2BTNA

Crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
242
Chain Sequence
b'MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
molecule keywords AIIA-LIKE PROTEIN
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 71
structure length 242
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2btnA01
3SBLA 5K0WA 1YCFA 5ACQA 5ACPA 2BGAA 1DDKA 4TYFA 5AHOA 1ZTCA 5EW0A 1WUPA 3JXPA 1VMEA 4UWRB 4HL1A 3I14A 5ACWA 5EH9A 3IDZA 2Q0JA 2FHXB 5LM6A 1HLKA 3IE1A 2AIOA 3PY5A 3IEMA 1X8GA 4C1FA 4YSKA 4O98A 2GCUA 2DKFA 5EVDA 2Y8BA 1A8TA 4Z7RA 5EV8A 1ZKPA 5ACTA 4J5FA 4Z5ZA 1DD6A 3SPUA 4GYQA 4UAMA 2P1EA 3KL7A 4C1EA 3RPCA 5A87A 1JJTA 1VJNA 1BMCA 2NYPA 2P97A 4C1CA 5HISA 4FEKA 4PVOA 4NQ5A 2BC2A 4DILA 4F6ZA 3VPEA 5HIPA 1K07A 4EXSA 5ACXA 3L6NA 4NQ2A 4UA4A 4BP0A 3ZWFA 1JT1A 3T3OA 2P18A 4NQ4A 5A0TA 4D1WA 5K4KA 2M5CA 4RBSA 3I15A 2DOOA 4UWPB 4KEPA 2BG7A 3T3NA 2GFKA 2XR1A 4D1UA 5AXOA 5K4NA 2BG2A 4EYLA 1P9EA 1E5DA 3RKJA 1XTOA 2QJSA 1XM8A 2Y8AA 2FU9A 3R2UA 4BZ3A 1DXKA 5AXRA 3ZNBA 5LMCA 3LVZA 2I7XA 5LS3A 4XWTA 3DH8A 4NQ6A 3G1PA 5HIQA 5FQCA 5ACRA 2OHHA 2GFJA 5LE1A 1ZNBA 4RL2A 4F6HA 3QH8A 5LSCA 2ZO4A 1BC2A 3AF6A 1WW1A 4Z60A 2BFZB 1M2XA 3IOGA 1SMLA 2H6AA 3H3EA 4FR7A 2ZWRA 4D02A 2YNTB 1WRAA 1JJEA 4C09A 5IQKA 3Q6VA 5A0VA 2BG6A 4P62A 2BFKA 4RAWA 5LCAA 4HL2A 4RAMA 1KR3A 3SRXA 2WHGA 3F9OA 5HH4A 4PVTA 2YZ3A 2NZFA 3FCZA 2I7TA 5LCHA 2BR6A 2OHIA 3X2YA 5LLDA 1L9YA 3AF5A 5AHRA 4Z67A 4Z6XA 2Q9UA 5KILA 4AX1B 5HIOA 1A7TA 5HH6A 4KEQA 3DHAA 2Q0IA 4JO0A 4HKYA 4DIKA 1QH3A 3SFPA 2AZ4A 5EWAA 2FM6A 2YCBA 4V0HA 2Y87A 3IE2A 5FQAA 4H0DA 3SW3A 4AWYB 1KO2A 2QINA 4TZBA 2YNVA 3BK1A 5EHTA 4YSLA 3BV6A 5B15A 2FK6A 3A4YA 4GCWA 3WXCA 5K4MA 4UWSB 2VW8A 3PY6A 4XWWA 5DPXA 2GKLA 3I0VA 1WUOA 4GYUA 3AJ3A 5A5ZA 5EVKA 3FAIA 4YSBA 5ACSA 4C1HA 2WYMC 3KNRA 3PG4A 2YNUA 2BG8A 5HH5A 2YNWA 4AWZA 3ZR9A 5KIKA 4ZO2A 2R2DA 1QH5A 4B87A 1X8IA 2WYMA 2BFLA 4TZEA 4EYFA 3RKKA 5EV6A 3X2ZA 5ACUA 4RM5A 3S0ZA 2ZNBA 2QDSA 4CHLA 4TZ9A 2I7VA 2XF4A 2YNVB 4UWOB 3X30A 3KNSA 2FU8A 4AD9A 5FQBA 2M5DA 4D1VA 4D1TA 4EXYA 1MQOA 3MD7A 4EFZA 2NXAA 5B3RA 4J5HA 2WYLA 3VQZA 5ACVA 5AYAA 1BVTA 3X2XA 3ZQ4A 5EVBA 2QDTA 1KO3A 2BIBA 3BK2A 3IE0A 1YCGA 4ZEJA 2ZZIA 3P2UA 3I11A 1X8HA 4XUKA 2BTNA 4Z5YA 4C1GA 4UBQA 2BG8B 4AX0B 2GMNA 2P4ZA 4U4LA 2FU7A 2OHJA 2BFZA 2FHXA 2YNTA 3TP9A 3IEKA 4ZNBA 4FSBA 1YCHA 2HB9A 3ESHA 4EYBA 4WD6A 1VGNA 2E7YA 2NZEA 4ZO3A 3I13A 2BMIA 4TZFA 5B1UA 2UYXA 3BC2A 2WRSA 3DHBA 4LE6A 5LCFA 3SD9A 2QEDA 2FU6A 3IOFA 4RL0A 5AEBA 3IELA 2CBNA 3T9MA 1Y44A 2A7MA 3DHCA 2Q42A 4C1DA 4EY2A 4TYTA 3ADRA
chains in the Genus database with same CATH superfamily
3SBLA 5K0WA 1YCFA 5ACQA 5ACPA 2BGAA 1DDKA 4TYFA 5AHOA 5AIJA 1ZTCA 5EW0A 1WUPA 3JXPA 1VMEA 4UWRB 4HL1A 3I14A 5ACWA 5EH9A 3IDZA 2Q0JA 2FHXB 5LM6A 1HLKA 3IE1A 2AIOA 3PY5A 3IEMA 1X8GA 4C1FA 4YSKA 4O98A 2GCUA 2DKFA 5EVDA 2Y8BA 1A8TA 4Z7RA 5EV8A 1ZKPA 5ACTA 4J5FA 4Z5ZA 1DD6A 3SPUA 4GYQA 4UAMA 2P1EA 3KL7A 4C1EA 3RPCA 5A87A 1JJTA 1VJNA 1BMCA 2NYPA 2P97A 4C1CA 5HISA 4FEKA 4PVOA 4NQ5A 2BC2A 4DILA 4F6ZA 3VPEA 5HIPA 1K07A 4EXSA 4NURA 5ACXA 3L6NA 4NQ2A 4UA4A 4BP0A 3ZWFA 1JT1A 3T3OA 2P18A 4NQ4A 5A0TA 4D1WA 5K4KA 2M5CA 4RBSA 3I15A 2DOOA 4UWPB 4KEPA 2BG7A 3T3NA 2GFKA 2XR1A 4D1UA 5AXOA 5K4NA 2BG2A 4EYLA 1P9EA 1E5DA 3RKJA 1XTOA 2QJSA 1XM8A 2Y8AA 2FU9A 3R2UA 5AJLA 4PDXA 4BZ3A 1DXKA 2YHEA 5AXRA 3ZNBA 5LMCA 3LVZA 2I7XA 5LS3A 4XWTA 3DH8A 4NQ6A 3G1PA 5HIQA 2CFUA 5FQCA 5ACRA 2OHHA 2GFJA 5LE1A 1ZNBA 4RL2A 4F6HA 3QH8A 5LSCA 2ZO4A 1BC2A 3AF6A 1WW1A 4Z60A 2BFZB 1M2XA 3IOGA 1SMLA 2H6AA 3H3EA 4FR7A 2ZWRA 4D02A 2YNTB 1WRAA 1JJEA 4C09A 4AXHA 5IQKA 3Q6VA 5A0VA 2BG6A 4P62A 2BFKA 4RAWA 5LCAA 4HL2A 4RAMA 1KR3A 3SRXA 2WHGA 3F9OA 5HH4A 4PVTA 2YZ3A 2NZFA 3FCZA 2I7TA 5LCHA 2BR6A 2OHIA 3X2YA 5LLDA 1L9YA 3AF5A 5AHRA 4Z67A 4Z6XA 2Q9UA 5KILA 4AX1B 5HIOA 1A7TA 5HH6A 4KEQA 3DHAA 2Q0IA 4JO0A 4HKYA 4DIKA 1QH3A 3SFPA 2AZ4A 5EWAA 2FM6A 2YCBA 4V0HA 2Y87A 3IE2A 5FQAA 4H0DA 3SW3A 4AWYB 1KO2A 2QINA 4TZBA 2YNVA 3BK1A 5EHTA 4YSLA 3BV6A 5B15A 2FK6A 3A4YA 4GCWA 3WXCA 5K4MA 4UWSB 2VW8A 3PY6A 4AV7A 4XWWA 5DPXA 2GKLA 3I0VA 1WUOA 4GYUA 3AJ3A 5A23A 5A5ZA 5EVKA 3FAIA 4YSBA 5ACSA 4C1HA 2WYMC 3KNRA 3PG4A 2YNUA 2BG8A 5HH5A 2YNWA 4AWZA 3ZR9A 5KIKA 4ZO2A 2R2DA 1QH5A 4B87A 1X8IA 2WYMA 2BFLA 2CG2A 4TZEA 4EYFA 3RKKA 5EV6A 3X2ZA 5ACUA 4RM5A 3S0ZA 2ZNBA 2QDSA 4CHLA 4TZ9A 2I7VA 2XF4A 2YNVB 4UWOB 3X30A 3KNSA 2FU8A 4AD9A 5FQBA 2M5DA 4D1VA 4D1TA 4EXYA 1MQOA 3MD7A 4EFZA 2NXAA 5B3RA 4J5HA 2WYLA 3VQZA 5ACVA 5AYAA 1BVTA 3X2XA 3ZQ4A 5EVBA 2QDTA 1KO3A 2BIBA 3BK2A 3IE0A 1YCGA 4ZEJA 2ZZIA 3P2UA 3I11A 1X8HA 4XUKA 2BTNA 4Z5YA 4C1GA 4UBQA 2BG8B 4AX0B 2GMNA 2P4ZA 4U4LA 2FU7A 2OHJA 2BFZA 2FHXA 2YNTA 3TP9A 3IEKA 4ZNBA 4FSBA 1YCHA 2HB9A 3ESHA 4EYBA 4WD6A 1VGNA 2E7YA 2NZEA 4ZO3A 2CFZA 3I13A 2BMIA 2CG3A 4TZFA 5B1UA 2UYXA 3BC2A 2WRSA 3DHBA 4LE6A 5LCFA 3SD9A 2QEDA 2FU6A 3IOFA 4RL0A 5AEBA 3IELA 2CBNA 3T9MA 1Y44A 2A7MA 3DHCA 2Q42A 4C1DA 4EY2A 4TYTA 3ADRA
chains in the Genus database with same CATH topology
3SBLA 5K0WA 1YCFA 5ACQA 5ACPA 2BGAA 1DDKA 4TYFA 5AHOA 1ZTCA 5EW0A 1WUPA 3JXPA 1VMEA 4UWRB 4HL1A 3I14A 5ACWA 5EH9A 3IDZA 2Q0JA 2FHXB 5LM6A 1HLKA 3IE1A 2AIOA 3PY5A 3IEMA 1X8GA 4C1FA 4YSKA 4O98A 2GCUA 2DKFA 5EVDA 2Y8BA 1A8TA 4Z7RA 5EV8A 1ZKPA 5ACTA 4J5FA 4Z5ZA 1DD6A 3SPUA 4GYQA 4UAMA 2P1EA 3KL7A 4C1EA 3RPCA 5A87A 1JJTA 1VJNA 1BMCA 2NYPA 2P97A 4C1CA 5HISA 4FEKA 4PVOA 4NQ5A 2BC2A 4DILA 4F6ZA 3VPEA 5HIPA 1K07A 4EXSA 5ACXA 3L6NA 4NQ2A 4UA4A 4BP0A 3ZWFA 1JT1A 3T3OA 2P18A 4NQ4A 5A0TA 4D1WA 5K4KA 2M5CA 4RBSA 3I15A 2DOOA 4UWPB 4KEPA 2BG7A 3T3NA 2GFKA 2XR1A 4D1UA 5AXOA 5K4NA 2BG2A 4EYLA 1P9EA 1E5DA 3RKJA 1XTOA 2QJSA 1XM8A 2Y8AA 2FU9A 3R2UA 4BZ3A 1DXKA 5AXRA 3ZNBA 5LMCA 3LVZA 2I7XA 5LS3A 4XWTA 3DH8A 4NQ6A 3G1PA 5HIQA 5FQCA 5ACRA 2OHHA 2GFJA 5LE1A 1ZNBA 4RL2A 4F6HA 3QH8A 5LSCA 2ZO4A 1BC2A 3AF6A 1WW1A 4Z60A 2BFZB 1M2XA 3IOGA 1SMLA 2H6AA 3H3EA 4FR7A 2ZWRA 4D02A 2YNTB 1WRAA 1JJEA 4C09A 5IQKA 3Q6VA 5A0VA 2BG6A 4P62A 2BFKA 4RAWA 5LCAA 4HL2A 4RAMA 1KR3A 3SRXA 2WHGA 3F9OA 5HH4A 4PVTA 2YZ3A 2NZFA 3FCZA 2I7TA 5LCHA 2BR6A 2OHIA 3X2YA 5LLDA 1L9YA 3AF5A 5AHRA 4Z67A 4Z6XA 2Q9UA 5KILA 4AX1B 5HIOA 1A7TA 5HH6A 4KEQA 3DHAA 2Q0IA 4JO0A 4HKYA 4DIKA 1QH3A 3SFPA 2AZ4A 5EWAA 2FM6A 2YCBA 4V0HA 2Y87A 3IE2A 5FQAA 4H0DA 3SW3A 4AWYB 1KO2A 2QINA 4TZBA 2YNVA 3BK1A 5EHTA 4YSLA 3BV6A 5B15A 2FK6A 3A4YA 4GCWA 3WXCA 5K4MA 4UWSB 2VW8A 3PY6A 4XWWA 5DPXA 2GKLA 3I0VA 1WUOA 4GYUA 3AJ3A 5A5ZA 5EVKA 3FAIA 4YSBA 5ACSA 4C1HA 2WYMC 3KNRA 3PG4A 2YNUA 2BG8A 5HH5A 2YNWA 4AWZA 3ZR9A 5KIKA 4ZO2A 2R2DA 1QH5A 4B87A 1X8IA 2WYMA 2BFLA 4TZEA 4EYFA 3RKKA 5EV6A 3X2ZA 5ACUA 4RM5A 3S0ZA 2ZNBA 2QDSA 4CHLA 4TZ9A 2I7VA 2XF4A 2YNVB 4UWOB 3X30A 3KNSA 2FU8A 4AD9A 5FQBA 2M5DA 4D1VA 4D1TA 4EXYA 1MQOA 3MD7A 4EFZA 2NXAA 5B3RA 4J5HA 2WYLA 3VQZA 5ACVA 5AYAA 1BVTA 3X2XA 3ZQ4A 5EVBA 2QDTA 1KO3A 2BIBA 3BK2A 3IE0A 1YCGA 4ZEJA 2ZZIA 3P2UA 3I11A 1X8HA 4XUKA 2BTNA 4Z5YA 4C1GA 4UBQA 2BG8B 4AX0B 2GMNA 2P4ZA 4U4LA 2FU7A 2OHJA 2BFZA 2FHXA 2YNTA 3TP9A 3IEKA 4ZNBA 4FSBA 1YCHA 2HB9A 3ESHA 4EYBA 4WD6A 1VGNA 2E7YA 2NZEA 4ZO3A 3I13A 2BMIA 4TZFA 5B1UA 2UYXA 3BC2A 2WRSA 3DHBA 4LE6A 5LCFA 3SD9A 2QEDA 2FU6A 3IOFA 4RL0A 5AEBA 3IELA 2CBNA 3T9MA 1Y44A 2A7MA 3DHCA 2Q42A 4C1DA 4EY2A 4TYTA 3ADRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBL A;  5K0W A;  1YCF A;  5ACQ A;  5ACP A;  2BGA A;  1DDK A;  4TYF A;  5AHO A;  1ZTC A;  5EW0 A;  1WUP A;  3JXP A;  1VME A;  4UWR B;  4HL1 A;  3I14 A;  5ACW A;  5EH9 A;  3IDZ A;  2Q0J A;  2FHX B;  5LM6 A;  1HLK A;  3IE1 A;  2AIO A;  3PY5 A;  3IEM A;  1X8G A;  4C1F A;  4YSK A;  4O98 A;  2GCU A;  2DKF A;  5EVD A;  2Y8B A;  1A8T A;  4Z7R A;  5EV8 A;  1ZKP A;  5ACT A;  4J5F A;  4Z5Z A;  1DD6 A;  3SPU A;  4GYQ A;  4UAM A;  2P1E A;  3KL7 A;  4C1E A;  3RPC A;  5A87 A;  1JJT A;  1VJN A;  1BMC A;  2NYP A;  2P97 A;  4C1C A;  5HIS A;  4FEK A;  4PVO A;  4NQ5 A;  2BC2 A;  4DIL A;  4F6Z A;  3VPE A;  5HIP A;  1K07 A;  4EXS A;  5ACX A;  3L6N A;  4NQ2 A;  4UA4 A;  4BP0 A;  3ZWF A;  1JT1 A;  3T3O A;  2P18 A;  4NQ4 A;  5A0T A;  4D1W A;  5K4K A;  2M5C A;  4RBS A;  3I15 A;  2DOO A;  4UWP B;  4KEP A;  2BG7 A;  3T3N A;  2GFK A;  2XR1 A;  4D1U A;  5AXO A;  5K4N A;  2BG2 A;  4EYL A;  1P9E A;  1E5D A;  3RKJ A;  1XTO A;  2QJS A;  1XM8 A;  2Y8A A;  2FU9 A;  3R2U A;  4BZ3 A;  1DXK A;  5AXR A;  3ZNB A;  5LMC A;  3LVZ A;  2I7X A;  5LS3 A;  4XWT A;  3DH8 A;  4NQ6 A;  3G1P A;  5HIQ A;  5FQC A;  5ACR A;  2OHH A;  2GFJ A;  5LE1 A;  1ZNB A;  4RL2 A;  4F6H A;  3QH8 A;  5LSC A;  2ZO4 A;  1BC2 A;  3AF6 A;  1WW1 A;  4Z60 A;  2BFZ B;  1M2X A;  3IOG A;  1SML A;  2H6A A;  3H3E A;  4FR7 A;  2ZWR A;  4D02 A;  2YNT B;  1WRA A;  1JJE A;  4C09 A;  5IQK A;  3Q6V A;  5A0V A;  2BG6 A;  4P62 A;  2BFK A;  4RAW A;  5LCA A;  4HL2 A;  4RAM A;  1KR3 A;  3SRX A;  2WHG A;  3F9O A;  5HH4 A;  4PVT A;  2YZ3 A;  2NZF A;  3FCZ A;  2I7T A;  5LCH A;  2BR6 A;  2OHI A;  3X2Y A;  5LLD A;  1L9Y A;  3AF5 A;  5AHR A;  4Z67 A;  4Z6X A;  2Q9U A;  5KIL A;  4AX1 B;  5HIO A;  1A7T A;  5HH6 A;  4KEQ A;  3DHA A;  2Q0I A;  4JO0 A;  4HKY A;  4DIK A;  1QH3 A;  3SFP A;  2AZ4 A;  5EWA A;  2FM6 A;  2YCB A;  4V0H A;  2Y87 A;  3IE2 A;  5FQA A;  4H0D A;  3SW3 A;  4AWY B;  1KO2 A;  2QIN A;  4TZB A;  2YNV A;  3BK1 A;  5EHT A;  4YSL A;  3BV6 A;  5B15 A;  2FK6 A;  3A4Y A;  4GCW A;  3WXC A;  5K4M A;  4UWS B;  2VW8 A;  3PY6 A;  4XWW A;  5DPX A;  2GKL A;  3I0V A;  1WUO A;  4GYU A;  3AJ3 A;  5A5Z A;  5EVK A;  3FAI A;  4YSB A;  5ACS A;  4C1H A;  2WYM C;  3KNR A;  3PG4 A;  2YNU A;  2BG8 A;  5HH5 A;  2YNW A;  4AWZ A;  3ZR9 A;  5KIK A;  4ZO2 A;  2R2D A;  1QH5 A;  4B87 A;  1X8I A;  2WYM A;  2BFL A;  4TZE A;  4EYF A;  3RKK A;  5EV6 A;  3X2Z A;  5ACU A;  4RM5 A;  3S0Z A;  2ZNB A;  2QDS A;  4CHL A;  4TZ9 A;  2I7V A;  2XF4 A;  2YNV B;  4UWO B;  3X30 A;  3KNS A;  2FU8 A;  4AD9 A;  5FQB A;  2M5D A;  4D1V A;  4D1T A;  4EXY A;  1MQO A;  3MD7 A;  4EFZ A;  2NXA A;  5B3R A;  4J5H A;  2WYL A;  3VQZ A;  5ACV A;  5AYA A;  1BVT A;  3X2X A;  3ZQ4 A;  5EVB A;  2QDT A;  1KO3 A;  2BIB A;  3BK2 A;  3IE0 A;  1YCG A;  4ZEJ A;  2ZZI A;  3P2U A;  3I11 A;  1X8H A;  4XUK A;  2BTN A;  4Z5Y A;  4C1G A;  4UBQ A;  2BG8 B;  4AX0 B;  2GMN A;  2P4Z A;  4U4L A;  2FU7 A;  2OHJ A;  2BFZ A;  2FHX A;  2YNT A;  3TP9 A;  3IEK A;  4ZNB A;  4FSB A;  1YCH A;  2HB9 A;  3ESH A;  4EYB A;  4WD6 A;  1VGN A;  2E7Y A;  2NZE A;  4ZO3 A;  3I13 A;  2BMI A;  4TZF A;  5B1U A;  2UYX A;  3BC2 A;  2WRS A;  3DHB A;  4LE6 A;  5LCF A;  3SD9 A;  2QED A;  2FU6 A;  3IOF A;  4RL0 A;  5AEB A;  3IEL A;  2CBN A;  3T9M A;  1Y44 A;  2A7M A;  3DHC A;  2Q42 A;  4C1D A;  4EY2 A;  4TYT A;  3ADR A; 
#chains in the Genus database with same CATH topology
 3SBL A;  5K0W A;  1YCF A;  5ACQ A;  5ACP A;  2BGA A;  1DDK A;  4TYF A;  5AHO A;  5AIJ A;  1ZTC A;  5EW0 A;  1WUP A;  3JXP A;  1VME A;  4UWR B;  4HL1 A;  3I14 A;  5ACW A;  5EH9 A;  3IDZ A;  2Q0J A;  2FHX B;  5LM6 A;  1HLK A;  3IE1 A;  2AIO A;  3PY5 A;  3IEM A;  1X8G A;  4C1F A;  4YSK A;  4O98 A;  2GCU A;  2DKF A;  5EVD A;  2Y8B A;  1A8T A;  4Z7R A;  5EV8 A;  1ZKP A;  5ACT A;  4J5F A;  4Z5Z A;  1DD6 A;  3SPU A;  4GYQ A;  4UAM A;  2P1E A;  3KL7 A;  4C1E A;  3RPC A;  5A87 A;  1JJT A;  1VJN A;  1BMC A;  2NYP A;  2P97 A;  4C1C A;  5HIS A;  4FEK A;  4PVO A;  4NQ5 A;  2BC2 A;  4DIL A;  4F6Z A;  3VPE A;  5HIP A;  1K07 A;  4EXS A;  4NUR A;  5ACX A;  3L6N A;  4NQ2 A;  4UA4 A;  4BP0 A;  3ZWF A;  1JT1 A;  3T3O A;  2P18 A;  4NQ4 A;  5A0T A;  4D1W A;  5K4K A;  2M5C A;  4RBS A;  3I15 A;  2DOO A;  4UWP B;  4KEP A;  2BG7 A;  3T3N A;  2GFK A;  2XR1 A;  4D1U A;  5AXO A;  5K4N A;  2BG2 A;  4EYL A;  1P9E A;  1E5D A;  3RKJ A;  1XTO A;  2QJS A;  1XM8 A;  2Y8A A;  2FU9 A;  3R2U A;  5AJL A;  4PDX A;  4BZ3 A;  1DXK A;  2YHE A;  5AXR A;  3ZNB A;  5LMC A;  3LVZ A;  2I7X A;  5LS3 A;  4XWT A;  3DH8 A;  4NQ6 A;  3G1P A;  5HIQ A;  2CFU A;  5FQC A;  5ACR A;  2OHH A;  2GFJ A;  5LE1 A;  1ZNB A;  4RL2 A;  4F6H A;  3QH8 A;  5LSC A;  2ZO4 A;  1BC2 A;  3AF6 A;  1WW1 A;  4Z60 A;  2BFZ B;  1M2X A;  3IOG A;  1SML A;  2H6A A;  3H3E A;  4FR7 A;  2ZWR A;  4D02 A;  2YNT B;  1WRA A;  1JJE A;  4C09 A;  4AXH A;  5IQK A;  3Q6V A;  5A0V A;  2BG6 A;  4P62 A;  2BFK A;  4RAW A;  5LCA A;  4HL2 A;  4RAM A;  1KR3 A;  3SRX A;  2WHG A;  3F9O A;  5HH4 A;  4PVT A;  2YZ3 A;  2NZF A;  3FCZ A;  2I7T A;  5LCH A;  2BR6 A;  2OHI A;  3X2Y A;  5LLD A;  1L9Y A;  3AF5 A;  5AHR A;  4Z67 A;  4Z6X A;  2Q9U A;  5KIL A;  4AX1 B;  5HIO A;  1A7T A;  5HH6 A;  4KEQ A;  3DHA A;  2Q0I A;  4JO0 A;  4HKY A;  4DIK A;  1QH3 A;  3SFP A;  2AZ4 A;  5EWA A;  2FM6 A;  2YCB A;  4V0H A;  2Y87 A;  3IE2 A;  5FQA A;  4H0D A;  3SW3 A;  4AWY B;  1KO2 A;  2QIN A;  4TZB A;  2YNV A;  3BK1 A;  5EHT A;  4YSL A;  3BV6 A;  5B15 A;  2FK6 A;  3A4Y A;  4GCW A;  3WXC A;  5K4M A;  4UWS B;  2VW8 A;  3PY6 A;  4AV7 A;  4XWW A;  5DPX A;  2GKL A;  3I0V A;  1WUO A;  4GYU A;  3AJ3 A;  5A23 A;  5A5Z A;  5EVK A;  3FAI A;  4YSB A;  5ACS A;  4C1H A;  2WYM C;  3KNR A;  3PG4 A;  2YNU A;  2BG8 A;  5HH5 A;  2YNW A;  4AWZ A;  3ZR9 A;  5KIK A;  4ZO2 A;  2R2D A;  1QH5 A;  4B87 A;  1X8I A;  2WYM A;  2BFL A;  2CG2 A;  4TZE A;  4EYF A;  3RKK A;  5EV6 A;  3X2Z A;  5ACU A;  4RM5 A;  3S0Z A;  2ZNB A;  2QDS A;  4CHL A;  4TZ9 A;  2I7V A;  2XF4 A;  2YNV B;  4UWO B;  3X30 A;  3KNS A;  2FU8 A;  4AD9 A;  5FQB A;  2M5D A;  4D1V A;  4D1T A;  4EXY A;  1MQO A;  3MD7 A;  4EFZ A;  2NXA A;  5B3R A;  4J5H A;  2WYL A;  3VQZ A;  5ACV A;  5AYA A;  1BVT A;  3X2X A;  3ZQ4 A;  5EVB A;  2QDT A;  1KO3 A;  2BIB A;  3BK2 A;  3IE0 A;  1YCG A;  4ZEJ A;  2ZZI A;  3P2U A;  3I11 A;  1X8H A;  4XUK A;  2BTN A;  4Z5Y A;  4C1G A;  4UBQ A;  2BG8 B;  4AX0 B;  2GMN A;  2P4Z A;  4U4L A;  2FU7 A;  2OHJ A;  2BFZ A;  2FHX A;  2YNT A;  3TP9 A;  3IEK A;  4ZNB A;  4FSB A;  1YCH A;  2HB9 A;  3ESH A;  4EYB A;  4WD6 A;  1VGN A;  2E7Y A;  2NZE A;  4ZO3 A;  2CFZ A;  3I13 A;  2BMI A;  2CG3 A;  4TZF A;  5B1U A;  2UYX A;  3BC2 A;  2WRS A;  3DHB A;  4LE6 A;  5LCF A;  3SD9 A;  2QED A;  2FU6 A;  3IOF A;  4RL0 A;  5AEB A;  3IEL A;  2CBN A;  3T9M A;  1Y44 A;  2A7M A;  3DHC A;  2Q42 A;  4C1D A;  4EY2 A;  4TYT A;  3ADR A; 
#chains in the Genus database with same CATH homology
 3SBL A;  5K0W A;  1YCF A;  5ACQ A;  5ACP A;  2BGA A;  1DDK A;  4TYF A;  5AHO A;  1ZTC A;  5EW0 A;  1WUP A;  3JXP A;  1VME A;  4UWR B;  4HL1 A;  3I14 A;  5ACW A;  5EH9 A;  3IDZ A;  2Q0J A;  2FHX B;  5LM6 A;  1HLK A;  3IE1 A;  2AIO A;  3PY5 A;  3IEM A;  1X8G A;  4C1F A;  4YSK A;  4O98 A;  2GCU A;  2DKF A;  5EVD A;  2Y8B A;  1A8T A;  4Z7R A;  5EV8 A;  1ZKP A;  5ACT A;  4J5F A;  4Z5Z A;  1DD6 A;  3SPU A;  4GYQ A;  4UAM A;  2P1E A;  3KL7 A;  4C1E A;  3RPC A;  5A87 A;  1JJT A;  1VJN A;  1BMC A;  2NYP A;  2P97 A;  4C1C A;  5HIS A;  4FEK A;  4PVO A;  4NQ5 A;  2BC2 A;  4DIL A;  4F6Z A;  3VPE A;  5HIP A;  1K07 A;  4EXS A;  5ACX A;  3L6N A;  4NQ2 A;  4UA4 A;  4BP0 A;  3ZWF A;  1JT1 A;  3T3O A;  2P18 A;  4NQ4 A;  5A0T A;  4D1W A;  5K4K A;  2M5C A;  4RBS A;  3I15 A;  2DOO A;  4UWP B;  4KEP A;  2BG7 A;  3T3N A;  2GFK A;  2XR1 A;  4D1U A;  5AXO A;  5K4N A;  2BG2 A;  4EYL A;  1P9E A;  1E5D A;  3RKJ A;  1XTO A;  2QJS A;  1XM8 A;  2Y8A A;  2FU9 A;  3R2U A;  4BZ3 A;  1DXK A;  5AXR A;  3ZNB A;  5LMC A;  3LVZ A;  2I7X A;  5LS3 A;  4XWT A;  3DH8 A;  4NQ6 A;  3G1P A;  5HIQ A;  5FQC A;  5ACR A;  2OHH A;  2GFJ A;  5LE1 A;  1ZNB A;  4RL2 A;  4F6H A;  3QH8 A;  5LSC A;  2ZO4 A;  1BC2 A;  3AF6 A;  1WW1 A;  4Z60 A;  2BFZ B;  1M2X A;  3IOG A;  1SML A;  2H6A A;  3H3E A;  4FR7 A;  2ZWR A;  4D02 A;  2YNT B;  1WRA A;  1JJE A;  4C09 A;  5IQK A;  3Q6V A;  5A0V A;  2BG6 A;  4P62 A;  2BFK A;  4RAW A;  5LCA A;  4HL2 A;  4RAM A;  1KR3 A;  3SRX A;  2WHG A;  3F9O A;  5HH4 A;  4PVT A;  2YZ3 A;  2NZF A;  3FCZ A;  2I7T A;  5LCH A;  2BR6 A;  2OHI A;  3X2Y A;  5LLD A;  1L9Y A;  3AF5 A;  5AHR A;  4Z67 A;  4Z6X A;  2Q9U A;  5KIL A;  4AX1 B;  5HIO A;  1A7T A;  5HH6 A;  4KEQ A;  3DHA A;  2Q0I A;  4JO0 A;  4HKY A;  4DIK A;  1QH3 A;  3SFP A;  2AZ4 A;  5EWA A;  2FM6 A;  2YCB A;  4V0H A;  2Y87 A;  3IE2 A;  5FQA A;  4H0D A;  3SW3 A;  4AWY B;  1KO2 A;  2QIN A;  4TZB A;  2YNV A;  3BK1 A;  5EHT A;  4YSL A;  3BV6 A;  5B15 A;  2FK6 A;  3A4Y A;  4GCW A;  3WXC A;  5K4M A;  4UWS B;  2VW8 A;  3PY6 A;  4XWW A;  5DPX A;  2GKL A;  3I0V A;  1WUO A;  4GYU A;  3AJ3 A;  5A5Z A;  5EVK A;  3FAI A;  4YSB A;  5ACS A;  4C1H A;  2WYM C;  3KNR A;  3PG4 A;  2YNU A;  2BG8 A;  5HH5 A;  2YNW A;  4AWZ A;  3ZR9 A;  5KIK A;  4ZO2 A;  2R2D A;  1QH5 A;  4B87 A;  1X8I A;  2WYM A;  2BFL A;  4TZE A;  4EYF A;  3RKK A;  5EV6 A;  3X2Z A;  5ACU A;  4RM5 A;  3S0Z A;  2ZNB A;  2QDS A;  4CHL A;  4TZ9 A;  2I7V A;  2XF4 A;  2YNV B;  4UWO B;  3X30 A;  3KNS A;  2FU8 A;  4AD9 A;  5FQB A;  2M5D A;  4D1V A;  4D1T A;  4EXY A;  1MQO A;  3MD7 A;  4EFZ A;  2NXA A;  5B3R A;  4J5H A;  2WYL A;  3VQZ A;  5ACV A;  5AYA A;  1BVT A;  3X2X A;  3ZQ4 A;  5EVB A;  2QDT A;  1KO3 A;  2BIB A;  3BK2 A;  3IE0 A;  1YCG A;  4ZEJ A;  2ZZI A;  3P2U A;  3I11 A;  1X8H A;  4XUK A;  2BTN A;  4Z5Y A;  4C1G A;  4UBQ A;  2BG8 B;  4AX0 B;  2GMN A;  2P4Z A;  4U4L A;  2FU7 A;  2OHJ A;  2BFZ A;  2FHX A;  2YNT A;  3TP9 A;  3IEK A;  4ZNB A;  4FSB A;  1YCH A;  2HB9 A;  3ESH A;  4EYB A;  4WD6 A;  1VGN A;  2E7Y A;  2NZE A;  4ZO3 A;  3I13 A;  2BMI A;  4TZF A;  5B1U A;  2UYX A;  3BC2 A;  2WRS A;  3DHB A;  4LE6 A;  5LCF A;  3SD9 A;  2QED A;  2FU6 A;  3IOF A;  4RL0 A;  5AEB A;  3IEL A;  2CBN A;  3T9M A;  1Y44 A;  2A7M A;  3DHC A;  2Q42 A;  4C1D A;  4EY2 A;  4TYT A;  3ADR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...