2BTNA

Crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
242
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
molecule keywords AIIA-LIKE PROTEIN
total genus 71
structure length 242
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2btnA01
1KO2A 5EVKA 2GFJA 4GCWA 3L6NA 4U4LA 1A8TA 3ZWFA 5B3RA 2QINA 4AWZA 2WHGA 4Z5YA 3RKKA 5LLDA 5FQCA 3X2ZA 2Y8BA 2BFZB 2Q9UA 5AHOA 3X30A 4UA4A 3MD7A 4EYFA 5A87A 1VMEA 2FK6A 4P62A 1A7TA 1DXKA 2FU7A 4GYQA 4YSLA 4RBSA 1BMCA 3QH8A 3T3OA 3IEKA 3KL7A 2YNTA 2YNUA 3SPUA 4C1EA 3PG4A 4EYBA 2NXAA 5FQAA 2NZFA 4EYLA 4D1TA 5KIKA 5ACQA 3AJ3A 2BG2A 2Q42A 4UBQA 5ACWA 5KILA 2YNTB 2GCUA 3FAIA 5EH9A 1KO3A 4FSBA 4Z67A 3I13A 3IDZA 4PVOA 2GFKA 5EV6A 4F6ZA 3BC2A 5AXRA 5A0VA 4ZEJA 4AX0B 4D1UA 3ZR9A 1DDKA 5LMCA 2BGAA 4DILA 3I0VA 2P18A 3I15A 1HLKA 1KR3A 2BC2A 1VGNA 2I7XA 3LVZA 4D1WA 3DHAA 2BFLA 3IELA 3BK2A 5AYAA 2YNVB 4TZ9A 3WXCA 3SBLA 4UAMA 5EVBA 3SD9A 2FHXA 3IOGA 2YZ3A 1QH3A 4C1CA 4LE6A 4AX1B 1YCGA 4NQ2A 2I7TA 5EWAA 3SRXA 4HKYA 4GYUA 2Q0JA 4AD9A 3FCZA 3AF6A 4Z5ZA 3P2UA 5IQKA 3Q6VA 5ACTA 2FU8A 2P1EA 1X8HA 1M2XA 5ACPA 1E5DA 5K4MA 3X2YA 4UWOB 2AIOA 4RL2A 2M5DA 4NQ6A 4UWRB 5HH6A 4RL0A 2A7MA 5LSCA 3A4YA 4XWWA 4ZNBA 2ZWRA 5EVDA 4BP0A 1YCFA 1X8IA 1ZNBA 2M5CA 2XF4A 5AHRA 2BFKA 4TYFA 2ZO4A 5HIOA 3DH8A 2DOOA 5HIQA 5ACUA 4XWTA 4NQ5A 1JT1A 4D1VA 4D02A 4KEPA 1WUOA 2YCBA 3RPCA 4EXYA 2E7YA 4DIKA 2BG6A 2FM6A 3F9OA 1ZKPA 3X2XA 2AZ4A 5FQBA 2DKFA 4F6HA 3PY6A 3S0ZA 4RAMA 3JXPA 3KNSA 4RAWA 3IE1A 4C1HA 4YSKA 1VJNA 2WYMC 4EXSA 2BG8A 4PVTA 4CHLA 5A5ZA 2CBNA 3DHCA 5HISA 4B87A 2R2DA 4BZ3A 5HIPA 4HL2A 5K4KA 4J5HA 5ACVA 3T9MA 2FU9A 4C1DA 4RM5A 4C1FA 1XM8A 2Y8AA 3I11A 5HH4A 1L9YA 5ACSA 4EFZA 5DPXA 2YNVA 4KEQA 2ZNBA 2BTNA 5LCFA 2P4ZA 2YNWA 4HL1A 2BFZA 4C1GA 1YCHA 1BC2A 3IE2A 4H0DA 2WRSA 5AEBA 2OHJA 4TZFA 5A0TA 2OHIA 3AF5A 3T3NA 4UWPB 4Z6XA 5HH5A 2P97A 3H3EA 1ZTCA 2GKLA 4V0HA 2QJSA 2I7VA 4TZEA 4TZBA 1JJTA 4NQ4A 3I14A 5EHTA 2OHHA 1XTOA 3ZQ4A 5B15A 1MQOA 1DD6A 3TP9A 3IE0A 5ACXA 2HB9A 3IOFA 2Y87A 1QH5A 4AWYB 4Z7RA 1P9EA 3G1PA 3R2UA 3IEMA 3KNRA 1Y44A 3SFPA 3DHBA 4UWSB 1JJEA 4TYTA 5LE1A 2UYXA 1X8GA 1BVTA 2QEDA 2BG7A 2BMIA 3SW3A 2ZZIA 1SMLA 5LS3A 4J5FA 5AXOA 2FU6A 5B1UA 2H6AA 2Q0IA 2NZEA 2VW8A 2QDTA 1K07A 5LM6A 3ZNBA 2BIBA 5K0WA 2XR1A 4FR7A 3VPEA 3ESHA 3RKJA 4XUKA 1WW1A 5LCHA 4O98A 5EV8A 4ZO2A 5K4NA 3ADRA 2BR6A 2QDSA 4YSBA 4FEKA 2FHXB 5LCAA 4JO0A 3BK1A 1WRAA 2GMNA 3BV6A 1WUPA 4Z60A 2WYLA 3PY5A 4C09A 4WD6A 5ACRA 2NYPA 4EY2A 4ZO3A 2BG8B 3VQZA 5EW0A 2WYMA
chains in the Genus database with same CATH superfamily
1KO2A 5EVKA 2CFUA 2GFJA 4GCWA 3L6NA 4U4LA 1A8TA 3ZWFA 5B3RA 2QINA 4AWZA 2WHGA 4Z5YA 3RKKA 5LLDA 5FQCA 3X2ZA 2Y8BA 2BFZB 2Q9UA 5AHOA 3X30A 4UA4A 3MD7A 4EYFA 5A87A 1VMEA 2FK6A 4P62A 1A7TA 1DXKA 2FU7A 4GYQA 4YSLA 4RBSA 1BMCA 3QH8A 3T3OA 3IEKA 3KL7A 2YNTA 2YNUA 3SPUA 4C1EA 3PG4A 4EYBA 2NXAA 5FQAA 2NZFA 4EYLA 4D1TA 5KIKA 5ACQA 3AJ3A 2BG2A 2Q42A 4UBQA 5ACWA 5KILA 2YNTB 2GCUA 3FAIA 5EH9A 1KO3A 4FSBA 4Z67A 3I13A 3IDZA 4PVOA 2GFKA 5EV6A 4F6ZA 3BC2A 5AXRA 5A0VA 4ZEJA 4AX0B 4D1UA 3ZR9A 1DDKA 5LMCA 2BGAA 4DILA 3I0VA 2P18A 3I15A 1HLKA 1KR3A 2BC2A 1VGNA 2I7XA 3LVZA 4D1WA 3DHAA 2BFLA 3IELA 3BK2A 5AYAA 2YNVB 4TZ9A 4PDXA 3WXCA 3SBLA 4UAMA 5EVBA 3SD9A 2FHXA 3IOGA 2YZ3A 1QH3A 4C1CA 4LE6A 4AX1B 1YCGA 4NQ2A 2I7TA 5EWAA 3SRXA 4HKYA 4GYUA 2Q0JA 4AD9A 3FCZA 3AF6A 4Z5ZA 3P2UA 5IQKA 3Q6VA 5ACTA 2FU8A 2P1EA 1X8HA 1M2XA 5ACPA 1E5DA 5AIJA 5K4MA 3X2YA 4UWOB 2AIOA 4RL2A 2M5DA 4NQ6A 4UWRB 2CG3A 5HH6A 4RL0A 2A7MA 5LSCA 3A4YA 4XWWA 4ZNBA 2ZWRA 5EVDA 4BP0A 1YCFA 1X8IA 1ZNBA 2M5CA 2XF4A 5AHRA 2BFKA 4TYFA 2ZO4A 5HIOA 3DH8A 2DOOA 5HIQA 5ACUA 4XWTA 4NQ5A 1JT1A 4D1VA 4D02A 4KEPA 1WUOA 2YCBA 3RPCA 4EXYA 2E7YA 4DIKA 2BG6A 2FM6A 3F9OA 1ZKPA 3X2XA 2AZ4A 5FQBA 2DKFA 4F6HA 3PY6A 3S0ZA 4RAMA 3JXPA 3KNSA 4RAWA 3IE1A 4C1HA 4YSKA 1VJNA 2WYMC 4EXSA 2BG8A 4PVTA 4CHLA 5A5ZA 2CBNA 3DHCA 5A23A 5HISA 4B87A 2R2DA 4BZ3A 5HIPA 4HL2A 5K4KA 4J5HA 2YHEA 5ACVA 3T9MA 2FU9A 4C1DA 4RM5A 4C1FA 1XM8A 2Y8AA 3I11A 5HH4A 1L9YA 5ACSA 4EFZA 5DPXA 2YNVA 4KEQA 2ZNBA 2BTNA 5LCFA 2P4ZA 2YNWA 4HL1A 2BFZA 4C1GA 1YCHA 1BC2A 3IE2A 4H0DA 2WRSA 5AEBA 2OHJA 4TZFA 5A0TA 2OHIA 3AF5A 3T3NA 4UWPB 4Z6XA 2CG2A 5HH5A 2P97A 3H3EA 1ZTCA 2GKLA 4V0HA 2QJSA 2I7VA 4TZEA 4TZBA 1JJTA 4NQ4A 3I14A 5EHTA 2OHHA 1XTOA 3ZQ4A 2CFZA 5B15A 1MQOA 1DD6A 3TP9A 3IE0A 5ACXA 2HB9A 3IOFA 2Y87A 1QH5A 4NURA 4AWYB 4Z7RA 1P9EA 3G1PA 3R2UA 3IEMA 3KNRA 1Y44A 3SFPA 3DHBA 4UWSB 1JJEA 4TYTA 5LE1A 2UYXA 1X8GA 1BVTA 4AXHA 2QEDA 2BG7A 2BMIA 3SW3A 2ZZIA 1SMLA 5LS3A 4J5FA 5AXOA 2FU6A 5B1UA 2H6AA 2Q0IA 2NZEA 2VW8A 4AV7A 2QDTA 1K07A 5LM6A 3ZNBA 2BIBA 2XR1A 4FR7A 5K0WA 3VPEA 3ESHA 3RKJA 4XUKA 1WW1A 5LCHA 4O98A 5EV8A 4ZO2A 5K4NA 3ADRA 2BR6A 2QDSA 4YSBA 4FEKA 2FHXB 5LCAA 4JO0A 3BK1A 1WRAA 2GMNA 3BV6A 5AJLA 1WUPA 4Z60A 2WYLA 3PY5A 4C09A 4WD6A 5ACRA 2NYPA 4EY2A 4ZO3A 2BG8B 3VQZA 5EW0A 2WYMA
chains in the Genus database with same CATH topology
1KO2A 5EVKA 2GFJA 4GCWA 3L6NA 4U4LA 1A8TA 3ZWFA 5B3RA 2QINA 4AWZA 2WHGA 4Z5YA 3RKKA 5LLDA 5FQCA 3X2ZA 2Y8BA 2BFZB 2Q9UA 5AHOA 3X30A 4UA4A 3MD7A 4EYFA 5A87A 1VMEA 2FK6A 4P62A 1A7TA 1DXKA 2FU7A 4GYQA 4YSLA 4RBSA 1BMCA 3QH8A 3T3OA 3IEKA 3KL7A 2YNTA 2YNUA 3SPUA 4C1EA 3PG4A 4EYBA 2NXAA 5FQAA 2NZFA 4EYLA 4D1TA 5KIKA 5ACQA 3AJ3A 2BG2A 2Q42A 4UBQA 5ACWA 5KILA 2YNTB 2GCUA 3FAIA 5EH9A 1KO3A 4FSBA 4Z67A 3I13A 3IDZA 4PVOA 2GFKA 5EV6A 4F6ZA 3BC2A 5AXRA 5A0VA 4ZEJA 4AX0B 4D1UA 3ZR9A 1DDKA 5LMCA 2BGAA 4DILA 3I0VA 2P18A 3I15A 1HLKA 1KR3A 2BC2A 1VGNA 2I7XA 3LVZA 4D1WA 3DHAA 2BFLA 3IELA 3BK2A 5AYAA 2YNVB 4TZ9A 3WXCA 3SBLA 4UAMA 5EVBA 3SD9A 2FHXA 3IOGA 2YZ3A 1QH3A 4C1CA 4LE6A 4AX1B 1YCGA 4NQ2A 2I7TA 5EWAA 3SRXA 4HKYA 4GYUA 2Q0JA 4AD9A 3FCZA 3AF6A 4Z5ZA 3P2UA 5IQKA 3Q6VA 5ACTA 2FU8A 2P1EA 1X8HA 1M2XA 5ACPA 1E5DA 5K4MA 3X2YA 4UWOB 2AIOA 4RL2A 2M5DA 4NQ6A 4UWRB 5HH6A 4RL0A 2A7MA 5LSCA 3A4YA 4XWWA 4ZNBA 2ZWRA 5EVDA 4BP0A 1YCFA 1X8IA 1ZNBA 2M5CA 2XF4A 5AHRA 2BFKA 4TYFA 2ZO4A 5HIOA 3DH8A 2DOOA 5HIQA 5ACUA 4XWTA 4NQ5A 1JT1A 4D1VA 4D02A 4KEPA 1WUOA 2YCBA 3RPCA 4EXYA 2E7YA 4DIKA 2BG6A 2FM6A 3F9OA 1ZKPA 3X2XA 2AZ4A 5FQBA 2DKFA 4F6HA 3PY6A 3S0ZA 4RAMA 3JXPA 3KNSA 4RAWA 3IE1A 4C1HA 4YSKA 1VJNA 2WYMC 4EXSA 2BG8A 4PVTA 4CHLA 5A5ZA 2CBNA 3DHCA 5HISA 4B87A 2R2DA 4BZ3A 5HIPA 4HL2A 5K4KA 4J5HA 5ACVA 3T9MA 2FU9A 4C1DA 4RM5A 4C1FA 1XM8A 2Y8AA 3I11A 5HH4A 1L9YA 5ACSA 4EFZA 5DPXA 2YNVA 4KEQA 2ZNBA 2BTNA 5LCFA 2P4ZA 2YNWA 4HL1A 2BFZA 4C1GA 1YCHA 1BC2A 3IE2A 4H0DA 2WRSA 5AEBA 2OHJA 4TZFA 5A0TA 2OHIA 3AF5A 3T3NA 4UWPB 4Z6XA 5HH5A 2P97A 3H3EA 1ZTCA 2GKLA 4V0HA 2QJSA 2I7VA 4TZEA 4TZBA 1JJTA 4NQ4A 3I14A 5EHTA 2OHHA 1XTOA 3ZQ4A 5B15A 1MQOA 1DD6A 3TP9A 3IE0A 5ACXA 2HB9A 3IOFA 2Y87A 1QH5A 4AWYB 4Z7RA 1P9EA 3G1PA 3R2UA 3IEMA 3KNRA 1Y44A 3SFPA 3DHBA 4UWSB 1JJEA 4TYTA 5LE1A 2UYXA 1X8GA 1BVTA 2QEDA 2BG7A 2BMIA 3SW3A 2ZZIA 1SMLA 5LS3A 4J5FA 5AXOA 2FU6A 5B1UA 2H6AA 2Q0IA 2NZEA 2VW8A 2QDTA 1K07A 5LM6A 3ZNBA 2BIBA 5K0WA 2XR1A 4FR7A 3VPEA 3ESHA 3RKJA 4XUKA 1WW1A 5LCHA 4O98A 5EV8A 4ZO2A 5K4NA 3ADRA 2BR6A 2QDSA 4YSBA 4FEKA 2FHXB 5LCAA 4JO0A 3BK1A 1WRAA 2GMNA 3BV6A 1WUPA 4Z60A 2WYLA 3PY5A 4C09A 4WD6A 5ACRA 2NYPA 4EY2A 4ZO3A 2BG8B 3VQZA 5EW0A 2WYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KO2 A;  5EVK A;  2GFJ A;  4GCW A;  3L6N A;  4U4L A;  1A8T A;  3ZWF A;  5B3R A;  2QIN A;  4AWZ A;  2WHG A;  4Z5Y A;  3RKK A;  5LLD A;  5FQC A;  3X2Z A;  2Y8B A;  2BFZ B;  2Q9U A;  5AHO A;  3X30 A;  4UA4 A;  3MD7 A;  4EYF A;  5A87 A;  1VME A;  2FK6 A;  4P62 A;  1A7T A;  1DXK A;  2FU7 A;  4GYQ A;  4YSL A;  4RBS A;  1BMC A;  3QH8 A;  3T3O A;  3IEK A;  3KL7 A;  2YNT A;  2YNU A;  3SPU A;  4C1E A;  3PG4 A;  4EYB A;  2NXA A;  5FQA A;  2NZF A;  4EYL A;  4D1T A;  5KIK A;  5ACQ A;  3AJ3 A;  2BG2 A;  2Q42 A;  4UBQ A;  5ACW A;  5KIL A;  2YNT B;  2GCU A;  3FAI A;  5EH9 A;  1KO3 A;  4FSB A;  4Z67 A;  3I13 A;  3IDZ A;  4PVO A;  2GFK A;  5EV6 A;  4F6Z A;  3BC2 A;  5AXR A;  5A0V A;  4ZEJ A;  4AX0 B;  4D1U A;  3ZR9 A;  1DDK A;  5LMC A;  2BGA A;  4DIL A;  3I0V A;  2P18 A;  3I15 A;  1HLK A;  1KR3 A;  2BC2 A;  1VGN A;  2I7X A;  3LVZ A;  4D1W A;  3DHA A;  2BFL A;  3IEL A;  3BK2 A;  5AYA A;  2YNV B;  4TZ9 A;  3WXC A;  3SBL A;  4UAM A;  5EVB A;  3SD9 A;  2FHX A;  3IOG A;  2YZ3 A;  1QH3 A;  4C1C A;  4LE6 A;  4AX1 B;  1YCG A;  4NQ2 A;  2I7T A;  5EWA A;  3SRX A;  4HKY A;  4GYU A;  2Q0J A;  4AD9 A;  3FCZ A;  3AF6 A;  4Z5Z A;  3P2U A;  5IQK A;  3Q6V A;  5ACT A;  2FU8 A;  2P1E A;  1X8H A;  1M2X A;  5ACP A;  1E5D A;  5K4M A;  3X2Y A;  4UWO B;  2AIO A;  4RL2 A;  2M5D A;  4NQ6 A;  4UWR B;  5HH6 A;  4RL0 A;  2A7M A;  5LSC A;  3A4Y A;  4XWW A;  4ZNB A;  2ZWR A;  5EVD A;  4BP0 A;  1YCF A;  1X8I A;  1ZNB A;  2M5C A;  2XF4 A;  5AHR A;  2BFK A;  4TYF A;  2ZO4 A;  5HIO A;  3DH8 A;  2DOO A;  5HIQ A;  5ACU A;  4XWT A;  4NQ5 A;  1JT1 A;  4D1V A;  4D02 A;  4KEP A;  1WUO A;  2YCB A;  3RPC A;  4EXY A;  2E7Y A;  4DIK A;  2BG6 A;  2FM6 A;  3F9O A;  1ZKP A;  3X2X A;  2AZ4 A;  5FQB A;  2DKF A;  4F6H A;  3PY6 A;  3S0Z A;  4RAM A;  3JXP A;  3KNS A;  4RAW A;  3IE1 A;  4C1H A;  4YSK A;  1VJN A;  2WYM C;  4EXS A;  2BG8 A;  4PVT A;  4CHL A;  5A5Z A;  2CBN A;  3DHC A;  5HIS A;  4B87 A;  2R2D A;  4BZ3 A;  5HIP A;  4HL2 A;  5K4K A;  4J5H A;  5ACV A;  3T9M A;  2FU9 A;  4C1D A;  4RM5 A;  4C1F A;  1XM8 A;  2Y8A A;  3I11 A;  5HH4 A;  1L9Y A;  5ACS A;  4EFZ A;  5DPX A;  2YNV A;  4KEQ A;  2ZNB A;  2BTN A;  5LCF A;  2P4Z A;  2YNW A;  4HL1 A;  2BFZ A;  4C1G A;  1YCH A;  1BC2 A;  3IE2 A;  4H0D A;  2WRS A;  5AEB A;  2OHJ A;  4TZF A;  5A0T A;  2OHI A;  3AF5 A;  3T3N A;  4UWP B;  4Z6X A;  5HH5 A;  2P97 A;  3H3E A;  1ZTC A;  2GKL A;  4V0H A;  2QJS A;  2I7V A;  4TZE A;  4TZB A;  1JJT A;  4NQ4 A;  3I14 A;  5EHT A;  2OHH A;  1XTO A;  3ZQ4 A;  5B15 A;  1MQO A;  1DD6 A;  3TP9 A;  3IE0 A;  5ACX A;  2HB9 A;  3IOF A;  2Y87 A;  1QH5 A;  4AWY B;  4Z7R A;  1P9E A;  3G1P A;  3R2U A;  3IEM A;  3KNR A;  1Y44 A;  3SFP A;  3DHB A;  4UWS B;  1JJE A;  4TYT A;  5LE1 A;  2UYX A;  1X8G A;  1BVT A;  2QED A;  2BG7 A;  2BMI A;  3SW3 A;  2ZZI A;  1SML A;  5LS3 A;  4J5F A;  5AXO A;  2FU6 A;  5B1U A;  2H6A A;  2Q0I A;  2NZE A;  2VW8 A;  2QDT A;  1K07 A;  5LM6 A;  3ZNB A;  2BIB A;  5K0W A;  2XR1 A;  4FR7 A;  3VPE A;  3ESH A;  3RKJ A;  4XUK A;  1WW1 A;  5LCH A;  4O98 A;  5EV8 A;  4ZO2 A;  5K4N A;  3ADR A;  2BR6 A;  2QDS A;  4YSB A;  4FEK A;  2FHX B;  5LCA A;  4JO0 A;  3BK1 A;  1WRA A;  2GMN A;  3BV6 A;  1WUP A;  4Z60 A;  2WYL A;  3PY5 A;  4C09 A;  4WD6 A;  5ACR A;  2NYP A;  4EY2 A;  4ZO3 A;  2BG8 B;  3VQZ A;  5EW0 A;  2WYM A; 
#chains in the Genus database with same CATH topology
 1KO2 A;  5EVK A;  2CFU A;  2GFJ A;  4GCW A;  3L6N A;  4U4L A;  1A8T A;  3ZWF A;  5B3R A;  2QIN A;  4AWZ A;  2WHG A;  4Z5Y A;  3RKK A;  5LLD A;  5FQC A;  3X2Z A;  2Y8B A;  2BFZ B;  2Q9U A;  5AHO A;  3X30 A;  4UA4 A;  3MD7 A;  4EYF A;  5A87 A;  1VME A;  2FK6 A;  4P62 A;  1A7T A;  1DXK A;  2FU7 A;  4GYQ A;  4YSL A;  4RBS A;  1BMC A;  3QH8 A;  3T3O A;  3IEK A;  3KL7 A;  2YNT A;  2YNU A;  3SPU A;  4C1E A;  3PG4 A;  4EYB A;  2NXA A;  5FQA A;  2NZF A;  4EYL A;  4D1T A;  5KIK A;  5ACQ A;  3AJ3 A;  2BG2 A;  2Q42 A;  4UBQ A;  5ACW A;  5KIL A;  2YNT B;  2GCU A;  3FAI A;  5EH9 A;  1KO3 A;  4FSB A;  4Z67 A;  3I13 A;  3IDZ A;  4PVO A;  2GFK A;  5EV6 A;  4F6Z A;  3BC2 A;  5AXR A;  5A0V A;  4ZEJ A;  4AX0 B;  4D1U A;  3ZR9 A;  1DDK A;  5LMC A;  2BGA A;  4DIL A;  3I0V A;  2P18 A;  3I15 A;  1HLK A;  1KR3 A;  2BC2 A;  1VGN A;  2I7X A;  3LVZ A;  4D1W A;  3DHA A;  2BFL A;  3IEL A;  3BK2 A;  5AYA A;  2YNV B;  4TZ9 A;  4PDX A;  3WXC A;  3SBL A;  4UAM A;  5EVB A;  3SD9 A;  2FHX A;  3IOG A;  2YZ3 A;  1QH3 A;  4C1C A;  4LE6 A;  4AX1 B;  1YCG A;  4NQ2 A;  2I7T A;  5EWA A;  3SRX A;  4HKY A;  4GYU A;  2Q0J A;  4AD9 A;  3FCZ A;  3AF6 A;  4Z5Z A;  3P2U A;  5IQK A;  3Q6V A;  5ACT A;  2FU8 A;  2P1E A;  1X8H A;  1M2X A;  5ACP A;  1E5D A;  5AIJ A;  5K4M A;  3X2Y A;  4UWO B;  2AIO A;  4RL2 A;  2M5D A;  4NQ6 A;  4UWR B;  2CG3 A;  5HH6 A;  4RL0 A;  2A7M A;  5LSC A;  3A4Y A;  4XWW A;  4ZNB A;  2ZWR A;  5EVD A;  4BP0 A;  1YCF A;  1X8I A;  1ZNB A;  2M5C A;  2XF4 A;  5AHR A;  2BFK A;  4TYF A;  2ZO4 A;  5HIO A;  3DH8 A;  2DOO A;  5HIQ A;  5ACU A;  4XWT A;  4NQ5 A;  1JT1 A;  4D1V A;  4D02 A;  4KEP A;  1WUO A;  2YCB A;  3RPC A;  4EXY A;  2E7Y A;  4DIK A;  2BG6 A;  2FM6 A;  3F9O A;  1ZKP A;  3X2X A;  2AZ4 A;  5FQB A;  2DKF A;  4F6H A;  3PY6 A;  3S0Z A;  4RAM A;  3JXP A;  3KNS A;  4RAW A;  3IE1 A;  4C1H A;  4YSK A;  1VJN A;  2WYM C;  4EXS A;  2BG8 A;  4PVT A;  4CHL A;  5A5Z A;  2CBN A;  3DHC A;  5A23 A;  5HIS A;  4B87 A;  2R2D A;  4BZ3 A;  5HIP A;  4HL2 A;  5K4K A;  4J5H A;  2YHE A;  5ACV A;  3T9M A;  2FU9 A;  4C1D A;  4RM5 A;  4C1F A;  1XM8 A;  2Y8A A;  3I11 A;  5HH4 A;  1L9Y A;  5ACS A;  4EFZ A;  5DPX A;  2YNV A;  4KEQ A;  2ZNB A;  2BTN A;  5LCF A;  2P4Z A;  2YNW A;  4HL1 A;  2BFZ A;  4C1G A;  1YCH A;  1BC2 A;  3IE2 A;  4H0D A;  2WRS A;  5AEB A;  2OHJ A;  4TZF A;  5A0T A;  2OHI A;  3AF5 A;  3T3N A;  4UWP B;  4Z6X A;  2CG2 A;  5HH5 A;  2P97 A;  3H3E A;  1ZTC A;  2GKL A;  4V0H A;  2QJS A;  2I7V A;  4TZE A;  4TZB A;  1JJT A;  4NQ4 A;  3I14 A;  5EHT A;  2OHH A;  1XTO A;  3ZQ4 A;  2CFZ A;  5B15 A;  1MQO A;  1DD6 A;  3TP9 A;  3IE0 A;  5ACX A;  2HB9 A;  3IOF A;  2Y87 A;  1QH5 A;  4NUR A;  4AWY B;  4Z7R A;  1P9E A;  3G1P A;  3R2U A;  3IEM A;  3KNR A;  1Y44 A;  3SFP A;  3DHB A;  4UWS B;  1JJE A;  4TYT A;  5LE1 A;  2UYX A;  1X8G A;  1BVT A;  4AXH A;  2QED A;  2BG7 A;  2BMI A;  3SW3 A;  2ZZI A;  1SML A;  5LS3 A;  4J5F A;  5AXO A;  2FU6 A;  5B1U A;  2H6A A;  2Q0I A;  2NZE A;  2VW8 A;  4AV7 A;  2QDT A;  1K07 A;  5LM6 A;  3ZNB A;  2BIB A;  2XR1 A;  4FR7 A;  5K0W A;  3VPE A;  3ESH A;  3RKJ A;  4XUK A;  1WW1 A;  5LCH A;  4O98 A;  5EV8 A;  4ZO2 A;  5K4N A;  3ADR A;  2BR6 A;  2QDS A;  4YSB A;  4FEK A;  2FHX B;  5LCA A;  4JO0 A;  3BK1 A;  1WRA A;  2GMN A;  3BV6 A;  5AJL A;  1WUP A;  4Z60 A;  2WYL A;  3PY5 A;  4C09 A;  4WD6 A;  5ACR A;  2NYP A;  4EY2 A;  4ZO3 A;  2BG8 B;  3VQZ A;  5EW0 A;  2WYM A; 
#chains in the Genus database with same CATH homology
 1KO2 A;  5EVK A;  2GFJ A;  4GCW A;  3L6N A;  4U4L A;  1A8T A;  3ZWF A;  5B3R A;  2QIN A;  4AWZ A;  2WHG A;  4Z5Y A;  3RKK A;  5LLD A;  5FQC A;  3X2Z A;  2Y8B A;  2BFZ B;  2Q9U A;  5AHO A;  3X30 A;  4UA4 A;  3MD7 A;  4EYF A;  5A87 A;  1VME A;  2FK6 A;  4P62 A;  1A7T A;  1DXK A;  2FU7 A;  4GYQ A;  4YSL A;  4RBS A;  1BMC A;  3QH8 A;  3T3O A;  3IEK A;  3KL7 A;  2YNT A;  2YNU A;  3SPU A;  4C1E A;  3PG4 A;  4EYB A;  2NXA A;  5FQA A;  2NZF A;  4EYL A;  4D1T A;  5KIK A;  5ACQ A;  3AJ3 A;  2BG2 A;  2Q42 A;  4UBQ A;  5ACW A;  5KIL A;  2YNT B;  2GCU A;  3FAI A;  5EH9 A;  1KO3 A;  4FSB A;  4Z67 A;  3I13 A;  3IDZ A;  4PVO A;  2GFK A;  5EV6 A;  4F6Z A;  3BC2 A;  5AXR A;  5A0V A;  4ZEJ A;  4AX0 B;  4D1U A;  3ZR9 A;  1DDK A;  5LMC A;  2BGA A;  4DIL A;  3I0V A;  2P18 A;  3I15 A;  1HLK A;  1KR3 A;  2BC2 A;  1VGN A;  2I7X A;  3LVZ A;  4D1W A;  3DHA A;  2BFL A;  3IEL A;  3BK2 A;  5AYA A;  2YNV B;  4TZ9 A;  3WXC A;  3SBL A;  4UAM A;  5EVB A;  3SD9 A;  2FHX A;  3IOG A;  2YZ3 A;  1QH3 A;  4C1C A;  4LE6 A;  4AX1 B;  1YCG A;  4NQ2 A;  2I7T A;  5EWA A;  3SRX A;  4HKY A;  4GYU A;  2Q0J A;  4AD9 A;  3FCZ A;  3AF6 A;  4Z5Z A;  3P2U A;  5IQK A;  3Q6V A;  5ACT A;  2FU8 A;  2P1E A;  1X8H A;  1M2X A;  5ACP A;  1E5D A;  5K4M A;  3X2Y A;  4UWO B;  2AIO A;  4RL2 A;  2M5D A;  4NQ6 A;  4UWR B;  5HH6 A;  4RL0 A;  2A7M A;  5LSC A;  3A4Y A;  4XWW A;  4ZNB A;  2ZWR A;  5EVD A;  4BP0 A;  1YCF A;  1X8I A;  1ZNB A;  2M5C A;  2XF4 A;  5AHR A;  2BFK A;  4TYF A;  2ZO4 A;  5HIO A;  3DH8 A;  2DOO A;  5HIQ A;  5ACU A;  4XWT A;  4NQ5 A;  1JT1 A;  4D1V A;  4D02 A;  4KEP A;  1WUO A;  2YCB A;  3RPC A;  4EXY A;  2E7Y A;  4DIK A;  2BG6 A;  2FM6 A;  3F9O A;  1ZKP A;  3X2X A;  2AZ4 A;  5FQB A;  2DKF A;  4F6H A;  3PY6 A;  3S0Z A;  4RAM A;  3JXP A;  3KNS A;  4RAW A;  3IE1 A;  4C1H A;  4YSK A;  1VJN A;  2WYM C;  4EXS A;  2BG8 A;  4PVT A;  4CHL A;  5A5Z A;  2CBN A;  3DHC A;  5HIS A;  4B87 A;  2R2D A;  4BZ3 A;  5HIP A;  4HL2 A;  5K4K A;  4J5H A;  5ACV A;  3T9M A;  2FU9 A;  4C1D A;  4RM5 A;  4C1F A;  1XM8 A;  2Y8A A;  3I11 A;  5HH4 A;  1L9Y A;  5ACS A;  4EFZ A;  5DPX A;  2YNV A;  4KEQ A;  2ZNB A;  2BTN A;  5LCF A;  2P4Z A;  2YNW A;  4HL1 A;  2BFZ A;  4C1G A;  1YCH A;  1BC2 A;  3IE2 A;  4H0D A;  2WRS A;  5AEB A;  2OHJ A;  4TZF A;  5A0T A;  2OHI A;  3AF5 A;  3T3N A;  4UWP B;  4Z6X A;  5HH5 A;  2P97 A;  3H3E A;  1ZTC A;  2GKL A;  4V0H A;  2QJS A;  2I7V A;  4TZE A;  4TZB A;  1JJT A;  4NQ4 A;  3I14 A;  5EHT A;  2OHH A;  1XTO A;  3ZQ4 A;  5B15 A;  1MQO A;  1DD6 A;  3TP9 A;  3IE0 A;  5ACX A;  2HB9 A;  3IOF A;  2Y87 A;  1QH5 A;  4AWY B;  4Z7R A;  1P9E A;  3G1P A;  3R2U A;  3IEM A;  3KNR A;  1Y44 A;  3SFP A;  3DHB A;  4UWS B;  1JJE A;  4TYT A;  5LE1 A;  2UYX A;  1X8G A;  1BVT A;  2QED A;  2BG7 A;  2BMI A;  3SW3 A;  2ZZI A;  1SML A;  5LS3 A;  4J5F A;  5AXO A;  2FU6 A;  5B1U A;  2H6A A;  2Q0I A;  2NZE A;  2VW8 A;  2QDT A;  1K07 A;  5LM6 A;  3ZNB A;  2BIB A;  5K0W A;  2XR1 A;  4FR7 A;  3VPE A;  3ESH A;  3RKJ A;  4XUK A;  1WW1 A;  5LCH A;  4O98 A;  5EV8 A;  4ZO2 A;  5K4N A;  3ADR A;  2BR6 A;  2QDS A;  4YSB A;  4FEK A;  2FHX B;  5LCA A;  4JO0 A;  3BK1 A;  1WRA A;  2GMN A;  3BV6 A;  1WUP A;  4Z60 A;  2WYL A;  3PY5 A;  4C09 A;  4WD6 A;  5ACR A;  2NYP A;  4EY2 A;  4ZO3 A;  2BG8 B;  3VQZ A;  5EW0 A;  2WYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...