2BTNA

Crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
242
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AIIA-LIKE PROTEIN
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 71
structure length 242
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2btnA01
4TZ9A 5ACRA 4RAMA 5LCFA 3FAIA 4ZO3A 1X8GA 3IE1A 3DHCA 4TZEA 2P18A 5A5ZA 1JJTA 3VQZA 5A87A 2BIBA 4RAWA 5AYAA 4UWOB 2WYLA 2ZZIA 4RBSA 4EYLA 3H3EA 2Q0JA 3VPEA 4PVOA 4EXYA 3JXPA 2DOOA 4YSKA 2I7XA 3ZR9A 5FQAA 2Q42A 4TYTA 3X30A 2WHGA 2DKFA 1ZKPA 2M5CA 1ZTCA 5EV8A 2YNWA 4D02A 3T3NA 4KEQA 3X2YA 3L6NA 2BFKA 3S0ZA 4UWPB 2NZFA 3BV6A 1YCGA 2Y8AA 3ZNBA 5EVBA 4AD9A 4C1FA 4Z6XA 2HB9A 3I13A 3MD7A 1HLKA 2YNVA 5ACVA 4NQ5A 4GYUA 3ESHA 5KIKA 1A7TA 2XF4A 4C1EA 4XWWA 3RKKA 2A7MA 4F6ZA 3IE0A 3I15A 2YNTA 4NQ4A 2FU9A 3IOFA 2P4ZA 2I7TA 2YNUA 4AX1B 1BVTA 4XWTA 3IOGA 3RKJA 4AWYB 1WW1A 5DPXA 4Z67A 5KILA 5HH4A 4AWZA 5HH6A 3PY6A 4Z7RA 4V0HA 5ACWA 5LSCA 3IELA 2GMNA 3KNRA 1A8TA 3X2ZA 3AF6A 2FHXB 2NXAA 5EV6A 2QINA 1K07A 1WRAA 1E5DA 1X8HA 3Q6VA 2AZ4A 1M2XA 2QDTA 2NYPA 5AHOA 3X2XA 3LVZA 2GFJA 2BMIA 2XR1A 2M5DA 2QJSA 2YNTB 5B1UA 2GCUA 2Q0IA 3IE2A 2ZWRA 5A0VA 4C09A 5ACQA 3WXCA 4PVTA 2NZEA 4GYQA 3BK1A 3IDZA 1SMLA 1YCFA 1DD6A 4AX0B 3IEKA 2FM6A 3F9OA 3P2UA 3PG4A 5IQKA 2BFZB 5HIOA 4Z5YA 5EWAA 2GKLA 4FSBA 3R2UA 1P9EA 4DIKA 1QH3A 3I11A 4CHLA 2WYMA 2ZO4A 4Z5ZA 3QH8A 2FHXA 3SFPA 5AEBA 4D1UA 5K4KA 5ACSA 4FEKA 1Y44A 5LCAA 2BG2A 3TP9A 2UYXA 2Y8BA 4RL0A 3BK2A 1DDKA 4YSBA 2H6AA 4C1CA 4O98A 2BC2A 2Q9UA 4EXSA 4HKYA 4H0DA 1L9YA 4NQ2A 4UAMA 4EYFA 1DXKA 4U4LA 1BC2A 2BG6A 4C1GA 3A4YA 4F6HA 2YCBA 4RM5A 4J5FA 5B3RA 2BFZA 1JJEA 3AF5A 5LM6A 3SW3A 4NQ6A 3FCZA 3DH8A 2ZNBA 3SD9A 1QH5A 4C1HA 4D1VA 2BR6A 4KEPA 2AIOA 2VW8A 2OHHA 3SBLA 5ACUA 5K4MA 4YSLA 4D1WA 4EYBA 1VMEA 1BMCA 1XTOA 3DHBA 5FQCA 3T3OA 1VGNA 5HIPA 4GCWA 4WD6A 4HL1A 1ZNBA 4EY2A 2WRSA 2QDSA 3SRXA 1MQOA 4JO0A 2BFLA 5LLDA 5AXRA 4UBQA 2FU7A 5HISA 5LE1A 2WYMC 2GFKA 5A0TA 4B87A 3T9MA 3BC2A 1X8IA 2BTNA 5EVDA 2P1EA 3PY5A 3AJ3A 3I0VA 1YCHA 1WUOA 4DILA 4UWSB 4RL2A 4EFZA 2BG8B 5ACPA 4BZ3A 2BG7A 3KL7A 5LS3A 4P62A 1KO3A 4ZEJA 1XM8A 3DHAA 5HIQA 1KR3A 3SPUA 5ACTA 5EW0A 4HL2A 2BGAA 4FR7A 2P97A 5B15A 4LE6A 3I14A 4J5HA 1JT1A 3G1PA 2I7VA 3ZQ4A 5ACXA 5AXOA 2FU8A 5EH9A 2OHIA 2E7YA 5FQBA 2OHJA 3ADRA 4UWRB 5LCHA 4ZNBA 4TZBA 5HH5A 5AHRA 5K4NA 3IEMA 2FU6A 2FK6A 2R2DA 4ZO2A 2Y87A 4BP0A 2YZ3A 4TZFA 4XUKA 4TYFA 5EVKA 2QEDA 3RPCA 1WUPA 5LMCA 4C1DA 5EHTA 2BG8A 4D1TA 5K0WA 4UA4A 2CBNA 1KO2A 1VJNA 4Z60A 3KNSA 3ZWFA 2YNVB
chains in the Genus database with same CATH superfamily
4TZ9A 5ACRA 4RAMA 5LCFA 3FAIA 4ZO3A 1X8GA 3IE1A 3DHCA 4TZEA 2P18A 5A5ZA 1JJTA 3VQZA 5A87A 2BIBA 4RAWA 5AYAA 4UWOB 2WYLA 2ZZIA 4RBSA 4EYLA 3H3EA 2Q0JA 3VPEA 4AXHA 4PVOA 4EXYA 3JXPA 2DOOA 4YSKA 2I7XA 3ZR9A 5FQAA 2Q42A 4TYTA 3X30A 2WHGA 2DKFA 1ZKPA 2M5CA 1ZTCA 5EV8A 2YNWA 4D02A 3T3NA 4KEQA 3X2YA 3L6NA 2BFKA 3S0ZA 4UWPB 2NZFA 3BV6A 1YCGA 2Y8AA 3ZNBA 5EVBA 4AD9A 4C1FA 4Z6XA 2HB9A 3I13A 3MD7A 1HLKA 2YNVA 5ACVA 4NQ5A 4GYUA 3ESHA 5KIKA 1A7TA 2XF4A 4C1EA 4XWWA 3RKKA 2A7MA 4F6ZA 3IE0A 3I15A 2YNTA 4NQ4A 2FU9A 3IOFA 5AJLA 2P4ZA 2I7TA 2YNUA 4AX1B 1BVTA 4XWTA 3IOGA 3RKJA 4AWYB 1WW1A 4PDXA 5DPXA 4Z67A 5KILA 5HH4A 4AWZA 5HH6A 3PY6A 4Z7RA 4V0HA 5ACWA 5LSCA 3IELA 2GMNA 3KNRA 1A8TA 3X2ZA 3AF6A 2FHXB 2NXAA 5EV6A 2QINA 1K07A 1WRAA 1E5DA 1X8HA 3Q6VA 2AZ4A 2CFZA 1M2XA 2QDTA 2NYPA 5AHOA 3X2XA 3LVZA 2GFJA 2BMIA 2XR1A 2M5DA 2QJSA 2YNTB 5B1UA 2GCUA 2Q0IA 3IE2A 2ZWRA 5A0VA 4C09A 5ACQA 3WXCA 4PVTA 2NZEA 4GYQA 3BK1A 3IDZA 1SMLA 1YCFA 1DD6A 4AX0B 3IEKA 2FM6A 3F9OA 3P2UA 3PG4A 5IQKA 2BFZB 5HIOA 4Z5YA 5EWAA 2GKLA 4FSBA 3R2UA 1P9EA 4DIKA 1QH3A 3I11A 4CHLA 2WYMA 2ZO4A 4Z5ZA 3QH8A 2FHXA 3SFPA 5AEBA 4D1UA 5K4KA 5ACSA 4FEKA 1Y44A 5LCAA 2BG2A 3TP9A 2UYXA 2Y8BA 4RL0A 3BK2A 5A23A 1DDKA 4YSBA 2H6AA 4C1CA 4O98A 2BC2A 2Q9UA 2CFUA 4EXSA 4HKYA 4H0DA 2CG3A 1L9YA 4NQ2A 4UAMA 4EYFA 1DXKA 4U4LA 1BC2A 2BG6A 4C1GA 3A4YA 4F6HA 2YCBA 4RM5A 4J5FA 5B3RA 2BFZA 1JJEA 3AF5A 5LM6A 3SW3A 4NQ6A 3FCZA 3DH8A 2ZNBA 3SD9A 1QH5A 4C1HA 4D1VA 2BR6A 4KEPA 2AIOA 2VW8A 2OHHA 3SBLA 5ACUA 5K4MA 4YSLA 4D1WA 4EYBA 1VMEA 1BMCA 1XTOA 3DHBA 5FQCA 3T3OA 1VGNA 5HIPA 4GCWA 4WD6A 4HL1A 1ZNBA 4EY2A 2WRSA 2QDSA 3SRXA 1MQOA 4JO0A 2BFLA 5LLDA 5AXRA 4UBQA 2FU7A 5HISA 5LE1A 4AV7A 2WYMC 2GFKA 5A0TA 4B87A 3T9MA 3BC2A 1X8IA 2BTNA 5EVDA 2P1EA 3PY5A 3AJ3A 3I0VA 1YCHA 1WUOA 4DILA 4UWSB 4RL2A 4EFZA 2BG8B 5ACPA 4BZ3A 2BG7A 3KL7A 5LS3A 4P62A 1KO3A 4ZEJA 1XM8A 3DHAA 2YHEA 5HIQA 1KR3A 3SPUA 5ACTA 5EW0A 4HL2A 2BGAA 4FR7A 4NURA 2P97A 5B15A 4LE6A 3I14A 4J5HA 1JT1A 5AIJA 3G1PA 2I7VA 3ZQ4A 5ACXA 5AXOA 2FU8A 5EH9A 2OHIA 2E7YA 5FQBA 2OHJA 3ADRA 4UWRB 5LCHA 4ZNBA 4TZBA 5HH5A 5AHRA 5K4NA 3IEMA 2CG2A 2FU6A 2FK6A 2R2DA 4ZO2A 2Y87A 4BP0A 2YZ3A 4TZFA 4XUKA 4TYFA 5EVKA 2QEDA 3RPCA 1WUPA 5LMCA 4C1DA 5EHTA 2BG8A 4D1TA 5K0WA 4UA4A 2CBNA 1KO2A 1VJNA 4Z60A 3KNSA 3ZWFA 2YNVB
chains in the Genus database with same CATH topology
4TZ9A 5ACRA 4RAMA 5LCFA 3FAIA 4ZO3A 1X8GA 3IE1A 3DHCA 4TZEA 2P18A 5A5ZA 1JJTA 3VQZA 5A87A 2BIBA 4RAWA 5AYAA 4UWOB 2WYLA 2ZZIA 4RBSA 4EYLA 3H3EA 2Q0JA 3VPEA 4PVOA 4EXYA 3JXPA 2DOOA 4YSKA 2I7XA 3ZR9A 5FQAA 2Q42A 4TYTA 3X30A 2WHGA 2DKFA 1ZKPA 2M5CA 1ZTCA 5EV8A 2YNWA 4D02A 3T3NA 4KEQA 3X2YA 3L6NA 2BFKA 3S0ZA 4UWPB 2NZFA 3BV6A 1YCGA 2Y8AA 3ZNBA 5EVBA 4AD9A 4C1FA 4Z6XA 2HB9A 3I13A 3MD7A 1HLKA 2YNVA 5ACVA 4NQ5A 4GYUA 3ESHA 5KIKA 1A7TA 2XF4A 4C1EA 4XWWA 3RKKA 2A7MA 4F6ZA 3IE0A 3I15A 2YNTA 4NQ4A 2FU9A 3IOFA 2P4ZA 2I7TA 2YNUA 4AX1B 1BVTA 4XWTA 3IOGA 3RKJA 4AWYB 1WW1A 5DPXA 4Z67A 5KILA 5HH4A 4AWZA 5HH6A 3PY6A 4Z7RA 4V0HA 5ACWA 5LSCA 3IELA 2GMNA 3KNRA 1A8TA 3X2ZA 3AF6A 2FHXB 2NXAA 5EV6A 2QINA 1K07A 1WRAA 1E5DA 1X8HA 3Q6VA 2AZ4A 1M2XA 2QDTA 2NYPA 5AHOA 3X2XA 3LVZA 2GFJA 2BMIA 2XR1A 2M5DA 2QJSA 2YNTB 5B1UA 2GCUA 2Q0IA 3IE2A 2ZWRA 5A0VA 4C09A 5ACQA 3WXCA 4PVTA 2NZEA 4GYQA 3BK1A 3IDZA 1SMLA 1YCFA 1DD6A 4AX0B 3IEKA 2FM6A 3F9OA 3P2UA 3PG4A 5IQKA 2BFZB 5HIOA 4Z5YA 5EWAA 2GKLA 4FSBA 3R2UA 1P9EA 4DIKA 1QH3A 3I11A 4CHLA 2WYMA 2ZO4A 4Z5ZA 3QH8A 2FHXA 3SFPA 5AEBA 4D1UA 5K4KA 5ACSA 4FEKA 1Y44A 5LCAA 2BG2A 3TP9A 2UYXA 2Y8BA 4RL0A 3BK2A 1DDKA 4YSBA 2H6AA 4C1CA 4O98A 2BC2A 2Q9UA 4EXSA 4HKYA 4H0DA 1L9YA 4NQ2A 4UAMA 4EYFA 1DXKA 4U4LA 1BC2A 2BG6A 4C1GA 3A4YA 4F6HA 2YCBA 4RM5A 4J5FA 5B3RA 2BFZA 1JJEA 3AF5A 5LM6A 3SW3A 4NQ6A 3FCZA 3DH8A 2ZNBA 3SD9A 1QH5A 4C1HA 4D1VA 2BR6A 4KEPA 2AIOA 2VW8A 2OHHA 3SBLA 5ACUA 5K4MA 4YSLA 4D1WA 4EYBA 1VMEA 1BMCA 1XTOA 3DHBA 5FQCA 3T3OA 1VGNA 5HIPA 4GCWA 4WD6A 4HL1A 1ZNBA 4EY2A 2WRSA 2QDSA 3SRXA 1MQOA 4JO0A 2BFLA 5LLDA 5AXRA 4UBQA 2FU7A 5HISA 5LE1A 2WYMC 2GFKA 5A0TA 4B87A 3T9MA 3BC2A 1X8IA 2BTNA 5EVDA 2P1EA 3PY5A 3AJ3A 3I0VA 1YCHA 1WUOA 4DILA 4UWSB 4RL2A 4EFZA 2BG8B 5ACPA 4BZ3A 2BG7A 3KL7A 5LS3A 4P62A 1KO3A 4ZEJA 1XM8A 3DHAA 5HIQA 1KR3A 3SPUA 5ACTA 5EW0A 4HL2A 2BGAA 4FR7A 2P97A 5B15A 4LE6A 3I14A 4J5HA 1JT1A 3G1PA 2I7VA 3ZQ4A 5ACXA 5AXOA 2FU8A 5EH9A 2OHIA 2E7YA 5FQBA 2OHJA 3ADRA 4UWRB 5LCHA 4ZNBA 4TZBA 5HH5A 5AHRA 5K4NA 3IEMA 2FU6A 2FK6A 2R2DA 4ZO2A 2Y87A 4BP0A 2YZ3A 4TZFA 4XUKA 4TYFA 5EVKA 2QEDA 3RPCA 1WUPA 5LMCA 4C1DA 5EHTA 2BG8A 4D1TA 5K0WA 4UA4A 2CBNA 1KO2A 1VJNA 4Z60A 3KNSA 3ZWFA 2YNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZ9 A;  5ACR A;  4RAM A;  5LCF A;  3FAI A;  4ZO3 A;  1X8G A;  3IE1 A;  3DHC A;  4TZE A;  2P18 A;  5A5Z A;  1JJT A;  3VQZ A;  5A87 A;  2BIB A;  4RAW A;  5AYA A;  4UWO B;  2WYL A;  2ZZI A;  4RBS A;  4EYL A;  3H3E A;  2Q0J A;  3VPE A;  4PVO A;  4EXY A;  3JXP A;  2DOO A;  4YSK A;  2I7X A;  3ZR9 A;  5FQA A;  2Q42 A;  4TYT A;  3X30 A;  2WHG A;  2DKF A;  1ZKP A;  2M5C A;  1ZTC A;  5EV8 A;  2YNW A;  4D02 A;  3T3N A;  4KEQ A;  3X2Y A;  3L6N A;  2BFK A;  3S0Z A;  4UWP B;  2NZF A;  3BV6 A;  1YCG A;  2Y8A A;  3ZNB A;  5EVB A;  4AD9 A;  4C1F A;  4Z6X A;  2HB9 A;  3I13 A;  3MD7 A;  1HLK A;  2YNV A;  5ACV A;  4NQ5 A;  4GYU A;  3ESH A;  5KIK A;  1A7T A;  2XF4 A;  4C1E A;  4XWW A;  3RKK A;  2A7M A;  4F6Z A;  3IE0 A;  3I15 A;  2YNT A;  4NQ4 A;  2FU9 A;  3IOF A;  2P4Z A;  2I7T A;  2YNU A;  4AX1 B;  1BVT A;  4XWT A;  3IOG A;  3RKJ A;  4AWY B;  1WW1 A;  5DPX A;  4Z67 A;  5KIL A;  5HH4 A;  4AWZ A;  5HH6 A;  3PY6 A;  4Z7R A;  4V0H A;  5ACW A;  5LSC A;  3IEL A;  2GMN A;  3KNR A;  1A8T A;  3X2Z A;  3AF6 A;  2FHX B;  2NXA A;  5EV6 A;  2QIN A;  1K07 A;  1WRA A;  1E5D A;  1X8H A;  3Q6V A;  2AZ4 A;  1M2X A;  2QDT A;  2NYP A;  5AHO A;  3X2X A;  3LVZ A;  2GFJ A;  2BMI A;  2XR1 A;  2M5D A;  2QJS A;  2YNT B;  5B1U A;  2GCU A;  2Q0I A;  3IE2 A;  2ZWR A;  5A0V A;  4C09 A;  5ACQ A;  3WXC A;  4PVT A;  2NZE A;  4GYQ A;  3BK1 A;  3IDZ A;  1SML A;  1YCF A;  1DD6 A;  4AX0 B;  3IEK A;  2FM6 A;  3F9O A;  3P2U A;  3PG4 A;  5IQK A;  2BFZ B;  5HIO A;  4Z5Y A;  5EWA A;  2GKL A;  4FSB A;  3R2U A;  1P9E A;  4DIK A;  1QH3 A;  3I11 A;  4CHL A;  2WYM A;  2ZO4 A;  4Z5Z A;  3QH8 A;  2FHX A;  3SFP A;  5AEB A;  4D1U A;  5K4K A;  5ACS A;  4FEK A;  1Y44 A;  5LCA A;  2BG2 A;  3TP9 A;  2UYX A;  2Y8B A;  4RL0 A;  3BK2 A;  1DDK A;  4YSB A;  2H6A A;  4C1C A;  4O98 A;  2BC2 A;  2Q9U A;  4EXS A;  4HKY A;  4H0D A;  1L9Y A;  4NQ2 A;  4UAM A;  4EYF A;  1DXK A;  4U4L A;  1BC2 A;  2BG6 A;  4C1G A;  3A4Y A;  4F6H A;  2YCB A;  4RM5 A;  4J5F A;  5B3R A;  2BFZ A;  1JJE A;  3AF5 A;  5LM6 A;  3SW3 A;  4NQ6 A;  3FCZ A;  3DH8 A;  2ZNB A;  3SD9 A;  1QH5 A;  4C1H A;  4D1V A;  2BR6 A;  4KEP A;  2AIO A;  2VW8 A;  2OHH A;  3SBL A;  5ACU A;  5K4M A;  4YSL A;  4D1W A;  4EYB A;  1VME A;  1BMC A;  1XTO A;  3DHB A;  5FQC A;  3T3O A;  1VGN A;  5HIP A;  4GCW A;  4WD6 A;  4HL1 A;  1ZNB A;  4EY2 A;  2WRS A;  2QDS A;  3SRX A;  1MQO A;  4JO0 A;  2BFL A;  5LLD A;  5AXR A;  4UBQ A;  2FU7 A;  5HIS A;  5LE1 A;  2WYM C;  2GFK A;  5A0T A;  4B87 A;  3T9M A;  3BC2 A;  1X8I A;  2BTN A;  5EVD A;  2P1E A;  3PY5 A;  3AJ3 A;  3I0V A;  1YCH A;  1WUO A;  4DIL A;  4UWS B;  4RL2 A;  4EFZ A;  2BG8 B;  5ACP A;  4BZ3 A;  2BG7 A;  3KL7 A;  5LS3 A;  4P62 A;  1KO3 A;  4ZEJ A;  1XM8 A;  3DHA A;  5HIQ A;  1KR3 A;  3SPU A;  5ACT A;  5EW0 A;  4HL2 A;  2BGA A;  4FR7 A;  2P97 A;  5B15 A;  4LE6 A;  3I14 A;  4J5H A;  1JT1 A;  3G1P A;  2I7V A;  3ZQ4 A;  5ACX A;  5AXO A;  2FU8 A;  5EH9 A;  2OHI A;  2E7Y A;  5FQB A;  2OHJ A;  3ADR A;  4UWR B;  5LCH A;  4ZNB A;  4TZB A;  5HH5 A;  5AHR A;  5K4N A;  3IEM A;  2FU6 A;  2FK6 A;  2R2D A;  4ZO2 A;  2Y87 A;  4BP0 A;  2YZ3 A;  4TZF A;  4XUK A;  4TYF A;  5EVK A;  2QED A;  3RPC A;  1WUP A;  5LMC A;  4C1D A;  5EHT A;  2BG8 A;  4D1T A;  5K0W A;  4UA4 A;  2CBN A;  1KO2 A;  1VJN A;  4Z60 A;  3KNS A;  3ZWF A;  2YNV B; 
#chains in the Genus database with same CATH topology
 4TZ9 A;  5ACR A;  4RAM A;  5LCF A;  3FAI A;  4ZO3 A;  1X8G A;  3IE1 A;  3DHC A;  4TZE A;  2P18 A;  5A5Z A;  1JJT A;  3VQZ A;  5A87 A;  2BIB A;  4RAW A;  5AYA A;  4UWO B;  2WYL A;  2ZZI A;  4RBS A;  4EYL A;  3H3E A;  2Q0J A;  3VPE A;  4AXH A;  4PVO A;  4EXY A;  3JXP A;  2DOO A;  4YSK A;  2I7X A;  3ZR9 A;  5FQA A;  2Q42 A;  4TYT A;  3X30 A;  2WHG A;  2DKF A;  1ZKP A;  2M5C A;  1ZTC A;  5EV8 A;  2YNW A;  4D02 A;  3T3N A;  4KEQ A;  3X2Y A;  3L6N A;  2BFK A;  3S0Z A;  4UWP B;  2NZF A;  3BV6 A;  1YCG A;  2Y8A A;  3ZNB A;  5EVB A;  4AD9 A;  4C1F A;  4Z6X A;  2HB9 A;  3I13 A;  3MD7 A;  1HLK A;  2YNV A;  5ACV A;  4NQ5 A;  4GYU A;  3ESH A;  5KIK A;  1A7T A;  2XF4 A;  4C1E A;  4XWW A;  3RKK A;  2A7M A;  4F6Z A;  3IE0 A;  3I15 A;  2YNT A;  4NQ4 A;  2FU9 A;  3IOF A;  5AJL A;  2P4Z A;  2I7T A;  2YNU A;  4AX1 B;  1BVT A;  4XWT A;  3IOG A;  3RKJ A;  4AWY B;  1WW1 A;  4PDX A;  5DPX A;  4Z67 A;  5KIL A;  5HH4 A;  4AWZ A;  5HH6 A;  3PY6 A;  4Z7R A;  4V0H A;  5ACW A;  5LSC A;  3IEL A;  2GMN A;  3KNR A;  1A8T A;  3X2Z A;  3AF6 A;  2FHX B;  2NXA A;  5EV6 A;  2QIN A;  1K07 A;  1WRA A;  1E5D A;  1X8H A;  3Q6V A;  2AZ4 A;  2CFZ A;  1M2X A;  2QDT A;  2NYP A;  5AHO A;  3X2X A;  3LVZ A;  2GFJ A;  2BMI A;  2XR1 A;  2M5D A;  2QJS A;  2YNT B;  5B1U A;  2GCU A;  2Q0I A;  3IE2 A;  2ZWR A;  5A0V A;  4C09 A;  5ACQ A;  3WXC A;  4PVT A;  2NZE A;  4GYQ A;  3BK1 A;  3IDZ A;  1SML A;  1YCF A;  1DD6 A;  4AX0 B;  3IEK A;  2FM6 A;  3F9O A;  3P2U A;  3PG4 A;  5IQK A;  2BFZ B;  5HIO A;  4Z5Y A;  5EWA A;  2GKL A;  4FSB A;  3R2U A;  1P9E A;  4DIK A;  1QH3 A;  3I11 A;  4CHL A;  2WYM A;  2ZO4 A;  4Z5Z A;  3QH8 A;  2FHX A;  3SFP A;  5AEB A;  4D1U A;  5K4K A;  5ACS A;  4FEK A;  1Y44 A;  5LCA A;  2BG2 A;  3TP9 A;  2UYX A;  2Y8B A;  4RL0 A;  3BK2 A;  5A23 A;  1DDK A;  4YSB A;  2H6A A;  4C1C A;  4O98 A;  2BC2 A;  2Q9U A;  2CFU A;  4EXS A;  4HKY A;  4H0D A;  2CG3 A;  1L9Y A;  4NQ2 A;  4UAM A;  4EYF A;  1DXK A;  4U4L A;  1BC2 A;  2BG6 A;  4C1G A;  3A4Y A;  4F6H A;  2YCB A;  4RM5 A;  4J5F A;  5B3R A;  2BFZ A;  1JJE A;  3AF5 A;  5LM6 A;  3SW3 A;  4NQ6 A;  3FCZ A;  3DH8 A;  2ZNB A;  3SD9 A;  1QH5 A;  4C1H A;  4D1V A;  2BR6 A;  4KEP A;  2AIO A;  2VW8 A;  2OHH A;  3SBL A;  5ACU A;  5K4M A;  4YSL A;  4D1W A;  4EYB A;  1VME A;  1BMC A;  1XTO A;  3DHB A;  5FQC A;  3T3O A;  1VGN A;  5HIP A;  4GCW A;  4WD6 A;  4HL1 A;  1ZNB A;  4EY2 A;  2WRS A;  2QDS A;  3SRX A;  1MQO A;  4JO0 A;  2BFL A;  5LLD A;  5AXR A;  4UBQ A;  2FU7 A;  5HIS A;  5LE1 A;  4AV7 A;  2WYM C;  2GFK A;  5A0T A;  4B87 A;  3T9M A;  3BC2 A;  1X8I A;  2BTN A;  5EVD A;  2P1E A;  3PY5 A;  3AJ3 A;  3I0V A;  1YCH A;  1WUO A;  4DIL A;  4UWS B;  4RL2 A;  4EFZ A;  2BG8 B;  5ACP A;  4BZ3 A;  2BG7 A;  3KL7 A;  5LS3 A;  4P62 A;  1KO3 A;  4ZEJ A;  1XM8 A;  3DHA A;  2YHE A;  5HIQ A;  1KR3 A;  3SPU A;  5ACT A;  5EW0 A;  4HL2 A;  2BGA A;  4FR7 A;  4NUR A;  2P97 A;  5B15 A;  4LE6 A;  3I14 A;  4J5H A;  1JT1 A;  5AIJ A;  3G1P A;  2I7V A;  3ZQ4 A;  5ACX A;  5AXO A;  2FU8 A;  5EH9 A;  2OHI A;  2E7Y A;  5FQB A;  2OHJ A;  3ADR A;  4UWR B;  5LCH A;  4ZNB A;  4TZB A;  5HH5 A;  5AHR A;  5K4N A;  3IEM A;  2CG2 A;  2FU6 A;  2FK6 A;  2R2D A;  4ZO2 A;  2Y87 A;  4BP0 A;  2YZ3 A;  4TZF A;  4XUK A;  4TYF A;  5EVK A;  2QED A;  3RPC A;  1WUP A;  5LMC A;  4C1D A;  5EHT A;  2BG8 A;  4D1T A;  5K0W A;  4UA4 A;  2CBN A;  1KO2 A;  1VJN A;  4Z60 A;  3KNS A;  3ZWF A;  2YNV B; 
#chains in the Genus database with same CATH homology
 4TZ9 A;  5ACR A;  4RAM A;  5LCF A;  3FAI A;  4ZO3 A;  1X8G A;  3IE1 A;  3DHC A;  4TZE A;  2P18 A;  5A5Z A;  1JJT A;  3VQZ A;  5A87 A;  2BIB A;  4RAW A;  5AYA A;  4UWO B;  2WYL A;  2ZZI A;  4RBS A;  4EYL A;  3H3E A;  2Q0J A;  3VPE A;  4PVO A;  4EXY A;  3JXP A;  2DOO A;  4YSK A;  2I7X A;  3ZR9 A;  5FQA A;  2Q42 A;  4TYT A;  3X30 A;  2WHG A;  2DKF A;  1ZKP A;  2M5C A;  1ZTC A;  5EV8 A;  2YNW A;  4D02 A;  3T3N A;  4KEQ A;  3X2Y A;  3L6N A;  2BFK A;  3S0Z A;  4UWP B;  2NZF A;  3BV6 A;  1YCG A;  2Y8A A;  3ZNB A;  5EVB A;  4AD9 A;  4C1F A;  4Z6X A;  2HB9 A;  3I13 A;  3MD7 A;  1HLK A;  2YNV A;  5ACV A;  4NQ5 A;  4GYU A;  3ESH A;  5KIK A;  1A7T A;  2XF4 A;  4C1E A;  4XWW A;  3RKK A;  2A7M A;  4F6Z A;  3IE0 A;  3I15 A;  2YNT A;  4NQ4 A;  2FU9 A;  3IOF A;  2P4Z A;  2I7T A;  2YNU A;  4AX1 B;  1BVT A;  4XWT A;  3IOG A;  3RKJ A;  4AWY B;  1WW1 A;  5DPX A;  4Z67 A;  5KIL A;  5HH4 A;  4AWZ A;  5HH6 A;  3PY6 A;  4Z7R A;  4V0H A;  5ACW A;  5LSC A;  3IEL A;  2GMN A;  3KNR A;  1A8T A;  3X2Z A;  3AF6 A;  2FHX B;  2NXA A;  5EV6 A;  2QIN A;  1K07 A;  1WRA A;  1E5D A;  1X8H A;  3Q6V A;  2AZ4 A;  1M2X A;  2QDT A;  2NYP A;  5AHO A;  3X2X A;  3LVZ A;  2GFJ A;  2BMI A;  2XR1 A;  2M5D A;  2QJS A;  2YNT B;  5B1U A;  2GCU A;  2Q0I A;  3IE2 A;  2ZWR A;  5A0V A;  4C09 A;  5ACQ A;  3WXC A;  4PVT A;  2NZE A;  4GYQ A;  3BK1 A;  3IDZ A;  1SML A;  1YCF A;  1DD6 A;  4AX0 B;  3IEK A;  2FM6 A;  3F9O A;  3P2U A;  3PG4 A;  5IQK A;  2BFZ B;  5HIO A;  4Z5Y A;  5EWA A;  2GKL A;  4FSB A;  3R2U A;  1P9E A;  4DIK A;  1QH3 A;  3I11 A;  4CHL A;  2WYM A;  2ZO4 A;  4Z5Z A;  3QH8 A;  2FHX A;  3SFP A;  5AEB A;  4D1U A;  5K4K A;  5ACS A;  4FEK A;  1Y44 A;  5LCA A;  2BG2 A;  3TP9 A;  2UYX A;  2Y8B A;  4RL0 A;  3BK2 A;  1DDK A;  4YSB A;  2H6A A;  4C1C A;  4O98 A;  2BC2 A;  2Q9U A;  4EXS A;  4HKY A;  4H0D A;  1L9Y A;  4NQ2 A;  4UAM A;  4EYF A;  1DXK A;  4U4L A;  1BC2 A;  2BG6 A;  4C1G A;  3A4Y A;  4F6H A;  2YCB A;  4RM5 A;  4J5F A;  5B3R A;  2BFZ A;  1JJE A;  3AF5 A;  5LM6 A;  3SW3 A;  4NQ6 A;  3FCZ A;  3DH8 A;  2ZNB A;  3SD9 A;  1QH5 A;  4C1H A;  4D1V A;  2BR6 A;  4KEP A;  2AIO A;  2VW8 A;  2OHH A;  3SBL A;  5ACU A;  5K4M A;  4YSL A;  4D1W A;  4EYB A;  1VME A;  1BMC A;  1XTO A;  3DHB A;  5FQC A;  3T3O A;  1VGN A;  5HIP A;  4GCW A;  4WD6 A;  4HL1 A;  1ZNB A;  4EY2 A;  2WRS A;  2QDS A;  3SRX A;  1MQO A;  4JO0 A;  2BFL A;  5LLD A;  5AXR A;  4UBQ A;  2FU7 A;  5HIS A;  5LE1 A;  2WYM C;  2GFK A;  5A0T A;  4B87 A;  3T9M A;  3BC2 A;  1X8I A;  2BTN A;  5EVD A;  2P1E A;  3PY5 A;  3AJ3 A;  3I0V A;  1YCH A;  1WUO A;  4DIL A;  4UWS B;  4RL2 A;  4EFZ A;  2BG8 B;  5ACP A;  4BZ3 A;  2BG7 A;  3KL7 A;  5LS3 A;  4P62 A;  1KO3 A;  4ZEJ A;  1XM8 A;  3DHA A;  5HIQ A;  1KR3 A;  3SPU A;  5ACT A;  5EW0 A;  4HL2 A;  2BGA A;  4FR7 A;  2P97 A;  5B15 A;  4LE6 A;  3I14 A;  4J5H A;  1JT1 A;  3G1P A;  2I7V A;  3ZQ4 A;  5ACX A;  5AXO A;  2FU8 A;  5EH9 A;  2OHI A;  2E7Y A;  5FQB A;  2OHJ A;  3ADR A;  4UWR B;  5LCH A;  4ZNB A;  4TZB A;  5HH5 A;  5AHR A;  5K4N A;  3IEM A;  2FU6 A;  2FK6 A;  2R2D A;  4ZO2 A;  2Y87 A;  4BP0 A;  2YZ3 A;  4TZF A;  4XUK A;  4TYF A;  5EVK A;  2QED A;  3RPC A;  1WUP A;  5LMC A;  4C1D A;  5EHT A;  2BG8 A;  4D1T A;  5K0W A;  4UA4 A;  2CBN A;  1KO2 A;  1VJN A;  4Z60 A;  3KNS A;  3ZWF A;  2YNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...