2BTNA

Crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
242
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
molecule keywords AIIA-LIKE PROTEIN
total genus 71
structure length 242
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2btnA01
3I14A 3AF5A 2WRSA 2DKFA 4RAWA 1X8GA 5B3RA 3ESHA 1KO2A 2NYPA 2P4ZA 4PVTA 2BMIA 3I11A 3RKJA 1XM8A 4AWZA 4C1GA 4FSBA 3PG4A 4F6HA 2VW8A 1DD6A 4KEPA 1VGNA 2ZO4A 5LCFA 1XTOA 4EY2A 4D02A 3SD9A 5LE1A 5HH5A 5LCHA 4GCWA 3BK1A 4Z67A 4DIKA 1ZKPA 3VQZA 1HLKA 1X8IA 4C1FA 3SW3A 4Z5YA 1KO3A 5HISA 4HL1A 2FK6A 2Y8AA 1JJEA 4Z6XA 3F9OA 4ZNBA 1WUOA 4AWYB 2BG2A 1A7TA 4RM5A 2WYLA 4CHLA 3SRXA 3RKKA 3IE0A 5KIKA 2Y87A 2BG8A 5EVBA 1SMLA 4UAMA 2ZNBA 3DH8A 4HL2A 5K0WA 2GFJA 4WD6A 5AEBA 1BVTA 4XUKA 3T3OA 2P18A 5EHTA 4D1UA 2YNTA 2WYMC 5A5ZA 4AD9A 4YSLA 4NQ5A 5LMCA 2BFZB 1DDKA 2WHGA 5HH4A 4Z60A 3IELA 5EV8A 5FQBA 4HKYA 4RAMA 4PVOA 4ZO3A 5A0VA 3A4YA 4TZFA 3I13A 3KL7A 4UBQA 3Q6VA 5ACRA 4UWOB 3X30A 2NZEA 3BK2A 4RL2A 2OHIA 1P9EA 4C1EA 2FHXA 4GYQA 4XWWA 3I15A 5EWAA 5B1UA 2QINA 1Y44A 3IEKA 2NZFA 1YCFA 3IOFA 5EVDA 2XF4A 2FU6A 2BGAA 2I7VA 1JJTA 5LLDA 2GCUA 3IEMA 1MQOA 5LM6A 2I7XA 5EVKA 5KILA 3KNSA 3ADRA 2H6AA 3ZWFA 3X2XA 2P1EA 4NQ4A 1L9YA 1YCHA 3MD7A 1BC2A 3T9MA 5ACTA 5HH6A 4EXSA 2R2DA 1VMEA 2OHHA 4JO0A 3S0ZA 3LVZA 4ZO2A 1ZTCA 4TYFA 3R2UA 4DILA 3SPUA 2AIOA 4FR7A 1M2XA 2YNWA 1WUPA 4EFZA 5HIQA 2WYMA 4TYTA 1K07A 4NQ2A 4O98A 1YCGA 4P62A 4C1DA 3TP9A 3L6NA 2BTNA 2P97A 4EYFA 1JT1A 3DHAA 2GMNA 5FQCA 2Q42A 2YCBA 3SFPA 4FEKA 2QDSA 2BFKA 3RPCA 2M5DA 4XWTA 3ZQ4A 2I7TA 3X2ZA 4EYLA 4NQ6A 3BV6A 5A87A 2BFLA 2AZ4A 2Q9UA 1WRAA 3JXPA 2Q0IA 2ZZIA 4V0HA 5DPXA 3T3NA 4Z7RA 2OHJA 4B87A 3VPEA 1BMCA 2YNVA 5EW0A 1QH5A 2BG8B 4BZ3A 5EV6A 2GFKA 2Y8BA 2YNVB 3AJ3A 1DXKA 4AX1B 4J5FA 2BR6A 3AF6A 5ACSA 5AHRA 2YZ3A 2YNTB 4F6ZA 3WXCA 2BFZA 4LE6A 1E5DA 5HIPA 2BG6A 3ZNBA 5AXOA 5A0TA 3PY5A 5LSCA 3KNRA 2YNUA 1X8HA 2FU9A 2CBNA 2QJSA 5AXRA 2FM6A 1A8TA 5ACXA 1ZNBA 5B15A 5AHOA 4TZEA 4KEQA 3P2UA 5K4KA 2ZWRA 4C09A 4UWRB 1VJNA 3SBLA 4D1TA 5K4MA 5K4NA 2BC2A 4D1VA 4U4LA 3H3EA 4RBSA 5ACQA 5ACVA 1QH3A 5LS3A 3DHCA 3FCZA 5IQKA 5HIOA 2Q0JA 3IDZA 2QEDA 3IE2A 4TZBA 4EYBA 5ACPA 4RL0A 4UWSB 4Z5ZA 3BC2A 2HB9A 3IOGA 2GKLA 3I0VA 4UWPB 2DOOA 5AYAA 3FAIA 5EH9A 4D1WA 2FHXB 4TZ9A 3DHBA 2BG7A 2BIBA 4C1HA 2FU7A 2NXAA 1KR3A 4YSBA 2QDTA 5ACUA 4J5HA 2A7MA 5FQAA 2FU8A 2XR1A 5LCAA 3QH8A 3G1PA 3PY6A 4C1CA 2UYXA 4GYUA 4YSKA 3IE1A 4UA4A 1WW1A 3ZR9A 4ZEJA 4EXYA 4H0DA 3X2YA 2M5CA 4AX0B 5ACWA 4BP0A 2E7YA
chains in the Genus database with same CATH superfamily
3I14A 3AF5A 2WRSA 2DKFA 4RAWA 1X8GA 5B3RA 3ESHA 1KO2A 2NYPA 2P4ZA 4PVTA 2BMIA 3I11A 3RKJA 1XM8A 4AWZA 4C1GA 2CFZA 4FSBA 3PG4A 4AXHA 4F6HA 2VW8A 1DD6A 4KEPA 1VGNA 2ZO4A 5LCFA 1XTOA 4EY2A 4D02A 3SD9A 5LE1A 5HH5A 5LCHA 4GCWA 3BK1A 4Z67A 4DIKA 1ZKPA 3VQZA 1HLKA 1X8IA 4C1FA 3SW3A 4Z5YA 1KO3A 5HISA 2CG2A 4HL1A 2FK6A 2Y8AA 5AJLA 1JJEA 4Z6XA 3F9OA 4ZNBA 4NURA 2CG3A 1WUOA 4AWYB 2BG2A 1A7TA 4RM5A 2WYLA 4CHLA 3SRXA 3RKKA 3IE0A 5KIKA 2Y87A 2BG8A 5EVBA 1SMLA 4UAMA 2ZNBA 3DH8A 4HL2A 5K0WA 2GFJA 4WD6A 5AEBA 1BVTA 4XUKA 3T3OA 2P18A 5EHTA 4D1UA 2YNTA 2WYMC 5A5ZA 4AD9A 4YSLA 4NQ5A 2BFZB 5LMCA 1DDKA 2WHGA 5HH4A 4Z60A 3IELA 5EV8A 5FQBA 4HKYA 4RAMA 4PVOA 4ZO3A 2CFUA 5A0VA 3A4YA 4TZFA 3I13A 3KL7A 4UBQA 3Q6VA 5ACRA 4UWOB 3X30A 2NZEA 3BK2A 4RL2A 2OHIA 1P9EA 4C1EA 2FHXA 4GYQA 4XWWA 3I15A 5EWAA 5B1UA 2QINA 1Y44A 3IEKA 5AIJA 2NZFA 1YCFA 3IOFA 5EVDA 2XF4A 2FU6A 2BGAA 2I7VA 1JJTA 5LLDA 2GCUA 3IEMA 1MQOA 5LM6A 2I7XA 4AV7A 5EVKA 5KILA 2YHEA 3KNSA 3ADRA 2H6AA 3ZWFA 3X2XA 2P1EA 4NQ4A 1L9YA 1YCHA 3MD7A 1BC2A 3T9MA 5ACTA 5HH6A 4EXSA 2R2DA 1VMEA 2OHHA 4JO0A 3S0ZA 3LVZA 4ZO2A 1ZTCA 4TYFA 3R2UA 4DILA 3SPUA 2AIOA 4FR7A 1M2XA 2YNWA 1WUPA 4EFZA 5HIQA 2WYMA 4TYTA 1K07A 4NQ2A 4O98A 1YCGA 4P62A 4C1DA 3TP9A 3L6NA 2BTNA 2P97A 4EYFA 1JT1A 3DHAA 2GMNA 5FQCA 2Q42A 2YCBA 3SFPA 4FEKA 2QDSA 2BFKA 3RPCA 2M5DA 4XWTA 3ZQ4A 2I7TA 3X2ZA 4EYLA 4NQ6A 3BV6A 5A87A 2BFLA 2AZ4A 2Q9UA 1WRAA 3JXPA 2Q0IA 2ZZIA 4V0HA 5DPXA 3T3NA 4Z7RA 2OHJA 4B87A 3VPEA 1BMCA 2YNVA 4PDXA 5EW0A 1QH5A 2BG8B 4BZ3A 5EV6A 2GFKA 2Y8BA 2YNVB 3AJ3A 1DXKA 4AX1B 4J5FA 2BR6A 3AF6A 5ACSA 5AHRA 2YZ3A 2YNTB 4F6ZA 3WXCA 2BFZA 4LE6A 1E5DA 5HIPA 2BG6A 3ZNBA 5AXOA 5A0TA 3PY5A 5LSCA 3KNRA 2YNUA 1X8HA 2FU9A 2CBNA 2QJSA 5AXRA 2FM6A 1A8TA 5ACXA 1ZNBA 5B15A 5AHOA 4TZEA 4KEQA 3P2UA 5K4KA 2ZWRA 4C09A 4UWRB 1VJNA 3SBLA 4D1TA 5K4MA 5K4NA 2BC2A 4D1VA 4U4LA 3H3EA 4RBSA 5ACQA 5ACVA 1QH3A 5LS3A 3DHCA 3FCZA 5IQKA 5HIOA 2Q0JA 3IDZA 2QEDA 3IE2A 5A23A 4TZBA 4EYBA 5ACPA 4RL0A 4UWSB 4Z5ZA 3BC2A 2HB9A 3IOGA 2GKLA 3I0VA 4UWPB 2DOOA 5AYAA 3FAIA 5EH9A 4D1WA 2FHXB 4TZ9A 3DHBA 2BG7A 2BIBA 4C1HA 2FU7A 2NXAA 1KR3A 4YSBA 2QDTA 5ACUA 4J5HA 2A7MA 5FQAA 2FU8A 2XR1A 5LCAA 3QH8A 3G1PA 3PY6A 4C1CA 2UYXA 4GYUA 4YSKA 3IE1A 4UA4A 1WW1A 3ZR9A 4ZEJA 4EXYA 4H0DA 3X2YA 2M5CA 4AX0B 5ACWA 4BP0A 2E7YA
chains in the Genus database with same CATH topology
3I14A 3AF5A 2WRSA 2DKFA 4RAWA 1X8GA 5B3RA 3ESHA 1KO2A 2NYPA 2P4ZA 4PVTA 2BMIA 3I11A 3RKJA 1XM8A 4AWZA 4C1GA 4FSBA 3PG4A 4F6HA 2VW8A 1DD6A 4KEPA 1VGNA 2ZO4A 5LCFA 1XTOA 4EY2A 4D02A 3SD9A 5LE1A 5HH5A 5LCHA 4GCWA 3BK1A 4Z67A 4DIKA 1ZKPA 3VQZA 1HLKA 1X8IA 4C1FA 3SW3A 4Z5YA 1KO3A 5HISA 4HL1A 2FK6A 2Y8AA 1JJEA 4Z6XA 3F9OA 4ZNBA 1WUOA 4AWYB 2BG2A 1A7TA 4RM5A 2WYLA 4CHLA 3SRXA 3RKKA 3IE0A 5KIKA 2Y87A 2BG8A 5EVBA 1SMLA 4UAMA 2ZNBA 3DH8A 4HL2A 5K0WA 2GFJA 4WD6A 5AEBA 1BVTA 4XUKA 3T3OA 2P18A 5EHTA 4D1UA 2YNTA 2WYMC 5A5ZA 4AD9A 4YSLA 4NQ5A 5LMCA 2BFZB 1DDKA 2WHGA 5HH4A 4Z60A 3IELA 5EV8A 5FQBA 4HKYA 4RAMA 4PVOA 4ZO3A 5A0VA 3A4YA 4TZFA 3I13A 3KL7A 4UBQA 3Q6VA 5ACRA 4UWOB 3X30A 2NZEA 3BK2A 4RL2A 2OHIA 1P9EA 4C1EA 2FHXA 4GYQA 4XWWA 3I15A 5EWAA 5B1UA 2QINA 1Y44A 3IEKA 2NZFA 1YCFA 3IOFA 5EVDA 2XF4A 2FU6A 2BGAA 2I7VA 1JJTA 5LLDA 2GCUA 3IEMA 1MQOA 5LM6A 2I7XA 5EVKA 5KILA 3KNSA 3ADRA 2H6AA 3ZWFA 3X2XA 2P1EA 4NQ4A 1L9YA 1YCHA 3MD7A 1BC2A 3T9MA 5ACTA 5HH6A 4EXSA 2R2DA 1VMEA 2OHHA 4JO0A 3S0ZA 3LVZA 4ZO2A 1ZTCA 4TYFA 3R2UA 4DILA 3SPUA 2AIOA 4FR7A 1M2XA 2YNWA 1WUPA 4EFZA 5HIQA 2WYMA 4TYTA 1K07A 4NQ2A 4O98A 1YCGA 4P62A 4C1DA 3TP9A 3L6NA 2BTNA 2P97A 4EYFA 1JT1A 3DHAA 2GMNA 5FQCA 2Q42A 2YCBA 3SFPA 4FEKA 2QDSA 2BFKA 3RPCA 2M5DA 4XWTA 3ZQ4A 2I7TA 3X2ZA 4EYLA 4NQ6A 3BV6A 5A87A 2BFLA 2AZ4A 2Q9UA 1WRAA 3JXPA 2Q0IA 2ZZIA 4V0HA 5DPXA 3T3NA 4Z7RA 2OHJA 4B87A 3VPEA 1BMCA 2YNVA 5EW0A 1QH5A 2BG8B 4BZ3A 5EV6A 2GFKA 2Y8BA 2YNVB 3AJ3A 1DXKA 4AX1B 4J5FA 2BR6A 3AF6A 5ACSA 5AHRA 2YZ3A 2YNTB 4F6ZA 3WXCA 2BFZA 4LE6A 1E5DA 5HIPA 2BG6A 3ZNBA 5AXOA 5A0TA 3PY5A 5LSCA 3KNRA 2YNUA 1X8HA 2FU9A 2CBNA 2QJSA 5AXRA 2FM6A 1A8TA 5ACXA 1ZNBA 5B15A 5AHOA 4TZEA 4KEQA 3P2UA 5K4KA 2ZWRA 4C09A 4UWRB 1VJNA 3SBLA 4D1TA 5K4MA 5K4NA 2BC2A 4D1VA 4U4LA 3H3EA 4RBSA 5ACQA 5ACVA 1QH3A 5LS3A 3DHCA 3FCZA 5IQKA 5HIOA 2Q0JA 3IDZA 2QEDA 3IE2A 4TZBA 4EYBA 5ACPA 4RL0A 4UWSB 4Z5ZA 3BC2A 2HB9A 3IOGA 2GKLA 3I0VA 4UWPB 2DOOA 5AYAA 3FAIA 5EH9A 4D1WA 2FHXB 4TZ9A 3DHBA 2BG7A 2BIBA 4C1HA 2FU7A 2NXAA 1KR3A 4YSBA 2QDTA 5ACUA 4J5HA 2A7MA 5FQAA 2FU8A 2XR1A 5LCAA 3QH8A 3G1PA 3PY6A 4C1CA 2UYXA 4GYUA 4YSKA 3IE1A 4UA4A 1WW1A 3ZR9A 4ZEJA 4EXYA 4H0DA 3X2YA 2M5CA 4AX0B 5ACWA 4BP0A 2E7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I14 A;  3AF5 A;  2WRS A;  2DKF A;  4RAW A;  1X8G A;  5B3R A;  3ESH A;  1KO2 A;  2NYP A;  2P4Z A;  4PVT A;  2BMI A;  3I11 A;  3RKJ A;  1XM8 A;  4AWZ A;  4C1G A;  4FSB A;  3PG4 A;  4F6H A;  2VW8 A;  1DD6 A;  4KEP A;  1VGN A;  2ZO4 A;  5LCF A;  1XTO A;  4EY2 A;  4D02 A;  3SD9 A;  5LE1 A;  5HH5 A;  5LCH A;  4GCW A;  3BK1 A;  4Z67 A;  4DIK A;  1ZKP A;  3VQZ A;  1HLK A;  1X8I A;  4C1F A;  3SW3 A;  4Z5Y A;  1KO3 A;  5HIS A;  4HL1 A;  2FK6 A;  2Y8A A;  1JJE A;  4Z6X A;  3F9O A;  4ZNB A;  1WUO A;  4AWY B;  2BG2 A;  1A7T A;  4RM5 A;  2WYL A;  4CHL A;  3SRX A;  3RKK A;  3IE0 A;  5KIK A;  2Y87 A;  2BG8 A;  5EVB A;  1SML A;  4UAM A;  2ZNB A;  3DH8 A;  4HL2 A;  5K0W A;  2GFJ A;  4WD6 A;  5AEB A;  1BVT A;  4XUK A;  3T3O A;  2P18 A;  5EHT A;  4D1U A;  2YNT A;  2WYM C;  5A5Z A;  4AD9 A;  4YSL A;  4NQ5 A;  5LMC A;  2BFZ B;  1DDK A;  2WHG A;  5HH4 A;  4Z60 A;  3IEL A;  5EV8 A;  5FQB A;  4HKY A;  4RAM A;  4PVO A;  4ZO3 A;  5A0V A;  3A4Y A;  4TZF A;  3I13 A;  3KL7 A;  4UBQ A;  3Q6V A;  5ACR A;  4UWO B;  3X30 A;  2NZE A;  3BK2 A;  4RL2 A;  2OHI A;  1P9E A;  4C1E A;  2FHX A;  4GYQ A;  4XWW A;  3I15 A;  5EWA A;  5B1U A;  2QIN A;  1Y44 A;  3IEK A;  2NZF A;  1YCF A;  3IOF A;  5EVD A;  2XF4 A;  2FU6 A;  2BGA A;  2I7V A;  1JJT A;  5LLD A;  2GCU A;  3IEM A;  1MQO A;  5LM6 A;  2I7X A;  5EVK A;  5KIL A;  3KNS A;  3ADR A;  2H6A A;  3ZWF A;  3X2X A;  2P1E A;  4NQ4 A;  1L9Y A;  1YCH A;  3MD7 A;  1BC2 A;  3T9M A;  5ACT A;  5HH6 A;  4EXS A;  2R2D A;  1VME A;  2OHH A;  4JO0 A;  3S0Z A;  3LVZ A;  4ZO2 A;  1ZTC A;  4TYF A;  3R2U A;  4DIL A;  3SPU A;  2AIO A;  4FR7 A;  1M2X A;  2YNW A;  1WUP A;  4EFZ A;  5HIQ A;  2WYM A;  4TYT A;  1K07 A;  4NQ2 A;  4O98 A;  1YCG A;  4P62 A;  4C1D A;  3TP9 A;  3L6N A;  2BTN A;  2P97 A;  4EYF A;  1JT1 A;  3DHA A;  2GMN A;  5FQC A;  2Q42 A;  2YCB A;  3SFP A;  4FEK A;  2QDS A;  2BFK A;  3RPC A;  2M5D A;  4XWT A;  3ZQ4 A;  2I7T A;  3X2Z A;  4EYL A;  4NQ6 A;  3BV6 A;  5A87 A;  2BFL A;  2AZ4 A;  2Q9U A;  1WRA A;  3JXP A;  2Q0I A;  2ZZI A;  4V0H A;  5DPX A;  3T3N A;  4Z7R A;  2OHJ A;  4B87 A;  3VPE A;  1BMC A;  2YNV A;  5EW0 A;  1QH5 A;  2BG8 B;  4BZ3 A;  5EV6 A;  2GFK A;  2Y8B A;  2YNV B;  3AJ3 A;  1DXK A;  4AX1 B;  4J5F A;  2BR6 A;  3AF6 A;  5ACS A;  5AHR A;  2YZ3 A;  2YNT B;  4F6Z A;  3WXC A;  2BFZ A;  4LE6 A;  1E5D A;  5HIP A;  2BG6 A;  3ZNB A;  5AXO A;  5A0T A;  3PY5 A;  5LSC A;  3KNR A;  2YNU A;  1X8H A;  2FU9 A;  2CBN A;  2QJS A;  5AXR A;  2FM6 A;  1A8T A;  5ACX A;  1ZNB A;  5B15 A;  5AHO A;  4TZE A;  4KEQ A;  3P2U A;  5K4K A;  2ZWR A;  4C09 A;  4UWR B;  1VJN A;  3SBL A;  4D1T A;  5K4M A;  5K4N A;  2BC2 A;  4D1V A;  4U4L A;  3H3E A;  4RBS A;  5ACQ A;  5ACV A;  1QH3 A;  5LS3 A;  3DHC A;  3FCZ A;  5IQK A;  5HIO A;  2Q0J A;  3IDZ A;  2QED A;  3IE2 A;  4TZB A;  4EYB A;  5ACP A;  4RL0 A;  4UWS B;  4Z5Z A;  3BC2 A;  2HB9 A;  3IOG A;  2GKL A;  3I0V A;  4UWP B;  2DOO A;  5AYA A;  3FAI A;  5EH9 A;  4D1W A;  2FHX B;  4TZ9 A;  3DHB A;  2BG7 A;  2BIB A;  4C1H A;  2FU7 A;  2NXA A;  1KR3 A;  4YSB A;  2QDT A;  5ACU A;  4J5H A;  2A7M A;  5FQA A;  2FU8 A;  2XR1 A;  5LCA A;  3QH8 A;  3G1P A;  3PY6 A;  4C1C A;  2UYX A;  4GYU A;  4YSK A;  3IE1 A;  4UA4 A;  1WW1 A;  3ZR9 A;  4ZEJ A;  4EXY A;  4H0D A;  3X2Y A;  2M5C A;  4AX0 B;  5ACW A;  4BP0 A;  2E7Y A; 
#chains in the Genus database with same CATH topology
 3I14 A;  3AF5 A;  2WRS A;  2DKF A;  4RAW A;  1X8G A;  5B3R A;  3ESH A;  1KO2 A;  2NYP A;  2P4Z A;  4PVT A;  2BMI A;  3I11 A;  3RKJ A;  1XM8 A;  4AWZ A;  4C1G A;  2CFZ A;  4FSB A;  3PG4 A;  4AXH A;  4F6H A;  2VW8 A;  1DD6 A;  4KEP A;  1VGN A;  2ZO4 A;  5LCF A;  1XTO A;  4EY2 A;  4D02 A;  3SD9 A;  5LE1 A;  5HH5 A;  5LCH A;  4GCW A;  3BK1 A;  4Z67 A;  4DIK A;  1ZKP A;  3VQZ A;  1HLK A;  1X8I A;  4C1F A;  3SW3 A;  4Z5Y A;  1KO3 A;  5HIS A;  2CG2 A;  4HL1 A;  2FK6 A;  2Y8A A;  5AJL A;  1JJE A;  4Z6X A;  3F9O A;  4ZNB A;  4NUR A;  2CG3 A;  1WUO A;  4AWY B;  2BG2 A;  1A7T A;  4RM5 A;  2WYL A;  4CHL A;  3SRX A;  3RKK A;  3IE0 A;  5KIK A;  2Y87 A;  2BG8 A;  5EVB A;  1SML A;  4UAM A;  2ZNB A;  3DH8 A;  4HL2 A;  5K0W A;  2GFJ A;  4WD6 A;  5AEB A;  1BVT A;  4XUK A;  3T3O A;  2P18 A;  5EHT A;  4D1U A;  2YNT A;  2WYM C;  5A5Z A;  4AD9 A;  4YSL A;  4NQ5 A;  2BFZ B;  5LMC A;  1DDK A;  2WHG A;  5HH4 A;  4Z60 A;  3IEL A;  5EV8 A;  5FQB A;  4HKY A;  4RAM A;  4PVO A;  4ZO3 A;  2CFU A;  5A0V A;  3A4Y A;  4TZF A;  3I13 A;  3KL7 A;  4UBQ A;  3Q6V A;  5ACR A;  4UWO B;  3X30 A;  2NZE A;  3BK2 A;  4RL2 A;  2OHI A;  1P9E A;  4C1E A;  2FHX A;  4GYQ A;  4XWW A;  3I15 A;  5EWA A;  5B1U A;  2QIN A;  1Y44 A;  3IEK A;  5AIJ A;  2NZF A;  1YCF A;  3IOF A;  5EVD A;  2XF4 A;  2FU6 A;  2BGA A;  2I7V A;  1JJT A;  5LLD A;  2GCU A;  3IEM A;  1MQO A;  5LM6 A;  2I7X A;  4AV7 A;  5EVK A;  5KIL A;  2YHE A;  3KNS A;  3ADR A;  2H6A A;  3ZWF A;  3X2X A;  2P1E A;  4NQ4 A;  1L9Y A;  1YCH A;  3MD7 A;  1BC2 A;  3T9M A;  5ACT A;  5HH6 A;  4EXS A;  2R2D A;  1VME A;  2OHH A;  4JO0 A;  3S0Z A;  3LVZ A;  4ZO2 A;  1ZTC A;  4TYF A;  3R2U A;  4DIL A;  3SPU A;  2AIO A;  4FR7 A;  1M2X A;  2YNW A;  1WUP A;  4EFZ A;  5HIQ A;  2WYM A;  4TYT A;  1K07 A;  4NQ2 A;  4O98 A;  1YCG A;  4P62 A;  4C1D A;  3TP9 A;  3L6N A;  2BTN A;  2P97 A;  4EYF A;  1JT1 A;  3DHA A;  2GMN A;  5FQC A;  2Q42 A;  2YCB A;  3SFP A;  4FEK A;  2QDS A;  2BFK A;  3RPC A;  2M5D A;  4XWT A;  3ZQ4 A;  2I7T A;  3X2Z A;  4EYL A;  4NQ6 A;  3BV6 A;  5A87 A;  2BFL A;  2AZ4 A;  2Q9U A;  1WRA A;  3JXP A;  2Q0I A;  2ZZI A;  4V0H A;  5DPX A;  3T3N A;  4Z7R A;  2OHJ A;  4B87 A;  3VPE A;  1BMC A;  2YNV A;  4PDX A;  5EW0 A;  1QH5 A;  2BG8 B;  4BZ3 A;  5EV6 A;  2GFK A;  2Y8B A;  2YNV B;  3AJ3 A;  1DXK A;  4AX1 B;  4J5F A;  2BR6 A;  3AF6 A;  5ACS A;  5AHR A;  2YZ3 A;  2YNT B;  4F6Z A;  3WXC A;  2BFZ A;  4LE6 A;  1E5D A;  5HIP A;  2BG6 A;  3ZNB A;  5AXO A;  5A0T A;  3PY5 A;  5LSC A;  3KNR A;  2YNU A;  1X8H A;  2FU9 A;  2CBN A;  2QJS A;  5AXR A;  2FM6 A;  1A8T A;  5ACX A;  1ZNB A;  5B15 A;  5AHO A;  4TZE A;  4KEQ A;  3P2U A;  5K4K A;  2ZWR A;  4C09 A;  4UWR B;  1VJN A;  3SBL A;  4D1T A;  5K4M A;  5K4N A;  2BC2 A;  4D1V A;  4U4L A;  3H3E A;  4RBS A;  5ACQ A;  5ACV A;  1QH3 A;  5LS3 A;  3DHC A;  3FCZ A;  5IQK A;  5HIO A;  2Q0J A;  3IDZ A;  2QED A;  3IE2 A;  5A23 A;  4TZB A;  4EYB A;  5ACP A;  4RL0 A;  4UWS B;  4Z5Z A;  3BC2 A;  2HB9 A;  3IOG A;  2GKL A;  3I0V A;  4UWP B;  2DOO A;  5AYA A;  3FAI A;  5EH9 A;  4D1W A;  2FHX B;  4TZ9 A;  3DHB A;  2BG7 A;  2BIB A;  4C1H A;  2FU7 A;  2NXA A;  1KR3 A;  4YSB A;  2QDT A;  5ACU A;  4J5H A;  2A7M A;  5FQA A;  2FU8 A;  2XR1 A;  5LCA A;  3QH8 A;  3G1P A;  3PY6 A;  4C1C A;  2UYX A;  4GYU A;  4YSK A;  3IE1 A;  4UA4 A;  1WW1 A;  3ZR9 A;  4ZEJ A;  4EXY A;  4H0D A;  3X2Y A;  2M5C A;  4AX0 B;  5ACW A;  4BP0 A;  2E7Y A; 
#chains in the Genus database with same CATH homology
 3I14 A;  3AF5 A;  2WRS A;  2DKF A;  4RAW A;  1X8G A;  5B3R A;  3ESH A;  1KO2 A;  2NYP A;  2P4Z A;  4PVT A;  2BMI A;  3I11 A;  3RKJ A;  1XM8 A;  4AWZ A;  4C1G A;  4FSB A;  3PG4 A;  4F6H A;  2VW8 A;  1DD6 A;  4KEP A;  1VGN A;  2ZO4 A;  5LCF A;  1XTO A;  4EY2 A;  4D02 A;  3SD9 A;  5LE1 A;  5HH5 A;  5LCH A;  4GCW A;  3BK1 A;  4Z67 A;  4DIK A;  1ZKP A;  3VQZ A;  1HLK A;  1X8I A;  4C1F A;  3SW3 A;  4Z5Y A;  1KO3 A;  5HIS A;  4HL1 A;  2FK6 A;  2Y8A A;  1JJE A;  4Z6X A;  3F9O A;  4ZNB A;  1WUO A;  4AWY B;  2BG2 A;  1A7T A;  4RM5 A;  2WYL A;  4CHL A;  3SRX A;  3RKK A;  3IE0 A;  5KIK A;  2Y87 A;  2BG8 A;  5EVB A;  1SML A;  4UAM A;  2ZNB A;  3DH8 A;  4HL2 A;  5K0W A;  2GFJ A;  4WD6 A;  5AEB A;  1BVT A;  4XUK A;  3T3O A;  2P18 A;  5EHT A;  4D1U A;  2YNT A;  2WYM C;  5A5Z A;  4AD9 A;  4YSL A;  4NQ5 A;  5LMC A;  2BFZ B;  1DDK A;  2WHG A;  5HH4 A;  4Z60 A;  3IEL A;  5EV8 A;  5FQB A;  4HKY A;  4RAM A;  4PVO A;  4ZO3 A;  5A0V A;  3A4Y A;  4TZF A;  3I13 A;  3KL7 A;  4UBQ A;  3Q6V A;  5ACR A;  4UWO B;  3X30 A;  2NZE A;  3BK2 A;  4RL2 A;  2OHI A;  1P9E A;  4C1E A;  2FHX A;  4GYQ A;  4XWW A;  3I15 A;  5EWA A;  5B1U A;  2QIN A;  1Y44 A;  3IEK A;  2NZF A;  1YCF A;  3IOF A;  5EVD A;  2XF4 A;  2FU6 A;  2BGA A;  2I7V A;  1JJT A;  5LLD A;  2GCU A;  3IEM A;  1MQO A;  5LM6 A;  2I7X A;  5EVK A;  5KIL A;  3KNS A;  3ADR A;  2H6A A;  3ZWF A;  3X2X A;  2P1E A;  4NQ4 A;  1L9Y A;  1YCH A;  3MD7 A;  1BC2 A;  3T9M A;  5ACT A;  5HH6 A;  4EXS A;  2R2D A;  1VME A;  2OHH A;  4JO0 A;  3S0Z A;  3LVZ A;  4ZO2 A;  1ZTC A;  4TYF A;  3R2U A;  4DIL A;  3SPU A;  2AIO A;  4FR7 A;  1M2X A;  2YNW A;  1WUP A;  4EFZ A;  5HIQ A;  2WYM A;  4TYT A;  1K07 A;  4NQ2 A;  4O98 A;  1YCG A;  4P62 A;  4C1D A;  3TP9 A;  3L6N A;  2BTN A;  2P97 A;  4EYF A;  1JT1 A;  3DHA A;  2GMN A;  5FQC A;  2Q42 A;  2YCB A;  3SFP A;  4FEK A;  2QDS A;  2BFK A;  3RPC A;  2M5D A;  4XWT A;  3ZQ4 A;  2I7T A;  3X2Z A;  4EYL A;  4NQ6 A;  3BV6 A;  5A87 A;  2BFL A;  2AZ4 A;  2Q9U A;  1WRA A;  3JXP A;  2Q0I A;  2ZZI A;  4V0H A;  5DPX A;  3T3N A;  4Z7R A;  2OHJ A;  4B87 A;  3VPE A;  1BMC A;  2YNV A;  5EW0 A;  1QH5 A;  2BG8 B;  4BZ3 A;  5EV6 A;  2GFK A;  2Y8B A;  2YNV B;  3AJ3 A;  1DXK A;  4AX1 B;  4J5F A;  2BR6 A;  3AF6 A;  5ACS A;  5AHR A;  2YZ3 A;  2YNT B;  4F6Z A;  3WXC A;  2BFZ A;  4LE6 A;  1E5D A;  5HIP A;  2BG6 A;  3ZNB A;  5AXO A;  5A0T A;  3PY5 A;  5LSC A;  3KNR A;  2YNU A;  1X8H A;  2FU9 A;  2CBN A;  2QJS A;  5AXR A;  2FM6 A;  1A8T A;  5ACX A;  1ZNB A;  5B15 A;  5AHO A;  4TZE A;  4KEQ A;  3P2U A;  5K4K A;  2ZWR A;  4C09 A;  4UWR B;  1VJN A;  3SBL A;  4D1T A;  5K4M A;  5K4N A;  2BC2 A;  4D1V A;  4U4L A;  3H3E A;  4RBS A;  5ACQ A;  5ACV A;  1QH3 A;  5LS3 A;  3DHC A;  3FCZ A;  5IQK A;  5HIO A;  2Q0J A;  3IDZ A;  2QED A;  3IE2 A;  4TZB A;  4EYB A;  5ACP A;  4RL0 A;  4UWS B;  4Z5Z A;  3BC2 A;  2HB9 A;  3IOG A;  2GKL A;  3I0V A;  4UWP B;  2DOO A;  5AYA A;  3FAI A;  5EH9 A;  4D1W A;  2FHX B;  4TZ9 A;  3DHB A;  2BG7 A;  2BIB A;  4C1H A;  2FU7 A;  2NXA A;  1KR3 A;  4YSB A;  2QDT A;  5ACU A;  4J5H A;  2A7M A;  5FQA A;  2FU8 A;  2XR1 A;  5LCA A;  3QH8 A;  3G1P A;  3PY6 A;  4C1C A;  2UYX A;  4GYU A;  4YSK A;  3IE1 A;  4UA4 A;  1WW1 A;  3ZR9 A;  4ZEJ A;  4EXY A;  4H0D A;  3X2Y A;  2M5C A;  4AX0 B;  5ACW A;  4BP0 A;  2E7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...