2BTTA

Nmr structure of myo3-sh3 domain from myosin-typei from s. cerevisiae
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
b'KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOSIN-3 ISOFORM
publication title New approaches to high-throughput structure characterization of SH3 complexes: the example of Myosin-3 and Myosin-5 SH3 domains from S. cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bttA01
1QLYA 4OMMA 2DILA 2RQVA 1KSWA 2DF6A 1T0HA 2MCNA 1WA7A 2DA9A 5IHNA 2RQRA 1AVZC 4Z8AA 1X6GA 1OOTA 3VS4A 2NUZA 1BU1A 1M30A 2J7IA 2FG0A 3H0FA 3M0UA 2QDLA 4AG2C 2EYYA 3I5SA 1M27C 3RBBB 1JU5C 2W10A 1X69A 4CC3A 1PHTA 1K1ZA 4LUEA 2D8JA 3U23A 5IH2A 2LP5A 1JQQA 1ZLMA 1QWFA 1UHFA 5EC7A 1AZEA 2EGAA 3EHRA 2DRMA 1ZUKA 1UG1A 4Z88A 1CKAA 2KR3A 2DJQA 1T3LA 3EG2A 1W1FA 2G6FX 2HCKA 2RN8A 2DRKA 2ABLA 2JMCA 4M4ZA 2LX7A 4ESRA 4OMQA 2DE0X 4IIOA 2DL7A 2GBQA 3I5RA 2EGEA 2YT6A 2ESWA 4GBQA 4Z89A 1MV3A 2JMAA 2EYWA 1M8MA 2JM9A 3UF4A 1U5SA 2ED1A 1GFDA 2XMFA 3H0HA 3UA6A 1UGVA 3NHNA 2GTOA 1SPKA 1PKSA 1SEMA 1Z9QA 1KIKA 1X43A 1VYTA 1SHGA 3TSZA 3M0TA 3THKA 1K76A 2VKNA 2E5KA 2DVJA 1GFCA 2LQWA 4HVUA 1AWOA 3ULRB 2EYXA 3VS3A 3EHQA 2A28A 3UATA 2VWFA 1AWJA 2J05A 4CC7A 1YWPA 4RTXA 3VS2A 4LUDA 2F2VA 2SRCA 1S1NA 1X6BA 3VRYA 3I9QA 1AOJA 2YUPA 2DM1A 4LNPA 4HVWA 2ED0A 1M3CA 2X3XD 2V1QA 2KXDA 3SHWA 1QKXA 1U06A 2CDTA 1K0SA 4LE9A 2KYMA 2EVRA 2K6DA 2D8HA 5IXBA 2RPNA 4OMPA 1M3BA 2EPDA 2F2WA 2HSPA 4A63B 1A0NB 1XOVA 1HD3A 3EG3A 3R6NA 1RLQC 2A36A 1AD5A 3H0IA 3VRZA 3QWYA 1RLPC 3REBB 1GRIA 1ZBJA 1HSQA 1UECA 1NG2A 4KRTA 2FPDA 1YWOA 1PNJA 1AZGB 1GL5A 2DL4A 3IQLA 1NEGA 2JXBA 1ZUYA 1FMKA 1V1CA 1WFWA 2SEMA 1UJ0A 2JS0A 2DX1A 4HVVA 1TUDA 1ABOA 3EGUA 1WXTA 2VVKA 1PWTA 2EBPA 2OJ2A 1OPLA 1T0JA 3CQTA 1E7OA 1WDXA 4J9GA 2JTEA 2V1RA 1WX6A 3VS7A 3C0CA 3JV3A 4ORZA 1KFZA 1TUCA 3I35A 2C0IA 1MUZA 4Y92A 1E6GA 3PVQA 1H92A 1EFNA 2KGTA 2CSIA 1K0XA 1UTIA 4JPBW 2RF0A 2KT1A 3NGPA 2KNBB 2DBMA 3SEMA 1CSKA 4FSSA 2P4RA 2CH4A 3FJ5A 1JXOA 2RQTA 1X2QA 1GCQA 2DL8A 1UJYA 2J6FA 2FPEA 4J9FA 5FWCA 1X2KA 1AWXA 1OPKA 1WXUA 2L3PA 4JZ4A 5L23A 3TSWA 4JZ3A 4D8KA 2D1XA 1ZSGA 4J9IA 2CSQA 1PRMC 2KROA 1Z9ZA 1LCKA 2I0NA 2PNIA 4LN2A 4OMOA 2FRYA 2O31A 2YSQA 5IXFA 3GBQA 2AKLA 1BBZA 1YN8A 2O2OA 2RQUA 1H3HA 3M0RA 5FWBA 2KRSA 3A98A 2K79A 1IO6A 1YP5A 2MOXA 2BZ8A 3EG1A 2YDLA 1VA7A 4DEXA 5GJWB 3ZL7C 2A08A 3KFVA 2CH4W 1N5ZA 4F14A 2JW4A 3VS1A 2RMOA 2KBTA 1JEGA 1AWWA 2ROLA 4DEYA 1RUWA 2HBWA 1K9AA 3VS6A 5I22A 2DL5A 1UFFA 4AFZC 1OEBA 2J6OA 4ZNXA 1T3SA 1WI7A 3RNJA 4RTTA 4EIKA 2O9VA 1I1JA 1CKBA 1I0CA 4AFQC 2HEQA 2K2MA 2OI3A 4F16A 2DL3A 1J3TA 1WIEA 2KRNA 2YUOA 2AZVA 2JM8A 2KT8A 1QCFA 1RI9A 2EYZA 1G2BA 1U3OA 2CREA 1NYFA 1HJDA 2K3BA 3PE0A 1GBQA 2RQWA 2LNHB 5IHKA 1E6HA 3PVLA 2LJ0A 1UHCA 1H8KA 2CT4A 2EKHA 2DNUA 4WCIA 2L3QA 2PTKA 1MV0B 4K11A 2FO0A 5HCKA 2BTTA 1I07A 1X27A 2AK5A 4HXJA 2BZXA 2DLPA 1TG0A 2YUNA 4AFSC 1QWEA 4OMNA 4AFUC 4D8DA 4AG1C 2DBKA 1SRLA 1WLPB 2C0TA 2GNCA 2FRWA 1BB9A 2GQIA 5FW9A 2L0AA 3TVTA 3H41A 2D0NA 4RUGA 2X3WD 2B86A 3EG0A 1W70A 4RTUA 4RTVA 1G83A 1B3QA 3M0SA 2F2XA 1GCPA 1ABQA 1PKTA 2EQIA 1SSHA 4J9BA 4J9HA 1GBRA 2JT4A 1VYUA 2W0ZA 3VS5A 3O5ZA 1FYNA 4CC4B 2KYBA 2K7AA 2HDAA 2KXCA 2LJ1A 5ECAA 1NM7A 1B07A 2CUDA 1WXBA 2AZSA 4E6RA 1NLPC 1BK2A 1Y0MA 2GGRA 4JJDA 2RNAA 4HCKA 1W6XA 1SRMA 1AEYA 1JO8A 4JJCA 2OAWA 1QKWA 4X1VA 1YNZA 2GTJA 3M0QA 2YUQA 1ZX6A 5GJVB 2BZYA 4F17A 2PZ1A 1M3AA 4CC2A 1UUEA 2JS2A 4J9EA 2KE9A 2M0YA 4JJBA 1NYGA 5I11A 1SHFA 1PRLC 2DMOA 3QWXX 4J9DA 3LH5A 1WYXA 3UA7A 2J06A 2KRMA 3M0PA 2CT3A 2EGCA 2H8HA 2ROTA 2LCSA 4QT7A 2ECZA 2L3SA 1YCSB 1OV3A 1ARKA 2IIMA 2LZ6B 2M51A 4IIMA 2FPFA 3VS0A 1Y57A 2LMJA 2CUBA 4J9CA 3REAB 2L2PA 2MIOA 1ZUUA 5IHIA 2DYBA 4R0KA 2LQNA 4RTWA 1UE9A 2NWMA 2C0OA 2ENMA 1VYVA 4GLMA 2A37A 2EW3A 1K4US 3NPFA 2LJ3A 2O88A 4RTZA 1JXMA 1UDLA 2O9SA 1KJWA 2AKKA 1NEBA 2K9GA 2KEAA 2FEIA 3NMZC 4OMLA 1NLOC 1GCQC 2J6KA 4RTYA
chains in the Genus database with same CATH superfamily
1IB8A 3KBGA 2QEXT 2MCNA 3NTKA 5IHNA 2D0QB 1RAFB 4Z8AA 3JCMh 1YIJT 1M30A 1KHCA 3CCMQ 1JU5C 2WACA 2DXCA 4A4KA 3JCMJ 4E47A 4CC3A 1PHTA 3TU4K 5GAN7 3E9GA 2Z0WA 2OTLT 1AT1B 1K1ZA 3VUZA 4HCZA 4DOWA 4LUEA 3U23A 3OS5A 1JQQA 1Q95G 1ZLMA 4J6WA 5GAOm 2I2LA 5HK0A 1QVGA 3MP8A 3EHRA 5LJ5e 1MMAA 1M2VB 2KR3A 1N8RR 4P5NA 2DRKA 2ABLA 3CCVT 2DFUA 2OTJQ 3H9NA 2O01E 2HL5C 4IIOA 4C8QD 4E7IA 1MMNA 2GBQA 3CXCP 2EGEA 4EMHA 2JOYA 2QQSA 3ZEHA 2EQJA 3C12A 3CCUQ 2HAXA 5GMKe 1VQ4Q 4GLKA 2ED1A 3JB9D 3UA6A 1KC8R 1UGVA 2YRVA 3CD6Q 5HY6A 3MO8A 1PKSA 1KIKA 5CQYA 3OYNA 2VKNA 4Y28E 2ATCB 1GFCA 2DZCA 3M53A 4HVUA 2K57A 1IHWA 3ULRB 2M16A 1YHQA 4WTOB 3OYJA 3E1SA 4BD3A 2PUKB 4PJOB 3EFOB 1YWPA 5CIUA 4F7UF 3SD4A 3VU3C 1S1NA 2DXBA 3CCRQ 3VRYA 1WJRA 4PFPA 3J80E 2AIRB 1AOJA 4MMKA 4DOVA 1IGUA 3F70A 4KH1B 4FSXA 3I56T 2DM1A 4LNPA 3P8DA 3CCLT 2X3XD 2O4XA 3G71A 3SHWA 4IURA 1U06A 2GCXA 2K6DA 5IXBA 2RPNA 1YJNT 2XIDA 1VUBA 1MNEA 2QASA 1ZHIA 2DXTA 4PJOG 3P8HA 5DY9A 2QAZA 3QWYA 3JCMe 1VQPA 1UECA 1NG2A 3GF5A 2FPDA 2AT1B 1GL5A 2LT1A 3IQLA 4DQ2A 1FMKA 1M9SA 2DX1A 2E3HA 2DO3A 4M7DB 4MDXA 4PJMA 3RKWA 5D6YA 3VYGA 1VQLA 5KYWA 2OJ2A 1X75C 1T0JA 3OYGA 1QQJA 2JN0A 1YITA 5CO7A 2OAUA 2LRQA 6AT1B 4ORZA 3PTAA 1KFZA 2E41A 3JCMV 5D6WA 3SWNC 3I55A 3PVQA 4NOYA 4JPBW 1PM3A 3CC4A 2DEUA 4OB1B 2KNBB 2RI2A 3SEMA 1WNLA 2P4RA 1Q7YC 4JUVA 4M7DG 3S3MA 1UB4A 3OYHA 2RQTA 4C92F 3G6EA 1YHQQ 1GCQA 2YXYA 3TCJA 1VQMT 5HK3A 3GPLA 2FPEA 4ATOA 2COYA 1VQOQ 3TREA 2E5QA 4JZ4A 2LVMA 2KAFA 1EIFA 4D8KA 5GAOn 1X01A 2L89A 4J9IA 1PCXA 5CR2A 3M54A 4MZPA 3G71Q 1LCKA 5GAOq 3MEUA 4LD6A 4OMOA 1TOVA 5IN1A 5CVIA 1O75A 1VQ7T 5IXFA 4N4HA 1ZSZC 1Q7YU 2BE9B 1JJ2S 3G1JA 1OU9A 1VQ6A 1QVFA 1I8FA 4YTLA 2RI5A 4ZGDB 1PSEA 2K79A 4XTVA 2M1HA 2XK0A 2MOXA 1FWZA 4DEXA 3CBMA 3FLGA 5GJWB 3ZL7C 4XTUA 2E12A 5LJ3f 2DIGA 2JW4A 1H641 3L1AA 1VQLQ 2YWWA 1JEGA 4NL2A 2ROLA 4DEYA 1B7TA 3RUXA 1VQ9T 3JB9I 4MZTA 4C5EA 4C0DC 2QYZA 2DYIA 1Q82R 3QZ5B 1YFNA 4AFQC 3I55Q 4F16A 3M57A 1VOMA 5IT9E 3CC4Q 1WIEA 4O6JA 2YUOA 2AZVA 2JM8A 2EYZA 2CREA 5HKCA 5AT1B 2K3BA 3OYKA 1HJDA 1MGQA 2LNHB 1WJQA 4PFZA 1E6HA 3PVLA 3RMQA 3G6EQ 2HMAA 1LOJA 1H8KA 4WCIA 4KGZB 3GLXA 4QKUA 2BTTA 1XQHA 3ASKA 4XTWA 1X6OA 4F7UE 5LJ5f 4C5HA 1O9SA 4AFSC 3PIOA 2X4WA 3OYBA 1K8AC 2XD0A 3GIBA 4IUTA 1SRLA 4N0AC 4HCBA 4TVRA 2H3EB 1PD1A 1BI0A 3OW2S 2D9TA 4PL6A 4VUBA 2E3IA 2X4XA 5KCOA 1QVGP 1VQ6Q 4RTUA 5GAOp 2ZGWA 3INZA 1B3QA 3M0SA 1GCPA 2NUPA 1SSHA 3MPUB 3UWNA 2RB6A 3PMTA 2JNGA 4L6V5 4PJNA 1K8AU 5IAYA 2K7AA 3JCMd 3KXTA 2KXCA 2LJ1A 4JS4A 4CRIA 4M7AA 3LH0A 1KD1C 4M77A 4JJNK 2AZSA 5GANe 4FT4A 1NLPC 4JJDA 1EX4A 3V8JA 4HCKA 2E6NA 1SRMA 2LCLA 3V8KA 1AEYA 2M0OA 4M7AE 1QKWA 1VQNA 2ZPBB 4PJOF 1TTHB 4JLIA 2DERA 1HYOA 2KI7A 1S72A 1UEBA 2RH2A 1D0YA 2RJFA 2DMOA 3OS2A 4J9DA 4C8QB 4E7JA 3LH5A 4C92E 4RMOA 3OS0A 4FIBA 1KD1U 2GFAA 2XDBA 3UA7A 1BIBA 3R6OA 3MJXA 4PLIA 5C0MA 2KRMA 4OGEA 1IHVA 5GAMd 5GAMg 2LCSA 2CZ1B 5KYNA 2FZGB 2IIMA 4M75A 3RESA 2LZ6B 1N6AA 2FPFA 3OYLA 3QJ6A 2CUBA 2RHYA 4J9CA 3BY7A 3QHSA 4M78A 2L2PA 2DYBA 1UE9A 2R57A 1OULA 2ENMA 4R55A 4QQ6A 1PG5B 4C8QG 3BDUA 1N9SA 1WPYA 1D1AA 2DTHA 4BB7A 1K4US 1Y07A 4KUDK 3JSCA 2O88A 2QXFA 1KJWA 2K9GA 4M78E 3RDVA 5FU7B 2CP6A 2RQVA 1KSWA 3A8GB 3V8LA 3JB9G 2RK1A 2LQ8A 3G4ST 1BCOA 3BFMA 1WA7A 2DA9A 2PQWA 2DJZA 1X6GA 3CCQT 1YBYA 2NUZA 1VQ8A 2NUPB 3H0FA 2J7IA 4ELZC 2CS7A 2FG0A 5I2SA 1JB0E 3DB3A 4XU3A 1TXQA 2RHXA 2AHJB 4FW2A 2ZAEA 3OYAA 3S3OA 2JTMA 4UC4A 4DA4A 2HBPA 2D8JA 5IH2A 1VQNQ 4M7AB 1I5OB 4M77B 1QWFA 4XTYA 4EMGA 1S72Q 1WHJA 2EGAA 1SG5A 4J8OA 4Z88A 1CKAA 2E6ZA 1QVPA 2DJQA 4ZGJB 1T3LA 1QW1A 5CKBA 5CKFA 3QG1A 2KVQG 4ESRA 2K3XA 1ZBXA 1WHLA 3VYHB 2DEQA 3CCMA 2DL7A 3I5RA 1N27A 2YT6A 4ANJA 1ACMB 1C1AA 1RL2A 3QPHA 3S3NA 1M90R 2LC4A 1GFDA 2XMFA 4M7AG 3H0HA 4M77G 1VQ5T 1QVFP 2GTOA 4Q5WA 3BE3A 1Z9QA 5FRMA 1VYTA 4AT1B 4OB2B 4X9DA 3M0TA 1YIJA 3OY9A 4M75B 2E5KA 2CZ0B 3QIIA 2BKDN 3E19A 5FLXE 2A28A 3C95A 4BI4A 2VWFA 5EG2A 1SF9A 2JTFA 5KE2A 2J05A 4CC7A 3ZFJA 3CC2Q 2SRCA 2OTLA 1G3TA 3JB9J 2DK3A 1X6BA 3EGDA 5CKDA 3I9QA 4J7FA 2V8KA 1VQ4A 3CXCS 4J6YA 1VQ8Q 3HFNA 4KGXB 2KXDA 3CD6A 1M8VA 1HXDA 2GFUA 2ZPGB 2CDTA 2FZKB 2KYMA 2EVRA 3CMET 2C06A 2LX9A 3CCVA 2K4YA 4M75G 4OMPA 2EPDA 2YLCA 4C0FA 4CI0C 4DBFA 1HD3A 3R6NA 2A36A 4PJOE 3DB4A 1PC0A 3H0IA 1LNXA 4DBHA 1HSQA 1YWOA 3CCRA 2JXBA 3M4YA 2Y90A 1V1CA 2SEMA 1UJ0A 3A8HB 4HVVA 1ABOA 3EGUA 2VVKA 1PWTA 2EBPA 1OPLA 4Y91A 3CQTA 1Q81C 1TWBA 1E7OA 4PK4A 1WDXA 2JTEA 2V1RA 1WX6A 3OYYA 7AT1B 3JV3A 2QQBA 4FYXB 4M7DA 3GP8A 2L8DA 1VQKT 1MUZA 1NBEB 4Y92A 5I2MA 2QEXQ 4A4EA 5GANf 5FU6B 2RF0A 3GOXA 2KQWA 3I56A 1YIJQ 4JRIA 1CSKA 2MK5A 3CCLA 1TS9A 4E2FB 4M7DE 3JCMP 1WHHA 2K3YA 1X2QA 1Q81U 1YJNA 4OGCA 3A8MB 2OTLQ 2J6FA 5GAMh 5GAN2 5FWCA 4BE2A 1AWXA 5L23A 2F69A 3TSWA 2G3RA 4JZ3A 2EQUA 1K9MR 1Z9ZA 1JBMA 4LN2A 4GY5A 1R0BG 3TQ7P 4KUIA 4E7ZA 4X9CA 5LJ3j 3WVEB 3CCVQ 3EGDB 3VKIA 1M1KR 2O2OA 3A5ZB 2RI3A 2DETA 5FWBA 3C4SA 3OYDA 3ZBDA 4ZGEB 1YP5A 4QVZA 2YDLA 1VQOA 1TSFA 2P4TA 2HQXA 3CCST 3PNWC 3CMAT 1N5ZA 2KBTA 1AWWA 3M56A 4XU1A 3VS6A 1QP2A 5CK9A 4BE1A 2DL5A 2J6OA 2IPOB 1RABB 4ZNXA 4N4GA 3CPFA 1WI7A 5A2QE 1WQ7A 4RTTA 4EIKA 4BDZA 2EWNA 3JAME 2DL3A 5LJ5j 1OYXA 1D1BA 2XICA 1C0MA 1RAIB 1J3TA 2DD5A 3I56Q 1QCFA 3OYFA 1WQWA 1EZZB 3CCLQ 1NYFA 1RADB 5KYUB 3PE0A 2RQWA 4EPCA 2LT4A 2EQKA 2LJ0A 5GMKm 1UHCA 2CT4A 1IZ6A 4A4FA 2P0QA 1VQ7A 4OF1A 3A8OB 1YJNQ 2FO0A 4B9XA 5HCKA 5GMKj 4DBQA 3FRNA 1I07A 4HXJA 1K73C 2DLPA 3QDFA 4FT2A 4AFUC 3CC7T 4LXCA 1BI1A 4AG1C 1WLPB 4M7AF 4RCCA 2YLBA 4M77F 2FRWA 1BB9A 3HPWA 2E70A 5FW9A 1FXXA 2A0FB 2P84A 1WZOA 2L0AA 4FM4B 4C92D 2HL3A 1U8RA 1ZA2B 2B86A 2L3RA 3PGGA 5GAMe 4BDYA 3EG0A 1VQ9A 1G83A 4FYWB 2F2XA 2CYZB 1ABQA 1PKTA 2PUOB 1NJIR 2E65A 2WSFE 1K73U 3M9QA 1G3WA 4FW1A 4J9HA 3JCMc 1NZ9A 3EG9B 1VYUA 2W0ZA 2DPPB 2ZPIB 4CC4B 2K2VA 4XTXA 4XQ3A 2CUDA 4IUQA 5KYYA 1D09B 2PVOB 5LJ3g 1M4ZA 4M75F 1Y0MA 3SWNA 3V7CA 2RNAA 3L2WA 1VQMQ 1VQPT 1W6XA 2ZZDA 5GAN5 2CZ7B 3QZ9B 3PFSA 4X1VA 1YNZA 4M78F 1RAAB 1RAHB 4QVDA 4F17A 2EIFA 3L2ZA 1QVGS 3FDRA 2PZ1A 4CC2A 4LDXA 1UUEA 4L59A 3CPWA 5I11A 1SHFA 1PRLC 1MHNA 4PNOA 3WXMB 1WYXA 1YITT 1VQ7Q 1BI2A 5LL6S 1KG1A 4D6WA 4JDSA 3M0PA 4PLLA 2EGCA 3ME9A 2ECZA 1D3BA 4EMKC 5KYXB 1OV3A 1ARKA 2QA4T 3DLMA 3JCMW 4HKEA 4IIMA 4C8QA 1R77A 2K5IA 1DJ7B 2QI2A 4J83A 2F5KA 3REAB 2MIOA 1ZUUA 3M59A 1M90C 4E7KA 4RTWA 2NWMA 4PFOA 2C0OA 1BYMA 5J26A 4C8QE 1YI2T 2A37A 2EKOA 2EW3A 1VQ9Q 4RTZA 3VUBA 2VUBA 1IGQA 2AKKA 1NEBA 2B8AA 2KEAA 2ZPFB 4OMLA 1NLOC 1OI1A 2K5LA 2FYKA 2HKNA 4OMMA 3UDCA 2DF6A 4AMCA 2DAQA 2VV5A 2F1LA 2RQRA 1AVZC 1N9RA 2ZCFB 2PU9B 1G3SA 3TEEA 2WSEE 2QTXA 2QDLA 4E7HA 1M90U 3I5SA 1M27C 3RBBB 5KE3A 4J5YA 1X69A 3HTRA 3OYIA 4JLGA 4IUPA 1BCMA 3BW1A 3EH2A 1M1GA 3LX7A 5KYYB 5CQXA 4C92C 4ELYC 1KQSA 5EC7A 1AZEA 1ZUKA 4EDUA 1UG1A 3SWNB 3UT1A 3EFRA 4BY6C 2G6FX 4XK8E 5I21A 2RN8A 4F04B 2JMCA 4M4ZA 2MF2A 2LX7A 2XDDA 5GAN8 1BIAA 4GBQA 4JRKA 4Z89A 1PD0A 4RG8A 1TUGB 2EYWA 3L2RA 4PJOD 4N0AA 2JM9A 3JCMb 3CCJT 4M77E 4KGVB 1G3YA 2ZPEB 3NHNA 1SPKA 3LLRA 1SHGA 1D3BB 4N4IA 3L2QA 5KH6A 3TSZA 1YJ9T 4M78C 1K76A 2LTOA 1KK7A 2DVJA 3META 2LQWA 1AWOA 4C0ZA 5GAOl 3VS3A 4A4HA 9ATCB 3EHQA 3JCMf 4X34A 2XI9A 3UATA 1AWJA 2XDPA 4XAXB 2V8JA 1QCOA 4RTXA 1N8RC 4LUDA 2L5QA 2F2VA 2JVVA 4KH0B 1B34B 1I4K1 4II1A 4ZTJA 3OSVA 2HNIA 5A0LA 2YUPA 4HVWA 1M3CA 3QXEB 4RCBA 3OA6A 4FU6A 2F5TX 4V2SA 1QKXA 1V29B 1WHGA 4M75E 1KC8C 4PJLA 1NPPA 2EAYA 2F2WA 4M7DF 1QVFS 3WVDB 4FYVB 1A0NB 1XOVA 3CCET 3LWHA 4PKCC 5D7UA 2CP0A 1AD5A 2HQEA 1TU0B 3VRZA 1N8RU 1RLPC 5J3BA 3REBB 4C0DB 1GRIA 1Q7YR 4HCCA 1GXIE 3CC2A 3QYHB 4KRTA 4LD9K 3GNFB 1AZGB 3CPWS 5GAMf 1ZA1B 1NEGA 3Q1JA 1VQ5A 2BE7D 2HZYA 2COWA 5GANj 1TUDA 1RAGB 1WXTA 4C5IA 4FL6A 1KC8U 2P0PA 2YRDA 5LJ3h 3VS7A 3C0CA 1BI3A 1UGPB 1LVKA 4OMFB 1JRIA 1TUCA 3I35A 1D1CA 1HK9A 3OSSC 3GNGA 2EFIA 3HFOA 1EFNA 2CSIA 3G4SQ 1OU8A 1SKUB 2RHIA 3NGPA 4LDWA 3CCQQ 2CZ6B 3X26B 4HT9A 3OMGA 3OBYA 4FSSA 2CH4A 3VJPA 2HKQB 1JXOA 1TH7A 1YJWT 1VIEA 4J9FA 3QJYA 3RIRA 3PMIA 1X2KA 3H8ZA 1OPKA 2L3PA 2MWPA 2VGNA 3SB2A 2D1XA 1ZSGA 2CSQA 1PRMC 2Y4XA 2QEXA 4FYYB 5DLOA 5LJ5h 2X35A 3MP1A 4MDWA 4J6XA 4RKUE 2FRYA 2O31A 4PJOC 2YSQA 2LDMA 2AKLA 1BBZA 3CPWP 3QUIA 1H3HA 3M0RA 4KULA 3LGLA 4NS5A 1P92A 3A98A 3QDRB 3PIPA 1IO6A 3RMSA 2FVUA 3J7AF 3JB9H 2DVEA 1VQKA 2XKOC 1VQ5Q 2EQMA 3DKMA 1FX7A 1K9AA 4JRPA 1K8AR 5I22A 2V26A 3L42A 1UFFA 4A4GA 3L2UA 1I1JA 2K5FA 1CKBA 1AHJB 2HEQA 1MMDA 1NE8A 3L2VA 2KSSA 4M7DC 1UGSB 2H3JA 3E9FA 2KT8A 1RI9A 3OBWA 3CCMT 3MP6A 2E1HA 2M9UA 1XJWB 2LQKA 3CMEQ 2EKHA 2DNUA 2Y4YA 3RERA 2EJFA 2L3QA 1G5VA 2PTKA 4K11A 1R0CB 2AK5A 2BZXA 2V8IA 4A53A 2DXUA 4BI8B 1C6VX 5KYUA 5FROA 2MYSA 1Y96A 4OMNA 1KD1R 2D6FA 5L8RE 2DBKA 2C0TA 2GNCA 2QK0A 1ZQ1A 3OQ5A 1Q82C 3JRZA 3VV0A 2GQIA 3CCSA 3CMAA 1OX8A 3TVTA 2RHZA 1FMWA 1PSFA 2OTJT 4RUGA 1KQSP 1JJ2A 1W70A 5D6XA 2DIQA 3CCUT 2EQIA 3BDLA 1VQ4T 1VQKQ 1GBRA 4XU0A 2RD1A 4LDYA 3CD6T 2QDYB 2JJ9A 3O5ZA 1SSFA 4OVAA 1Q82U 1NM7A 3OYMA 4HT8A 4E6RA 2CGHA 1BK2A 3EG9A 4C8QF 3URGA 3QO3A 4QQDA 1JO8A 3CCRT 1W2BP 3O8VA 1IXDA 2GTJA 2YUQA 5GJVB 4QW2A 3A8LB 3CC7A 4JRQA 1M3AA 3JB9F 4OB3B 3CBPA 3FEOA 2KE9A 2M0YA 4RG2A 3LW5E 4JJBA 1NYGA 1OQKA 3LYIA 2QGFB 1W4SA 4LDUA 5FRNA 4MZMA 1MMGA 1KHIA 1Q86R 2RO0A 3G7ZA 2CT3A 2KY9A 2CP2A 1M1FA 2MAMA 4ZN3A 2COZA 1VQMA 3VS0A 1Y57A 2RK2A 5GAN3 2YHTA 4DBRA 2VYTA 2RA2A 3MEAA 2RM4A 2LMJA 3EGXA 3CCSQ 3CMAQ 3QYGB 2RJEA 4MMLA 2EJ9A 4R0KA 2LQNA 5KYXA 3OW2A 1BKBA 1Y96B 2QQRA 3NPFA 1M5Q1 2NUTA 3PT9A 2A7YA 3LGFA 2QG9B 2XG8D 1GCQC 3EAEA 2J6KA 4RTYA 1QLYA 3UPUA 2DILA 3M4GA 1F1BB 4NL3A 1VIFA 3LWIA 3FC3A 4M7AD 1T0HA 4M77D 5GAN6 1OOTA 3VS4A 1BU1A 1WJSA 3V7SA 2VB6A 3M0UA 4AG2C 2EYYA 2W10A 1RI0A 3J81E 1YHQT 3M5AA 4BACA 3C94A 5M9OA 1OZ3A 1VQOT 2LP5A 3OMCA 1IREB 1LJOA 2MMPA 2QA4A 4E7LA 1UHFA 3RKXA 3CC7Q 2DRMA 5GAN4 3G71T 4C5GA 3T9NA 3HRSA 4OP0A 3MCAB 3EG2A 1W1FA 2HCKA 2LNVA 4OMQA 2DE0X 4M75D 2E10A 1YI2A 2ESWA 1I81A 1I5LA 1MV3A 5LJ3d 2JMAA 2FB7A 4ME7A 4M78D 2ZPHB 2X51A 1M8MA 2R58A 3UF4A 1U5SA 2XU8A 4ZTFA 4JS5A 1Y7XA 2P0KA 4C8QC 1SEMA 1X43A 3JCMX 2PVDB 4BI3A 1VQLT 3FJPA 3THKA 1IRXA 5J39A 2EYXA 5GANh 3EGXB 2O4XB 3VS2A 3V7RA 1VQPQ 3NTHA 3I55T 2CKKA 2RHUA 2IVWA 1Y71A 2LCCA 2GQVA 3CC4T 1Q81R 2XHCA 3HRUA 4KBMB 2CP7A 2NUTB 3AT1B 1XTDA 2ED0A 2M02A 1D0ZA 1YCYA 3M58A 2V1QA 5LJ5g 5LJ5d 1ZSZA 5CAIA 5GAMj 1K0SA 4LE9A 3G6ET 2D8HA 1YITQ 1XNIA 1B34A 3HRTA 1M3BA 2FL7A 5FU7C 2HSPA 4B9WA 1QP3A 3MHXA 4A63B 3EG3A 2QGGA 3QSUA 4OB0B 1RLQC 2WSCE 2QA4Q 5KYWB 4B6MA 2DD4A 1ZBJA 1PNJA 2CP3A 4F7UA 2VXFA 2DL4A 3CCJA 1ZUYA 1FMVA 1WFWA 8AT1B 2JS0A 2X4JA 1OZ2A 2KMTA 1YJ9A 2HSEB 1MNDA 4EMKA 1YI2Q 1VQ6T 2EYQA 2HD0A 3N5BB 4J9GA 4M7AC 2DTIA 4M77C 3ER0A 8ATCB 2QQ9A 2R5AA 4L5GA 4J7IA 2C0IA 2IG0A 1JJ2P 1E6GA 1OX9A 1H92A 2JUFA 2KGTA 1K0XA 1U1SA 1UTIA 3X28B 3DLLA 5KCHA 2KT1A 2DBMA 3SDZA 2EJGA 3MEWA 3FJ5A 3MKDA 2DL8A 1UJYA 1RAEB 2VC8A 2R5MA 4IUVA 5DM7R 3MEVA 3HKSA 4FCYA 4BUGA 3CCEA 1H3ZA 1WXUA 3OYEA 3JCMg 4M75C 3X25B 4XTZA 3CXCA 2KROA 1R8OB 2I0NA 2PNIA 3G4SA 1D0XA 3CCQA 3P8BB 2E4HA 3GBQA 1W2BA 2VXEA 2RQUA 1YN8A 4QVCA 1WHMA 2BUDA 4C92A 3QKJA 2KRSA 3CBOA 1ZSZB 2VGMA 2BZ8A 3EG1A 1VA7A 5AYFA 3H6ZA 3CCJQ 3EH1A 2A08A 2GF7A 3KFVA 2CH4W 4QQGA 2MWOA 3HP9A 4F14A 2KDSA 4IUUA 3VS1A 1K73R 2RMOA 1YJ9Q 1RUWA 2HBWA 3E2UA 5DLQE 4M7DD 4O5VA 4AFZC 1K9MC 1OEBA 1M2OA 4F7UB 1T3SA 3RNJA 1YJWA 2O9VA 3OW2P 1I0CA 2K2MA 2OI3A 4HA8A 1M1KC 4EMKB 2FHDA 2KRNA 3EFSA 2NLUA 3CEYA 1KQ1A 1G2BA 1U3OA 2BIVA 1NPRA 4E7SA 2RJDA 1GBQA 5IHKA 4Z02A 1MV0B 4A54A 1UGRB 1K9MU 1KQ2A 2RJCA 1X27A 4F7UG 5FU6C 1TG0A 2NYSA 2YUNA 3CCEQ 1VQNT 1QWEA 3JCMQ 5CKHA 1Q86C 2QQAA 3HL8A 4D8DA 1S72T 1M1KU 1WGSA 2JZ2A 4ZN1A 2CP5A 3FIFA 3D7SB 3H41A 3SFMA 2D0NA 5A0GA 5GAOr 4BE0A 2X3WD 1LPLA 3HHTB 4RTVA 3AHUA 3CMEA 3S6WA 3OB9A 3RR6A 4XU2A 3OYCA 3A1PA 4J9BA 1Q86U 5GMKl 2JT4A 1WHKA 3VS5A 2OX7A 4WF2A 2MI6A 1FYNA 2KYBA 3M55A 3OS1A 2KK4A 2HDAA 3RKYA 2X4YA 3HSBA 5CCAA 2HQHA 4C92B 5ECAA 2X9HA 1B07A 1WXBA 3NTIA 1QMCA 4LDVA 4BY6B 2FZCB 2GGRA 1YJWQ 1M2VA 4IKFA 1V76A 3CC2T 2DTOA 3X20B 4C0GA 5GMKi 4JJCA 5CKEA 2OAWA 3M0QA 1ZX6A 2BZYA 1KQSS 5GMKh 2YRCA 1VQ8T 2JS2A 4J9EA 1NJIC 3QWXX 2A3LA 1QCNA 4C92G 1G8XA 2MPXC 2OTJA 2J06A 3NFCA 4M78B 5C6SA 2H8HA 2ROTA 4QT7A 5A0DA 2L3SA 1YCSB 4R56A 1RACB 2M51A 3CCUA 1UGQB 4KT0E 3QBYA 4PJOA 3EFOA 5IHIA 1NJIU 4PJJA 2DZ9A 3KUFA 1VYVA 1W2BS 2PVGB 4GLMA 3FB9A 1U1TA 2DKGA 2LJ3A 5LJ3e 5GANd 1JXMA 5GANg 1UDLA 2O9SA 2E64A 3X24B 4M78G 2FEIA 3NMZC 2QTVA 2VASA
chains in the Genus database with same CATH topology
1QLYA 4OMMA 2DILA 2RQVA 1KSWA 2DF6A 1T0HA 2MCNA 1WA7A 2DA9A 5IHNA 2RQRA 1AVZC 4Z8AA 1X6GA 1OOTA 3VS4A 2NUZA 1BU1A 1M30A 2J7IA 2FG0A 3H0FA 3M0UA 2QDLA 4AG2C 2EYYA 3I5SA 1M27C 3RBBB 1JU5C 2W10A 1X69A 4CC3A 1PHTA 1K1ZA 4LUEA 2D8JA 3U23A 5IH2A 2LP5A 1JQQA 1ZLMA 1QWFA 1UHFA 5EC7A 1AZEA 2EGAA 3EHRA 2DRMA 1ZUKA 1UG1A 4Z88A 1CKAA 2KR3A 2DJQA 1T3LA 3EG2A 1W1FA 2G6FX 2HCKA 2RN8A 2DRKA 2ABLA 2JMCA 4M4ZA 2LX7A 4ESRA 4OMQA 2DE0X 4IIOA 2DL7A 2GBQA 3I5RA 2EGEA 2YT6A 2ESWA 4GBQA 4Z89A 1MV3A 2JMAA 2EYWA 1M8MA 2JM9A 3UF4A 1U5SA 2ED1A 1GFDA 2XMFA 3H0HA 3UA6A 1UGVA 3NHNA 2GTOA 1SPKA 1PKSA 1SEMA 1Z9QA 1KIKA 1X43A 1VYTA 1SHGA 3TSZA 3M0TA 3THKA 1K76A 2VKNA 2E5KA 2DVJA 1GFCA 2LQWA 4HVUA 1AWOA 3ULRB 2EYXA 3VS3A 3EHQA 2A28A 3UATA 2VWFA 1AWJA 2J05A 4CC7A 1YWPA 4RTXA 3VS2A 4LUDA 2F2VA 2SRCA 1S1NA 1X6BA 3VRYA 3I9QA 1AOJA 2YUPA 2DM1A 4LNPA 4HVWA 2ED0A 1M3CA 2X3XD 2V1QA 2KXDA 3SHWA 1QKXA 1U06A 2CDTA 1K0SA 4LE9A 2KYMA 2EVRA 2K6DA 2D8HA 5IXBA 2RPNA 4OMPA 1M3BA 2EPDA 2F2WA 2HSPA 4A63B 1A0NB 1XOVA 1HD3A 3EG3A 3R6NA 1RLQC 2A36A 1AD5A 3H0IA 3VRZA 3QWYA 1RLPC 3REBB 1GRIA 1ZBJA 1HSQA 1UECA 1NG2A 4KRTA 2FPDA 1YWOA 1PNJA 1AZGB 1GL5A 2DL4A 3IQLA 1NEGA 2JXBA 1ZUYA 1FMKA 1V1CA 1WFWA 2SEMA 1UJ0A 2JS0A 2DX1A 4HVVA 1TUDA 1ABOA 3EGUA 1WXTA 2VVKA 1PWTA 2EBPA 2OJ2A 1OPLA 1T0JA 3CQTA 1E7OA 1WDXA 4J9GA 2JTEA 2V1RA 1WX6A 3VS7A 3C0CA 3JV3A 4ORZA 1KFZA 1TUCA 3I35A 2C0IA 1MUZA 4Y92A 1E6GA 3PVQA 1H92A 1EFNA 2KGTA 2CSIA 1K0XA 1UTIA 4JPBW 2RF0A 2KT1A 3NGPA 2KNBB 2DBMA 3SEMA 1CSKA 4FSSA 2P4RA 2CH4A 3FJ5A 1JXOA 2RQTA 1X2QA 1GCQA 2DL8A 1UJYA 2J6FA 2FPEA 4J9FA 5FWCA 1X2KA 1AWXA 1OPKA 1WXUA 2L3PA 4JZ4A 5L23A 3TSWA 4JZ3A 4D8KA 2D1XA 1ZSGA 4J9IA 2CSQA 1PRMC 2KROA 1Z9ZA 1LCKA 2I0NA 2PNIA 4LN2A 4OMOA 2FRYA 2O31A 2YSQA 5IXFA 3GBQA 2AKLA 1BBZA 1YN8A 2O2OA 2RQUA 1H3HA 3M0RA 5FWBA 2KRSA 3A98A 2K79A 1IO6A 1YP5A 2MOXA 2BZ8A 3EG1A 2YDLA 1VA7A 4DEXA 5GJWB 3ZL7C 2A08A 3KFVA 2CH4W 1N5ZA 4F14A 2JW4A 3VS1A 2RMOA 2KBTA 1JEGA 1AWWA 2ROLA 4DEYA 1RUWA 2HBWA 1K9AA 3VS6A 5I22A 2DL5A 1UFFA 4AFZC 1OEBA 2J6OA 4ZNXA 1T3SA 1WI7A 3RNJA 4RTTA 4EIKA 2O9VA 1I1JA 1CKBA 1I0CA 4AFQC 2HEQA 2K2MA 2OI3A 4F16A 2DL3A 1J3TA 1WIEA 2KRNA 2YUOA 2AZVA 2JM8A 2KT8A 1QCFA 1RI9A 2EYZA 1G2BA 1U3OA 2CREA 1NYFA 1HJDA 2K3BA 3PE0A 1GBQA 2RQWA 2LNHB 5IHKA 1E6HA 3PVLA 2LJ0A 1UHCA 1H8KA 2CT4A 2EKHA 2DNUA 4WCIA 2L3QA 2PTKA 1MV0B 4K11A 2FO0A 5HCKA 2BTTA 1I07A 1X27A 2AK5A 4HXJA 2BZXA 2DLPA 1TG0A 2YUNA 4AFSC 1QWEA 4OMNA 4AFUC 4D8DA 4AG1C 2DBKA 1SRLA 1WLPB 2C0TA 2GNCA 2FRWA 1BB9A 2GQIA 5FW9A 2L0AA 3TVTA 3H41A 2D0NA 4RUGA 2X3WD 2B86A 3EG0A 1W70A 4RTUA 4RTVA 1G83A 1B3QA 3M0SA 2F2XA 1GCPA 1ABQA 1PKTA 2EQIA 1SSHA 4J9BA 4J9HA 1GBRA 2JT4A 1VYUA 2W0ZA 3VS5A 3O5ZA 1FYNA 4CC4B 2KYBA 2K7AA 2HDAA 2KXCA 2LJ1A 5ECAA 1NM7A 1B07A 2CUDA 1WXBA 2AZSA 4E6RA 1NLPC 1BK2A 1Y0MA 2GGRA 4JJDA 2RNAA 4HCKA 1W6XA 1SRMA 1AEYA 1JO8A 4JJCA 2OAWA 1QKWA 4X1VA 1YNZA 2GTJA 3M0QA 2YUQA 1ZX6A 5GJVB 2BZYA 4F17A 2PZ1A 1M3AA 4CC2A 1UUEA 2JS2A 4J9EA 2KE9A 2M0YA 4JJBA 1NYGA 5I11A 1SHFA 1PRLC 2DMOA 3QWXX 4J9DA 3LH5A 1WYXA 3UA7A 2J06A 2KRMA 3M0PA 2CT3A 2EGCA 2H8HA 2ROTA 2LCSA 4QT7A 2ECZA 2L3SA 1YCSB 1OV3A 1ARKA 2IIMA 2LZ6B 2M51A 4IIMA 2FPFA 3VS0A 1Y57A 2LMJA 2CUBA 4J9CA 3REAB 2L2PA 2MIOA 1ZUUA 5IHIA 2DYBA 4R0KA 2LQNA 4RTWA 1UE9A 2NWMA 2C0OA 2ENMA 1VYVA 4GLMA 2A37A 2EW3A 1K4US 3NPFA 2LJ3A 2O88A 4RTZA 1JXMA 1UDLA 2O9SA 1KJWA 2AKKA 1NEBA 2K9GA 2KEAA 2FEIA 3NMZC 4OMLA 1NLOC 1GCQC 2J6KA 4RTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLY A;  4OMM A;  2DIL A;  2RQV A;  1KSW A;  2DF6 A;  1T0H A;  2MCN A;  1WA7 A;  2DA9 A;  5IHN A;  2RQR A;  1AVZ C;  4Z8A A;  1X6G A;  1OOT A;  3VS4 A;  2NUZ A;  1BU1 A;  1M30 A;  2J7I A;  2FG0 A;  3H0F A;  3M0U A;  2QDL A;  4AG2 C;  2EYY A;  3I5S A;  1M27 C;  3RBB B;  1JU5 C;  2W10 A;  1X69 A;  4CC3 A;  1PHT A;  1K1Z A;  4LUE A;  2D8J A;  3U23 A;  5IH2 A;  2LP5 A;  1JQQ A;  1ZLM A;  1QWF A;  1UHF A;  5EC7 A;  1AZE A;  2EGA A;  3EHR A;  2DRM A;  1ZUK A;  1UG1 A;  4Z88 A;  1CKA A;  2KR3 A;  2DJQ A;  1T3L A;  3EG2 A;  1W1F A;  2G6F X;  2HCK A;  2RN8 A;  2DRK A;  2ABL A;  2JMC A;  4M4Z A;  2LX7 A;  4ESR A;  4OMQ A;  2DE0 X;  4IIO A;  2DL7 A;  2GBQ A;  3I5R A;  2EGE A;  2YT6 A;  2ESW A;  4GBQ A;  4Z89 A;  1MV3 A;  2JMA A;  2EYW A;  1M8M A;  2JM9 A;  3UF4 A;  1U5S A;  2ED1 A;  1GFD A;  2XMF A;  3H0H A;  3UA6 A;  1UGV A;  3NHN A;  2GTO A;  1SPK A;  1PKS A;  1SEM A;  1Z9Q A;  1KIK A;  1X43 A;  1VYT A;  1SHG A;  3TSZ A;  3M0T A;  3THK A;  1K76 A;  2VKN A;  2E5K A;  2DVJ A;  1GFC A;  2LQW A;  4HVU A;  1AWO A;  3ULR B;  2EYX A;  3VS3 A;  3EHQ A;  2A28 A;  3UAT A;  2VWF A;  1AWJ A;  2J05 A;  4CC7 A;  1YWP A;  4RTX A;  3VS2 A;  4LUD A;  2F2V A;  2SRC A;  1S1N A;  1X6B A;  3VRY A;  3I9Q A;  1AOJ A;  2YUP A;  2DM1 A;  4LNP A;  4HVW A;  2ED0 A;  1M3C A;  2X3X D;  2V1Q A;  2KXD A;  3SHW A;  1QKX A;  1U06 A;  2CDT A;  1K0S A;  4LE9 A;  2KYM A;  2EVR A;  2K6D A;  2D8H A;  5IXB A;  2RPN A;  4OMP A;  1M3B A;  2EPD A;  2F2W A;  2HSP A;  4A63 B;  1A0N B;  1XOV A;  1HD3 A;  3EG3 A;  3R6N A;  1RLQ C;  2A36 A;  1AD5 A;  3H0I A;  3VRZ A;  3QWY A;  1RLP C;  3REB B;  1GRI A;  1ZBJ A;  1HSQ A;  1UEC A;  1NG2 A;  4KRT A;  2FPD A;  1YWO A;  1PNJ A;  1AZG B;  1GL5 A;  2DL4 A;  3IQL A;  1NEG A;  2JXB A;  1ZUY A;  1FMK A;  1V1C A;  1WFW A;  2SEM A;  1UJ0 A;  2JS0 A;  2DX1 A;  4HVV A;  1TUD A;  1ABO A;  3EGU A;  1WXT A;  2VVK A;  1PWT A;  2EBP A;  2OJ2 A;  1OPL A;  1T0J A;  3CQT A;  1E7O A;  1WDX A;  4J9G A;  2JTE A;  2V1R A;  1WX6 A;  3VS7 A;  3C0C A;  3JV3 A;  4ORZ A;  1KFZ A;  1TUC A;  3I35 A;  2C0I A;  1MUZ A;  4Y92 A;  1E6G A;  3PVQ A;  1H92 A;  1EFN A;  2KGT A;  2CSI A;  1K0X A;  1UTI A;  4JPB W;  2RF0 A;  2KT1 A;  3NGP A;  2KNB B;  2DBM A;  3SEM A;  1CSK A;  4FSS A;  2P4R A;  2CH4 A;  3FJ5 A;  1JXO A;  2RQT A;  1X2Q A;  1GCQ A;  2DL8 A;  1UJY A;  2J6F A;  2FPE A;  4J9F A;  5FWC A;  1X2K A;  1AWX A;  1OPK A;  1WXU A;  2L3P A;  4JZ4 A;  5L23 A;  3TSW A;  4JZ3 A;  4D8K A;  2D1X A;  1ZSG A;  4J9I A;  2CSQ A;  1PRM C;  2KRO A;  1Z9Z A;  1LCK A;  2I0N A;  2PNI A;  4LN2 A;  4OMO A;  2FRY A;  2O31 A;  2YSQ A;  5IXF A;  3GBQ A;  2AKL A;  1BBZ A;  1YN8 A;  2O2O A;  2RQU A;  1H3H A;  3M0R A;  5FWB A;  2KRS A;  3A98 A;  2K79 A;  1IO6 A;  1YP5 A;  2MOX A;  2BZ8 A;  3EG1 A;  2YDL A;  1VA7 A;  4DEX A;  5GJW B;  3ZL7 C;  2A08 A;  3KFV A;  2CH4 W;  1N5Z A;  4F14 A;  2JW4 A;  3VS1 A;  2RMO A;  2KBT A;  1JEG A;  1AWW A;  2ROL A;  4DEY A;  1RUW A;  2HBW A;  1K9A A;  3VS6 A;  5I22 A;  2DL5 A;  1UFF A;  4AFZ C;  1OEB A;  2J6O A;  4ZNX A;  1T3S A;  1WI7 A;  3RNJ A;  4RTT A;  4EIK A;  2O9V A;  1I1J A;  1CKB A;  1I0C A;  4AFQ C;  2HEQ A;  2K2M A;  2OI3 A;  4F16 A;  2DL3 A;  1J3T A;  1WIE A;  2KRN A;  2YUO A;  2AZV A;  2JM8 A;  2KT8 A;  1QCF A;  1RI9 A;  2EYZ A;  1G2B A;  1U3O A;  2CRE A;  1NYF A;  1HJD A;  2K3B A;  3PE0 A;  1GBQ A;  2RQW A;  2LNH B;  5IHK A;  1E6H A;  3PVL A;  2LJ0 A;  1UHC A;  1H8K A;  2CT4 A;  2EKH A;  2DNU A;  4WCI A;  2L3Q A;  2PTK A;  1MV0 B;  4K11 A;  2FO0 A;  5HCK A;  2BTT A;  1I07 A;  1X27 A;  2AK5 A;  4HXJ A;  2BZX A;  2DLP A;  1TG0 A;  2YUN A;  4AFS C;  1QWE A;  4OMN A;  4AFU C;  4D8D A;  4AG1 C;  2DBK A;  1SRL A;  1WLP B;  2C0T A;  2GNC A;  2FRW A;  1BB9 A;  2GQI A;  5FW9 A;  2L0A A;  3TVT A;  3H41 A;  2D0N A;  4RUG A;  2X3W D;  2B86 A;  3EG0 A;  1W70 A;  4RTU A;  4RTV A;  1G83 A;  1B3Q A;  3M0S A;  2F2X A;  1GCP A;  1ABQ A;  1PKT A;  2EQI A;  1SSH A;  4J9B A;  4J9H A;  1GBR A;  2JT4 A;  1VYU A;  2W0Z A;  3VS5 A;  3O5Z A;  1FYN A;  4CC4 B;  2KYB A;  2K7A A;  2HDA A;  2KXC A;  2LJ1 A;  5ECA A;  1NM7 A;  1B07 A;  2CUD A;  1WXB A;  2AZS A;  4E6R A;  1NLP C;  1BK2 A;  1Y0M A;  2GGR A;  4JJD A;  2RNA A;  4HCK A;  1W6X A;  1SRM A;  1AEY A;  1JO8 A;  4JJC A;  2OAW A;  1QKW A;  4X1V A;  1YNZ A;  2GTJ A;  3M0Q A;  2YUQ A;  1ZX6 A;  5GJV B;  2BZY A;  4F17 A;  2PZ1 A;  1M3A A;  4CC2 A;  1UUE A;  2JS2 A;  4J9E A;  2KE9 A;  2M0Y A;  4JJB A;  1NYG A;  5I11 A;  1SHF A;  1PRL C;  2DMO A;  3QWX X;  4J9D A;  3LH5 A;  1WYX A;  3UA7 A;  2J06 A;  2KRM A;  3M0P A;  2CT3 A;  2EGC A;  2H8H A;  2ROT A;  2LCS A;  4QT7 A;  2ECZ A;  2L3S A;  1YCS B;  1OV3 A;  1ARK A;  2IIM A;  2LZ6 B;  2M51 A;  4IIM A;  2FPF A;  3VS0 A;  1Y57 A;  2LMJ A;  2CUB A;  4J9C A;  3REA B;  2L2P A;  2MIO A;  1ZUU A;  5IHI A;  2DYB A;  4R0K A;  2LQN A;  4RTW A;  1UE9 A;  2NWM A;  2C0O A;  2ENM A;  1VYV A;  4GLM A;  2A37 A;  2EW3 A;  1K4U S;  3NPF A;  2LJ3 A;  2O88 A;  4RTZ A;  1JXM A;  1UDL A;  2O9S A;  1KJW A;  2AKK A;  1NEB A;  2K9G A;  2KEA A;  2FEI A;  3NMZ C;  4OML A;  1NLO C;  1GCQ C;  2J6K A;  4RTY A; 
#chains in the Genus database with same CATH topology
 1IB8 A;  3KBG A;  2QEX T;  2MCN A;  3NTK A;  5IHN A;  2D0Q B;  1RAF B;  4Z8A A;  3JCM h;  1YIJ T;  1M30 A;  1KHC A;  3CCM Q;  1JU5 C;  2WAC A;  2DXC A;  4A4K A;  3JCM J;  4E47 A;  4CC3 A;  1PHT A;  3TU4 K;  5GAN 7;  3E9G A;  2Z0W A;  2OTL T;  1AT1 B;  1K1Z A;  3VUZ A;  4HCZ A;  4DOW A;  4LUE A;  3U23 A;  3OS5 A;  1JQQ A;  1Q95 G;  1ZLM A;  4J6W A;  5GAO m;  2I2L A;  5HK0 A;  1QVG A;  3MP8 A;  3EHR A;  5LJ5 e;  1MMA A;  1M2V B;  2KR3 A;  1N8R R;  4P5N A;  2DRK A;  2ABL A;  3CCV T;  2DFU A;  2OTJ Q;  3H9N A;  2O01 E;  2HL5 C;  4IIO A;  4C8Q D;  4E7I A;  1MMN A;  2GBQ A;  3CXC P;  2EGE A;  4EMH A;  2JOY A;  2QQS A;  3ZEH A;  2EQJ A;  3C12 A;  3CCU Q;  2HAX A;  5GMK e;  1VQ4 Q;  4GLK A;  2ED1 A;  3JB9 D;  3UA6 A;  1KC8 R;  1UGV A;  2YRV A;  3CD6 Q;  5HY6 A;  3MO8 A;  1PKS A;  1KIK A;  5CQY A;  3OYN A;  2VKN A;  4Y28 E;  2ATC B;  1GFC A;  2DZC A;  3M53 A;  4HVU A;  2K57 A;  1IHW A;  3ULR B;  2M16 A;  1YHQ A;  4WTO B;  3OYJ A;  3E1S A;  4BD3 A;  2PUK B;  4PJO B;  3EFO B;  1YWP A;  5CIU A;  4F7U F;  3SD4 A;  3VU3 C;  1S1N A;  2DXB A;  3CCR Q;  3VRY A;  1WJR A;  4PFP A;  3J80 E;  2AIR B;  1AOJ A;  4MMK A;  4DOV A;  1IGU A;  3F70 A;  4KH1 B;  4FSX A;  3I56 T;  2DM1 A;  4LNP A;  3P8D A;  3CCL T;  2X3X D;  2O4X A;  3G71 A;  3SHW A;  4IUR A;  1U06 A;  2GCX A;  2K6D A;  5IXB A;  2RPN A;  1YJN T;  2XID A;  1VUB A;  1MNE A;  2QAS A;  1ZHI A;  2DXT A;  4PJO G;  3P8H A;  5DY9 A;  2QAZ A;  3QWY A;  3JCM e;  1VQP A;  1UEC A;  1NG2 A;  3GF5 A;  2FPD A;  2AT1 B;  1GL5 A;  2LT1 A;  3IQL A;  4DQ2 A;  1FMK A;  1M9S A;  2DX1 A;  2E3H A;  2DO3 A;  4M7D B;  4MDX A;  4PJM A;  3RKW A;  5D6Y A;  3VYG A;  1VQL A;  5KYW A;  2OJ2 A;  1X75 C;  1T0J A;  3OYG A;  1QQJ A;  2JN0 A;  1YIT A;  5CO7 A;  2OAU A;  2LRQ A;  6AT1 B;  4ORZ A;  3PTA A;  1KFZ A;  2E41 A;  3JCM V;  5D6W A;  3SWN C;  3I55 A;  3PVQ A;  4NOY A;  4JPB W;  1PM3 A;  3CC4 A;  2DEU A;  4OB1 B;  2KNB B;  2RI2 A;  3SEM A;  1WNL A;  2P4R A;  1Q7Y C;  4JUV A;  4M7D G;  3S3M A;  1UB4 A;  3OYH A;  2RQT A;  4C92 F;  3G6E A;  1YHQ Q;  1GCQ A;  2YXY A;  3TCJ A;  1VQM T;  5HK3 A;  3GPL A;  2FPE A;  4ATO A;  2COY A;  1VQO Q;  3TRE A;  2E5Q A;  4JZ4 A;  2LVM A;  2KAF A;  1EIF A;  4D8K A;  5GAO n;  1X01 A;  2L89 A;  4J9I A;  1PCX A;  5CR2 A;  3M54 A;  4MZP A;  3G71 Q;  1LCK A;  5GAO q;  3MEU A;  4LD6 A;  4OMO A;  1TOV A;  5IN1 A;  5CVI A;  1O75 A;  1VQ7 T;  5IXF A;  4N4H A;  1ZSZ C;  1Q7Y U;  2BE9 B;  1JJ2 S;  3G1J A;  1OU9 A;  1VQ6 A;  1QVF A;  1I8F A;  4YTL A;  2RI5 A;  4ZGD B;  1PSE A;  2K79 A;  4XTV A;  2M1H A;  2XK0 A;  2MOX A;  1FWZ A;  4DEX A;  3CBM A;  3FLG A;  5GJW B;  3ZL7 C;  4XTU A;  2E12 A;  5LJ3 f;  2DIG A;  2JW4 A;  1H64 1;  3L1A A;  1VQL Q;  2YWW A;  1JEG A;  4NL2 A;  2ROL A;  4DEY A;  1B7T A;  3RUX A;  1VQ9 T;  3JB9 I;  4MZT A;  4C5E A;  4C0D C;  2QYZ A;  2DYI A;  1Q82 R;  3QZ5 B;  1YFN A;  4AFQ C;  3I55 Q;  4F16 A;  3M57 A;  1VOM A;  5IT9 E;  3CC4 Q;  1WIE A;  4O6J A;  2YUO A;  2AZV A;  2JM8 A;  2EYZ A;  2CRE A;  5HKC A;  5AT1 B;  2K3B A;  3OYK A;  1HJD A;  1MGQ A;  2LNH B;  1WJQ A;  4PFZ A;  1E6H A;  3PVL A;  3RMQ A;  3G6E Q;  2HMA A;  1LOJ A;  1H8K A;  4WCI A;  4KGZ B;  3GLX A;  4QKU A;  2BTT A;  1XQH A;  3ASK A;  4XTW A;  1X6O A;  4F7U E;  5LJ5 f;  4C5H A;  1O9S A;  4AFS C;  3PIO A;  2X4W A;  3OYB A;  1K8A C;  2XD0 A;  3GIB A;  4IUT A;  1SRL A;  4N0A C;  4HCB A;  4TVR A;  2H3E B;  1PD1 A;  1BI0 A;  3OW2 S;  2D9T A;  4PL6 A;  4VUB A;  2E3I A;  2X4X A;  5KCO A;  1QVG P;  1VQ6 Q;  4RTU A;  5GAO p;  2ZGW A;  3INZ A;  1B3Q A;  3M0S A;  1GCP A;  2NUP A;  1SSH A;  3MPU B;  3UWN A;  2RB6 A;  3PMT A;  2JNG A;  4L6V 5;  4PJN A;  1K8A U;  5IAY A;  2K7A A;  3JCM d;  3KXT A;  2KXC A;  2LJ1 A;  4JS4 A;  4CRI A;  4M7A A;  3LH0 A;  1KD1 C;  4M77 A;  4JJN K;  2AZS A;  5GAN e;  4FT4 A;  1NLP C;  4JJD A;  1EX4 A;  3V8J A;  4HCK A;  2E6N A;  1SRM A;  2LCL A;  3V8K A;  1AEY A;  2M0O A;  4M7A E;  1QKW A;  1VQN A;  2ZPB B;  4PJO F;  1TTH B;  4JLI A;  2DER A;  1HYO A;  2KI7 A;  1S72 A;  1UEB A;  2RH2 A;  1D0Y A;  2RJF A;  2DMO A;  3OS2 A;  4J9D A;  4C8Q B;  4E7J A;  3LH5 A;  4C92 E;  4RMO A;  3OS0 A;  4FIB A;  1KD1 U;  2GFA A;  2XDB A;  3UA7 A;  1BIB A;  3R6O A;  3MJX A;  4PLI A;  5C0M A;  2KRM A;  4OGE A;  1IHV A;  5GAM d;  5GAM g;  2LCS A;  2CZ1 B;  5KYN A;  2FZG B;  2IIM A;  4M75 A;  3RES A;  2LZ6 B;  1N6A A;  2FPF A;  3OYL A;  3QJ6 A;  2CUB A;  2RHY A;  4J9C A;  3BY7 A;  3QHS A;  4M78 A;  2L2P A;  2DYB A;  1UE9 A;  2R57 A;  1OUL A;  2ENM A;  4R55 A;  4QQ6 A;  1PG5 B;  4C8Q G;  3BDU A;  1N9S A;  1WPY A;  1D1A A;  2DTH A;  4BB7 A;  1K4U S;  1Y07 A;  4KUD K;  3JSC A;  2O88 A;  2QXF A;  1KJW A;  2K9G A;  4M78 E;  3RDV A;  5FU7 B;  2CP6 A;  2RQV A;  1KSW A;  3A8G B;  3V8L A;  3JB9 G;  2RK1 A;  2LQ8 A;  3G4S T;  1BCO A;  3BFM A;  1WA7 A;  2DA9 A;  2PQW A;  2DJZ A;  1X6G A;  3CCQ T;  1YBY A;  2NUZ A;  1VQ8 A;  2NUP B;  3H0F A;  2J7I A;  4ELZ C;  2CS7 A;  2FG0 A;  5I2S A;  1JB0 E;  3DB3 A;  4XU3 A;  1TXQ A;  2RHX A;  2AHJ B;  4FW2 A;  2ZAE A;  3OYA A;  3S3O A;  2JTM A;  4UC4 A;  4DA4 A;  2HBP A;  2D8J A;  5IH2 A;  1VQN Q;  4M7A B;  1I5O B;  4M77 B;  1QWF A;  4XTY A;  4EMG A;  1S72 Q;  1WHJ A;  2EGA A;  1SG5 A;  4J8O A;  4Z88 A;  1CKA A;  2E6Z A;  1QVP A;  2DJQ A;  4ZGJ B;  1T3L A;  1QW1 A;  5CKB A;  5CKF A;  3QG1 A;  2KVQ G;  4ESR A;  2K3X A;  1ZBX A;  1WHL A;  3VYH B;  2DEQ A;  3CCM A;  2DL7 A;  3I5R A;  1N27 A;  2YT6 A;  4ANJ A;  1ACM B;  1C1A A;  1RL2 A;  3QPH A;  3S3N A;  1M90 R;  2LC4 A;  1GFD A;  2XMF A;  4M7A G;  3H0H A;  4M77 G;  1VQ5 T;  1QVF P;  2GTO A;  4Q5W A;  3BE3 A;  1Z9Q A;  5FRM A;  1VYT A;  4AT1 B;  4OB2 B;  4X9D A;  3M0T A;  1YIJ A;  3OY9 A;  4M75 B;  2E5K A;  2CZ0 B;  3QII A;  2BKD N;  3E19 A;  5FLX E;  2A28 A;  3C95 A;  4BI4 A;  2VWF A;  5EG2 A;  1SF9 A;  2JTF A;  5KE2 A;  2J05 A;  4CC7 A;  3ZFJ A;  3CC2 Q;  2SRC A;  2OTL A;  1G3T A;  3JB9 J;  2DK3 A;  1X6B A;  3EGD A;  5CKD A;  3I9Q A;  4J7F A;  2V8K A;  1VQ4 A;  3CXC S;  4J6Y A;  1VQ8 Q;  3HFN A;  4KGX B;  2KXD A;  3CD6 A;  1M8V A;  1HXD A;  2GFU A;  2ZPG B;  2CDT A;  2FZK B;  2KYM A;  2EVR A;  3CME T;  2C06 A;  2LX9 A;  3CCV A;  2K4Y A;  4M75 G;  4OMP A;  2EPD A;  2YLC A;  4C0F A;  4CI0 C;  4DBF A;  1HD3 A;  3R6N A;  2A36 A;  4PJO E;  3DB4 A;  1PC0 A;  3H0I A;  1LNX A;  4DBH A;  1HSQ A;  1YWO A;  3CCR A;  2JXB A;  3M4Y A;  2Y90 A;  1V1C A;  2SEM A;  1UJ0 A;  3A8H B;  4HVV A;  1ABO A;  3EGU A;  2VVK A;  1PWT A;  2EBP A;  1OPL A;  4Y91 A;  3CQT A;  1Q81 C;  1TWB A;  1E7O A;  4PK4 A;  1WDX A;  2JTE A;  2V1R A;  1WX6 A;  3OYY A;  7AT1 B;  3JV3 A;  2QQB A;  4FYX B;  4M7D A;  3GP8 A;  2L8D A;  1VQK T;  1MUZ A;  1NBE B;  4Y92 A;  5I2M A;  2QEX Q;  4A4E A;  5GAN f;  5FU6 B;  2RF0 A;  3GOX A;  2KQW A;  3I56 A;  1YIJ Q;  4JRI A;  1CSK A;  2MK5 A;  3CCL A;  1TS9 A;  4E2F B;  4M7D E;  3JCM P;  1WHH A;  2K3Y A;  1X2Q A;  1Q81 U;  1YJN A;  4OGC A;  3A8M B;  2OTL Q;  2J6F A;  5GAM h;  5GAN 2;  5FWC A;  4BE2 A;  1AWX A;  5L23 A;  2F69 A;  3TSW A;  2G3R A;  4JZ3 A;  2EQU A;  1K9M R;  1Z9Z A;  1JBM A;  4LN2 A;  4GY5 A;  1R0B G;  3TQ7 P;  4KUI A;  4E7Z A;  4X9C A;  5LJ3 j;  3WVE B;  3CCV Q;  3EGD B;  3VKI A;  1M1K R;  2O2O A;  3A5Z B;  2RI3 A;  2DET A;  5FWB A;  3C4S A;  3OYD A;  3ZBD A;  4ZGE B;  1YP5 A;  4QVZ A;  2YDL A;  1VQO A;  1TSF A;  2P4T A;  2HQX A;  3CCS T;  3PNW C;  3CMA T;  1N5Z A;  2KBT A;  1AWW A;  3M56 A;  4XU1 A;  3VS6 A;  1QP2 A;  5CK9 A;  4BE1 A;  2DL5 A;  2J6O A;  2IPO B;  1RAB B;  4ZNX A;  4N4G A;  3CPF A;  1WI7 A;  5A2Q E;  1WQ7 A;  4RTT A;  4EIK A;  4BDZ A;  2EWN A;  3JAM E;  2DL3 A;  5LJ5 j;  1OYX A;  1D1B A;  2XIC A;  1C0M A;  1RAI B;  1J3T A;  2DD5 A;  3I56 Q;  1QCF A;  3OYF A;  1WQW A;  1EZZ B;  3CCL Q;  1NYF A;  1RAD B;  5KYU B;  3PE0 A;  2RQW A;  4EPC A;  2LT4 A;  2EQK A;  2LJ0 A;  5GMK m;  1UHC A;  2CT4 A;  1IZ6 A;  4A4F A;  2P0Q A;  1VQ7 A;  4OF1 A;  3A8O B;  1YJN Q;  2FO0 A;  4B9X A;  5HCK A;  5GMK j;  4DBQ A;  3FRN A;  1I07 A;  4HXJ A;  1K73 C;  2DLP A;  3QDF A;  4FT2 A;  4AFU C;  3CC7 T;  4LXC A;  1BI1 A;  4AG1 C;  1WLP B;  4M7A F;  4RCC A;  2YLB A;  4M77 F;  2FRW A;  1BB9 A;  3HPW A;  2E70 A;  5FW9 A;  1FXX A;  2A0F B;  2P84 A;  1WZO A;  2L0A A;  4FM4 B;  4C92 D;  2HL3 A;  1U8R A;  1ZA2 B;  2B86 A;  2L3R A;  3PGG A;  5GAM e;  4BDY A;  3EG0 A;  1VQ9 A;  1G83 A;  4FYW B;  2F2X A;  2CYZ B;  1ABQ A;  1PKT A;  2PUO B;  1NJI R;  2E65 A;  2WSF E;  1K73 U;  3M9Q A;  1G3W A;  4FW1 A;  4J9H A;  3JCM c;  1NZ9 A;  3EG9 B;  1VYU A;  2W0Z A;  2DPP B;  2ZPI B;  4CC4 B;  2K2V A;  4XTX A;  4XQ3 A;  2CUD A;  4IUQ A;  5KYY A;  1D09 B;  2PVO B;  5LJ3 g;  1M4Z A;  4M75 F;  1Y0M A;  3SWN A;  3V7C A;  2RNA A;  3L2W A;  1VQM Q;  1VQP T;  1W6X A;  2ZZD A;  5GAN 5;  2CZ7 B;  3QZ9 B;  3PFS A;  4X1V A;  1YNZ A;  4M78 F;  1RAA B;  1RAH B;  4QVD A;  4F17 A;  2EIF A;  3L2Z A;  1QVG S;  3FDR A;  2PZ1 A;  4CC2 A;  4LDX A;  1UUE A;  4L59 A;  3CPW A;  5I11 A;  1SHF A;  1PRL C;  1MHN A;  4PNO A;  3WXM B;  1WYX A;  1YIT T;  1VQ7 Q;  1BI2 A;  5LL6 S;  1KG1 A;  4D6W A;  4JDS A;  3M0P A;  4PLL A;  2EGC A;  3ME9 A;  2ECZ A;  1D3B A;  4EMK C;  5KYX B;  1OV3 A;  1ARK A;  2QA4 T;  3DLM A;  3JCM W;  4HKE A;  4IIM A;  4C8Q A;  1R77 A;  2K5I A;  1DJ7 B;  2QI2 A;  4J83 A;  2F5K A;  3REA B;  2MIO A;  1ZUU A;  3M59 A;  1M90 C;  4E7K A;  4RTW A;  2NWM A;  4PFO A;  2C0O A;  1BYM A;  5J26 A;  4C8Q E;  1YI2 T;  2A37 A;  2EKO A;  2EW3 A;  1VQ9 Q;  4RTZ A;  3VUB A;  2VUB A;  1IGQ A;  2AKK A;  1NEB A;  2B8A A;  2KEA A;  2ZPF B;  4OML A;  1NLO C;  1OI1 A;  2K5L A;  2FYK A;  2HKN A;  4OMM A;  3UDC A;  2DF6 A;  4AMC A;  2DAQ A;  2VV5 A;  2F1L A;  2RQR A;  1AVZ C;  1N9R A;  2ZCF B;  2PU9 B;  1G3S A;  3TEE A;  2WSE E;  2QTX A;  2QDL A;  4E7H A;  1M90 U;  3I5S A;  1M27 C;  3RBB B;  5KE3 A;  4J5Y A;  1X69 A;  3HTR A;  3OYI A;  4JLG A;  4IUP A;  1BCM A;  3BW1 A;  3EH2 A;  1M1G A;  3LX7 A;  5KYY B;  5CQX A;  4C92 C;  4ELY C;  1KQS A;  5EC7 A;  1AZE A;  1ZUK A;  4EDU A;  1UG1 A;  3SWN B;  3UT1 A;  3EFR A;  4BY6 C;  2G6F X;  4XK8 E;  5I21 A;  2RN8 A;  4F04 B;  2JMC A;  4M4Z A;  2MF2 A;  2LX7 A;  2XDD A;  5GAN 8;  1BIA A;  4GBQ A;  4JRK A;  4Z89 A;  1PD0 A;  4RG8 A;  1TUG B;  2EYW A;  3L2R A;  4PJO D;  4N0A A;  2JM9 A;  3JCM b;  3CCJ T;  4M77 E;  4KGV B;  1G3Y A;  2ZPE B;  3NHN A;  1SPK A;  3LLR A;  1SHG A;  1D3B B;  4N4I A;  3L2Q A;  5KH6 A;  3TSZ A;  1YJ9 T;  4M78 C;  1K76 A;  2LTO A;  1KK7 A;  2DVJ A;  3MET A;  2LQW A;  1AWO A;  4C0Z A;  5GAO l;  3VS3 A;  4A4H A;  9ATC B;  3EHQ A;  3JCM f;  4X34 A;  2XI9 A;  3UAT A;  1AWJ A;  2XDP A;  4XAX B;  2V8J A;  1QCO A;  4RTX A;  1N8R C;  4LUD A;  2L5Q A;  2F2V A;  2JVV A;  4KH0 B;  1B34 B;  1I4K 1;  4II1 A;  4ZTJ A;  3OSV A;  2HNI A;  5A0L A;  2YUP A;  4HVW A;  1M3C A;  3QXE B;  4RCB A;  3OA6 A;  4FU6 A;  2F5T X;  4V2S A;  1QKX A;  1V29 B;  1WHG A;  4M75 E;  1KC8 C;  4PJL A;  1NPP A;  2EAY A;  2F2W A;  4M7D F;  1QVF S;  3WVD B;  4FYV B;  1A0N B;  1XOV A;  3CCE T;  3LWH A;  4PKC C;  5D7U A;  2CP0 A;  1AD5 A;  2HQE A;  1TU0 B;  3VRZ A;  1N8R U;  1RLP C;  5J3B A;  3REB B;  4C0D B;  1GRI A;  1Q7Y R;  4HCC A;  1GXI E;  3CC2 A;  3QYH B;  4KRT A;  4LD9 K;  3GNF B;  1AZG B;  3CPW S;  5GAM f;  1ZA1 B;  1NEG A;  3Q1J A;  1VQ5 A;  2BE7 D;  2HZY A;  2COW A;  5GAN j;  1TUD A;  1RAG B;  1WXT A;  4C5I A;  4FL6 A;  1KC8 U;  2P0P A;  2YRD A;  5LJ3 h;  3VS7 A;  3C0C A;  1BI3 A;  1UGP B;  1LVK A;  4OMF B;  1JRI A;  1TUC A;  3I35 A;  1D1C A;  1HK9 A;  3OSS C;  3GNG A;  2EFI A;  3HFO A;  1EFN A;  2CSI A;  3G4S Q;  1OU8 A;  1SKU B;  2RHI A;  3NGP A;  4LDW A;  3CCQ Q;  2CZ6 B;  3X26 B;  4HT9 A;  3OMG A;  3OBY A;  4FSS A;  2CH4 A;  3VJP A;  2HKQ B;  1JXO A;  1TH7 A;  1YJW T;  1VIE A;  4J9F A;  3QJY A;  3RIR A;  3PMI A;  1X2K A;  3H8Z A;  1OPK A;  2L3P A;  2MWP A;  2VGN A;  3SB2 A;  2D1X A;  1ZSG A;  2CSQ A;  1PRM C;  2Y4X A;  2QEX A;  4FYY B;  5DLO A;  5LJ5 h;  2X35 A;  3MP1 A;  4MDW A;  4J6X A;  4RKU E;  2FRY A;  2O31 A;  4PJO C;  2YSQ A;  2LDM A;  2AKL A;  1BBZ A;  3CPW P;  3QUI A;  1H3H A;  3M0R A;  4KUL A;  3LGL A;  4NS5 A;  1P92 A;  3A98 A;  3QDR B;  3PIP A;  1IO6 A;  3RMS A;  2FVU A;  3J7A F;  3JB9 H;  2DVE A;  1VQK A;  2XKO C;  1VQ5 Q;  2EQM A;  3DKM A;  1FX7 A;  1K9A A;  4JRP A;  1K8A R;  5I22 A;  2V26 A;  3L42 A;  1UFF A;  4A4G A;  3L2U A;  1I1J A;  2K5F A;  1CKB A;  1AHJ B;  2HEQ A;  1MMD A;  1NE8 A;  3L2V A;  2KSS A;  4M7D C;  1UGS B;  2H3J A;  3E9F A;  2KT8 A;  1RI9 A;  3OBW A;  3CCM T;  3MP6 A;  2E1H A;  2M9U A;  1XJW B;  2LQK A;  3CME Q;  2EKH A;  2DNU A;  2Y4Y A;  3RER A;  2EJF A;  2L3Q A;  1G5V A;  2PTK A;  4K11 A;  1R0C B;  2AK5 A;  2BZX A;  2V8I A;  4A53 A;  2DXU A;  4BI8 B;  1C6V X;  5KYU A;  5FRO A;  2MYS A;  1Y96 A;  4OMN A;  1KD1 R;  2D6F A;  5L8R E;  2DBK A;  2C0T A;  2GNC A;  2QK0 A;  1ZQ1 A;  3OQ5 A;  1Q82 C;  3JRZ A;  3VV0 A;  2GQI A;  3CCS A;  3CMA A;  1OX8 A;  3TVT A;  2RHZ A;  1FMW A;  1PSF A;  2OTJ T;  4RUG A;  1KQS P;  1JJ2 A;  1W70 A;  5D6X A;  2DIQ A;  3CCU T;  2EQI A;  3BDL A;  1VQ4 T;  1VQK Q;  1GBR A;  4XU0 A;  2RD1 A;  4LDY A;  3CD6 T;  2QDY B;  2JJ9 A;  3O5Z A;  1SSF A;  4OVA A;  1Q82 U;  1NM7 A;  3OYM A;  4HT8 A;  4E6R A;  2CGH A;  1BK2 A;  3EG9 A;  4C8Q F;  3URG A;  3QO3 A;  4QQD A;  1JO8 A;  3CCR T;  1W2B P;  3O8V A;  1IXD A;  2GTJ A;  2YUQ A;  5GJV B;  4QW2 A;  3A8L B;  3CC7 A;  4JRQ A;  1M3A A;  3JB9 F;  4OB3 B;  3CBP A;  3FEO A;  2KE9 A;  2M0Y A;  4RG2 A;  3LW5 E;  4JJB A;  1NYG A;  1OQK A;  3LYI A;  2QGF B;  1W4S A;  4LDU A;  5FRN A;  4MZM A;  1MMG A;  1KHI A;  1Q86 R;  2RO0 A;  3G7Z A;  2CT3 A;  2KY9 A;  2CP2 A;  1M1F A;  2MAM A;  4ZN3 A;  2COZ A;  1VQM A;  3VS0 A;  1Y57 A;  2RK2 A;  5GAN 3;  2YHT A;  4DBR A;  2VYT A;  2RA2 A;  3MEA A;  2RM4 A;  2LMJ A;  3EGX A;  3CCS Q;  3CMA Q;  3QYG B;  2RJE A;  4MML A;  2EJ9 A;  4R0K A;  2LQN A;  5KYX A;  3OW2 A;  1BKB A;  1Y96 B;  2QQR A;  3NPF A;  1M5Q 1;  2NUT A;  3PT9 A;  2A7Y A;  3LGF A;  2QG9 B;  2XG8 D;  1GCQ C;  3EAE A;  2J6K A;  4RTY A;  1QLY A;  3UPU A;  2DIL A;  3M4G A;  1F1B B;  4NL3 A;  1VIF A;  3LWI A;  3FC3 A;  4M7A D;  1T0H A;  4M77 D;  5GAN 6;  1OOT A;  3VS4 A;  1BU1 A;  1WJS A;  3V7S A;  2VB6 A;  3M0U A;  4AG2 C;  2EYY A;  2W10 A;  1RI0 A;  3J81 E;  1YHQ T;  3M5A A;  4BAC A;  3C94 A;  5M9O A;  1OZ3 A;  1VQO T;  2LP5 A;  3OMC A;  1IRE B;  1LJO A;  2MMP A;  2QA4 A;  4E7L A;  1UHF A;  3RKX A;  3CC7 Q;  2DRM A;  5GAN 4;  3G71 T;  4C5G A;  3T9N A;  3HRS A;  4OP0 A;  3MCA B;  3EG2 A;  1W1F A;  2HCK A;  2LNV A;  4OMQ A;  2DE0 X;  4M75 D;  2E10 A;  1YI2 A;  2ESW A;  1I81 A;  1I5L A;  1MV3 A;  5LJ3 d;  2JMA A;  2FB7 A;  4ME7 A;  4M78 D;  2ZPH B;  2X51 A;  1M8M A;  2R58 A;  3UF4 A;  1U5S A;  2XU8 A;  4ZTF A;  4JS5 A;  1Y7X A;  2P0K A;  4C8Q C;  1SEM A;  1X43 A;  3JCM X;  2PVD B;  4BI3 A;  1VQL T;  3FJP A;  3THK A;  1IRX A;  5J39 A;  2EYX A;  5GAN h;  3EGX B;  2O4X B;  3VS2 A;  3V7R A;  1VQP Q;  3NTH A;  3I55 T;  2CKK A;  2RHU A;  2IVW A;  1Y71 A;  2LCC A;  2GQV A;  3CC4 T;  1Q81 R;  2XHC A;  3HRU A;  4KBM B;  2CP7 A;  2NUT B;  3AT1 B;  1XTD A;  2ED0 A;  2M02 A;  1D0Z A;  1YCY A;  3M58 A;  2V1Q A;  5LJ5 g;  5LJ5 d;  1ZSZ A;  5CAI A;  5GAM j;  1K0S A;  4LE9 A;  3G6E T;  2D8H A;  1YIT Q;  1XNI A;  1B34 A;  3HRT A;  1M3B A;  2FL7 A;  5FU7 C;  2HSP A;  4B9W A;  1QP3 A;  3MHX A;  4A63 B;  3EG3 A;  2QGG A;  3QSU A;  4OB0 B;  1RLQ C;  2WSC E;  2QA4 Q;  5KYW B;  4B6M A;  2DD4 A;  1ZBJ A;  1PNJ A;  2CP3 A;  4F7U A;  2VXF A;  2DL4 A;  3CCJ A;  1ZUY A;  1FMV A;  1WFW A;  8AT1 B;  2JS0 A;  2X4J A;  1OZ2 A;  2KMT A;  1YJ9 A;  2HSE B;  1MND A;  4EMK A;  1YI2 Q;  1VQ6 T;  2EYQ A;  2HD0 A;  3N5B B;  4J9G A;  4M7A C;  2DTI A;  4M77 C;  3ER0 A;  8ATC B;  2QQ9 A;  2R5A A;  4L5G A;  4J7I A;  2C0I A;  2IG0 A;  1JJ2 P;  1E6G A;  1OX9 A;  1H92 A;  2JUF A;  2KGT A;  1K0X A;  1U1S A;  1UTI A;  3X28 B;  3DLL A;  5KCH A;  2KT1 A;  2DBM A;  3SDZ A;  2EJG A;  3MEW A;  3FJ5 A;  3MKD A;  2DL8 A;  1UJY A;  1RAE B;  2VC8 A;  2R5M A;  4IUV A;  5DM7 R;  3MEV A;  3HKS A;  4FCY A;  4BUG A;  3CCE A;  1H3Z A;  1WXU A;  3OYE A;  3JCM g;  4M75 C;  3X25 B;  4XTZ A;  3CXC A;  2KRO A;  1R8O B;  2I0N A;  2PNI A;  3G4S A;  1D0X A;  3CCQ A;  3P8B B;  2E4H A;  3GBQ A;  1W2B A;  2VXE A;  2RQU A;  1YN8 A;  4QVC A;  1WHM A;  2BUD A;  4C92 A;  3QKJ A;  2KRS A;  3CBO A;  1ZSZ B;  2VGM A;  2BZ8 A;  3EG1 A;  1VA7 A;  5AYF A;  3H6Z A;  3CCJ Q;  3EH1 A;  2A08 A;  2GF7 A;  3KFV A;  2CH4 W;  4QQG A;  2MWO A;  3HP9 A;  4F14 A;  2KDS A;  4IUU A;  3VS1 A;  1K73 R;  2RMO A;  1YJ9 Q;  1RUW A;  2HBW A;  3E2U A;  5DLQ E;  4M7D D;  4O5V A;  4AFZ C;  1K9M C;  1OEB A;  1M2O A;  4F7U B;  1T3S A;  3RNJ A;  1YJW A;  2O9V A;  3OW2 P;  1I0C A;  2K2M A;  2OI3 A;  4HA8 A;  1M1K C;  4EMK B;  2FHD A;  2KRN A;  3EFS A;  2NLU A;  3CEY A;  1KQ1 A;  1G2B A;  1U3O A;  2BIV A;  1NPR A;  4E7S A;  2RJD A;  1GBQ A;  5IHK A;  4Z02 A;  1MV0 B;  4A54 A;  1UGR B;  1K9M U;  1KQ2 A;  2RJC A;  1X27 A;  4F7U G;  5FU6 C;  1TG0 A;  2NYS A;  2YUN A;  3CCE Q;  1VQN T;  1QWE A;  3JCM Q;  5CKH A;  1Q86 C;  2QQA A;  3HL8 A;  4D8D A;  1S72 T;  1M1K U;  1WGS A;  2JZ2 A;  4ZN1 A;  2CP5 A;  3FIF A;  3D7S B;  3H41 A;  3SFM A;  2D0N A;  5A0G A;  5GAO r;  4BE0 A;  2X3W D;  1LPL A;  3HHT B;  4RTV A;  3AHU A;  3CME A;  3S6W A;  3OB9 A;  3RR6 A;  4XU2 A;  3OYC A;  3A1P A;  4J9B A;  1Q86 U;  5GMK l;  2JT4 A;  1WHK A;  3VS5 A;  2OX7 A;  4WF2 A;  2MI6 A;  1FYN A;  2KYB A;  3M55 A;  3OS1 A;  2KK4 A;  2HDA A;  3RKY A;  2X4Y A;  3HSB A;  5CCA A;  2HQH A;  4C92 B;  5ECA A;  2X9H A;  1B07 A;  1WXB A;  3NTI A;  1QMC A;  4LDV A;  4BY6 B;  2FZC B;  2GGR A;  1YJW Q;  1M2V A;  4IKF A;  1V76 A;  3CC2 T;  2DTO A;  3X20 B;  4C0G A;  5GMK i;  4JJC A;  5CKE A;  2OAW A;  3M0Q A;  1ZX6 A;  2BZY A;  1KQS S;  5GMK h;  2YRC A;  1VQ8 T;  2JS2 A;  4J9E A;  1NJI C;  3QWX X;  2A3L A;  1QCN A;  4C92 G;  1G8X A;  2MPX C;  2OTJ A;  2J06 A;  3NFC A;  4M78 B;  5C6S A;  2H8H A;  2ROT A;  4QT7 A;  5A0D A;  2L3S A;  1YCS B;  4R56 A;  1RAC B;  2M51 A;  3CCU A;  1UGQ B;  4KT0 E;  3QBY A;  4PJO A;  3EFO A;  5IHI A;  1NJI U;  4PJJ A;  2DZ9 A;  3KUF A;  1VYV A;  1W2B S;  2PVG B;  4GLM A;  3FB9 A;  1U1T A;  2DKG A;  2LJ3 A;  5LJ3 e;  5GAN d;  1JXM A;  5GAN g;  1UDL A;  2O9S A;  2E64 A;  3X24 B;  4M78 G;  2FEI A;  3NMZ C;  2QTV A;  2VAS A; 
#chains in the Genus database with same CATH homology
 1QLY A;  4OMM A;  2DIL A;  2RQV A;  1KSW A;  2DF6 A;  1T0H A;  2MCN A;  1WA7 A;  2DA9 A;  5IHN A;  2RQR A;  1AVZ C;  4Z8A A;  1X6G A;  1OOT A;  3VS4 A;  2NUZ A;  1BU1 A;  1M30 A;  2J7I A;  2FG0 A;  3H0F A;  3M0U A;  2QDL A;  4AG2 C;  2EYY A;  3I5S A;  1M27 C;  3RBB B;  1JU5 C;  2W10 A;  1X69 A;  4CC3 A;  1PHT A;  1K1Z A;  4LUE A;  2D8J A;  3U23 A;  5IH2 A;  2LP5 A;  1JQQ A;  1ZLM A;  1QWF A;  1UHF A;  5EC7 A;  1AZE A;  2EGA A;  3EHR A;  2DRM A;  1ZUK A;  1UG1 A;  4Z88 A;  1CKA A;  2KR3 A;  2DJQ A;  1T3L A;  3EG2 A;  1W1F A;  2G6F X;  2HCK A;  2RN8 A;  2DRK A;  2ABL A;  2JMC A;  4M4Z A;  2LX7 A;  4ESR A;  4OMQ A;  2DE0 X;  4IIO A;  2DL7 A;  2GBQ A;  3I5R A;  2EGE A;  2YT6 A;  2ESW A;  4GBQ A;  4Z89 A;  1MV3 A;  2JMA A;  2EYW A;  1M8M A;  2JM9 A;  3UF4 A;  1U5S A;  2ED1 A;  1GFD A;  2XMF A;  3H0H A;  3UA6 A;  1UGV A;  3NHN A;  2GTO A;  1SPK A;  1PKS A;  1SEM A;  1Z9Q A;  1KIK A;  1X43 A;  1VYT A;  1SHG A;  3TSZ A;  3M0T A;  3THK A;  1K76 A;  2VKN A;  2E5K A;  2DVJ A;  1GFC A;  2LQW A;  4HVU A;  1AWO A;  3ULR B;  2EYX A;  3VS3 A;  3EHQ A;  2A28 A;  3UAT A;  2VWF A;  1AWJ A;  2J05 A;  4CC7 A;  1YWP A;  4RTX A;  3VS2 A;  4LUD A;  2F2V A;  2SRC A;  1S1N A;  1X6B A;  3VRY A;  3I9Q A;  1AOJ A;  2YUP A;  2DM1 A;  4LNP A;  4HVW A;  2ED0 A;  1M3C A;  2X3X D;  2V1Q A;  2KXD A;  3SHW A;  1QKX A;  1U06 A;  2CDT A;  1K0S A;  4LE9 A;  2KYM A;  2EVR A;  2K6D A;  2D8H A;  5IXB A;  2RPN A;  4OMP A;  1M3B A;  2EPD A;  2F2W A;  2HSP A;  4A63 B;  1A0N B;  1XOV A;  1HD3 A;  3EG3 A;  3R6N A;  1RLQ C;  2A36 A;  1AD5 A;  3H0I A;  3VRZ A;  3QWY A;  1RLP C;  3REB B;  1GRI A;  1ZBJ A;  1HSQ A;  1UEC A;  1NG2 A;  4KRT A;  2FPD A;  1YWO A;  1PNJ A;  1AZG B;  1GL5 A;  2DL4 A;  3IQL A;  1NEG A;  2JXB A;  1ZUY A;  1FMK A;  1V1C A;  1WFW A;  2SEM A;  1UJ0 A;  2JS0 A;  2DX1 A;  4HVV A;  1TUD A;  1ABO A;  3EGU A;  1WXT A;  2VVK A;  1PWT A;  2EBP A;  2OJ2 A;  1OPL A;  1T0J A;  3CQT A;  1E7O A;  1WDX A;  4J9G A;  2JTE A;  2V1R A;  1WX6 A;  3VS7 A;  3C0C A;  3JV3 A;  4ORZ A;  1KFZ A;  1TUC A;  3I35 A;  2C0I A;  1MUZ A;  4Y92 A;  1E6G A;  3PVQ A;  1H92 A;  1EFN A;  2KGT A;  2CSI A;  1K0X A;  1UTI A;  4JPB W;  2RF0 A;  2KT1 A;  3NGP A;  2KNB B;  2DBM A;  3SEM A;  1CSK A;  4FSS A;  2P4R A;  2CH4 A;  3FJ5 A;  1JXO A;  2RQT A;  1X2Q A;  1GCQ A;  2DL8 A;  1UJY A;  2J6F A;  2FPE A;  4J9F A;  5FWC A;  1X2K A;  1AWX A;  1OPK A;  1WXU A;  2L3P A;  4JZ4 A;  5L23 A;  3TSW A;  4JZ3 A;  4D8K A;  2D1X A;  1ZSG A;  4J9I A;  2CSQ A;  1PRM C;  2KRO A;  1Z9Z A;  1LCK A;  2I0N A;  2PNI A;  4LN2 A;  4OMO A;  2FRY A;  2O31 A;  2YSQ A;  5IXF A;  3GBQ A;  2AKL A;  1BBZ A;  1YN8 A;  2O2O A;  2RQU A;  1H3H A;  3M0R A;  5FWB A;  2KRS A;  3A98 A;  2K79 A;  1IO6 A;  1YP5 A;  2MOX A;  2BZ8 A;  3EG1 A;  2YDL A;  1VA7 A;  4DEX A;  5GJW B;  3ZL7 C;  2A08 A;  3KFV A;  2CH4 W;  1N5Z A;  4F14 A;  2JW4 A;  3VS1 A;  2RMO A;  2KBT A;  1JEG A;  1AWW A;  2ROL A;  4DEY A;  1RUW A;  2HBW A;  1K9A A;  3VS6 A;  5I22 A;  2DL5 A;  1UFF A;  4AFZ C;  1OEB A;  2J6O A;  4ZNX A;  1T3S A;  1WI7 A;  3RNJ A;  4RTT A;  4EIK A;  2O9V A;  1I1J A;  1CKB A;  1I0C A;  4AFQ C;  2HEQ A;  2K2M A;  2OI3 A;  4F16 A;  2DL3 A;  1J3T A;  1WIE A;  2KRN A;  2YUO A;  2AZV A;  2JM8 A;  2KT8 A;  1QCF A;  1RI9 A;  2EYZ A;  1G2B A;  1U3O A;  2CRE A;  1NYF A;  1HJD A;  2K3B A;  3PE0 A;  1GBQ A;  2RQW A;  2LNH B;  5IHK A;  1E6H A;  3PVL A;  2LJ0 A;  1UHC A;  1H8K A;  2CT4 A;  2EKH A;  2DNU A;  4WCI A;  2L3Q A;  2PTK A;  1MV0 B;  4K11 A;  2FO0 A;  5HCK A;  2BTT A;  1I07 A;  1X27 A;  2AK5 A;  4HXJ A;  2BZX A;  2DLP A;  1TG0 A;  2YUN A;  4AFS C;  1QWE A;  4OMN A;  4AFU C;  4D8D A;  4AG1 C;  2DBK A;  1SRL A;  1WLP B;  2C0T A;  2GNC A;  2FRW A;  1BB9 A;  2GQI A;  5FW9 A;  2L0A A;  3TVT A;  3H41 A;  2D0N A;  4RUG A;  2X3W D;  2B86 A;  3EG0 A;  1W70 A;  4RTU A;  4RTV A;  1G83 A;  1B3Q A;  3M0S A;  2F2X A;  1GCP A;  1ABQ A;  1PKT A;  2EQI A;  1SSH A;  4J9B A;  4J9H A;  1GBR A;  2JT4 A;  1VYU A;  2W0Z A;  3VS5 A;  3O5Z A;  1FYN A;  4CC4 B;  2KYB A;  2K7A A;  2HDA A;  2KXC A;  2LJ1 A;  5ECA A;  1NM7 A;  1B07 A;  2CUD A;  1WXB A;  2AZS A;  4E6R A;  1NLP C;  1BK2 A;  1Y0M A;  2GGR A;  4JJD A;  2RNA A;  4HCK A;  1W6X A;  1SRM A;  1AEY A;  1JO8 A;  4JJC A;  2OAW A;  1QKW A;  4X1V A;  1YNZ A;  2GTJ A;  3M0Q A;  2YUQ A;  1ZX6 A;  5GJV B;  2BZY A;  4F17 A;  2PZ1 A;  1M3A A;  4CC2 A;  1UUE A;  2JS2 A;  4J9E A;  2KE9 A;  2M0Y A;  4JJB A;  1NYG A;  5I11 A;  1SHF A;  1PRL C;  2DMO A;  3QWX X;  4J9D A;  3LH5 A;  1WYX A;  3UA7 A;  2J06 A;  2KRM A;  3M0P A;  2CT3 A;  2EGC A;  2H8H A;  2ROT A;  2LCS A;  4QT7 A;  2ECZ A;  2L3S A;  1YCS B;  1OV3 A;  1ARK A;  2IIM A;  2LZ6 B;  2M51 A;  4IIM A;  2FPF A;  3VS0 A;  1Y57 A;  2LMJ A;  2CUB A;  4J9C A;  3REA B;  2L2P A;  2MIO A;  1ZUU A;  5IHI A;  2DYB A;  4R0K A;  2LQN A;  4RTW A;  1UE9 A;  2NWM A;  2C0O A;  2ENM A;  1VYV A;  4GLM A;  2A37 A;  2EW3 A;  1K4U S;  3NPF A;  2LJ3 A;  2O88 A;  4RTZ A;  1JXM A;  1UDL A;  2O9S A;  1KJW A;  2AKK A;  1NEB A;  2K9G A;  2KEA A;  2FEI A;  3NMZ C;  4OML A;  1NLO C;  1GCQ C;  2J6K A;  4RTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...