2BTNA

Crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
242
Chain Sequence
b'MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AIIA-LIKE PROTEIN
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 71
structure length 242
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2btnA01
1QH3A 4EFZA 2FK6A 4TYTA 3A4YA 3P2UA 3PY6A 2YZ3A 3KNRA 3DH8A 2FU9A 1XM8A 2BIBA 2ZO4A 2M5DA 5A0TA 5EHTA 3BK2A 5AHOA 2I7XA 2BR6A 4TZBA 1ZNBA 3PY5A 3IE0A 3AF6A 4XUKA 4AX1B 2OHHA 2P1EA 3IOGA 3G1PA 4AWYB 3KNSA 2WYMC 4D1UA 2YNVA 5FQAA 4Z60A 1DD6A 2BFKA 2E7YA 4UAMA 5EV6A 4GYUA 4HL2A 2BTNA 3FCZA 2AIOA 2GMNA 4C1GA 2I7VA 3R2UA 4C1EA 1JJTA 2P97A 4NQ2A 3DHAA 4DILA 3IEMA 4B87A 5K4NA 1WUPA 2QINA 1SMLA 3H3EA 2Q9UA 4NQ5A 5LE1A 2NZEA 2NXAA 5ACRA 4YSLA 5EWAA 3I11A 3FAIA 5ACQA 2BGAA 3RKKA 4TZFA 3ADRA 5LLDA 2GFJA 1BMCA 2R2DA 2A7MA 2CBNA 5KIKA 3ZQ4A 2FM6A 2DOOA 4ZO3A 2OHJA 2WYLA 1E5DA 4LE6A 4HL1A 2YNVB 2BG7A 3BK1A 2ZNBA 5ACWA 3SPUA 4FR7A 2XF4A 1K07A 3IE1A 3X2XA 3IDZA 3SD9A 2Q42A 4NQ4A 4F6HA 2QEDA 3DHCA 3MD7A 4WD6A 5A5ZA 1X8HA 3KL7A 1JT1A 2H6AA 4XWWA 5K4MA 5IQKA 3ZNBA 4UWRB 4TZEA 4J5FA 2WYMA 1L9YA 2DKFA 5EVBA 4P62A 4EYFA 3T9MA 5FQCA 3IELA 1KR3A 1MQOA 5ACTA 3TP9A 4XWTA 2FU8A 4BP0A 2BG8A 5EW0A 4RL2A 4KEQA 4AD9A 4HKYA 1HLKA 4C09A 4RBSA 2NYPA 4ZNBA 5AHRA 5LCHA 2WHGA 1ZTCA 2HB9A 1A8TA 5HIOA 4TZ9A 4YSKA 1Y44A 3SFPA 2FU7A 3L6NA 4CHLA 5ACVA 1VJNA 1X8IA 2ZWRA 3RKJA 2GCUA 3IOFA 4D02A 2P4ZA 2BMIA 3T3OA 4EYBA 4EY2A 5LSCA 5B1UA 2FU6A 4NQ6A 4UBQA 1XTOA 1VGNA 1X8GA 2Q0IA 2VW8A 1BC2A 2BG8B 3SW3A 1JJEA 2I7TA 2NZFA 2Y8BA 5LS3A 3I15A 5HH5A 4O98A 2FHXA 2WRSA 4RAWA 3T3NA 3BC2A 2BG6A 1DDKA 1DXKA 4EYLA 2YNTB 1YCGA 4JO0A 5LCAA 3IE2A 3WXCA 4BZ3A 1YCHA 3PG4A 5HH6A 1KO3A 2BC2A 4RM5A 4Z5ZA 5K0WA 3X2ZA 3IEKA 4EXSA 5B15A 2BFLA 5A87A 5AEBA 1A7TA 3I13A 3RPCA 4C1FA 2GKLA 4U4LA 4Z7RA 3ESHA 4UWSB 3X30A 4Z6XA 5HIQA 4PVTA 5AXOA 2UYXA 5LMCA 4F6ZA 2OHIA 2ZZIA 1WRAA 4RL0A 4H0DA 4J5HA 5HIPA 1KO2A 2QDSA 3I0VA 3S0ZA 3JXPA 4FEKA 1VMEA 4D1TA 2FHXB 4C1DA 2YNUA 5K4KA 4TYFA 1BVTA 4V0HA 4Z5YA 4FSBA 2BG2A 5DPXA 2YNTA 1M2XA 3Q6VA 1QH5A 3F9OA 2Q0JA 5KILA 2QDTA 5EV8A 3DHBA 4RAMA 2YCBA 3VQZA 4C1CA 2BFZA 4UA4A 5B3RA 3SBLA 2XR1A 4AX0B 3QH8A 5AYAA 4ZEJA 2Y87A 3LVZA 5EVKA 4UWOB 3I14A 4DIKA 2QJSA 4GYQA 4D1VA 3SRXA 5HISA 3X2YA 3BV6A 1WUOA 4ZO2A 4Z67A 3VPEA 2P18A 1P9EA 4UWPB 2AZ4A 5ACXA 4EXYA 5EH9A 2M5CA 2GFKA 3AJ3A 5FQBA 5AXRA 4YSBA 1WW1A 5HH4A 3AF5A 3ZR9A 2Y8AA 5A0VA 3ZWFA 5ACUA 4GCWA 4KEPA 1YCFA 4PVOA 2YNWA 5ACPA 2BFZB 4D1WA 5LM6A 5LCFA 4AWZA 1ZKPA 4C1HA 5ACSA 5EVDA
chains in the Genus database with same CATH superfamily
1QH3A 4EFZA 2FK6A 4TYTA 3A4YA 3P2UA 3PY6A 2YZ3A 3KNRA 3DH8A 2FU9A 1XM8A 2BIBA 2ZO4A 2M5DA 5A0TA 5EHTA 3BK2A 5AHOA 2I7XA 2BR6A 2YHEA 4TZBA 1ZNBA 3PY5A 3IE0A 3AF6A 4XUKA 4AX1B 2OHHA 2P1EA 3IOGA 3G1PA 4AWYB 3KNSA 2WYMC 4PDXA 4D1UA 2YNVA 5FQAA 4Z60A 1DD6A 2BFKA 2E7YA 4UAMA 5EV6A 4GYUA 4HL2A 2BTNA 3FCZA 2AIOA 2GMNA 4C1GA 2I7VA 3R2UA 4C1EA 1JJTA 2P97A 4NQ2A 3DHAA 4DILA 3IEMA 4B87A 5K4NA 4NURA 1WUPA 2QINA 1SMLA 3H3EA 2Q9UA 4NQ5A 5LE1A 2NZEA 2NXAA 5ACRA 4YSLA 5EWAA 3I11A 3FAIA 5ACQA 2BGAA 3RKKA 4TZFA 3ADRA 5LLDA 2GFJA 1BMCA 2R2DA 2A7MA 2CBNA 5A23A 5KIKA 3ZQ4A 2FM6A 5AJLA 2DOOA 4ZO3A 2OHJA 2WYLA 1E5DA 4LE6A 4HL1A 2YNVB 2BG7A 3BK1A 2ZNBA 5ACWA 3SPUA 4FR7A 2XF4A 1K07A 3IE1A 3X2XA 2CG3A 3IDZA 3SD9A 2Q42A 4NQ4A 4F6HA 2QEDA 3DHCA 3MD7A 4WD6A 5A5ZA 1X8HA 3KL7A 1JT1A 2H6AA 4XWWA 5K4MA 5IQKA 3ZNBA 4UWRB 4TZEA 4J5FA 2WYMA 1L9YA 2DKFA 5EVBA 4P62A 4EYFA 3T9MA 5FQCA 3IELA 1KR3A 1MQOA 5ACTA 3TP9A 4XWTA 2FU8A 4BP0A 2BG8A 5EW0A 4RL2A 4KEQA 4AD9A 4HKYA 1HLKA 4C09A 4RBSA 2NYPA 4ZNBA 5AHRA 5LCHA 2WHGA 1ZTCA 2HB9A 1A8TA 5HIOA 4TZ9A 4YSKA 1Y44A 3SFPA 2FU7A 2CG2A 3L6NA 4CHLA 5ACVA 1VJNA 2CFUA 1X8IA 2ZWRA 3RKJA 2GCUA 3IOFA 4D02A 2P4ZA 2BMIA 3T3OA 4EYBA 4EY2A 5LSCA 5B1UA 2FU6A 4NQ6A 4UBQA 5AIJA 1XTOA 1VGNA 1X8GA 2Q0IA 2VW8A 1BC2A 2BG8B 3SW3A 1JJEA 2I7TA 2NZFA 2Y8BA 5LS3A 3I15A 5HH5A 4O98A 2FHXA 2WRSA 4RAWA 3T3NA 3BC2A 2BG6A 1DDKA 1DXKA 4EYLA 2YNTB 1YCGA 4JO0A 5LCAA 3IE2A 3WXCA 4BZ3A 1YCHA 3PG4A 5HH6A 1KO3A 2BC2A 4RM5A 4Z5ZA 5K0WA 3X2ZA 3IEKA 4EXSA 5B15A 2BFLA 5A87A 5AEBA 1A7TA 3I13A 3RPCA 4C1FA 2GKLA 4U4LA 4Z7RA 3ESHA 4UWSB 3X30A 4Z6XA 5HIQA 4PVTA 5AXOA 2UYXA 5LMCA 4F6ZA 2OHIA 2ZZIA 1WRAA 4RL0A 4H0DA 4J5HA 5HIPA 1KO2A 2QDSA 3I0VA 3S0ZA 3JXPA 4FEKA 1VMEA 4D1TA 2FHXB 4C1DA 2YNUA 5K4KA 4TYFA 1BVTA 4V0HA 4Z5YA 4FSBA 2BG2A 5DPXA 2YNTA 1M2XA 3Q6VA 2CFZA 1QH5A 3F9OA 2Q0JA 5KILA 4AXHA 2QDTA 5EV8A 3DHBA 4RAMA 2YCBA 3VQZA 4C1CA 2BFZA 4UA4A 5B3RA 3SBLA 2XR1A 4AX0B 3QH8A 5AYAA 4ZEJA 2Y87A 3LVZA 5EVKA 4UWOB 3I14A 4DIKA 2QJSA 4AV7A 4GYQA 4D1VA 3SRXA 5HISA 3X2YA 3BV6A 1WUOA 4ZO2A 4Z67A 3VPEA 2P18A 1P9EA 4UWPB 2AZ4A 5ACXA 4EXYA 5EH9A 2M5CA 2GFKA 3AJ3A 5FQBA 5AXRA 4YSBA 1WW1A 5HH4A 3AF5A 3ZR9A 2Y8AA 5A0VA 3ZWFA 5ACUA 4GCWA 4KEPA 1YCFA 4PVOA 2YNWA 5ACPA 2BFZB 4D1WA 5LM6A 5LCFA 4AWZA 1ZKPA 4C1HA 5ACSA 5EVDA
chains in the Genus database with same CATH topology
1QH3A 4EFZA 2FK6A 4TYTA 3A4YA 3P2UA 3PY6A 2YZ3A 3KNRA 3DH8A 2FU9A 1XM8A 2BIBA 2ZO4A 2M5DA 5A0TA 5EHTA 3BK2A 5AHOA 2I7XA 2BR6A 4TZBA 1ZNBA 3PY5A 3IE0A 3AF6A 4XUKA 4AX1B 2OHHA 2P1EA 3IOGA 3G1PA 4AWYB 3KNSA 2WYMC 4D1UA 2YNVA 5FQAA 4Z60A 1DD6A 2BFKA 2E7YA 4UAMA 5EV6A 4GYUA 4HL2A 2BTNA 3FCZA 2AIOA 2GMNA 4C1GA 2I7VA 3R2UA 4C1EA 1JJTA 2P97A 4NQ2A 3DHAA 4DILA 3IEMA 4B87A 5K4NA 1WUPA 2QINA 1SMLA 3H3EA 2Q9UA 4NQ5A 5LE1A 2NZEA 2NXAA 5ACRA 4YSLA 5EWAA 3I11A 3FAIA 5ACQA 2BGAA 3RKKA 4TZFA 3ADRA 5LLDA 2GFJA 1BMCA 2R2DA 2A7MA 2CBNA 5KIKA 3ZQ4A 2FM6A 2DOOA 4ZO3A 2OHJA 2WYLA 1E5DA 4LE6A 4HL1A 2YNVB 2BG7A 3BK1A 2ZNBA 5ACWA 3SPUA 4FR7A 2XF4A 1K07A 3IE1A 3X2XA 3IDZA 3SD9A 2Q42A 4NQ4A 4F6HA 2QEDA 3DHCA 3MD7A 4WD6A 5A5ZA 1X8HA 3KL7A 1JT1A 2H6AA 4XWWA 5K4MA 5IQKA 3ZNBA 4UWRB 4TZEA 4J5FA 2WYMA 1L9YA 2DKFA 5EVBA 4P62A 4EYFA 3T9MA 5FQCA 3IELA 1KR3A 1MQOA 5ACTA 3TP9A 4XWTA 2FU8A 4BP0A 2BG8A 5EW0A 4RL2A 4KEQA 4AD9A 4HKYA 1HLKA 4C09A 4RBSA 2NYPA 4ZNBA 5AHRA 5LCHA 2WHGA 1ZTCA 2HB9A 1A8TA 5HIOA 4TZ9A 4YSKA 1Y44A 3SFPA 2FU7A 3L6NA 4CHLA 5ACVA 1VJNA 1X8IA 2ZWRA 3RKJA 2GCUA 3IOFA 4D02A 2P4ZA 2BMIA 3T3OA 4EYBA 4EY2A 5LSCA 5B1UA 2FU6A 4NQ6A 4UBQA 1XTOA 1VGNA 1X8GA 2Q0IA 2VW8A 1BC2A 2BG8B 3SW3A 1JJEA 2I7TA 2NZFA 2Y8BA 5LS3A 3I15A 5HH5A 4O98A 2FHXA 2WRSA 4RAWA 3T3NA 3BC2A 2BG6A 1DDKA 1DXKA 4EYLA 2YNTB 1YCGA 4JO0A 5LCAA 3IE2A 3WXCA 4BZ3A 1YCHA 3PG4A 5HH6A 1KO3A 2BC2A 4RM5A 4Z5ZA 5K0WA 3X2ZA 3IEKA 4EXSA 5B15A 2BFLA 5A87A 5AEBA 1A7TA 3I13A 3RPCA 4C1FA 2GKLA 4U4LA 4Z7RA 3ESHA 4UWSB 3X30A 4Z6XA 5HIQA 4PVTA 5AXOA 2UYXA 5LMCA 4F6ZA 2OHIA 2ZZIA 1WRAA 4RL0A 4H0DA 4J5HA 5HIPA 1KO2A 2QDSA 3I0VA 3S0ZA 3JXPA 4FEKA 1VMEA 4D1TA 2FHXB 4C1DA 2YNUA 5K4KA 4TYFA 1BVTA 4V0HA 4Z5YA 4FSBA 2BG2A 5DPXA 2YNTA 1M2XA 3Q6VA 1QH5A 3F9OA 2Q0JA 5KILA 2QDTA 5EV8A 3DHBA 4RAMA 2YCBA 3VQZA 4C1CA 2BFZA 4UA4A 5B3RA 3SBLA 2XR1A 4AX0B 3QH8A 5AYAA 4ZEJA 2Y87A 3LVZA 5EVKA 4UWOB 3I14A 4DIKA 2QJSA 4GYQA 4D1VA 3SRXA 5HISA 3X2YA 3BV6A 1WUOA 4ZO2A 4Z67A 3VPEA 2P18A 1P9EA 4UWPB 2AZ4A 5ACXA 4EXYA 5EH9A 2M5CA 2GFKA 3AJ3A 5FQBA 5AXRA 4YSBA 1WW1A 5HH4A 3AF5A 3ZR9A 2Y8AA 5A0VA 3ZWFA 5ACUA 4GCWA 4KEPA 1YCFA 4PVOA 2YNWA 5ACPA 2BFZB 4D1WA 5LM6A 5LCFA 4AWZA 1ZKPA 4C1HA 5ACSA 5EVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QH3 A;  4EFZ A;  2FK6 A;  4TYT A;  3A4Y A;  3P2U A;  3PY6 A;  2YZ3 A;  3KNR A;  3DH8 A;  2FU9 A;  1XM8 A;  2BIB A;  2ZO4 A;  2M5D A;  5A0T A;  5EHT A;  3BK2 A;  5AHO A;  2I7X A;  2BR6 A;  4TZB A;  1ZNB A;  3PY5 A;  3IE0 A;  3AF6 A;  4XUK A;  4AX1 B;  2OHH A;  2P1E A;  3IOG A;  3G1P A;  4AWY B;  3KNS A;  2WYM C;  4D1U A;  2YNV A;  5FQA A;  4Z60 A;  1DD6 A;  2BFK A;  2E7Y A;  4UAM A;  5EV6 A;  4GYU A;  4HL2 A;  2BTN A;  3FCZ A;  2AIO A;  2GMN A;  4C1G A;  2I7V A;  3R2U A;  4C1E A;  1JJT A;  2P97 A;  4NQ2 A;  3DHA A;  4DIL A;  3IEM A;  4B87 A;  5K4N A;  1WUP A;  2QIN A;  1SML A;  3H3E A;  2Q9U A;  4NQ5 A;  5LE1 A;  2NZE A;  2NXA A;  5ACR A;  4YSL A;  5EWA A;  3I11 A;  3FAI A;  5ACQ A;  2BGA A;  3RKK A;  4TZF A;  3ADR A;  5LLD A;  2GFJ A;  1BMC A;  2R2D A;  2A7M A;  2CBN A;  5KIK A;  3ZQ4 A;  2FM6 A;  2DOO A;  4ZO3 A;  2OHJ A;  2WYL A;  1E5D A;  4LE6 A;  4HL1 A;  2YNV B;  2BG7 A;  3BK1 A;  2ZNB A;  5ACW A;  3SPU A;  4FR7 A;  2XF4 A;  1K07 A;  3IE1 A;  3X2X A;  3IDZ A;  3SD9 A;  2Q42 A;  4NQ4 A;  4F6H A;  2QED A;  3DHC A;  3MD7 A;  4WD6 A;  5A5Z A;  1X8H A;  3KL7 A;  1JT1 A;  2H6A A;  4XWW A;  5K4M A;  5IQK A;  3ZNB A;  4UWR B;  4TZE A;  4J5F A;  2WYM A;  1L9Y A;  2DKF A;  5EVB A;  4P62 A;  4EYF A;  3T9M A;  5FQC A;  3IEL A;  1KR3 A;  1MQO A;  5ACT A;  3TP9 A;  4XWT A;  2FU8 A;  4BP0 A;  2BG8 A;  5EW0 A;  4RL2 A;  4KEQ A;  4AD9 A;  4HKY A;  1HLK A;  4C09 A;  4RBS A;  2NYP A;  4ZNB A;  5AHR A;  5LCH A;  2WHG A;  1ZTC A;  2HB9 A;  1A8T A;  5HIO A;  4TZ9 A;  4YSK A;  1Y44 A;  3SFP A;  2FU7 A;  3L6N A;  4CHL A;  5ACV A;  1VJN A;  1X8I A;  2ZWR A;  3RKJ A;  2GCU A;  3IOF A;  4D02 A;  2P4Z A;  2BMI A;  3T3O A;  4EYB A;  4EY2 A;  5LSC A;  5B1U A;  2FU6 A;  4NQ6 A;  4UBQ A;  1XTO A;  1VGN A;  1X8G A;  2Q0I A;  2VW8 A;  1BC2 A;  2BG8 B;  3SW3 A;  1JJE A;  2I7T A;  2NZF A;  2Y8B A;  5LS3 A;  3I15 A;  5HH5 A;  4O98 A;  2FHX A;  2WRS A;  4RAW A;  3T3N A;  3BC2 A;  2BG6 A;  1DDK A;  1DXK A;  4EYL A;  2YNT B;  1YCG A;  4JO0 A;  5LCA A;  3IE2 A;  3WXC A;  4BZ3 A;  1YCH A;  3PG4 A;  5HH6 A;  1KO3 A;  2BC2 A;  4RM5 A;  4Z5Z A;  5K0W A;  3X2Z A;  3IEK A;  4EXS A;  5B15 A;  2BFL A;  5A87 A;  5AEB A;  1A7T A;  3I13 A;  3RPC A;  4C1F A;  2GKL A;  4U4L A;  4Z7R A;  3ESH A;  4UWS B;  3X30 A;  4Z6X A;  5HIQ A;  4PVT A;  5AXO A;  2UYX A;  5LMC A;  4F6Z A;  2OHI A;  2ZZI A;  1WRA A;  4RL0 A;  4H0D A;  4J5H A;  5HIP A;  1KO2 A;  2QDS A;  3I0V A;  3S0Z A;  3JXP A;  4FEK A;  1VME A;  4D1T A;  2FHX B;  4C1D A;  2YNU A;  5K4K A;  4TYF A;  1BVT A;  4V0H A;  4Z5Y A;  4FSB A;  2BG2 A;  5DPX A;  2YNT A;  1M2X A;  3Q6V A;  1QH5 A;  3F9O A;  2Q0J A;  5KIL A;  2QDT A;  5EV8 A;  3DHB A;  4RAM A;  2YCB A;  3VQZ A;  4C1C A;  2BFZ A;  4UA4 A;  5B3R A;  3SBL A;  2XR1 A;  4AX0 B;  3QH8 A;  5AYA A;  4ZEJ A;  2Y87 A;  3LVZ A;  5EVK A;  4UWO B;  3I14 A;  4DIK A;  2QJS A;  4GYQ A;  4D1V A;  3SRX A;  5HIS A;  3X2Y A;  3BV6 A;  1WUO A;  4ZO2 A;  4Z67 A;  3VPE A;  2P18 A;  1P9E A;  4UWP B;  2AZ4 A;  5ACX A;  4EXY A;  5EH9 A;  2M5C A;  2GFK A;  3AJ3 A;  5FQB A;  5AXR A;  4YSB A;  1WW1 A;  5HH4 A;  3AF5 A;  3ZR9 A;  2Y8A A;  5A0V A;  3ZWF A;  5ACU A;  4GCW A;  4KEP A;  1YCF A;  4PVO A;  2YNW A;  5ACP A;  2BFZ B;  4D1W A;  5LM6 A;  5LCF A;  4AWZ A;  1ZKP A;  4C1H A;  5ACS A;  5EVD A; 
#chains in the Genus database with same CATH topology
 1QH3 A;  4EFZ A;  2FK6 A;  4TYT A;  3A4Y A;  3P2U A;  3PY6 A;  2YZ3 A;  3KNR A;  3DH8 A;  2FU9 A;  1XM8 A;  2BIB A;  2ZO4 A;  2M5D A;  5A0T A;  5EHT A;  3BK2 A;  5AHO A;  2I7X A;  2BR6 A;  2YHE A;  4TZB A;  1ZNB A;  3PY5 A;  3IE0 A;  3AF6 A;  4XUK A;  4AX1 B;  2OHH A;  2P1E A;  3IOG A;  3G1P A;  4AWY B;  3KNS A;  2WYM C;  4PDX A;  4D1U A;  2YNV A;  5FQA A;  4Z60 A;  1DD6 A;  2BFK A;  2E7Y A;  4UAM A;  5EV6 A;  4GYU A;  4HL2 A;  2BTN A;  3FCZ A;  2AIO A;  2GMN A;  4C1G A;  2I7V A;  3R2U A;  4C1E A;  1JJT A;  2P97 A;  4NQ2 A;  3DHA A;  4DIL A;  3IEM A;  4B87 A;  5K4N A;  4NUR A;  1WUP A;  2QIN A;  1SML A;  3H3E A;  2Q9U A;  4NQ5 A;  5LE1 A;  2NZE A;  2NXA A;  5ACR A;  4YSL A;  5EWA A;  3I11 A;  3FAI A;  5ACQ A;  2BGA A;  3RKK A;  4TZF A;  3ADR A;  5LLD A;  2GFJ A;  1BMC A;  2R2D A;  2A7M A;  2CBN A;  5A23 A;  5KIK A;  3ZQ4 A;  2FM6 A;  5AJL A;  2DOO A;  4ZO3 A;  2OHJ A;  2WYL A;  1E5D A;  4LE6 A;  4HL1 A;  2YNV B;  2BG7 A;  3BK1 A;  2ZNB A;  5ACW A;  3SPU A;  4FR7 A;  2XF4 A;  1K07 A;  3IE1 A;  3X2X A;  2CG3 A;  3IDZ A;  3SD9 A;  2Q42 A;  4NQ4 A;  4F6H A;  2QED A;  3DHC A;  3MD7 A;  4WD6 A;  5A5Z A;  1X8H A;  3KL7 A;  1JT1 A;  2H6A A;  4XWW A;  5K4M A;  5IQK A;  3ZNB A;  4UWR B;  4TZE A;  4J5F A;  2WYM A;  1L9Y A;  2DKF A;  5EVB A;  4P62 A;  4EYF A;  3T9M A;  5FQC A;  3IEL A;  1KR3 A;  1MQO A;  5ACT A;  3TP9 A;  4XWT A;  2FU8 A;  4BP0 A;  2BG8 A;  5EW0 A;  4RL2 A;  4KEQ A;  4AD9 A;  4HKY A;  1HLK A;  4C09 A;  4RBS A;  2NYP A;  4ZNB A;  5AHR A;  5LCH A;  2WHG A;  1ZTC A;  2HB9 A;  1A8T A;  5HIO A;  4TZ9 A;  4YSK A;  1Y44 A;  3SFP A;  2FU7 A;  2CG2 A;  3L6N A;  4CHL A;  5ACV A;  1VJN A;  2CFU A;  1X8I A;  2ZWR A;  3RKJ A;  2GCU A;  3IOF A;  4D02 A;  2P4Z A;  2BMI A;  3T3O A;  4EYB A;  4EY2 A;  5LSC A;  5B1U A;  2FU6 A;  4NQ6 A;  4UBQ A;  5AIJ A;  1XTO A;  1VGN A;  1X8G A;  2Q0I A;  2VW8 A;  1BC2 A;  2BG8 B;  3SW3 A;  1JJE A;  2I7T A;  2NZF A;  2Y8B A;  5LS3 A;  3I15 A;  5HH5 A;  4O98 A;  2FHX A;  2WRS A;  4RAW A;  3T3N A;  3BC2 A;  2BG6 A;  1DDK A;  1DXK A;  4EYL A;  2YNT B;  1YCG A;  4JO0 A;  5LCA A;  3IE2 A;  3WXC A;  4BZ3 A;  1YCH A;  3PG4 A;  5HH6 A;  1KO3 A;  2BC2 A;  4RM5 A;  4Z5Z A;  5K0W A;  3X2Z A;  3IEK A;  4EXS A;  5B15 A;  2BFL A;  5A87 A;  5AEB A;  1A7T A;  3I13 A;  3RPC A;  4C1F A;  2GKL A;  4U4L A;  4Z7R A;  3ESH A;  4UWS B;  3X30 A;  4Z6X A;  5HIQ A;  4PVT A;  5AXO A;  2UYX A;  5LMC A;  4F6Z A;  2OHI A;  2ZZI A;  1WRA A;  4RL0 A;  4H0D A;  4J5H A;  5HIP A;  1KO2 A;  2QDS A;  3I0V A;  3S0Z A;  3JXP A;  4FEK A;  1VME A;  4D1T A;  2FHX B;  4C1D A;  2YNU A;  5K4K A;  4TYF A;  1BVT A;  4V0H A;  4Z5Y A;  4FSB A;  2BG2 A;  5DPX A;  2YNT A;  1M2X A;  3Q6V A;  2CFZ A;  1QH5 A;  3F9O A;  2Q0J A;  5KIL A;  4AXH A;  2QDT A;  5EV8 A;  3DHB A;  4RAM A;  2YCB A;  3VQZ A;  4C1C A;  2BFZ A;  4UA4 A;  5B3R A;  3SBL A;  2XR1 A;  4AX0 B;  3QH8 A;  5AYA A;  4ZEJ A;  2Y87 A;  3LVZ A;  5EVK A;  4UWO B;  3I14 A;  4DIK A;  2QJS A;  4AV7 A;  4GYQ A;  4D1V A;  3SRX A;  5HIS A;  3X2Y A;  3BV6 A;  1WUO A;  4ZO2 A;  4Z67 A;  3VPE A;  2P18 A;  1P9E A;  4UWP B;  2AZ4 A;  5ACX A;  4EXY A;  5EH9 A;  2M5C A;  2GFK A;  3AJ3 A;  5FQB A;  5AXR A;  4YSB A;  1WW1 A;  5HH4 A;  3AF5 A;  3ZR9 A;  2Y8A A;  5A0V A;  3ZWF A;  5ACU A;  4GCW A;  4KEP A;  1YCF A;  4PVO A;  2YNW A;  5ACP A;  2BFZ B;  4D1W A;  5LM6 A;  5LCF A;  4AWZ A;  1ZKP A;  4C1H A;  5ACS A;  5EVD A; 
#chains in the Genus database with same CATH homology
 1QH3 A;  4EFZ A;  2FK6 A;  4TYT A;  3A4Y A;  3P2U A;  3PY6 A;  2YZ3 A;  3KNR A;  3DH8 A;  2FU9 A;  1XM8 A;  2BIB A;  2ZO4 A;  2M5D A;  5A0T A;  5EHT A;  3BK2 A;  5AHO A;  2I7X A;  2BR6 A;  4TZB A;  1ZNB A;  3PY5 A;  3IE0 A;  3AF6 A;  4XUK A;  4AX1 B;  2OHH A;  2P1E A;  3IOG A;  3G1P A;  4AWY B;  3KNS A;  2WYM C;  4D1U A;  2YNV A;  5FQA A;  4Z60 A;  1DD6 A;  2BFK A;  2E7Y A;  4UAM A;  5EV6 A;  4GYU A;  4HL2 A;  2BTN A;  3FCZ A;  2AIO A;  2GMN A;  4C1G A;  2I7V A;  3R2U A;  4C1E A;  1JJT A;  2P97 A;  4NQ2 A;  3DHA A;  4DIL A;  3IEM A;  4B87 A;  5K4N A;  1WUP A;  2QIN A;  1SML A;  3H3E A;  2Q9U A;  4NQ5 A;  5LE1 A;  2NZE A;  2NXA A;  5ACR A;  4YSL A;  5EWA A;  3I11 A;  3FAI A;  5ACQ A;  2BGA A;  3RKK A;  4TZF A;  3ADR A;  5LLD A;  2GFJ A;  1BMC A;  2R2D A;  2A7M A;  2CBN A;  5KIK A;  3ZQ4 A;  2FM6 A;  2DOO A;  4ZO3 A;  2OHJ A;  2WYL A;  1E5D A;  4LE6 A;  4HL1 A;  2YNV B;  2BG7 A;  3BK1 A;  2ZNB A;  5ACW A;  3SPU A;  4FR7 A;  2XF4 A;  1K07 A;  3IE1 A;  3X2X A;  3IDZ A;  3SD9 A;  2Q42 A;  4NQ4 A;  4F6H A;  2QED A;  3DHC A;  3MD7 A;  4WD6 A;  5A5Z A;  1X8H A;  3KL7 A;  1JT1 A;  2H6A A;  4XWW A;  5K4M A;  5IQK A;  3ZNB A;  4UWR B;  4TZE A;  4J5F A;  2WYM A;  1L9Y A;  2DKF A;  5EVB A;  4P62 A;  4EYF A;  3T9M A;  5FQC A;  3IEL A;  1KR3 A;  1MQO A;  5ACT A;  3TP9 A;  4XWT A;  2FU8 A;  4BP0 A;  2BG8 A;  5EW0 A;  4RL2 A;  4KEQ A;  4AD9 A;  4HKY A;  1HLK A;  4C09 A;  4RBS A;  2NYP A;  4ZNB A;  5AHR A;  5LCH A;  2WHG A;  1ZTC A;  2HB9 A;  1A8T A;  5HIO A;  4TZ9 A;  4YSK A;  1Y44 A;  3SFP A;  2FU7 A;  3L6N A;  4CHL A;  5ACV A;  1VJN A;  1X8I A;  2ZWR A;  3RKJ A;  2GCU A;  3IOF A;  4D02 A;  2P4Z A;  2BMI A;  3T3O A;  4EYB A;  4EY2 A;  5LSC A;  5B1U A;  2FU6 A;  4NQ6 A;  4UBQ A;  1XTO A;  1VGN A;  1X8G A;  2Q0I A;  2VW8 A;  1BC2 A;  2BG8 B;  3SW3 A;  1JJE A;  2I7T A;  2NZF A;  2Y8B A;  5LS3 A;  3I15 A;  5HH5 A;  4O98 A;  2FHX A;  2WRS A;  4RAW A;  3T3N A;  3BC2 A;  2BG6 A;  1DDK A;  1DXK A;  4EYL A;  2YNT B;  1YCG A;  4JO0 A;  5LCA A;  3IE2 A;  3WXC A;  4BZ3 A;  1YCH A;  3PG4 A;  5HH6 A;  1KO3 A;  2BC2 A;  4RM5 A;  4Z5Z A;  5K0W A;  3X2Z A;  3IEK A;  4EXS A;  5B15 A;  2BFL A;  5A87 A;  5AEB A;  1A7T A;  3I13 A;  3RPC A;  4C1F A;  2GKL A;  4U4L A;  4Z7R A;  3ESH A;  4UWS B;  3X30 A;  4Z6X A;  5HIQ A;  4PVT A;  5AXO A;  2UYX A;  5LMC A;  4F6Z A;  2OHI A;  2ZZI A;  1WRA A;  4RL0 A;  4H0D A;  4J5H A;  5HIP A;  1KO2 A;  2QDS A;  3I0V A;  3S0Z A;  3JXP A;  4FEK A;  1VME A;  4D1T A;  2FHX B;  4C1D A;  2YNU A;  5K4K A;  4TYF A;  1BVT A;  4V0H A;  4Z5Y A;  4FSB A;  2BG2 A;  5DPX A;  2YNT A;  1M2X A;  3Q6V A;  1QH5 A;  3F9O A;  2Q0J A;  5KIL A;  2QDT A;  5EV8 A;  3DHB A;  4RAM A;  2YCB A;  3VQZ A;  4C1C A;  2BFZ A;  4UA4 A;  5B3R A;  3SBL A;  2XR1 A;  4AX0 B;  3QH8 A;  5AYA A;  4ZEJ A;  2Y87 A;  3LVZ A;  5EVK A;  4UWO B;  3I14 A;  4DIK A;  2QJS A;  4GYQ A;  4D1V A;  3SRX A;  5HIS A;  3X2Y A;  3BV6 A;  1WUO A;  4ZO2 A;  4Z67 A;  3VPE A;  2P18 A;  1P9E A;  4UWP B;  2AZ4 A;  5ACX A;  4EXY A;  5EH9 A;  2M5C A;  2GFK A;  3AJ3 A;  5FQB A;  5AXR A;  4YSB A;  1WW1 A;  5HH4 A;  3AF5 A;  3ZR9 A;  2Y8A A;  5A0V A;  3ZWF A;  5ACU A;  4GCW A;  4KEP A;  1YCF A;  4PVO A;  2YNW A;  5ACP A;  2BFZ B;  4D1W A;  5LM6 A;  5LCF A;  4AWZ A;  1ZKP A;  4C1H A;  5ACS A;  5EVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...