2BTTA

Nmr structure of myo3-sh3 domain from myosin-typei from s. cerevisiae
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New approaches to high-throughput structure characterization of SH3 complexes: the example of Myosin-3 and Myosin-5 SH3 domains from S. cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords MYOSIN-3 ISOFORM
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bttA01
3VS6A 2PTKA 1AWOA 1GBQA 1K9AA 1YN8A 2KE9A 1JO8A 2DVJA 2E5KA 1WXBA 2I0NA 2YT6A 3QWXX 5ECAA 1X2QA 2CUBA 3SHWA 3UA6A 1ZX6A 4RTWA 1BB9A 4JJDA 1PRMC 3EG0A 3TSZA 1SEMA 2EYWA 4GBQA 4JZ4A 4LUDA 3IQLA 2EGEA 1T3SA 2EBPA 2FPDA 4J9DA 2DX1A 1AZEA 4JZ3A 1QCFA 1NYGA 1WDXA 1T0HA 2V1QA 2KRNA 2KRMA 1VYVA 3REBB 1AOJA 4OMMA 3EG2A 4F17A 1T0JA 2PNIA 3C0CA 4ESRA 1K0SA 1PNJA 1HSQA 2CT4A 2OI3A 2HDAA 2MOXA 1U5SA 1NEBA 3VS4A 2CREA 4X1VA 3EHQA 1AZGB 2GQIA 4J9IA 4HVWA 2RF0A 3PVQA 1OOTA 1N5ZA 3VS0A 2G6FX 1QLYA 2C0OA 5EC7A 3FJ5A 4AFUC 1V1CA 2LQWA 2DF6A 4FSSA 2DE0X 2DL5A 2KT1A 2OAWA 3UF4A 2KR3A 2A37A 4AG2C 1WFWA 2YUQA 4DEYA 1PRLC 2GNCA 1JXMA 3M0TA 3VS7A 3NPFA 5FWCA 1VYTA 2O9SA 3A98A 1W6XA 2RMOA 4HCKA 2KEAA 2CSQA 3I35A 2JTEA 3R6NA 4Y92A 5FW9A 2BZXA 1T3LA 2KXCA 3RNJA 5IXFA 1WYXA 1Y57A 1JU5C 4RTXA 4RTVA 2YUNA 3KFVA 2A36A 1BU1A 5IXBA 2M51A 1E7OA 4RTTA 4LE9A 4M4ZA 1UUEA 2LZ6B 2DL4A 1WXTA 1B07A 1QWEA 2OJ2A 2D8JA 1SHFA 2DILA 4IIMA 2SRCA 3H41A 4CC7A 1K1ZA 2MIOA 1M27C 1WI7A 2RQUA 1E6HA 4LN2A 1UFFA 2O9VA 1WIEA 3UA7A 2LP5A 4J9EA 3TVTA 1Y0MA 1KSWA 1G2BA 4RTZA 5IHIA 1OPKA 1Z9QA 2BZYA 2DNUA 2JXBA 2W0ZA 1QWFA 3ZL7C 2LJ1A 1X27A 3VS5A 2KGTA 3M0UA 2CUDA 2NUZA 4EIKA 4AFSC 2J6OA 2O31A 1W70A 1SPKA 1LCKA 5L23A 3NHNA 2K7AA 3RBBB 1ZUKA 2AKKA 3EGUA 4J9BA 1UHFA 2F2WA 2L0AA 1ABOA 4RTUA 2RQVA 1UDLA 1UHCA 1X2KA 1ZSGA 1M3BA 3NMZC 2KT8A 3M0RA 2BZ8A 2EGAA 2KXDA 4LUEA 1GL5A 4F16A 1TUCA 2EGCA 5I11A 2RQRA 2YDLA 1K4US 5FWBA 1U06A 3QWYA 2AK5A 2W10A 2FRYA 4CC4B 2QDLA 2EYZA 1K76A 1PHTA 2DYBA 1ZBJA 1HJDA 2L2PA 2ROLA 4GLMA 2ROTA 3I9QA 2KYBA 2HCKA 2DRKA 2HBWA 1KFZA 3I5RA 4LNPA 1AEYA 1I1JA 2K9GA 3LH5A 4Z8AA 2LJ0A 1AVZC 1I0CA 4AFZC 2LX7A 3REAB 1JXOA 1E6GA 2LJ3A 1AWJA 1YP5A 1MV3A 1SSHA 1UTIA 4E6RA 1SRMA 3H0FA 4OMLA 1AWWA 2O88A 4CC2A 1B3QA 4J9CA 3THKA 4D8DA 2H8HA 3CQTA 3VRZA 1OPLA 2K6DA 2DA9A 4AG1C 2RPNA 2NWMA 1ARKA 2EKHA 2FEIA 1OEBA 3PE0A 1BBZA 2DL3A 3NGPA 2DRMA 2A08A 1GFCA 1XOVA 2DMOA 2FO0A 1GCQA 2JT4A 2C0IA 5IHKA 1PKTA 1JEGA 2EYXA 4K11A 1ZUYA 1AWXA 1S1NA 1WX6A 1BK2A 1J3TA 1NLPC 2DM1A 2L3SA 2FPFA 1I07A 2LNHB 1WLPB 1Z9ZA 1AD5A 2YUOA 2MCNA 2JM9A 4OMQA 1FYNA 4CC3A 3JV3A 3H0IA 1K0XA 4J9FA 2V1RA 1PKSA 2XMFA 3PVLA 2DBMA 1ZUUA 4D8KA 2ENMA 2AKLA 1X6GA 1GCQC 1MV0B 1NLOC 4ZNXA 2ABLA 1TUDA 2K2MA 5GJVB 2L3PA 4Z88A 2JS2A 1VYUA 1H92A 2LQNA 2RQTA 1M3AA 2RQWA 4J9HA 1EFNA 1NEGA 2HSPA 2YUPA 2CH4W 2D8HA 4RUGA 3I5SA 4J9GA 3M0QA 4HVVA 1GBRA 2O2OA 5GJWB 2CH4A 2C0TA 4OMPA 1JQQA 2KBTA 3EHRA 5I22A 3VS1A 1WXUA 2DJQA 2ED1A 1GCPA 2EPDA 2PZ1A 4Z89A 2X3XD 1VA7A 2JMAA 1UECA 1NYFA 1X6BA 1WA7A 2SEMA 3GBQA 1SRLA 1QKWA 1SHGA 3UATA 4JPBW 4AFQC 1CKAA 1UJ0A 1MUZA 3O5ZA 1YNZA 2AZSA 1IO6A 2CDTA 2D1XA 4DEXA 1OV3A 1NG2A 1UJYA 2YSQA 2JW4A 2DLPA 3VS2A 1M8MA 1H3HA 2GTJA 2J7IA 2FG0A 2CT3A 1GRIA 1U3OA 2J6FA 2P4RA 4F14A 2FRWA 2F2VA 2GBQA 1TG0A 2ED0A 1RI9A 1FMKA 3EG3A 1KJWA 2EQIA 2JMCA 2RNAA 2VVKA 1RLPC 2J06A 3EG1A 1YWPA 2KRSA 5IH2A 3ULRB 2X3WD 1W1FA 3VRYA 2EVRA 2DL8A 2IIMA 4JJCA 1X69A 1H8KA 4KRTA 2VWFA 2F2XA 1NM7A 2K3BA 4QT7A 1HD3A 2EW3A 3U23A 1GFDA 2JM8A 1QKXA 5IHNA 3M0PA 2HEQA 1ZLMA 4OMNA 1A0NB 1X43A 1UG1A 2ESWA 4HVUA 2J05A 2BTTA 1ABQA 2KNBB 1M3CA 4R0KA 2AZVA 2A28A 1M30A 2ECZA 1KIKA 4IIOA 4A63B 2DBKA 3VS3A 3M0SA 1RUWA 1PWTA 4RTYA 2DL7A 5HCKA 2EYYA 3H0HA 1UE9A 4HXJA 4ORZA 2L3QA 2JS0A 2J6KA 1YWOA 4JJBA 2GGRA 2KYMA 2K79A 2FPEA 2VKNA 3SEMA 2B86A 4WCIA 2D0NA 2KROA 1RLQC 4OMOA 2LCSA 1CKBA 1CSKA 1UGVA 2LMJA 2RN8A 2CSIA 2GTOA 3TSWA 1YCSB 2M0YA 1G83A
chains in the Genus database with same CATH superfamily
3VS6A 1O75A 4C0DB 1ZQ1A 1AWOA 4BB7A 2IG0A 1GBQA 1YN8A 4M7AE 2E5KA 2I0NA 3UA6A 2YT6A 2CUBA 2BE9B 4RTWA 3E2UA 4M75G 4ME7A 4JJDA 4C8QF 3TSZA 2E3IA 1TSFA 4N4HA 3OYDA 4KUIA 2EQKA 4LUDA 2EJFA 2E12A 3V8JA 1K73U 1WHHA 1NYGA 4PJOF 5CKBA 3J81E 1KD1U 4IUPA 3JB9J 2LVMA 3FEOA 4ZGEB 2PQWA 4JUVA 4FCYA 4RKUE 2P0PA 4BDYA 2JJ9A 5LJ5e 2OTLQ 4XTUA 2JTMA 2OTJT 1PNJA 2RJCA 1WHGA 3EHQA 4NS5A 4X1VA 1AZGB 3ER0A 1PSFA 2XDDA 3VKIA 4CI0C 1UGSB 1PD0A 3JCMP 2RHYA 5CKDA 3HRSA 2AHJB 1IB8A 3FJ5A 4C5EA 2RI2A 2CGHA 4AFUC 1D0ZA 2LQWA 2X51A 4N4IA 2DL5A 2KT1A 2OAWA 4AG2C 4JS4A 2DJZA 3M0TA 2E70A 2COYA 3EG9B 4BY6C 4EMHA 2RMOA 2KEAA 3CPWA 2JTEA 3R6NA 5FW9A 1JJ2P 2BZXA 1Q81C 2KXCA 1XTDA 3OYYA 4C8QD 4XU2A 1Y57A 1JU5C 4N0AC 1OX9A 3X28B 2X9HA 4L6V5 5IXBA 2O01E 4HT8A 4LE9A 1UUEA 3QPHA 3MEAA 2D8JA 3RKWA 2LQKA 4QQGA 3TREA 3QZ5B 3CMEQ 2XI9A 4CC7A 2MIOA 4CRIA 1M27C 1FMVA 4AMCA 3OYEA 2E64A 4LN2A 2X4YA 2DEUA 2RI3A 1D1CA 1N6AA 2O9VA 4Y28E 4M7AG 2LP5A 2DTHA 2E3HA 5GMKe 3OYAA 3LWIA 1MGQA 1G2BA 3V7RA 4QW2A 1Z9QA 2W0ZA 1PCXA 3EG9A 5CAIA 1JJ2A 3ZL7C 3RERA 4R56A 3VS5A 2CZ7B 1D3BB 2KGTA 2CUDA 3CXCS 2RHXA 2OTLA 3JCMV 3JB9F 1SPKA 4OMFB 2ZPHB 3NHNA 4KH1B 4LXCA 4LDVA 5GMKm 2CP2A 4BE0A 2AKKA 1UHFA 3ME9A 4RG2A 3CD6Q 4C92G 1OULA 1WQ7A 2KT8A 5CKFA 3HFNA 2EGAA 3G71Q 3RKXA 5HKCA 2KXDA 4LUEA 1GL5A 4F16A 1TUCA 1VQPT 1SF9A 5I11A 1MMNA 2RQRA 1MNEA 3A8LB 1VQOQ 3M53A 2FRYA 4GLKA 1K76A 2HD0A 4RMOA 5KYUA 2KI7A 2ROLA 4GLMA 2RH2A 4KGZB 4M7DE 1O9SA 3PMIA 4KUDK 3CCUA 3RDVA 1AVZC 3P8HA 5I2SA 4AFZC 4IUQA 2LX7A 1OYXA 3KUFA 4O6JA 3E1SA 1AWJA 1JB0E 4E6RA 1U1TA 4FSXA 1VQNQ 2ZPEB 4EPCA 4D8DA 4ATOA 4KT0E 1R8OB 3H8ZA 4M7DD 1F1BB 1R0CB 4FT2A 2DA9A 2RPNA 4J5YA 1D3BA 1Q86R 1UB4A 2QDYB 3CCLQ 4C8QG 3G71A 1LVKA 3H6ZA 2A08A 2MK5A 4EDUA 2FO0A 3V7SA 1FWZA 4JJNK 5IHKA 1RI0A 5HK0A 1YBYA 1ZUYA 2YHTA 4M7DC 4BI4A 4ZN3A 1BK2A 1YI2A 5KE2A 2FPFA 1I07A 1EZZB 1XQHA 1AD5A 4M77D 3SB2A 4C0ZA 2JM9A 3X20B 3PFSA 3JV3A 4M75B 3OW2P 1K0XA 4DBFA 3PVLA 1PKSA 2XMFA 2DIGA 2QXFA 3GOXA 3CCST 2CP3A 4D8KA 1QVPA 2VGNA 4FYVB 4N0AA 5KYUB 1WHKA 3HSBA 2L3PA 1VYUA 4XQ3A 2RQTA 5C0MA 1M3AA 2RQWA 2EQMA 4J9HA 4C5HA 3CC4A 1Y7XA 2HSPA 2RM4A 5GANf 1HXDA 2CH4W 2D8HA 1XJWB 3FIFA 3RESA 1K73C 2QEXQ 2PVDB 3G6EQ 4HVVA 5GJWB 3BFMA 1RAGB 2OTLT 4RCCA 4M78G 4YTLA 2XKOC 2ED1A 3CMET 3EH1A 3OYLA 4B9WA 2RHIA 4KBMB 1WA7A 3GBQA 1VQ4T 3UATA 4JPBW 1YIJT 1UJ0A 3BE3A 5GAMg 5FU6C 8AT1B 1YIJA 2HAXA 2KSSA 2CDTA 2D1XA 2YSQA 2DLPA 2QQ9A 3OSVA 2FHDA 3TU4K 3VUBA 2QTVA 2HL3A 3JCMf 2J7IA 5KH6A 2LNVA 2FG0A 2QK0A 2J6FA 1U3OA 3A8GB 1WPYA 2P4RA 4C0FA 3UT1A 4FIBA 2K3XA 2RJDA 2X35A 1TG0A 1YI2T 1U1SA 1D09B 3BDLA 4C8QC 2JMCA 2QA4A 2VVKA 1GXIE 2LRQA 5DLOA 1WNLA 1M2OA 5IH2A 1WHJA 4R55A 1W1FA 4MDXA 2EVRA 1WGSA 5IAYA 3I55T 2QA4T 4E7HA 4M78A 1TOVA 3BY7A 1YJWA 4FYWB 3ZEHA 4PJOE 3CXCP 2VWFA 2K3BA 4QT7A 4A4EA 1VQ9A 4M75A 3M9QA 5HY6A 3JCMh 1M1GA 1X6OA 1QKXA 1W2BA 3M0PA 5LL6S 1ZLMA 1VQ8Q 1Y96A 4PNOA 1X43A 1UG1A 2EWNA 5A0LA 1H641 2BTTA 1Y71A 1M3CA 3CEYA 2AZVA 1TXQA 2A28A 2RA2A 1QCNA 2ZPBB 2NUTB 3L2QA 1D1BA 3M0SA 1QP2A 1PWTA 2QGFB 4RTYA 4WTOB 1YFNA 4ZTFA 4B6MA 1IXDA 3JCMW 1UE9A 4HXJA 4ORZA 4KULA 5HK3A 2JS0A 2L3QA 2NYSA 3CCMQ 2K79A 2WACA 3P8DA 2B86A 2YLBA 1DJ7B 4O5VA 2CZ0B 2GTOA 1S72Q 1VQLA 2WSFE 2QA4Q 3FDRA 3X26B 2M0YA 2QQBA 2F5TX 3OYHA 3GF5A 3JCMc 2PTKA 1SKUB 1BCOA 3OBYA 5ECAA 1X2QA 3QDRB 5LJ3d 4QQ6A 4LD6A 4JDSA 2G3RA 4IUVA 1VQ8T 3IQLA 2EGEA 3PGGA 1T3SA 2EBPA 2FPDA 4J9DA 1AZEA 4M78D 2RO0A 1WDXA 5I21A 4A53A 2KRNA 2KRMA 2MWPA 2GCXA 1AOJA 3SD4A 5J26A 3CMAQ 4M77F 1NPPA 3C94A 2L8DA 1BIBA 2YWWA 2PVOB 1WHMA 6AT1B 1LPLA 2F1LA 3C0CA 4BY6B 1K0SA 1OQKA 1Q82R 1HSQA 1M9SA 2ZZDA 2CP5A 2ZPGB 1VQMA 2ZAEA 2KVQG 3QYHB 1M1KU 3VS4A 3V8KA 2GQIA 2P0KA 4J9IA 4HVWA 4JRPA 4M78B 3LH0A 3GNGA 3WVEB 1QLYA 2C0OA 3META 4X34A 1YITQ 2MF2A 3MEUA 3CCRT 4F04B 3TQ7P 3CC2Q 3VJPA 1VQ4Q 4L5GA 2A37A 2DAQA 2YUQA 4DEYA 1PRLC 1M1KR 1M2VB 3M58A 1KQ2A 1IREB 1RACB 2MYSA 3CCQQ 3OSSC 3SWNB 4HCKA 3OMGA 2CSQA 4M7DF 3QO3A 5IXFA 2YLCA 1WYXA 2K5IA 2RHZA 1VQ5A 4OF1A 4OB3B 4RTVA 3NTKA 4ELZC 4DBHA 1BU1A 4C92E 7AT1B 3S3MA 1E7OA 4KH0B 3ASKA 1WXTA 5D6WA 3EFSA 2EFIA 3EGDA 1VQOA 1YI2Q 4M75E 3H41A 3BDUA 3I56Q 4FT4A 1K1ZA 4EMGA 1X01A 1VQKA 2DKGA 2RQUA 4D6WA 4M7AD 2DETA 2M0OA 1WIEA 1MHNA 3UA7A 3I55Q 1U8RA 2DD4A 4J9EA 4N4GA 1Y0MA 2K5LA 2LDMA 5LJ5d 4E2FB 3KBGA 1OPKA 1MMDA 1NE8A 2DZCA 2V8KA 1QWFA 2LJ1A 2WSCE 3M0UA 1YHQQ 2NUZA 3CMEA 4AFSC 3JRZA 5GAOp 4E7JA 2J6OA 2O31A 3R6OA 2VXFA 5L23A 1KC8C 3OW2A 1BIAA 4AT1B 3JSCA 4KGXB 3EGUA 4PFZA 4PJOB 2X4WA 4HCZA 2DFUA 2L0AA 1OZ2A 1VQMT 2NUTA 1M3BA 1QVGP 4OVAA 2RD1A 1NJIC 4JRIA 1K8AU 4F7UF 3AT1B 2QYZA 1D0XA 3QSUA 5D6YA 1Q86C 4F7UG 2W10A 5GAMf 2QDLA 3OB9A 2VYTA 3M55A 4MDWA 2QASA 3I9QA 2CYZB 2JUFA 4C92C 2HCKA 1HYOA 1I8FA 2HBWA 2VGMA 1I1JA 5CK9A 3L2VA 3CCUT 1JXOA 1E6GA 3CCSA 4A4KA 2V8IA 2XU8A 3M4GA 4MZTA 4XTYA 1SRMA 3H0FA 4OMLA 5KYNA 1M2VA 2YRDA 3OMCA 2VUBA 4J9CA 1YJWT 2H8HA 3CCET 1ZSZC 3M59A 3VRZA 1OPLA 2K6DA 2CP6A 2NWMA 1OEBA 2F69A 2QGGA 1EX4A 1IZ6A 3N5BB 1R77A 2DZ9A 1N9RA 1QW1A 3NGPA 2DRMA 1PM3A 1XOVA 1I5LA 2CZ6B 2C0IA 5GANg 3VYHB 1PKTA 1JEGA 2EYXA 2DXCA 3CD6A 4A54A 4J6WA 2RB6A 3D7SB 3AHUA 4DA4A 1WX6A 2L3SA 2LNHB 1Z9ZA 2YUOA 2MCNA 1G5VA 2H3JA 4OMQA 3G4ST 2K2VA 2PUKB 2RJFA 3S3OA 3QDFA 5D6XA 3G1JA 3CCVT 1RABB 4IKFA 1N8RR 2AKLA 3P8BB 3QBYA 3L2ZA 4Z88A 1M1KC 1EFNA 1MNDA 1NEGA 3FJPA 2DTOA 5GAMj 4PJOC 3TEEA 2OTJQ 4NOYA 2HZYA 1I81A 4EMKB 5CCAA 4J9GA 1G3SA 3H9NA 2KQWA 1G3TA 1GBRA 4OMPA 4J7FA 3M56A 4BACA 1WJQA 1VQMQ 3JCMQ 2DJQA 2PZ1A 5LJ3g 1KQSS 2COWA 1IGUA 3G4SQ 3A8MB 1BI1A 5J3BA 1X6BA 1QKWA 1BKBA 4PJOG 4C8QB 3A5ZB 4AFQC 1KK7A 1M90R 4M78C 2AZSA 2QEXT 3OS0A 1IO6A 2HKQB 4MZMA 1NG2A 1G3YA 2JVVA 2JW4A 1M8MA 5CQXA 1H3HA 2GTJA 2PUOB 1FX7A 2D6FA 3FRNA 1KC8R 5CVIA 1N9SA 3BW1A 2GBQA 1RI9A 4PLIA 5FRNA 1FMKA 3EG3A 2X4XA 2RK1A 2COZA 1VQLQ 3ULRB 2C06A 2X3WD 2LCLA 4M77E 3CCEA 2NLUA 1B34B 4ZGDB 3QG1A 1VIFA 3CCVA 3CCMT 1KC8U 3LX7A 1NM7A 3M54A 3CPWP 4PJNA 2ZGWA 2OTJA 2BKDN 5FU7B 2EW3A 3URGA 2JM8A 2HKNA 5IHNA 2BE7D 2HEQA 4OMNA 1G3WA 2CZ1B 2M16A 1Y07A 4HVUA 5A0DA 3QXEB 2KNBB 3S3NA 5GAN2 1KIKA 4JRKA 2EYQA 4IIOA 4A63B 4BD3A 2XHCA 5J39A 3VS3A 1RUWA 5HCKA 2DD5A 2EQUA 3OQ5A 3LLRA 1IHVA 4BI8B 1YWOA 2P84A 4PK4A 4M7AB 2KYMA 2FPEA 3C12A 4WCIA 2D0NA 4OMOA 1RLQC 2LCSA 3UWNA 1CKBA 1UEBA 3HTRA 1K9MR 1Q7YC 3TSWA 3KXTA 3RMQA 2KMTA 5GAOm 3HHTB 1YJNT 2HQXA 1K8AC 4HKEA 1JO8A 2DVJA 4HCBA 3MO8A 2LX9A 2QQSA 4X9DA 4J83A 2EYWA 4GBQA 4Q5WA 5CQYA 1BYMA 4PJOD 3CCJA 4JZ3A 2FVUA 5LJ5j 4RG8A 1Q7YR 1T0HA 1OU8A 2V1QA 2EKOA 3GP8A 3PIPA 3EG2A 1LJOA 3MP6A 2PNIA 2A0FB 4IUTA 4ESRA 4E7IA 1YHQA 2CT4A 2OI3A 3JCMe 4FW2A 5I2MA 1NZ9A 1NEBA 2CREA 1VQ7Q 3CC4T 1YJNA 1BCMA 4QKUA 3MP8A 5FLXE 3OA6A 3DLLA 1QP3A 4XAXB 3VYGA 1N8RU 2OAUA 2YRVA 1OOTA 2QQRA 1N5ZA 3VS0A 4GY5A 5GMKh 5EC7A 3EGXA 1V1CA 5GANe 1QVGA 4FSSA 2DE0X 1SG5A 1W2BP 4DBRA 3RKYA 2KR3A 4C92F 4C0GA 3VS7A 2K5FA 3NPFA 1IRXA 1VYTA 1QCOA 2O9SA 3EFOB 4C92B 1VOMA 1C1AA 3A98A 1W6XA 4Y92A 1VQ6Q 1WZOA 1X75C 2O4XA 1T3LA 3OYJA 3RNJA 3CBPA 2ZPIB 2MMPA 4XTVA 3J7AF 4DBQA 2R58A 4RTXA 2DPPB 4DOVA 1ACMB 3MJXA 5KYWB 4LDUA 1RADB 2YUNA 3KFVA 1VQ6A 2A36A 4PLLA 4PJOA 2M51A 4RTTA 4ELYC 4PJLA 2LZ6B 2DL4A 1VQKQ 3JCMg 1B07A 1QWEA 3CCRQ 4IIMA 3RUXA 2SRCA 5M9OA 2IPOB 1VQOT 4JLGA 1WI7A 2VB6A 4XK8E 1XNIA 1E6HA 3EGXB 1YJ9T 3CCJT 2CP0A 1OI1A 2A7YA 3TVTA 1LOJA 1PC0A 3PT9A 4BE2A 4RTZA 3PNWC 4XTWA 2BZYA 1Q81R 2DNUA 2JXBA 2RI5A 3EFOA 3PTAA 1M90C 1M5Q1 4XU1A 4EIKA 3M57A 1W70A 1LCKA 4M7DG 2D9TA 1RAIB 5A0GA 1JRIA 3GIBA 1ZUKA 2DXUA 3CCUQ 2CKKA 4BDZA 2F2WA 2LC4A 1KD1C 1X2KA 1ZSGA 3NMZC 2JZ2A 4QQDA 1VQKT 2I2LA 2LQ8A 2EGCA 2QQAA 5KCHA 1K4US 1U06A 3MHXA 4BE1A 2KAFA 5KYXA 3CCRA 4CC4B 2EYZA 4C5IA 5LJ5f 2HBPA 1HJDA 2ROTA 2BUDA 5GAN5 3L2RA 2DIQA 1V29B 4M7DA 1KFZA 4X9CA 5LJ3f 1VQ7T 4FU6A 1AEYA 2HNIA 2K9GA 4IUUA 4L59A 2LJ0A 1I0CA 1M1FA 3REAB 3OYFA 5LJ3h 3QJYA 3OYGA 2LJ3A 4PL6A 3I55A 1VQ7A 2L89A 2ZPFB 1MV3A 1SSHA 1UTIA 4TVRA 2M9UA 3THKA 5LJ5h 3OYIA 3CCQA 4E47A 2VASA 2HSEB 4OB0B 2EKHA 8ATCB 2PVGB 3EFRA 3PE0A 4C92D 1ZBXA 2DL3A 1IGQA 1M4ZA 3DB3A 1VQ5Q 2JT4A 1TUGB 5GAN6 3HL8A 1OX8A 1MMGA 2GFUA 1NLPC 2DM1A 1WLPB 2XG8D 1PG5B 1Q81U 3VUZA 4CC3A 3VV0A 2FL7A 1VQ4A 4J9FA 3E19A 4P5NA 2V1RA 5GAMd 1ZUUA 3E9FA 5AYFA 4M77A 2E4HA 9ATCB 3SFMA 1NLOC 1ZHIA 4ZNXA 4FL6A 4C8QE 1TUDA 3CCJQ 2E1HA 2ATCB 2K2MA 4M7AA 3MEVA 2LQNA 2QI2A 1H92A 3HFOA 2NUPA 1RL2A 5GAN8 3M4YA 2YUPA 2R5AA 1NJIR 3CC7Q 1N27A 1MMAA 2HQEA 4OB1B 4E7LA 1OU9A 5GAN3 2FYKA 3EAEA 1QVFA 3MEWA 1PD1A 4BUGA 2FZCB 3M0QA 1AT1B 4PKCC 2O2OA 1YJ9A 2CH4A 2KBTA 2LTOA 1S72A 1V76A 3VS1A 5I22A 2X4JA 1GCPA 2EPDA 2GQVA 4M77G 4ZN1A 5FRMA 1UECA 1NYFA 1SSFA 1SRLA 2L3RA 5GAOq 5GMKi 1TU0B 2K3YA 2MAMA 1MUZA 3O5ZA 4FM4B 2Y4XA 2D0QB 1FXXA 1N8RC 1PSEA 2QEXA 2YXYA 1OV3A 1UJYA 4M75F 2CP7A 4XTZA 1YJNQ 2DYIA 1GRIA 2LCCA 3VU3C 2K57A 2F2VA 3OY9A 2ED0A 3CCVQ 3CBMA 1KJWA 1TH7A 1B34A 1RLPC 3HPWA 1YWPA 4JRQA 5GAOl 1VIEA 3VRYA 4M78F 2XK0A 1BI2A 3HKSA 2IIMA 1X69A 1H8KA 4C92A 2F2XA 4HA8A 2AIRB 3QJ6A 4M75C 5EG2A 1GFDA 4HCCA 4OGEA 1UGRB 3MP1A 4ANJA 1W2BS 5CO7A 1A0NB 3F70A 2ESWA 3Q1JA 4OGCA 2J05A 2M1HA 4MMKA 3RR6A 1VQPA 5GAN7 2ECZA 4F7UA 4EMKC 3CCLA 2FZKB 4EMKA 2VC8A 3FLGA 2DBKA 3CC7A 5GAOn 2DXBA 2DL7A 3QHSA 4JS5A 3H0HA 2E6ZA 5CKHA 3S6WA 3DKMA 1JBMA 1VQNA 2J6KA 2DTIA 4JJBA 3SEMA 3OYNA 2JOYA 2Z0WA 4RCBA 1CSKA 2RN8A 2CSIA 1G8XA 3OYMA 1EIFA 4M7DB 5GMKl 1RAHB 1K9AA 4PJJA 2KE9A 4WF2A 3SHWA 1WXBA 3UDCA 3QWXX 4A4HA 5KYYA 1ZX6A 3OS2A 1YITT 1BB9A 1PRMC 3EG0A 1HK9A 1SEMA 3OS5A 5KE3A 4JZ4A 3WXMB 4PFOA 2DVEA 1Q82U 2NUPB 5FU6B 2DX1A 4UC4A 1QCFA 4VUBA 3JCMd 1I4K1 1B7TA 1KG1A 2HQHA 1VYVA 3OYCA 1VQNT 3REBB 3C4SA 4OMMA 3L2WA 4NL3A 5GAMe 1H3ZA 4F17A 2EJGA 1T0JA 2XICA 2HL5C 1VQ6T 1VUBA 5CIUA 2BIVA 2HDAA 2MOXA 1U5SA 2K4YA 2EIFA 3A8OB 2JTFA 1WQWA 2KY9A 1YCYA 4E7SA 3G6ET 2RF0A 1QQJA 3PVQA 3V7CA 1TTHB 1WHLA 2G6FX 4V2SA 2E41A 3JB9D 3A8HB 1Y96B 3DLMA 3I56A 2DF6A 1KQSA 3UF4A 2AT1B 2V26A 1WFWA 5KYXB 2GNCA 4MZPA 5L8RE 1JXMA 1NBEB 5FWCA 2XDPA 4QVZA 3CCSQ 3G4SA 3SWNC 4XTXA 3JAME 3I35A 4J6XA 2DERA 1QMCA 5GANj 4OB2B 4M7AC 1KD1R 3LWHA 3QIIA 1KHCA 3RMSA 2L5QA 3CXCA 4M4ZA 3OYBA 4DQ2A 2OJ2A 4XU3A 1SHFA 2DILA 4C0DC 4M7AF 4QVDA 2Y4YA 1UGPB 4LDWA 1K8AR 4NL2A 3PMTA 2R57A 3LGLA 4M77B 4OP0A 3WVDB 2OX7A 1UFFA 3PIOA 3CC7T 3NTIA 1KSWA 5IHIA 1K9MU 5A2QE 1X27A 5GAOr 2E10A 3OYKA 1C6VX 5DLQE 2DEQA 2K7AA 3LYIA 3TCJA 3RBBB 4ZGJB 3CMAA 4J9BA 3ZBDA 3JB9I 1W4SA 1ABOA 4RTUA 4Y91A 2RQVA 1UDLA 1UHCA 3G7ZA 3X25B 1UGQB 3M0RA 2EAYA 2BZ8A 3HRTA 1R0BG 1QVFP 2FB7A 2XD0A 3V8LA 2YDLA 1P92A 2E5QA 2VXEA 2AK5A 3QWYA 5FWBA 3SWNA 1ZSZA 4IURA 2KK4A 3EH2A 5IN1A 3HRUA 3CCLT 2MI6A 1PHTA 5FU7C 2DYBA 2HMAA 1ZBJA 1Q95G 2L2PA 1S72T 1KQSP 2KYBA 2RK2A 4E7ZA 2DRKA 2P0QA 2QG9B 3I5RA 4LNPA 4KGVB 5GAN4 4II1A 3LH5A 4Z8AA 4M78E 2VV5A 2O4XB 2R5MA 3JB9G 5IT9E 4LD9K 1YP5A 3GPLA 3JCMX 4B9XA 1AWWA 2O88A 4CC2A 1B3QA 3MPUB 2DK3A 3UPUA 1JJ2S 2LT1A 1ZSZB 3CQTA 2M02A 5DY9A 3CC2T 1C0MA 4AG1C 1VQLT 2WSEE 1ARKA 2FEIA 5AT1B 1D1AA 3INZA 3QZ9B 3OBWA 3CC2A 3RIRA 1BBZA 4QVCA 1GFCA 2DMOA 3A1PA 1GCQA 3L42A 3QYGB 2E65A 1TS9A 1Q86U 4K11A 1VQ8A 1AWXA 4XU0A 1S1NA 1Q82C 1J3TA 2MWOA 1WJSA 1ZA2B 3FC3A 2DO3A 3OS1A 1FYNA 4FYYB 5KYYB 3H0IA 4A4GA 3L2UA 3HP9A 4DOWA 1Q7YU 2DBMA 3O8VA 1RAFB 5DM7R 2ENMA 2LT4A 1X6GA 1GCQC 1MV0B 3X24B 3OW2S 1VQPQ 3SDZA 2ABLA 2KDSA 4C8QA 5GJVB 3CCMA 2JS2A 4LDXA 3EGDB 3CPWS 4BI3A 1IHWA 3JB9H 4RUGA 4C5GA 4PJMA 4M75D 3JCMb 1QVFS 3I5SA 1KQ1A 4F7UE 4F7UB 3QUIA 2A3LA 2C0TA 1JQQA 3EHRA 4MMLA 1WXUA 1NPRA 1BI3A 4Z89A 4LDYA 3CMAT 2X3XD 2ZCFB 1VA7A 1LNXA 2JMAA 5GMKj 1VQ9Q 4E7KA 2SEMA 1SHGA 2CS7A 5LJ5g 1D0YA 1CKAA 2JNGA 4M77C 5KCOA 3C95A 2V8JA 5CR2A 3NTHA 3T9NA 3JCMJ 1VQ5T 1RAEB 2B8AA 1YITA 1YNZA 3G6EA 2GFAA 2H3EB 4Z02A 2P4TA 4DEXA 1AHJB 2Y90A 3VS2A 5GAMh 5GANd 5D7UA 3J80E 5GANh 2XDBA 1M8VA 2FZGB 2CT3A 2JN0A 3GNFB 2E6NA 3ZFJA 3G71T 3L1AA 3CC4Q 3DB4A 4F14A 3FB9A 2FRWA 3QKJA 1YJWQ 2QAZA 3CCEQ 1RAAB 5FROA 2PU9B 2EQIA 2RNAA 4A4FA 1TWBA 2J06A 3EG1A 2KRSA 5C6SA 4FW1A 1YIJQ 3LGFA 5CKEA 1YJ9Q 1KHIA 2DL8A 4JJCA 4KRTA 1VQ9T 1HD3A 4ZTJA 2F5KA 2RJEA 3U23A 1I5OB 5LJ3j 1ZA1B 3MKDA 1WJRA 3CBOA 3I56T 1ABQA 4R0KA 1QVGS 1M30A 5KYWA 2MPXC 3M5AA 3GLXA 3CD6T 2XIDA 2YRCA 2IVWA 3MCAB 2EJ9A 1K9MC 5LJ3e 3NFCA 1M90U 3E9GA 4J8OA 2EYYA 2EQJA 1OZ3A 3LW5E 4HT9A 4J6YA 2GGRA 2VKNA 1YHQT 2KROA 2DXTA 2GF7A 2RHUA 4J7IA 3CCQT 1BI0A 1FMWA 1UGVA 2LMJA 4FYXB 4JLIA 1K73R 1YCSB 2QTXA 4PFPA 3CPFA 1G83A 1NJIU
chains in the Genus database with same CATH topology
3VS6A 2PTKA 1AWOA 1GBQA 1K9AA 1YN8A 2KE9A 1JO8A 2DVJA 2E5KA 1WXBA 2I0NA 2YT6A 3QWXX 5ECAA 1X2QA 2CUBA 3SHWA 3UA6A 1ZX6A 4RTWA 1BB9A 4JJDA 1PRMC 3EG0A 3TSZA 1SEMA 2EYWA 4GBQA 4JZ4A 4LUDA 3IQLA 2EGEA 1T3SA 2EBPA 2FPDA 4J9DA 2DX1A 1AZEA 4JZ3A 1QCFA 1NYGA 1WDXA 1T0HA 2V1QA 2KRNA 2KRMA 1VYVA 3REBB 1AOJA 4OMMA 3EG2A 4F17A 1T0JA 2PNIA 3C0CA 4ESRA 1K0SA 1PNJA 1HSQA 2CT4A 2OI3A 2HDAA 2MOXA 1U5SA 1NEBA 3VS4A 2CREA 4X1VA 3EHQA 1AZGB 2GQIA 4J9IA 4HVWA 2RF0A 3PVQA 1OOTA 1N5ZA 3VS0A 2G6FX 1QLYA 2C0OA 5EC7A 3FJ5A 4AFUC 1V1CA 2LQWA 2DF6A 4FSSA 2DE0X 2DL5A 2KT1A 2OAWA 3UF4A 2KR3A 2A37A 4AG2C 1WFWA 2YUQA 4DEYA 1PRLC 2GNCA 1JXMA 3M0TA 3VS7A 3NPFA 5FWCA 1VYTA 2O9SA 3A98A 1W6XA 2RMOA 4HCKA 2KEAA 2CSQA 3I35A 2JTEA 3R6NA 4Y92A 5FW9A 2BZXA 1T3LA 2KXCA 3RNJA 5IXFA 1WYXA 1Y57A 1JU5C 4RTXA 4RTVA 2YUNA 3KFVA 2A36A 1BU1A 5IXBA 2M51A 1E7OA 4RTTA 4LE9A 4M4ZA 1UUEA 2LZ6B 2DL4A 1WXTA 1B07A 1QWEA 2OJ2A 2D8JA 1SHFA 2DILA 4IIMA 2SRCA 3H41A 4CC7A 1K1ZA 2MIOA 1M27C 1WI7A 2RQUA 1E6HA 4LN2A 1UFFA 2O9VA 1WIEA 3UA7A 2LP5A 4J9EA 3TVTA 1Y0MA 1KSWA 1G2BA 4RTZA 5IHIA 1OPKA 1Z9QA 2BZYA 2DNUA 2JXBA 2W0ZA 1QWFA 3ZL7C 2LJ1A 1X27A 3VS5A 2KGTA 3M0UA 2CUDA 2NUZA 4EIKA 4AFSC 2J6OA 2O31A 1W70A 1SPKA 1LCKA 5L23A 3NHNA 2K7AA 3RBBB 1ZUKA 2AKKA 3EGUA 4J9BA 1UHFA 2F2WA 2L0AA 1ABOA 4RTUA 2RQVA 1UDLA 1UHCA 1X2KA 1ZSGA 1M3BA 3NMZC 2KT8A 3M0RA 2BZ8A 2EGAA 2KXDA 4LUEA 1GL5A 4F16A 1TUCA 2EGCA 5I11A 2RQRA 2YDLA 1K4US 5FWBA 1U06A 3QWYA 2AK5A 2W10A 2FRYA 4CC4B 2QDLA 2EYZA 1K76A 1PHTA 2DYBA 1ZBJA 1HJDA 2L2PA 2ROLA 4GLMA 2ROTA 3I9QA 2KYBA 2HCKA 2DRKA 2HBWA 1KFZA 3I5RA 4LNPA 1AEYA 1I1JA 2K9GA 3LH5A 4Z8AA 2LJ0A 1AVZC 1I0CA 4AFZC 2LX7A 3REAB 1JXOA 1E6GA 2LJ3A 1AWJA 1YP5A 1MV3A 1SSHA 1UTIA 4E6RA 1SRMA 3H0FA 4OMLA 1AWWA 2O88A 4CC2A 1B3QA 4J9CA 3THKA 4D8DA 2H8HA 3CQTA 3VRZA 1OPLA 2K6DA 2DA9A 4AG1C 2RPNA 2NWMA 1ARKA 2EKHA 2FEIA 1OEBA 3PE0A 1BBZA 2DL3A 3NGPA 2DRMA 2A08A 1GFCA 1XOVA 2DMOA 2FO0A 1GCQA 2JT4A 2C0IA 5IHKA 1PKTA 1JEGA 2EYXA 4K11A 1ZUYA 1AWXA 1S1NA 1WX6A 1BK2A 1J3TA 1NLPC 2DM1A 2L3SA 2FPFA 1I07A 2LNHB 1WLPB 1Z9ZA 1AD5A 2YUOA 2MCNA 2JM9A 4OMQA 1FYNA 4CC3A 3JV3A 3H0IA 1K0XA 4J9FA 2V1RA 1PKSA 2XMFA 3PVLA 2DBMA 1ZUUA 4D8KA 2ENMA 2AKLA 1X6GA 1GCQC 1MV0B 1NLOC 4ZNXA 2ABLA 1TUDA 2K2MA 5GJVB 2L3PA 4Z88A 2JS2A 1VYUA 1H92A 2LQNA 2RQTA 1M3AA 2RQWA 4J9HA 1EFNA 1NEGA 2HSPA 2YUPA 2CH4W 2D8HA 4RUGA 3I5SA 4J9GA 3M0QA 4HVVA 1GBRA 2O2OA 5GJWB 2CH4A 2C0TA 4OMPA 1JQQA 2KBTA 3EHRA 5I22A 3VS1A 1WXUA 2DJQA 2ED1A 1GCPA 2EPDA 2PZ1A 4Z89A 2X3XD 1VA7A 2JMAA 1UECA 1NYFA 1X6BA 1WA7A 2SEMA 3GBQA 1SRLA 1QKWA 1SHGA 3UATA 4JPBW 4AFQC 1CKAA 1UJ0A 1MUZA 3O5ZA 1YNZA 2AZSA 1IO6A 2CDTA 2D1XA 4DEXA 1OV3A 1NG2A 1UJYA 2YSQA 2JW4A 2DLPA 3VS2A 1M8MA 1H3HA 2GTJA 2J7IA 2FG0A 2CT3A 1GRIA 1U3OA 2J6FA 2P4RA 4F14A 2FRWA 2F2VA 2GBQA 1TG0A 2ED0A 1RI9A 1FMKA 3EG3A 1KJWA 2EQIA 2JMCA 2RNAA 2VVKA 1RLPC 2J06A 3EG1A 1YWPA 2KRSA 5IH2A 3ULRB 2X3WD 1W1FA 3VRYA 2EVRA 2DL8A 2IIMA 4JJCA 1X69A 1H8KA 4KRTA 2VWFA 2F2XA 1NM7A 2K3BA 4QT7A 1HD3A 2EW3A 3U23A 1GFDA 2JM8A 1QKXA 5IHNA 3M0PA 2HEQA 1ZLMA 4OMNA 1A0NB 1X43A 1UG1A 2ESWA 4HVUA 2J05A 2BTTA 1ABQA 2KNBB 1M3CA 4R0KA 2AZVA 2A28A 1M30A 2ECZA 1KIKA 4IIOA 4A63B 2DBKA 3VS3A 3M0SA 1RUWA 1PWTA 4RTYA 2DL7A 5HCKA 2EYYA 3H0HA 1UE9A 4HXJA 4ORZA 2L3QA 2JS0A 2J6KA 1YWOA 4JJBA 2GGRA 2KYMA 2K79A 2FPEA 2VKNA 3SEMA 2B86A 4WCIA 2D0NA 2KROA 1RLQC 4OMOA 2LCSA 1CKBA 1CSKA 1UGVA 2LMJA 2RN8A 2CSIA 2GTOA 3TSWA 1YCSB 2M0YA 1G83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS6 A;  2PTK A;  1AWO A;  1GBQ A;  1K9A A;  1YN8 A;  2KE9 A;  1JO8 A;  2DVJ A;  2E5K A;  1WXB A;  2I0N A;  2YT6 A;  3QWX X;  5ECA A;  1X2Q A;  2CUB A;  3SHW A;  3UA6 A;  1ZX6 A;  4RTW A;  1BB9 A;  4JJD A;  1PRM C;  3EG0 A;  3TSZ A;  1SEM A;  2EYW A;  4GBQ A;  4JZ4 A;  4LUD A;  3IQL A;  2EGE A;  1T3S A;  2EBP A;  2FPD A;  4J9D A;  2DX1 A;  1AZE A;  4JZ3 A;  1QCF A;  1NYG A;  1WDX A;  1T0H A;  2V1Q A;  2KRN A;  2KRM A;  1VYV A;  3REB B;  1AOJ A;  4OMM A;  3EG2 A;  4F17 A;  1T0J A;  2PNI A;  3C0C A;  4ESR A;  1K0S A;  1PNJ A;  1HSQ A;  2CT4 A;  2OI3 A;  2HDA A;  2MOX A;  1U5S A;  1NEB A;  3VS4 A;  2CRE A;  4X1V A;  3EHQ A;  1AZG B;  2GQI A;  4J9I A;  4HVW A;  2RF0 A;  3PVQ A;  1OOT A;  1N5Z A;  3VS0 A;  2G6F X;  1QLY A;  2C0O A;  5EC7 A;  3FJ5 A;  4AFU C;  1V1C A;  2LQW A;  2DF6 A;  4FSS A;  2DE0 X;  2DL5 A;  2KT1 A;  2OAW A;  3UF4 A;  2KR3 A;  2A37 A;  4AG2 C;  1WFW A;  2YUQ A;  4DEY A;  1PRL C;  2GNC A;  1JXM A;  3M0T A;  3VS7 A;  3NPF A;  5FWC A;  1VYT A;  2O9S A;  3A98 A;  1W6X A;  2RMO A;  4HCK A;  2KEA A;  2CSQ A;  3I35 A;  2JTE A;  3R6N A;  4Y92 A;  5FW9 A;  2BZX A;  1T3L A;  2KXC A;  3RNJ A;  5IXF A;  1WYX A;  1Y57 A;  1JU5 C;  4RTX A;  4RTV A;  2YUN A;  3KFV A;  2A36 A;  1BU1 A;  5IXB A;  2M51 A;  1E7O A;  4RTT A;  4LE9 A;  4M4Z A;  1UUE A;  2LZ6 B;  2DL4 A;  1WXT A;  1B07 A;  1QWE A;  2OJ2 A;  2D8J A;  1SHF A;  2DIL A;  4IIM A;  2SRC A;  3H41 A;  4CC7 A;  1K1Z A;  2MIO A;  1M27 C;  1WI7 A;  2RQU A;  1E6H A;  4LN2 A;  1UFF A;  2O9V A;  1WIE A;  3UA7 A;  2LP5 A;  4J9E A;  3TVT A;  1Y0M A;  1KSW A;  1G2B A;  4RTZ A;  5IHI A;  1OPK A;  1Z9Q A;  2BZY A;  2DNU A;  2JXB A;  2W0Z A;  1QWF A;  3ZL7 C;  2LJ1 A;  1X27 A;  3VS5 A;  2KGT A;  3M0U A;  2CUD A;  2NUZ A;  4EIK A;  4AFS C;  2J6O A;  2O31 A;  1W70 A;  1SPK A;  1LCK A;  5L23 A;  3NHN A;  2K7A A;  3RBB B;  1ZUK A;  2AKK A;  3EGU A;  4J9B A;  1UHF A;  2F2W A;  2L0A A;  1ABO A;  4RTU A;  2RQV A;  1UDL A;  1UHC A;  1X2K A;  1ZSG A;  1M3B A;  3NMZ C;  2KT8 A;  3M0R A;  2BZ8 A;  2EGA A;  2KXD A;  4LUE A;  1GL5 A;  4F16 A;  1TUC A;  2EGC A;  5I11 A;  2RQR A;  2YDL A;  1K4U S;  5FWB A;  1U06 A;  3QWY A;  2AK5 A;  2W10 A;  2FRY A;  4CC4 B;  2QDL A;  2EYZ A;  1K76 A;  1PHT A;  2DYB A;  1ZBJ A;  1HJD A;  2L2P A;  2ROL A;  4GLM A;  2ROT A;  3I9Q A;  2KYB A;  2HCK A;  2DRK A;  2HBW A;  1KFZ A;  3I5R A;  4LNP A;  1AEY A;  1I1J A;  2K9G A;  3LH5 A;  4Z8A A;  2LJ0 A;  1AVZ C;  1I0C A;  4AFZ C;  2LX7 A;  3REA B;  1JXO A;  1E6G A;  2LJ3 A;  1AWJ A;  1YP5 A;  1MV3 A;  1SSH A;  1UTI A;  4E6R A;  1SRM A;  3H0F A;  4OML A;  1AWW A;  2O88 A;  4CC2 A;  1B3Q A;  4J9C A;  3THK A;  4D8D A;  2H8H A;  3CQT A;  3VRZ A;  1OPL A;  2K6D A;  2DA9 A;  4AG1 C;  2RPN A;  2NWM A;  1ARK A;  2EKH A;  2FEI A;  1OEB A;  3PE0 A;  1BBZ A;  2DL3 A;  3NGP A;  2DRM A;  2A08 A;  1GFC A;  1XOV A;  2DMO A;  2FO0 A;  1GCQ A;  2JT4 A;  2C0I A;  5IHK A;  1PKT A;  1JEG A;  2EYX A;  4K11 A;  1ZUY A;  1AWX A;  1S1N A;  1WX6 A;  1BK2 A;  1J3T A;  1NLP C;  2DM1 A;  2L3S A;  2FPF A;  1I07 A;  2LNH B;  1WLP B;  1Z9Z A;  1AD5 A;  2YUO A;  2MCN A;  2JM9 A;  4OMQ A;  1FYN A;  4CC3 A;  3JV3 A;  3H0I A;  1K0X A;  4J9F A;  2V1R A;  1PKS A;  2XMF A;  3PVL A;  2DBM A;  1ZUU A;  4D8K A;  2ENM A;  2AKL A;  1X6G A;  1GCQ C;  1MV0 B;  1NLO C;  4ZNX A;  2ABL A;  1TUD A;  2K2M A;  5GJV B;  2L3P A;  4Z88 A;  2JS2 A;  1VYU A;  1H92 A;  2LQN A;  2RQT A;  1M3A A;  2RQW A;  4J9H A;  1EFN A;  1NEG A;  2HSP A;  2YUP A;  2CH4 W;  2D8H A;  4RUG A;  3I5S A;  4J9G A;  3M0Q A;  4HVV A;  1GBR A;  2O2O A;  5GJW B;  2CH4 A;  2C0T A;  4OMP A;  1JQQ A;  2KBT A;  3EHR A;  5I22 A;  3VS1 A;  1WXU A;  2DJQ A;  2ED1 A;  1GCP A;  2EPD A;  2PZ1 A;  4Z89 A;  2X3X D;  1VA7 A;  2JMA A;  1UEC A;  1NYF A;  1X6B A;  1WA7 A;  2SEM A;  3GBQ A;  1SRL A;  1QKW A;  1SHG A;  3UAT A;  4JPB W;  4AFQ C;  1CKA A;  1UJ0 A;  1MUZ A;  3O5Z A;  1YNZ A;  2AZS A;  1IO6 A;  2CDT A;  2D1X A;  4DEX A;  1OV3 A;  1NG2 A;  1UJY A;  2YSQ A;  2JW4 A;  2DLP A;  3VS2 A;  1M8M A;  1H3H A;  2GTJ A;  2J7I A;  2FG0 A;  2CT3 A;  1GRI A;  1U3O A;  2J6F A;  2P4R A;  4F14 A;  2FRW A;  2F2V A;  2GBQ A;  1TG0 A;  2ED0 A;  1RI9 A;  1FMK A;  3EG3 A;  1KJW A;  2EQI A;  2JMC A;  2RNA A;  2VVK A;  1RLP C;  2J06 A;  3EG1 A;  1YWP A;  2KRS A;  5IH2 A;  3ULR B;  2X3W D;  1W1F A;  3VRY A;  2EVR A;  2DL8 A;  2IIM A;  4JJC A;  1X69 A;  1H8K A;  4KRT A;  2VWF A;  2F2X A;  1NM7 A;  2K3B A;  4QT7 A;  1HD3 A;  2EW3 A;  3U23 A;  1GFD A;  2JM8 A;  1QKX A;  5IHN A;  3M0P A;  2HEQ A;  1ZLM A;  4OMN A;  1A0N B;  1X43 A;  1UG1 A;  2ESW A;  4HVU A;  2J05 A;  2BTT A;  1ABQ A;  2KNB B;  1M3C A;  4R0K A;  2AZV A;  2A28 A;  1M30 A;  2ECZ A;  1KIK A;  4IIO A;  4A63 B;  2DBK A;  3VS3 A;  3M0S A;  1RUW A;  1PWT A;  4RTY A;  2DL7 A;  5HCK A;  2EYY A;  3H0H A;  1UE9 A;  4HXJ A;  4ORZ A;  2L3Q A;  2JS0 A;  2J6K A;  1YWO A;  4JJB A;  2GGR A;  2KYM A;  2K79 A;  2FPE A;  2VKN A;  3SEM A;  2B86 A;  4WCI A;  2D0N A;  2KRO A;  1RLQ C;  4OMO A;  2LCS A;  1CKB A;  1CSK A;  1UGV A;  2LMJ A;  2RN8 A;  2CSI A;  2GTO A;  3TSW A;  1YCS B;  2M0Y A;  1G83 A; 
#chains in the Genus database with same CATH topology
 3VS6 A;  1O75 A;  4C0D B;  1ZQ1 A;  1AWO A;  4BB7 A;  2IG0 A;  1GBQ A;  1YN8 A;  4M7A E;  2E5K A;  2I0N A;  3UA6 A;  2YT6 A;  2CUB A;  2BE9 B;  4RTW A;  3E2U A;  4M75 G;  4ME7 A;  4JJD A;  4C8Q F;  3TSZ A;  2E3I A;  1TSF A;  4N4H A;  3OYD A;  4KUI A;  2EQK A;  4LUD A;  2EJF A;  2E12 A;  3V8J A;  1K73 U;  1WHH A;  1NYG A;  4PJO F;  5CKB A;  3J81 E;  1KD1 U;  4IUP A;  3JB9 J;  2LVM A;  3FEO A;  4ZGE B;  2PQW A;  4JUV A;  4FCY A;  4RKU E;  2P0P A;  4BDY A;  2JJ9 A;  5LJ5 e;  2OTL Q;  4XTU A;  2JTM A;  2OTJ T;  1PNJ A;  2RJC A;  1WHG A;  3EHQ A;  4NS5 A;  4X1V A;  1AZG B;  3ER0 A;  1PSF A;  2XDD A;  3VKI A;  4CI0 C;  1UGS B;  1PD0 A;  3JCM P;  2RHY A;  5CKD A;  3HRS A;  2AHJ B;  1IB8 A;  3FJ5 A;  4C5E A;  2RI2 A;  2CGH A;  4AFU C;  1D0Z A;  2LQW A;  2X51 A;  4N4I A;  2DL5 A;  2KT1 A;  2OAW A;  4AG2 C;  4JS4 A;  2DJZ A;  3M0T A;  2E70 A;  2COY A;  3EG9 B;  4BY6 C;  4EMH A;  2RMO A;  2KEA A;  3CPW A;  2JTE A;  3R6N A;  5FW9 A;  1JJ2 P;  2BZX A;  1Q81 C;  2KXC A;  1XTD A;  3OYY A;  4C8Q D;  4XU2 A;  1Y57 A;  1JU5 C;  4N0A C;  1OX9 A;  3X28 B;  2X9H A;  4L6V 5;  5IXB A;  2O01 E;  4HT8 A;  4LE9 A;  1UUE A;  3QPH A;  3MEA A;  2D8J A;  3RKW A;  2LQK A;  4QQG A;  3TRE A;  3QZ5 B;  3CME Q;  2XI9 A;  4CC7 A;  2MIO A;  4CRI A;  1M27 C;  1FMV A;  4AMC A;  3OYE A;  2E64 A;  4LN2 A;  2X4Y A;  2DEU A;  2RI3 A;  1D1C A;  1N6A A;  2O9V A;  4Y28 E;  4M7A G;  2LP5 A;  2DTH A;  2E3H A;  5GMK e;  3OYA A;  3LWI A;  1MGQ A;  1G2B A;  3V7R A;  4QW2 A;  1Z9Q A;  2W0Z A;  1PCX A;  3EG9 A;  5CAI A;  1JJ2 A;  3ZL7 C;  3RER A;  4R56 A;  3VS5 A;  2CZ7 B;  1D3B B;  2KGT A;  2CUD A;  3CXC S;  2RHX A;  2OTL A;  3JCM V;  3JB9 F;  1SPK A;  4OMF B;  2ZPH B;  3NHN A;  4KH1 B;  4LXC A;  4LDV A;  5GMK m;  2CP2 A;  4BE0 A;  2AKK A;  1UHF A;  3ME9 A;  4RG2 A;  3CD6 Q;  4C92 G;  1OUL A;  1WQ7 A;  2KT8 A;  5CKF A;  3HFN A;  2EGA A;  3G71 Q;  3RKX A;  5HKC A;  2KXD A;  4LUE A;  1GL5 A;  4F16 A;  1TUC A;  1VQP T;  1SF9 A;  5I11 A;  1MMN A;  2RQR A;  1MNE A;  3A8L B;  1VQO Q;  3M53 A;  2FRY A;  4GLK A;  1K76 A;  2HD0 A;  4RMO A;  5KYU A;  2KI7 A;  2ROL A;  4GLM A;  2RH2 A;  4KGZ B;  4M7D E;  1O9S A;  3PMI A;  4KUD K;  3CCU A;  3RDV A;  1AVZ C;  3P8H A;  5I2S A;  4AFZ C;  4IUQ A;  2LX7 A;  1OYX A;  3KUF A;  4O6J A;  3E1S A;  1AWJ A;  1JB0 E;  4E6R A;  1U1T A;  4FSX A;  1VQN Q;  2ZPE B;  4EPC A;  4D8D A;  4ATO A;  4KT0 E;  1R8O B;  3H8Z A;  4M7D D;  1F1B B;  1R0C B;  4FT2 A;  2DA9 A;  2RPN A;  4J5Y A;  1D3B A;  1Q86 R;  1UB4 A;  2QDY B;  3CCL Q;  4C8Q G;  3G71 A;  1LVK A;  3H6Z A;  2A08 A;  2MK5 A;  4EDU A;  2FO0 A;  3V7S A;  1FWZ A;  4JJN K;  5IHK A;  1RI0 A;  5HK0 A;  1YBY A;  1ZUY A;  2YHT A;  4M7D C;  4BI4 A;  4ZN3 A;  1BK2 A;  1YI2 A;  5KE2 A;  2FPF A;  1I07 A;  1EZZ B;  1XQH A;  1AD5 A;  4M77 D;  3SB2 A;  4C0Z A;  2JM9 A;  3X20 B;  3PFS A;  3JV3 A;  4M75 B;  3OW2 P;  1K0X A;  4DBF A;  3PVL A;  1PKS A;  2XMF A;  2DIG A;  2QXF A;  3GOX A;  3CCS T;  2CP3 A;  4D8K A;  1QVP A;  2VGN A;  4FYV B;  4N0A A;  5KYU B;  1WHK A;  3HSB A;  2L3P A;  1VYU A;  4XQ3 A;  2RQT A;  5C0M A;  1M3A A;  2RQW A;  2EQM A;  4J9H A;  4C5H A;  3CC4 A;  1Y7X A;  2HSP A;  2RM4 A;  5GAN f;  1HXD A;  2CH4 W;  2D8H A;  1XJW B;  3FIF A;  3RES A;  1K73 C;  2QEX Q;  2PVD B;  3G6E Q;  4HVV A;  5GJW B;  3BFM A;  1RAG B;  2OTL T;  4RCC A;  4M78 G;  4YTL A;  2XKO C;  2ED1 A;  3CME T;  3EH1 A;  3OYL A;  4B9W A;  2RHI A;  4KBM B;  1WA7 A;  3GBQ A;  1VQ4 T;  3UAT A;  4JPB W;  1YIJ T;  1UJ0 A;  3BE3 A;  5GAM g;  5FU6 C;  8AT1 B;  1YIJ A;  2HAX A;  2KSS A;  2CDT A;  2D1X A;  2YSQ A;  2DLP A;  2QQ9 A;  3OSV A;  2FHD A;  3TU4 K;  3VUB A;  2QTV A;  2HL3 A;  3JCM f;  2J7I A;  5KH6 A;  2LNV A;  2FG0 A;  2QK0 A;  2J6F A;  1U3O A;  3A8G B;  1WPY A;  2P4R A;  4C0F A;  3UT1 A;  4FIB A;  2K3X A;  2RJD A;  2X35 A;  1TG0 A;  1YI2 T;  1U1S A;  1D09 B;  3BDL A;  4C8Q C;  2JMC A;  2QA4 A;  2VVK A;  1GXI E;  2LRQ A;  5DLO A;  1WNL A;  1M2O A;  5IH2 A;  1WHJ A;  4R55 A;  1W1F A;  4MDX A;  2EVR A;  1WGS A;  5IAY A;  3I55 T;  2QA4 T;  4E7H A;  4M78 A;  1TOV A;  3BY7 A;  1YJW A;  4FYW B;  3ZEH A;  4PJO E;  3CXC P;  2VWF A;  2K3B A;  4QT7 A;  4A4E A;  1VQ9 A;  4M75 A;  3M9Q A;  5HY6 A;  3JCM h;  1M1G A;  1X6O A;  1QKX A;  1W2B A;  3M0P A;  5LL6 S;  1ZLM A;  1VQ8 Q;  1Y96 A;  4PNO A;  1X43 A;  1UG1 A;  2EWN A;  5A0L A;  1H64 1;  2BTT A;  1Y71 A;  1M3C A;  3CEY A;  2AZV A;  1TXQ A;  2A28 A;  2RA2 A;  1QCN A;  2ZPB B;  2NUT B;  3L2Q A;  1D1B A;  3M0S A;  1QP2 A;  1PWT A;  2QGF B;  4RTY A;  4WTO B;  1YFN A;  4ZTF A;  4B6M A;  1IXD A;  3JCM W;  1UE9 A;  4HXJ A;  4ORZ A;  4KUL A;  5HK3 A;  2JS0 A;  2L3Q A;  2NYS A;  3CCM Q;  2K79 A;  2WAC A;  3P8D A;  2B86 A;  2YLB A;  1DJ7 B;  4O5V A;  2CZ0 B;  2GTO A;  1S72 Q;  1VQL A;  2WSF E;  2QA4 Q;  3FDR A;  3X26 B;  2M0Y A;  2QQB A;  2F5T X;  3OYH A;  3GF5 A;  3JCM c;  2PTK A;  1SKU B;  1BCO A;  3OBY A;  5ECA A;  1X2Q A;  3QDR B;  5LJ3 d;  4QQ6 A;  4LD6 A;  4JDS A;  2G3R A;  4IUV A;  1VQ8 T;  3IQL A;  2EGE A;  3PGG A;  1T3S A;  2EBP A;  2FPD A;  4J9D A;  1AZE A;  4M78 D;  2RO0 A;  1WDX A;  5I21 A;  4A53 A;  2KRN A;  2KRM A;  2MWP A;  2GCX A;  1AOJ A;  3SD4 A;  5J26 A;  3CMA Q;  4M77 F;  1NPP A;  3C94 A;  2L8D A;  1BIB A;  2YWW A;  2PVO B;  1WHM A;  6AT1 B;  1LPL A;  2F1L A;  3C0C A;  4BY6 B;  1K0S A;  1OQK A;  1Q82 R;  1HSQ A;  1M9S A;  2ZZD A;  2CP5 A;  2ZPG B;  1VQM A;  2ZAE A;  2KVQ G;  3QYH B;  1M1K U;  3VS4 A;  3V8K A;  2GQI A;  2P0K A;  4J9I A;  4HVW A;  4JRP A;  4M78 B;  3LH0 A;  3GNG A;  3WVE B;  1QLY A;  2C0O A;  3MET A;  4X34 A;  1YIT Q;  2MF2 A;  3MEU A;  3CCR T;  4F04 B;  3TQ7 P;  3CC2 Q;  3VJP A;  1VQ4 Q;  4L5G A;  2A37 A;  2DAQ A;  2YUQ A;  4DEY A;  1PRL C;  1M1K R;  1M2V B;  3M58 A;  1KQ2 A;  1IRE B;  1RAC B;  2MYS A;  3CCQ Q;  3OSS C;  3SWN B;  4HCK A;  3OMG A;  2CSQ A;  4M7D F;  3QO3 A;  5IXF A;  2YLC A;  1WYX A;  2K5I A;  2RHZ A;  1VQ5 A;  4OF1 A;  4OB3 B;  4RTV A;  3NTK A;  4ELZ C;  4DBH A;  1BU1 A;  4C92 E;  7AT1 B;  3S3M A;  1E7O A;  4KH0 B;  3ASK A;  1WXT A;  5D6W A;  3EFS A;  2EFI A;  3EGD A;  1VQO A;  1YI2 Q;  4M75 E;  3H41 A;  3BDU A;  3I56 Q;  4FT4 A;  1K1Z A;  4EMG A;  1X01 A;  1VQK A;  2DKG A;  2RQU A;  4D6W A;  4M7A D;  2DET A;  2M0O A;  1WIE A;  1MHN A;  3UA7 A;  3I55 Q;  1U8R A;  2DD4 A;  4J9E A;  4N4G A;  1Y0M A;  2K5L A;  2LDM A;  5LJ5 d;  4E2F B;  3KBG A;  1OPK A;  1MMD A;  1NE8 A;  2DZC A;  2V8K A;  1QWF A;  2LJ1 A;  2WSC E;  3M0U A;  1YHQ Q;  2NUZ A;  3CME A;  4AFS C;  3JRZ A;  5GAO p;  4E7J A;  2J6O A;  2O31 A;  3R6O A;  2VXF A;  5L23 A;  1KC8 C;  3OW2 A;  1BIA A;  4AT1 B;  3JSC A;  4KGX B;  3EGU A;  4PFZ A;  4PJO B;  2X4W A;  4HCZ A;  2DFU A;  2L0A A;  1OZ2 A;  1VQM T;  2NUT A;  1M3B A;  1QVG P;  4OVA A;  2RD1 A;  1NJI C;  4JRI A;  1K8A U;  4F7U F;  3AT1 B;  2QYZ A;  1D0X A;  3QSU A;  5D6Y A;  1Q86 C;  4F7U G;  2W10 A;  5GAM f;  2QDL A;  3OB9 A;  2VYT A;  3M55 A;  4MDW A;  2QAS A;  3I9Q A;  2CYZ B;  2JUF A;  4C92 C;  2HCK A;  1HYO A;  1I8F A;  2HBW A;  2VGM A;  1I1J A;  5CK9 A;  3L2V A;  3CCU T;  1JXO A;  1E6G A;  3CCS A;  4A4K A;  2V8I A;  2XU8 A;  3M4G A;  4MZT A;  4XTY A;  1SRM A;  3H0F A;  4OML A;  5KYN A;  1M2V A;  2YRD A;  3OMC A;  2VUB A;  4J9C A;  1YJW T;  2H8H A;  3CCE T;  1ZSZ C;  3M59 A;  3VRZ A;  1OPL A;  2K6D A;  2CP6 A;  2NWM A;  1OEB A;  2F69 A;  2QGG A;  1EX4 A;  1IZ6 A;  3N5B B;  1R77 A;  2DZ9 A;  1N9R A;  1QW1 A;  3NGP A;  2DRM A;  1PM3 A;  1XOV A;  1I5L A;  2CZ6 B;  2C0I A;  5GAN g;  3VYH B;  1PKT A;  1JEG A;  2EYX A;  2DXC A;  3CD6 A;  4A54 A;  4J6W A;  2RB6 A;  3D7S B;  3AHU A;  4DA4 A;  1WX6 A;  2L3S A;  2LNH B;  1Z9Z A;  2YUO A;  2MCN A;  1G5V A;  2H3J A;  4OMQ A;  3G4S T;  2K2V A;  2PUK B;  2RJF A;  3S3O A;  3QDF A;  5D6X A;  3G1J A;  3CCV T;  1RAB B;  4IKF A;  1N8R R;  2AKL A;  3P8B B;  3QBY A;  3L2Z A;  4Z88 A;  1M1K C;  1EFN A;  1MND A;  1NEG A;  3FJP A;  2DTO A;  5GAM j;  4PJO C;  3TEE A;  2OTJ Q;  4NOY A;  2HZY A;  1I81 A;  4EMK B;  5CCA A;  4J9G A;  1G3S A;  3H9N A;  2KQW A;  1G3T A;  1GBR A;  4OMP A;  4J7F A;  3M56 A;  4BAC A;  1WJQ A;  1VQM Q;  3JCM Q;  2DJQ A;  2PZ1 A;  5LJ3 g;  1KQS S;  2COW A;  1IGU A;  3G4S Q;  3A8M B;  1BI1 A;  5J3B A;  1X6B A;  1QKW A;  1BKB A;  4PJO G;  4C8Q B;  3A5Z B;  4AFQ C;  1KK7 A;  1M90 R;  4M78 C;  2AZS A;  2QEX T;  3OS0 A;  1IO6 A;  2HKQ B;  4MZM A;  1NG2 A;  1G3Y A;  2JVV A;  2JW4 A;  1M8M A;  5CQX A;  1H3H A;  2GTJ A;  2PUO B;  1FX7 A;  2D6F A;  3FRN A;  1KC8 R;  5CVI A;  1N9S A;  3BW1 A;  2GBQ A;  1RI9 A;  4PLI A;  5FRN A;  1FMK A;  3EG3 A;  2X4X A;  2RK1 A;  2COZ A;  1VQL Q;  3ULR B;  2C06 A;  2X3W D;  2LCL A;  4M77 E;  3CCE A;  2NLU A;  1B34 B;  4ZGD B;  3QG1 A;  1VIF A;  3CCV A;  3CCM T;  1KC8 U;  3LX7 A;  1NM7 A;  3M54 A;  3CPW P;  4PJN A;  2ZGW A;  2OTJ A;  2BKD N;  5FU7 B;  2EW3 A;  3URG A;  2JM8 A;  2HKN A;  5IHN A;  2BE7 D;  2HEQ A;  4OMN A;  1G3W A;  2CZ1 B;  2M16 A;  1Y07 A;  4HVU A;  5A0D A;  3QXE B;  2KNB B;  3S3N A;  5GAN 2;  1KIK A;  4JRK A;  2EYQ A;  4IIO A;  4A63 B;  4BD3 A;  2XHC A;  5J39 A;  3VS3 A;  1RUW A;  5HCK A;  2DD5 A;  2EQU A;  3OQ5 A;  3LLR A;  1IHV A;  4BI8 B;  1YWO A;  2P84 A;  4PK4 A;  4M7A B;  2KYM A;  2FPE A;  3C12 A;  4WCI A;  2D0N A;  4OMO A;  1RLQ C;  2LCS A;  3UWN A;  1CKB A;  1UEB A;  3HTR A;  1K9M R;  1Q7Y C;  3TSW A;  3KXT A;  3RMQ A;  2KMT A;  5GAO m;  3HHT B;  1YJN T;  2HQX A;  1K8A C;  4HKE A;  1JO8 A;  2DVJ A;  4HCB A;  3MO8 A;  2LX9 A;  2QQS A;  4X9D A;  4J83 A;  2EYW A;  4GBQ A;  4Q5W A;  5CQY A;  1BYM A;  4PJO D;  3CCJ A;  4JZ3 A;  2FVU A;  5LJ5 j;  4RG8 A;  1Q7Y R;  1T0H A;  1OU8 A;  2V1Q A;  2EKO A;  3GP8 A;  3PIP A;  3EG2 A;  1LJO A;  3MP6 A;  2PNI A;  2A0F B;  4IUT A;  4ESR A;  4E7I A;  1YHQ A;  2CT4 A;  2OI3 A;  3JCM e;  4FW2 A;  5I2M A;  1NZ9 A;  1NEB A;  2CRE A;  1VQ7 Q;  3CC4 T;  1YJN A;  1BCM A;  4QKU A;  3MP8 A;  5FLX E;  3OA6 A;  3DLL A;  1QP3 A;  4XAX B;  3VYG A;  1N8R U;  2OAU A;  2YRV A;  1OOT A;  2QQR A;  1N5Z A;  3VS0 A;  4GY5 A;  5GMK h;  5EC7 A;  3EGX A;  1V1C A;  5GAN e;  1QVG A;  4FSS A;  2DE0 X;  1SG5 A;  1W2B P;  4DBR A;  3RKY A;  2KR3 A;  4C92 F;  4C0G A;  3VS7 A;  2K5F A;  3NPF A;  1IRX A;  1VYT A;  1QCO A;  2O9S A;  3EFO B;  4C92 B;  1VOM A;  1C1A A;  3A98 A;  1W6X A;  4Y92 A;  1VQ6 Q;  1WZO A;  1X75 C;  2O4X A;  1T3L A;  3OYJ A;  3RNJ A;  3CBP A;  2ZPI B;  2MMP A;  4XTV A;  3J7A F;  4DBQ A;  2R58 A;  4RTX A;  2DPP B;  4DOV A;  1ACM B;  3MJX A;  5KYW B;  4LDU A;  1RAD B;  2YUN A;  3KFV A;  1VQ6 A;  2A36 A;  4PLL A;  4PJO A;  2M51 A;  4RTT A;  4ELY C;  4PJL A;  2LZ6 B;  2DL4 A;  1VQK Q;  3JCM g;  1B07 A;  1QWE A;  3CCR Q;  4IIM A;  3RUX A;  2SRC A;  5M9O A;  2IPO B;  1VQO T;  4JLG A;  1WI7 A;  2VB6 A;  4XK8 E;  1XNI A;  1E6H A;  3EGX B;  1YJ9 T;  3CCJ T;  2CP0 A;  1OI1 A;  2A7Y A;  3TVT A;  1LOJ A;  1PC0 A;  3PT9 A;  4BE2 A;  4RTZ A;  3PNW C;  4XTW A;  2BZY A;  1Q81 R;  2DNU A;  2JXB A;  2RI5 A;  3EFO A;  3PTA A;  1M90 C;  1M5Q 1;  4XU1 A;  4EIK A;  3M57 A;  1W70 A;  1LCK A;  4M7D G;  2D9T A;  1RAI B;  5A0G A;  1JRI A;  3GIB A;  1ZUK A;  2DXU A;  3CCU Q;  2CKK A;  4BDZ A;  2F2W A;  2LC4 A;  1KD1 C;  1X2K A;  1ZSG A;  3NMZ C;  2JZ2 A;  4QQD A;  1VQK T;  2I2L A;  2LQ8 A;  2EGC A;  2QQA A;  5KCH A;  1K4U S;  1U06 A;  3MHX A;  4BE1 A;  2KAF A;  5KYX A;  3CCR A;  4CC4 B;  2EYZ A;  4C5I A;  5LJ5 f;  2HBP A;  1HJD A;  2ROT A;  2BUD A;  5GAN 5;  3L2R A;  2DIQ A;  1V29 B;  4M7D A;  1KFZ A;  4X9C A;  5LJ3 f;  1VQ7 T;  4FU6 A;  1AEY A;  2HNI A;  2K9G A;  4IUU A;  4L59 A;  2LJ0 A;  1I0C A;  1M1F A;  3REA B;  3OYF A;  5LJ3 h;  3QJY A;  3OYG A;  2LJ3 A;  4PL6 A;  3I55 A;  1VQ7 A;  2L89 A;  2ZPF B;  1MV3 A;  1SSH A;  1UTI A;  4TVR A;  2M9U A;  3THK A;  5LJ5 h;  3OYI A;  3CCQ A;  4E47 A;  2VAS A;  2HSE B;  4OB0 B;  2EKH A;  8ATC B;  2PVG B;  3EFR A;  3PE0 A;  4C92 D;  1ZBX A;  2DL3 A;  1IGQ A;  1M4Z A;  3DB3 A;  1VQ5 Q;  2JT4 A;  1TUG B;  5GAN 6;  3HL8 A;  1OX8 A;  1MMG A;  2GFU A;  1NLP C;  2DM1 A;  1WLP B;  2XG8 D;  1PG5 B;  1Q81 U;  3VUZ A;  4CC3 A;  3VV0 A;  2FL7 A;  1VQ4 A;  4J9F A;  3E19 A;  4P5N A;  2V1R A;  5GAM d;  1ZUU A;  3E9F A;  5AYF A;  4M77 A;  2E4H A;  9ATC B;  3SFM A;  1NLO C;  1ZHI A;  4ZNX A;  4FL6 A;  4C8Q E;  1TUD A;  3CCJ Q;  2E1H A;  2ATC B;  2K2M A;  4M7A A;  3MEV A;  2LQN A;  2QI2 A;  1H92 A;  3HFO A;  2NUP A;  1RL2 A;  5GAN 8;  3M4Y A;  2YUP A;  2R5A A;  1NJI R;  3CC7 Q;  1N27 A;  1MMA A;  2HQE A;  4OB1 B;  4E7L A;  1OU9 A;  5GAN 3;  2FYK A;  3EAE A;  1QVF A;  3MEW A;  1PD1 A;  4BUG A;  2FZC B;  3M0Q A;  1AT1 B;  4PKC C;  2O2O A;  1YJ9 A;  2CH4 A;  2KBT A;  2LTO A;  1S72 A;  1V76 A;  3VS1 A;  5I22 A;  2X4J A;  1GCP A;  2EPD A;  2GQV A;  4M77 G;  4ZN1 A;  5FRM A;  1UEC A;  1NYF A;  1SSF A;  1SRL A;  2L3R A;  5GAO q;  5GMK i;  1TU0 B;  2K3Y A;  2MAM A;  1MUZ A;  3O5Z A;  4FM4 B;  2Y4X A;  2D0Q B;  1FXX A;  1N8R C;  1PSE A;  2QEX A;  2YXY A;  1OV3 A;  1UJY A;  4M75 F;  2CP7 A;  4XTZ A;  1YJN Q;  2DYI A;  1GRI A;  2LCC A;  3VU3 C;  2K57 A;  2F2V A;  3OY9 A;  2ED0 A;  3CCV Q;  3CBM A;  1KJW A;  1TH7 A;  1B34 A;  1RLP C;  3HPW A;  1YWP A;  4JRQ A;  5GAO l;  1VIE A;  3VRY A;  4M78 F;  2XK0 A;  1BI2 A;  3HKS A;  2IIM A;  1X69 A;  1H8K A;  4C92 A;  2F2X A;  4HA8 A;  2AIR B;  3QJ6 A;  4M75 C;  5EG2 A;  1GFD A;  4HCC A;  4OGE A;  1UGR B;  3MP1 A;  4ANJ A;  1W2B S;  5CO7 A;  1A0N B;  3F70 A;  2ESW A;  3Q1J A;  4OGC A;  2J05 A;  2M1H A;  4MMK A;  3RR6 A;  1VQP A;  5GAN 7;  2ECZ A;  4F7U A;  4EMK C;  3CCL A;  2FZK B;  4EMK A;  2VC8 A;  3FLG A;  2DBK A;  3CC7 A;  5GAO n;  2DXB A;  2DL7 A;  3QHS A;  4JS5 A;  3H0H A;  2E6Z A;  5CKH A;  3S6W A;  3DKM A;  1JBM A;  1VQN A;  2J6K A;  2DTI A;  4JJB A;  3SEM A;  3OYN A;  2JOY A;  2Z0W A;  4RCB A;  1CSK A;  2RN8 A;  2CSI A;  1G8X A;  3OYM A;  1EIF A;  4M7D B;  5GMK l;  1RAH B;  1K9A A;  4PJJ A;  2KE9 A;  4WF2 A;  3SHW A;  1WXB A;  3UDC A;  3QWX X;  4A4H A;  5KYY A;  1ZX6 A;  3OS2 A;  1YIT T;  1BB9 A;  1PRM C;  3EG0 A;  1HK9 A;  1SEM A;  3OS5 A;  5KE3 A;  4JZ4 A;  3WXM B;  4PFO A;  2DVE A;  1Q82 U;  2NUP B;  5FU6 B;  2DX1 A;  4UC4 A;  1QCF A;  4VUB A;  3JCM d;  1I4K 1;  1B7T A;  1KG1 A;  2HQH A;  1VYV A;  3OYC A;  1VQN T;  3REB B;  3C4S A;  4OMM A;  3L2W A;  4NL3 A;  5GAM e;  1H3Z A;  4F17 A;  2EJG A;  1T0J A;  2XIC A;  2HL5 C;  1VQ6 T;  1VUB A;  5CIU A;  2BIV A;  2HDA A;  2MOX A;  1U5S A;  2K4Y A;  2EIF A;  3A8O B;  2JTF A;  1WQW A;  2KY9 A;  1YCY A;  4E7S A;  3G6E T;  2RF0 A;  1QQJ A;  3PVQ A;  3V7C A;  1TTH B;  1WHL A;  2G6F X;  4V2S A;  2E41 A;  3JB9 D;  3A8H B;  1Y96 B;  3DLM A;  3I56 A;  2DF6 A;  1KQS A;  3UF4 A;  2AT1 B;  2V26 A;  1WFW A;  5KYX B;  2GNC A;  4MZP A;  5L8R E;  1JXM A;  1NBE B;  5FWC A;  2XDP A;  4QVZ A;  3CCS Q;  3G4S A;  3SWN C;  4XTX A;  3JAM E;  3I35 A;  4J6X A;  2DER A;  1QMC A;  5GAN j;  4OB2 B;  4M7A C;  1KD1 R;  3LWH A;  3QII A;  1KHC A;  3RMS A;  2L5Q A;  3CXC A;  4M4Z A;  3OYB A;  4DQ2 A;  2OJ2 A;  4XU3 A;  1SHF A;  2DIL A;  4C0D C;  4M7A F;  4QVD A;  2Y4Y A;  1UGP B;  4LDW A;  1K8A R;  4NL2 A;  3PMT A;  2R57 A;  3LGL A;  4M77 B;  4OP0 A;  3WVD B;  2OX7 A;  1UFF A;  3PIO A;  3CC7 T;  3NTI A;  1KSW A;  5IHI A;  1K9M U;  5A2Q E;  1X27 A;  5GAO r;  2E10 A;  3OYK A;  1C6V X;  5DLQ E;  2DEQ A;  2K7A A;  3LYI A;  3TCJ A;  3RBB B;  4ZGJ B;  3CMA A;  4J9B A;  3ZBD A;  3JB9 I;  1W4S A;  1ABO A;  4RTU A;  4Y91 A;  2RQV A;  1UDL A;  1UHC A;  3G7Z A;  3X25 B;  1UGQ B;  3M0R A;  2EAY A;  2BZ8 A;  3HRT A;  1R0B G;  1QVF P;  2FB7 A;  2XD0 A;  3V8L A;  2YDL A;  1P92 A;  2E5Q A;  2VXE A;  2AK5 A;  3QWY A;  5FWB A;  3SWN A;  1ZSZ A;  4IUR A;  2KK4 A;  3EH2 A;  5IN1 A;  3HRU A;  3CCL T;  2MI6 A;  1PHT A;  5FU7 C;  2DYB A;  2HMA A;  1ZBJ A;  1Q95 G;  2L2P A;  1S72 T;  1KQS P;  2KYB A;  2RK2 A;  4E7Z A;  2DRK A;  2P0Q A;  2QG9 B;  3I5R A;  4LNP A;  4KGV B;  5GAN 4;  4II1 A;  3LH5 A;  4Z8A A;  4M78 E;  2VV5 A;  2O4X B;  2R5M A;  3JB9 G;  5IT9 E;  4LD9 K;  1YP5 A;  3GPL A;  3JCM X;  4B9X A;  1AWW A;  2O88 A;  4CC2 A;  1B3Q A;  3MPU B;  2DK3 A;  3UPU A;  1JJ2 S;  2LT1 A;  1ZSZ B;  3CQT A;  2M02 A;  5DY9 A;  3CC2 T;  1C0M A;  4AG1 C;  1VQL T;  2WSE E;  1ARK A;  2FEI A;  5AT1 B;  1D1A A;  3INZ A;  3QZ9 B;  3OBW A;  3CC2 A;  3RIR A;  1BBZ A;  4QVC A;  1GFC A;  2DMO A;  3A1P A;  1GCQ A;  3L42 A;  3QYG B;  2E65 A;  1TS9 A;  1Q86 U;  4K11 A;  1VQ8 A;  1AWX A;  4XU0 A;  1S1N A;  1Q82 C;  1J3T A;  2MWO A;  1WJS A;  1ZA2 B;  3FC3 A;  2DO3 A;  3OS1 A;  1FYN A;  4FYY B;  5KYY B;  3H0I A;  4A4G A;  3L2U A;  3HP9 A;  4DOW A;  1Q7Y U;  2DBM A;  3O8V A;  1RAF B;  5DM7 R;  2ENM A;  2LT4 A;  1X6G A;  1GCQ C;  1MV0 B;  3X24 B;  3OW2 S;  1VQP Q;  3SDZ A;  2ABL A;  2KDS A;  4C8Q A;  5GJV B;  3CCM A;  2JS2 A;  4LDX A;  3EGD B;  3CPW S;  4BI3 A;  1IHW A;  3JB9 H;  4RUG A;  4C5G A;  4PJM A;  4M75 D;  3JCM b;  1QVF S;  3I5S A;  1KQ1 A;  4F7U E;  4F7U B;  3QUI A;  2A3L A;  2C0T A;  1JQQ A;  3EHR A;  4MML A;  1WXU A;  1NPR A;  1BI3 A;  4Z89 A;  4LDY A;  3CMA T;  2X3X D;  2ZCF B;  1VA7 A;  1LNX A;  2JMA A;  5GMK j;  1VQ9 Q;  4E7K A;  2SEM A;  1SHG A;  2CS7 A;  5LJ5 g;  1D0Y A;  1CKA A;  2JNG A;  4M77 C;  5KCO A;  3C95 A;  2V8J A;  5CR2 A;  3NTH A;  3T9N A;  3JCM J;  1VQ5 T;  1RAE B;  2B8A A;  1YIT A;  1YNZ A;  3G6E A;  2GFA A;  2H3E B;  4Z02 A;  2P4T A;  4DEX A;  1AHJ B;  2Y90 A;  3VS2 A;  5GAM h;  5GAN d;  5D7U A;  3J80 E;  5GAN h;  2XDB A;  1M8V A;  2FZG B;  2CT3 A;  2JN0 A;  3GNF B;  2E6N A;  3ZFJ A;  3G71 T;  3L1A A;  3CC4 Q;  3DB4 A;  4F14 A;  3FB9 A;  2FRW A;  3QKJ A;  1YJW Q;  2QAZ A;  3CCE Q;  1RAA B;  5FRO A;  2PU9 B;  2EQI A;  2RNA A;  4A4F A;  1TWB A;  2J06 A;  3EG1 A;  2KRS A;  5C6S A;  4FW1 A;  1YIJ Q;  3LGF A;  5CKE A;  1YJ9 Q;  1KHI A;  2DL8 A;  4JJC A;  4KRT A;  1VQ9 T;  1HD3 A;  4ZTJ A;  2F5K A;  2RJE A;  3U23 A;  1I5O B;  5LJ3 j;  1ZA1 B;  3MKD A;  1WJR A;  3CBO A;  3I56 T;  1ABQ A;  4R0K A;  1QVG S;  1M30 A;  5KYW A;  2MPX C;  3M5A A;  3GLX A;  3CD6 T;  2XID A;  2YRC A;  2IVW A;  3MCA B;  2EJ9 A;  1K9M C;  5LJ3 e;  3NFC A;  1M90 U;  3E9G A;  4J8O A;  2EYY A;  2EQJ A;  1OZ3 A;  3LW5 E;  4HT9 A;  4J6Y A;  2GGR A;  2VKN A;  1YHQ T;  2KRO A;  2DXT A;  2GF7 A;  2RHU A;  4J7I A;  3CCQ T;  1BI0 A;  1FMW A;  1UGV A;  2LMJ A;  4FYX B;  4JLI A;  1K73 R;  1YCS B;  2QTX A;  4PFP A;  3CPF A;  1G83 A;  1NJI U; 
#chains in the Genus database with same CATH homology
 3VS6 A;  2PTK A;  1AWO A;  1GBQ A;  1K9A A;  1YN8 A;  2KE9 A;  1JO8 A;  2DVJ A;  2E5K A;  1WXB A;  2I0N A;  2YT6 A;  3QWX X;  5ECA A;  1X2Q A;  2CUB A;  3SHW A;  3UA6 A;  1ZX6 A;  4RTW A;  1BB9 A;  4JJD A;  1PRM C;  3EG0 A;  3TSZ A;  1SEM A;  2EYW A;  4GBQ A;  4JZ4 A;  4LUD A;  3IQL A;  2EGE A;  1T3S A;  2EBP A;  2FPD A;  4J9D A;  2DX1 A;  1AZE A;  4JZ3 A;  1QCF A;  1NYG A;  1WDX A;  1T0H A;  2V1Q A;  2KRN A;  2KRM A;  1VYV A;  3REB B;  1AOJ A;  4OMM A;  3EG2 A;  4F17 A;  1T0J A;  2PNI A;  3C0C A;  4ESR A;  1K0S A;  1PNJ A;  1HSQ A;  2CT4 A;  2OI3 A;  2HDA A;  2MOX A;  1U5S A;  1NEB A;  3VS4 A;  2CRE A;  4X1V A;  3EHQ A;  1AZG B;  2GQI A;  4J9I A;  4HVW A;  2RF0 A;  3PVQ A;  1OOT A;  1N5Z A;  3VS0 A;  2G6F X;  1QLY A;  2C0O A;  5EC7 A;  3FJ5 A;  4AFU C;  1V1C A;  2LQW A;  2DF6 A;  4FSS A;  2DE0 X;  2DL5 A;  2KT1 A;  2OAW A;  3UF4 A;  2KR3 A;  2A37 A;  4AG2 C;  1WFW A;  2YUQ A;  4DEY A;  1PRL C;  2GNC A;  1JXM A;  3M0T A;  3VS7 A;  3NPF A;  5FWC A;  1VYT A;  2O9S A;  3A98 A;  1W6X A;  2RMO A;  4HCK A;  2KEA A;  2CSQ A;  3I35 A;  2JTE A;  3R6N A;  4Y92 A;  5FW9 A;  2BZX A;  1T3L A;  2KXC A;  3RNJ A;  5IXF A;  1WYX A;  1Y57 A;  1JU5 C;  4RTX A;  4RTV A;  2YUN A;  3KFV A;  2A36 A;  1BU1 A;  5IXB A;  2M51 A;  1E7O A;  4RTT A;  4LE9 A;  4M4Z A;  1UUE A;  2LZ6 B;  2DL4 A;  1WXT A;  1B07 A;  1QWE A;  2OJ2 A;  2D8J A;  1SHF A;  2DIL A;  4IIM A;  2SRC A;  3H41 A;  4CC7 A;  1K1Z A;  2MIO A;  1M27 C;  1WI7 A;  2RQU A;  1E6H A;  4LN2 A;  1UFF A;  2O9V A;  1WIE A;  3UA7 A;  2LP5 A;  4J9E A;  3TVT A;  1Y0M A;  1KSW A;  1G2B A;  4RTZ A;  5IHI A;  1OPK A;  1Z9Q A;  2BZY A;  2DNU A;  2JXB A;  2W0Z A;  1QWF A;  3ZL7 C;  2LJ1 A;  1X27 A;  3VS5 A;  2KGT A;  3M0U A;  2CUD A;  2NUZ A;  4EIK A;  4AFS C;  2J6O A;  2O31 A;  1W70 A;  1SPK A;  1LCK A;  5L23 A;  3NHN A;  2K7A A;  3RBB B;  1ZUK A;  2AKK A;  3EGU A;  4J9B A;  1UHF A;  2F2W A;  2L0A A;  1ABO A;  4RTU A;  2RQV A;  1UDL A;  1UHC A;  1X2K A;  1ZSG A;  1M3B A;  3NMZ C;  2KT8 A;  3M0R A;  2BZ8 A;  2EGA A;  2KXD A;  4LUE A;  1GL5 A;  4F16 A;  1TUC A;  2EGC A;  5I11 A;  2RQR A;  2YDL A;  1K4U S;  5FWB A;  1U06 A;  3QWY A;  2AK5 A;  2W10 A;  2FRY A;  4CC4 B;  2QDL A;  2EYZ A;  1K76 A;  1PHT A;  2DYB A;  1ZBJ A;  1HJD A;  2L2P A;  2ROL A;  4GLM A;  2ROT A;  3I9Q A;  2KYB A;  2HCK A;  2DRK A;  2HBW A;  1KFZ A;  3I5R A;  4LNP A;  1AEY A;  1I1J A;  2K9G A;  3LH5 A;  4Z8A A;  2LJ0 A;  1AVZ C;  1I0C A;  4AFZ C;  2LX7 A;  3REA B;  1JXO A;  1E6G A;  2LJ3 A;  1AWJ A;  1YP5 A;  1MV3 A;  1SSH A;  1UTI A;  4E6R A;  1SRM A;  3H0F A;  4OML A;  1AWW A;  2O88 A;  4CC2 A;  1B3Q A;  4J9C A;  3THK A;  4D8D A;  2H8H A;  3CQT A;  3VRZ A;  1OPL A;  2K6D A;  2DA9 A;  4AG1 C;  2RPN A;  2NWM A;  1ARK A;  2EKH A;  2FEI A;  1OEB A;  3PE0 A;  1BBZ A;  2DL3 A;  3NGP A;  2DRM A;  2A08 A;  1GFC A;  1XOV A;  2DMO A;  2FO0 A;  1GCQ A;  2JT4 A;  2C0I A;  5IHK A;  1PKT A;  1JEG A;  2EYX A;  4K11 A;  1ZUY A;  1AWX A;  1S1N A;  1WX6 A;  1BK2 A;  1J3T A;  1NLP C;  2DM1 A;  2L3S A;  2FPF A;  1I07 A;  2LNH B;  1WLP B;  1Z9Z A;  1AD5 A;  2YUO A;  2MCN A;  2JM9 A;  4OMQ A;  1FYN A;  4CC3 A;  3JV3 A;  3H0I A;  1K0X A;  4J9F A;  2V1R A;  1PKS A;  2XMF A;  3PVL A;  2DBM A;  1ZUU A;  4D8K A;  2ENM A;  2AKL A;  1X6G A;  1GCQ C;  1MV0 B;  1NLO C;  4ZNX A;  2ABL A;  1TUD A;  2K2M A;  5GJV B;  2L3P A;  4Z88 A;  2JS2 A;  1VYU A;  1H92 A;  2LQN A;  2RQT A;  1M3A A;  2RQW A;  4J9H A;  1EFN A;  1NEG A;  2HSP A;  2YUP A;  2CH4 W;  2D8H A;  4RUG A;  3I5S A;  4J9G A;  3M0Q A;  4HVV A;  1GBR A;  2O2O A;  5GJW B;  2CH4 A;  2C0T A;  4OMP A;  1JQQ A;  2KBT A;  3EHR A;  5I22 A;  3VS1 A;  1WXU A;  2DJQ A;  2ED1 A;  1GCP A;  2EPD A;  2PZ1 A;  4Z89 A;  2X3X D;  1VA7 A;  2JMA A;  1UEC A;  1NYF A;  1X6B A;  1WA7 A;  2SEM A;  3GBQ A;  1SRL A;  1QKW A;  1SHG A;  3UAT A;  4JPB W;  4AFQ C;  1CKA A;  1UJ0 A;  1MUZ A;  3O5Z A;  1YNZ A;  2AZS A;  1IO6 A;  2CDT A;  2D1X A;  4DEX A;  1OV3 A;  1NG2 A;  1UJY A;  2YSQ A;  2JW4 A;  2DLP A;  3VS2 A;  1M8M A;  1H3H A;  2GTJ A;  2J7I A;  2FG0 A;  2CT3 A;  1GRI A;  1U3O A;  2J6F A;  2P4R A;  4F14 A;  2FRW A;  2F2V A;  2GBQ A;  1TG0 A;  2ED0 A;  1RI9 A;  1FMK A;  3EG3 A;  1KJW A;  2EQI A;  2JMC A;  2RNA A;  2VVK A;  1RLP C;  2J06 A;  3EG1 A;  1YWP A;  2KRS A;  5IH2 A;  3ULR B;  2X3W D;  1W1F A;  3VRY A;  2EVR A;  2DL8 A;  2IIM A;  4JJC A;  1X69 A;  1H8K A;  4KRT A;  2VWF A;  2F2X A;  1NM7 A;  2K3B A;  4QT7 A;  1HD3 A;  2EW3 A;  3U23 A;  1GFD A;  2JM8 A;  1QKX A;  5IHN A;  3M0P A;  2HEQ A;  1ZLM A;  4OMN A;  1A0N B;  1X43 A;  1UG1 A;  2ESW A;  4HVU A;  2J05 A;  2BTT A;  1ABQ A;  2KNB B;  1M3C A;  4R0K A;  2AZV A;  2A28 A;  1M30 A;  2ECZ A;  1KIK A;  4IIO A;  4A63 B;  2DBK A;  3VS3 A;  3M0S A;  1RUW A;  1PWT A;  4RTY A;  2DL7 A;  5HCK A;  2EYY A;  3H0H A;  1UE9 A;  4HXJ A;  4ORZ A;  2L3Q A;  2JS0 A;  2J6K A;  1YWO A;  4JJB A;  2GGR A;  2KYM A;  2K79 A;  2FPE A;  2VKN A;  3SEM A;  2B86 A;  4WCI A;  2D0N A;  2KRO A;  1RLQ C;  4OMO A;  2LCS A;  1CKB A;  1CSK A;  1UGV A;  2LMJ A;  2RN8 A;  2CSI A;  2GTO A;  3TSW A;  1YCS B;  2M0Y A;  1G83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...