT7H 1Y3UA 1BTXA 4NCYA 1CO7E 1ZPCA 2IJOB 3OU0A 4ZKSU 4MNXA 1MKWH 1VJAU 4RN6A 5A2MH 5EPYA 1FY5A 4HZHA 3B23B 2B7DH 1O30A 2FMJA 1DE7H 1ZHMA 2ODPA 3BEIB 4YZUA 1FNIA 2TIOA 3JZ2B 9ESTA 4MNVA 3E6PH 1VITH 4GAWA 1O31A 1Z71A 3M3TA 4WVPE 1SPJA 5E8EH 1ZRBA 5EQRA 4AFQA 4U2WA 1AN1E 1PQ7A 4X1SU 2CJIA 1GJCB 1BITA 3PB1E 3ZVEA 1UTJA 1FONA 1Z7KA 1QQUA 1FZZA 4U01A 1BJVA 5FXLA 5FBIA 3B9FH 2BXTH 2BHGA 2V35A 2QIQA 2HRVA 1YPHE 1EZQA 4K8BA 3GDVA 4KTUA 4CRCA 2ZC9H 3QUMP 2GTBA 2NU3E 1O2GH 1LMWB 1MTUA 2AGIX 5E0JA 1TOCB 2VWNA 2Z3CA 2GCHG 2BB4A 4FU7A 1SC8U 3H7TA 3LC5A 1DXWA 2PUXB 1Y59T 2CV3A 3PLPA 1TNIA 2D8WA 2FS9A 3RLYH 3H5CB 1PJPA 1NESE 1SLWB 3M3SA 2O8LA 3M7UA 1KLIH 1C5VA 1CSOE 2CMYA 1F0UA 3SHCH 1O3DA 8LPRA 5C5NA 1HDTH 2O9QA 1MTVA 4FUGA 1G2MA 1ZJKA 1CHOG 2PR3A 3M5NA 5FPSA 1QNJA 1EZUC 1YKTA 2VIQA 4E06H 3Q3XA 4BAKB 2FO9A 3SZNA 3A86A 4WF8A 2B9LA 1A0JA 1V2JT 3UFAA 2H9TH 2BD3A 4ABIA 3UUZA 2ZHQH 3DD2H 1C4Y2 3SW2B 3TH4H 2O8WA 2BM2A 3SGAE 1EKBB 1Q2WA 5I25A 1D6RA 1JRTA 4H6TA 1DSUA 3BG8A 3RXVA 2H2ZA 5LPRA 3P95A 1O3OA 1CGIE 2G55A 4FVDA 3C27B 3A7XA 4MDSA 3RXCA 1LVMA 1T8MA 2RDLA 1QRZA 4CBOA 4BXSA 3SU1A 1OXGA 2FI5E 2A7JA 4D7GA 3D49H 3PTBA 2ASUB 1F7ZA 2G4TA 5A8YA 1HAYB 4AX9H 3LC3A 1QURH 2IN2A 1E38B 1TYNA 1AFQC 1EJAA 2H5DA 2V0BA 4X8VH 1HAOH 1ZSLA 1A4WH 1Y5AT 1BBRE 4WJG2 4X2VA 4X0WU 2J38A 2JETC 3MHWU 4ZHAA 1T32A 3HATH 4XBCA 1OS8A 2UWPA 4CH2B 4X6PA 1T8NA 4FU8A 2HGTH 2F9PA 5HMAA 3TPIZ 1NRQH 4NA7A 1DICA 1SG8B 3ELAH 3DT0H 1OYQA 2JH6D 4AB9A 1BTHH 4X2YA 3LONA 1T8LA 3E3TA 1NFXA 4XOJA 1QCPA 1AFQB 1GDQA 1LQEA 3GDUA 4ZHLU 1KLJH 1C1WH 4K69A 1SGCA 1Q31A 2ULLA 3IG6B 1P05A 1SR5C 1BRBE 2P94A 5TJXA 3RXUA 2R0LA 4NIYA 1QL9A 1H8IH 3SQEE 1GMDF 3VGCB 2ZFPH 1WCZA 1F0TA 1WBGB 5SGAE 1Z8JB 1SGQE 2K1QA 3P92A 2G8TA 1AWFH 1BCUH 4ZKOU 1C1OA 1O39A 3AASA 1OWJA 1TE0A 2ZCLP 3UTUH 1Z1JA 2HPQH 3UNQA 4A92A 5J4SA 4NWKA 1HFDA 2BDAA 1NRNH 1TGBA 4B2CA 1CQQA 3UY9A 1K28D 3PROA 3ENSB 3AAVA 4SGBE 1J17T 3MYWA 3GOVB 8GCHF 3F68H 1P11E 3IWMA 1YCPK 1GGDB 2Q6GA 5LPFA 1P09A 2WV4A 1VZQH 4ZXXH 1GVZA 1TNKA 5LGOA 4ISLA 2AFQB 1L0ZA 1V2OT 2CF9H 1ZMJA 4R0IA 2PWXA 1O2QA 1EZXC 2Q6FA 1A3BH 1MTWA 3LH3A 3MFJA 2VNTA 4MPVA 1HBTH 3C1KA 1UVSH 2GV7A 1O5AB 2BD2A 3DUXH 3LOXA 4K1TA 4DY7B 3VPKA 2HNTE 4WMEA 2BVRH 2ZCKP 2GCTC 1NO9H 1YLCA 2BZ6H 2A5KA 1GHBG 1FPHH 1TNLA 3UR9A 1W13U 3TNSA 2ZDAH 4DT7B 1P12E 1WQSA 1W11U 3PLKA 1HCGA 5A0AE 2GD4B 4X2WA 2FX4A 5DP5A 2HVXA 1K1IA 1IOEA 5FCKA 4E05H 1MU6B 1O36A 1FN8A 1TIOA 2J34A 4A6LA 2OUAA 1BQYA 1GI9B 1DLEA 1NRRH 1OWIA 3F9GA 1GI0A 4B76A 2F91A 4TWYA 1HJAC 5TCAA 1O2IA 1PPBH 1GBJA 3ZZ4A 1C2JA 2H6MA 2ZEBA 4A1TA 4CR5A 1BRAA 2QXGA 1GI4A 4YESB 5HXFA 3S9BA 1KSNA 2ZU4A 4GVUA 1LKAA 1F5RA 1BT7A 2XNIA 4ABHA 1GHWH 2Y5FA 3LKWA 3TK9A 3SUFA 3T62A 1AKSA 4FUHA 1ESAA 2BOKA 1O5DH 2GDEH 3FVFB 2BVSH 1QHRB 2FYRA 2ZNKH 1D3TB 5C5OA 1VCWA 1MKXK 3MNBA 3CENA 4LK4A 2OC7A 1P2NA 2ZPQA 3W94A 4X6OA 3BV9B 1GJ9B 1KTTB 1HIAB 1HAVB 3A81A 1UCYH 2GT8A 2WV5A 2XCFA 1H9IE 4MG3A 4WH8A 1GJ5H 1PYTD 1EJNA 1TA2A 5AF9H 2UWLA 4O9VA 3VB5A 1MBMA 3VXEH 3MU5A 3NWUA 2WPKS 3TH2H 3Q76A 1MBQA 4O3UA 3FFGA 2SGAA 5C1UA 1HLTH 2VIPA 1SGPE 4AYYB 1AO5A 3FZDA 1GI5A 4NFEA 5DKMA 1UTKA 4Q7ZA 1B0EA 5FAHA 3LU9B 3P8GA 2Z3DA 3PMAB 4AB8A 1O2MA 4D8NA 2FESH 2FOCA 1O2VA 1V2LT 3VB6A 1GJ6A 3RU4T 2YNBA 4Q7XA 4D9QA 1MCVA 1GVKB 2FTLE 1EAXA 1ZOMA 2ZQ2A 1O5GH 1AHTH 2VVUA 5ESBA 4NIXA 3STIA 1K1JA 4DOQA 1DX5M 2Q1JA 1FN6A 4NA9H 4DIIH 1ZGVA 1W3CA 2BXUH 2ZHFH 1TOMH 4UE7H 4B73A 2ANWA 2A45B 3EDXB 3N7OA 4Y7BA 4ZKNU 1OYTH 1C5XB 4O03A 1H9HE 4TY7A 4AFZA 1S84A 4K3JA 1FDPA 4AN7A 4JYTA 1VR1H 4B2AA 1MKWK 5EU8A 3FP8E 4NWLA 1AKSB 2BTCE 2BQ6B 1DWBH 1CGJE 2CHAC 4X6MA 1GBMA 5B6OA 2OINA 4LOYH 5BPEA 1GJ4H 3KQDA 3ATWA 3SU0A 1QRXA 3A84A 4J1YA 3SJKA 4CHAB 4MVNA 1O5BB 4JZEH 2A4QA 5F8ZA 3UOPA 5GPIB 2FYQA 1MTNB 2TGTA 1MTSA 1C2EA 3ZYDA 2SNWA 3G01A 2ZDLA 2OQ5A 3RXQA 3SV2H 3VEQB 1FIZA 1Z8IB 5E0GA 1O2HA 2DUCA 5DG6A 3RLWH 1LPZB 1XUGA 3BTHE 1FUJA 2VWMA 2WPIS 2FS8A 3VB7A 2SGFE 2XRCA 1DWEH 1DITH 3UPEA 1A5HA 4BAOB 4JZFH 3U1JB 2WYGA 4BTTB 3GCTG 2VJ1A 3GY5A 1TQ0B 1JRSA 1W2KH 5EPNA 2Y80A 4E7RG 1SGRE 1P02A 1GVLA 2FOGA 3AVZA 3R0FA 3SUDA 1PPHE 4IS5A 1CT0E 2FOEA 2XBVA 1VGCB 4E7NA 3V13A 3RU4D 4B71A 1TPPA 2QA9E 2VIOA 1AVGH 1EPTC 2ZHDA 3EAJA 4FUJA 4IN2A 4H6SB 1P0SH 7GCHF 4MLFB 1ELGA 3NKKA 4ISOA 1DUAA 4WMFA 2BX4A 1MMJN 2NWNA 2UWOA 1IHTH 2VH0A 3MH5A 3P8OA 4FXGH 2ZGHA 2ZGJA 1IQHA 1NFUA 3V7TA 4PROA 4ZMAH 3DFLA 1PPZA 1A7SA 1EX3A 3SU4A 5AVDA 1C9TA 1V2MT 1C5PA 1DT2A 3JZ1B 4JYVH 1DWCH 2FODA 4OS5A 3O8DA 1GI2A 1O2TA 4JCNA 1UVTH 3FP6E 3CP7A 4CRFA 2XTTB 1FQ3A 2D2DA 1V2RT 1GBIA 5K0HA 1N6YA 2NU0E 2Y81A 3UR6A 2BDBA 5FPYA 4TWWA 2GZ9A 1AQ7A 3T25A 2FDAA 3ZZ5A 3TJVA 3KL6A 1MZDA 5DGJA 2P59A 4YOJA 1P3EA 2G52A 3M61U 1DLKB 2QC2A 1MZAA 1F0SA 4YTAA 1HV7A 2JETB 4FUDA 4OGXA 2ZDMA 2D1JA 3K9XB 2C8WB 2Y7ZA 1O34A 3B8JA 4O97A 5L6NH 2C8YB 1HXFH 4NFFA 3RXTA 1S81A 5EW2H 1GMHF 1CT2E 5DP9A 1BMAA 1TX7A 2P95A 1VCPA 4I7YH 1SQTA 2STAE 3ZZCA 1QGFA 3TH3H 4YM9A 3QGJA 4DG4A 1QRWA 4NIWA 3GCOA 4GCHG 2J9NA 2HPPH 4B75A 1XMNB 2ZP0H 3M7TA 4I8GA 2BD4A 3IITA 5C1XA 2R3UA 2Z9KA 1C5MD 4U30A 3OTJE 4TPYA 3A80A 1KTSB 3MH4A 3PO1B 5CE1A 2B8OH 5H4IB 3ATKA 1FY8E 3OY5U 1YF4A 3BIUH 2XBYA 3RDZA 3LGTA 2GX4A 2QF3A 2H5CA 5AHGH 4VGCB 4QT8C 1SB1H 3MWIU 2FXRA 5FHTA 2G5VA 2XBWA 3BTTE 3HPTB 2ZTYA 1G3EA 1ELVA 1YPLH 1IQIA 1MD7A 2XXLA 1P04A 1YCPH 2SFAA 3QX5H 4YO9A 3EYDA 3PM3A 3GCHC 1D3QB 5A09A 3GY7A 5DJ7A 5A0BA 5I46H 2YNAA 1ELTA 1U6QA 2ZFFH 1D3DB 3TJOA 5F6MA 1ELFA 1GCDA 2G5NA 5EXLA 1G2LA 1G3DA 1OWEA 3LGYA 3M5OA 3RC4A 2BY6X 1GMCF 2QYIA 3SNDA 2AMQA 4OS7A 1WQVH 2ANYA 2DE8A 3A8BA 1UO6A 3OYPA 3P6ZB 1BBRH 1RTFB 2GZ8A 4DCDA 2HALA 2NU2E 3TJNA 3PWBA 1HJ8A 1NFYA 4U32A 5DP6A 2UUJB 3PMHB 1BA8B 1NT1A 2ODQA 1WSSH 4ZKRU 3S7HB 1IHSH 1GBFA 1OOKB 1CHOF 5FX5A 3FP7E 4INLA 4K1EA 2CHAB 4JZIA 3F9EA 1S83A 2FLBH 3I78A 3F6UH 1L1NA 1XUIA 3F9HA 1UTPA 4KKDA 3ZZ6A 1K1PA 4DW2U 1W14U 4Y0ZE 3ZZ8A 2ODYB 3RU4E 3ZZAA 1B5GH 3A82A 3A87A 4UFGH 4HI3A 1GHAF 1FJSA 2ZGXH 2O8UA 1TRMA 2VVVA 3ZZ3A 1UTOA 1O3NA 1FV9A 1V2VT 1V2NT 4KP0A 1SLUB 3RXKA 1V3XA 1SLVB 3ATIA 5EXMA 1Q3XA 1DVAH 5JB9S 2UUYA 1P57B 3BTGE 2ZO3H 1K2I1 3R3GB 1GG6B 3BTEE 2BLWA 2NU4E 1XUKA 4CRAA 2VINA 3VGCC 4DURA 1G30B 2BLQA 2XC0A 5AFYH 3BTDE 1IQKA 3ZZ7A 2FIRH 4TY6A 2FOBA 1QL7A 3T2NA 2GKVE 2A5IA 3ESTA 1UCYK 3O8CA 3M5LA 4WXVA 2VH6A 2OBQA 1TX6A 2YOLA 3MOCA 1EZSC 1FIWA 1L4ZA 3SBKA 3LGIA 1E37B 6GCHF 1HYLA 2ZI2H 2P8OC 5EQQA 2EEKA 2GV6A 4B2BA 2AIQA 1AMHA 1P8VC 1KXCA 3DA9B 1GG6C 1C4U2