2BTTA

Nmr structure of myo3-sh3 domain from myosin-typei from s. cerevisiae
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOSIN-3 ISOFORM
publication title New approaches to high-throughput structure characterization of SH3 complexes: the example of Myosin-3 and Myosin-5 SH3 domains from S. cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bttA01
2F2VA 2YT6A 1M3BA 2RQWA 1WFWA 4M4ZA 2IIMA 5IH2A 4GBQA 1G2BA 4ESRA 2FPFA 1EFNA 2L3QA 2ENMA 4AG2C 1ZX6A 1WXBA 1Z9ZA 4RTVA 4J9FA 2CDTA 2KR3A 2GTJA 1E7OA 1FYNA 1PKTA 2ED1A 1H8KA 3ULRB 2O31A 2O88A 2EPDA 1JQQA 2JS2A 2KE9A 2MIOA 1GRIA 1K76A 2VKNA 1ABQA 1M30A 2NUZA 3IQLA 2HCKA 2AKKA 2HEQA 2DM1A 1HSQA 2DL7A 4LUDA 4RTXA 4D8DA 4LN2A 1UG1A 1QLYA 2AZVA 5IHNA 1W1FA 3H0HA 2KYBA 1NLOC 2JM8A 2EBPA 5FWCA 2X3WD 3REAB 1NEGA 1UUEA 4J9HA 4QT7A 3EGUA 1W6XA 1T3LA 3PVQA 3H0IA 4LE9A 2VVKA 3NPFA 3NGPA 3A98A 1PNJA 2K3BA 2OJ2A 4FSSA 4RTYA 1AWOA 1QCFA 4OMPA 3H0FA 1UE9A 2LNHB 4AFQC 4F14A 2KROA 1JXOA 3JV3A 4JJDA 3M0RA 3C0CA 1AWJA 2EGEA 2K7AA 4K11A 1QKWA 2RQTA 1PRLC 2NWMA 2YUNA 1UGVA 4ZNXA 2QDLA 3EG1A 5EC7A 3NMZC 2RMOA 5IHIA 2KGTA 1HD3A 1X2KA 1LCKA 4ORZA 1TG0A 1WI7A 3UF4A 1X43A 2CH4W 2CH4A 3M0QA 2P4RA 1OOTA 1RUWA 1V1CA 1JXMA 1GBRA 2RPNA 4J9BA 3I5RA 1X27A 1JO8A 2ABLA 1A0NB 2DNUA 2K79A 2OAWA 3VS0A 2JS0A 2DL4A 1OPKA 2CREA 1JEGA 3PVLA 1W70A 1GFDA 2AK5A 4Z89A 4JZ3A 2PNIA 1YN8A 1IO6A 4OMOA 1WXTA 2HBWA 1GCQC 2O2OA 1T0JA 2FPEA 5FW9A 2DL8A 2EYYA 2RQUA 4HCKA 1ARKA 1UHCA 4OMLA 1I0CA 4R0KA 1QKXA 3REBB 4J9DA 4F17A 2A37A 2KT1A 1G83A 2DX1A 2DBMA 1AD5A 2DA9A 4AFZC 1UECA 2K9GA 1CKAA 3M0SA 3U23A 1GCQA 3VS2A 1SHGA 2BZ8A 1H92A 3EG2A 1T0HA 3CQTA 2FPDA 1X6GA 2ROLA 5HCKA 1WXUA 2YDLA 2DL5A 2YUOA 2KBTA 1YWPA 1UFFA 1QWEA 2HSPA 2RF0A 2JTEA 2SEMA 4D8KA 1AZGB 2SRCA 3I35A 2JMAA 1SEMA 2M51A 1CKBA 4LNPA 2V1QA 2G6FX 2LP5A 5I11A 4RTZA 1UJ0A 1UJYA 2W0ZA 2ED0A 1NYFA 1PHTA 2K6DA 4F16A 1ZLMA 2ECZA 3THKA 2EQIA 1AVZC 2OI3A 3R6NA 2B86A 2E5KA 4RTTA 2GNCA 1M8MA 2DYBA 5FWBA 2L0AA 2J6OA 2JMCA 1BBZA 1K4US 2A28A 2GBQA 1M3AA 4IIMA 1UDLA 1PRMC 2DMOA 4CC7A 1MUZA 2KRSA 2RQRA 4Y92A 2CSIA 1WLPB 1SRMA 3KFVA 1U5SA 1YCSB 3EHQA 3RNJA 3VS6A 4GLMA 1E6GA 1H3HA 1WA7A 2RNAA 4WCIA 1WYXA 1ZUUA 4J9CA 3UATA 3ZL7C 5GJWB 3VRYA 2KT8A 1B07A 2LX7A 5L23A 1AWXA 1S1NA 4KRTA 2CT3A 2LZ6B 4JPBW 2KRMA 3TSWA 1NG2A 2GTOA 1SPKA 2GQIA 2ROTA 4CC4B 4HVWA 4Z88A 1K1ZA 3I9QA 2D0NA 2DRKA 3UA6A 2LJ0A 3EG3A 2YSQA 1NM7A 2A08A 1XOVA 1RLPC 4OMNA 1KJWA 4RUGA 5ECAA 1OEBA 2JM9A 2C0OA 1KSWA 4DEXA 2EGCA 1UHFA 1SRLA 3EG0A 2J7IA 1B3QA 1GBQA 4LUEA 1ZSGA 2JXBA 1ZUYA 2YUQA 2EW3A 3SHWA 1U3OA 2I0NA 2FRWA 2PZ1A 1X6BA 2FEIA 2FRYA 4J9IA 4EIKA 1WDXA 4HXJA 4J9GA 1BB9A 2AKLA 2GGRA 2KRNA 2MOXA 3TVTA 3M0PA 4HVUA 5IHKA 2RN8A 2W10A 1VYVA 4OMQA 1AZEA 4AFSC 2A36A 1TUCA 1CSKA 3QWXX 2FO0A 2J6KA 1YNZA 1K9AA 1UTIA 1Y57A 4AFUC 2D1XA 1X69A 2CUDA 4DEYA 1M27C 2LMJA 3VS7A 2DLPA 1AEYA 3UA7A 2L3PA 2O9SA 3VS5A 2DBKA 3VS1A 3PE0A 1GFCA 2LQNA 2LCSA 1X2QA 1WX6A 4X1VA 1ZUKA 3M0UA 2L3SA 5IXFA 1AWWA 1VYUA 2HDAA 2CT4A 2EYWA 1MV3A 2J6FA 2RQVA 1M3CA 2VWFA 4CC3A 2DE0X 4HVVA 2KNBB 3LH5A 1WIEA 1TUDA 2JT4A 5IXBA 2LQWA 2O9VA 1I07A 1PWTA 1BU1A 3I5SA 2LJ1A 3RBBB 2M0YA 2EVRA 2FG0A 2BZYA 2EYXA 4J9EA 3SEMA 1SSHA 5GJVB 1YWOA 2V1RA 2EYZA 2XMFA 1I1JA 1Y0MA 1J3TA 4OMMA 1K0SA 2H8HA 4JZ4A 4CC2A 2LJ3A 2ESWA 1RI9A 2CSQA 4E6RA 4AG1C 1QWFA 1MV0B 2KXCA 2MCNA 4A63B 3TSZA 2AZSA 2X3XD 1VA7A 4JJBA 3EHRA 2DF6A 1JU5C 2KXDA 4Z8AA 2EKHA 2K2MA 3NHNA 1NYGA 1YP5A 1BK2A 2C0IA 3FJ5A 1NLPC 1AOJA 2KYMA 2DJQA 2F2XA 1GL5A 1K0XA 2J06A 2DVJA 2PTKA 1KFZA 2DL3A 1RLQC 2DILA 3VRZA 3QWYA 2J05A 2BZXA 1T3SA 1NEBA 2D8HA 3GBQA 1PKSA 1SHFA 1OPLA 4JJCA 1U06A 4RTUA 1VYTA 3H41A 1Z9QA 2KEAA 3O5ZA 1ZBJA 2DRMA 2CUBA 1ABOA 1E6HA 3VS3A 2BTTA 4RTWA 2L2PA 3VS4A 2F2WA 1KIKA 2D8JA 1N5ZA 2EGAA 1HJDA 2JW4A 2C0TA 5I22A 2YUPA 4IIOA 1FMKA 1OV3A 1GCPA 3M0TA
chains in the Genus database with same CATH superfamily
2DPPB 2RI3A 2F2VA 1WHMA 1M3BA 2RQWA 2E70A 4FU6A 4F7UE 2P0QA 3RIRA 1N8RC 4ESRA 2KVQG 4AG2C 1YJWQ 1WXBA 4KGXB 3ASKA 4J9FA 3HSBA 2I2LA 3DB4A 3PTAA 1PKTA 3QZ5B 4O6JA 5GAOm 3EAEA 1VQ5T 4C5IA 2YXYA 3HFOA 1JQQA 2JS2A 3OSSC 5GANj 1NJIC 4M7AC 4QW2A 1G3YA 2HEQA 1G8XA 1HSQA 3CMAQ 3QDRB 4PFOA 1VQ9A 2E12A 4M77A 4Z02A 4LN2A 1UG1A 3RERA 2QGFB 1OQKA 1C0MA 1W1FA 2KYBA 3M55A 3M53A 2EBPA 4M77E 1QVPA 3HP9A 2DKGA 1QVGA 1UUEA 1KD1R 3CXCP 3CPWP 4FW2A 1W6XA 5L8RE 5GMKl 1TH7A 3PVQA 3H0IA 1I5OB 1PCXA 2VVKA 2DZ9A 3NPFA 3NGPA 3EFRA 2M16A 4FSSA 1QCFA 2CP0A 4X34A 1UE9A 4JJDA 2HL5C 3E1SA 1AWJA 2EGEA 2E6ZA 3H8ZA 3HKSA 4ZNXA 1VQOQ 4E7JA 1P92A 3LGFA 3EG1A 3CCLQ 5EC7A 2C06A 2HBPA 3TEEA 3OSVA 4MDWA 2KGTA 4J6XA 1VOMA 4ORZA 1VQ6T 1TG0A 4IUQA 3MEUA 5KH6A 1X43A 3V7CA 2CH4W 1BI3A 1IRXA 2P4RA 1WQ7A 2RPNA 4E7KA 5KYWA 3JB9D 3MP1A 5DY9A 4O5VA 2RK2A 2OAWA 3NTIA 1OI1A 5D7UA 5I21A 3OS1A 3VUZA 2R57A 3CBPA 1K9MC 2CREA 1K8AU 5J39A 3CCVA 3I55A 2GFAA 1M1KR 3CCUQ 2AHJB 1S72Q 4EMKA 1IO6A 4OMOA 5LJ5g 2L3RA 2FPEA 4KULA 2AIRB 1JBMA 1ARKA 4OMLA 5LJ5d 3REBB 3CCVT 3JB9H 3I55T 4J9DA 5GMKj 3WVEB 2A37A 3HTRA 2V8IA 1OU8A 4ZGEB 1TU0B 2QA4Q 3OY9A 1PSFA 1UECA 1CKAA 1IREB 2LCLA 2OTLT 3EG2A 2FPDA 5CKDA 1WXUA 4BI8B 2G3RA 2KBTA 1YWPA 5CVIA 3M59A 1PC0A 4C5GA 2YLCA 3QUIA 3CC4T 1D1BA 2V8KA 2JMAA 3JCMc 4FW1A 5GMKm 1CKBA 2QTVA 4M7DG 4HKEA 1YJWA 1FWZA 4XU3A 2XU8A 5LJ3e 4MZTA 2ED0A 1ZLMA 5CKEA 4PJOF 4PJOG 1UGRB 3MHXA 2X4XA 5FRNA 4DA4A 3L2QA 4M7DB 3ZBDA 1YJWT 4F04B 4MMLA 2J6OA 3M9QA 4JLGA 3CMAA 3DB3A 1M9SA 4A53A 1MUZA 4Y92A 1PD1A 1SRMA 4PJOB 4A4HA 1YCSB 1IZ6A 3CC7A 2CYZB 5KCOA 3UATA 1VQMQ 1B07A 3TREA 3OYYA 1S1NA 4J5YA 3CXCS 3CPWS 1R0CB 4JPBW 2NLUA 5GANe 9ATCB 5KYYB 4Z88A 1K1ZA 3LGLA 3UA6A 4ATOA 4FYXB 2RK1A 2YSQA 2A08A 2LNVA 2FB7A 3EGXA 2JM9A 4PJOC 1U1TA 1OZ2A 1LOJA 2EGCA 1UHFA 1SRLA 4L59A 2J7IA 4XTVA 1RAIB 2KMTA 1VQOA 2FVUA 2YUQA 3OYIA 2EQMA 3L42A 3M4GA 2PZ1A 4C8QA 1X6BA 2E3HA 3CCLA 2CP3A 4J9IA 1BB9A 2YRDA 2AKLA 3EG9B 2JTMA 4C8QE 4HVUA 2HKNA 5IHKA 1VQLA 1VQOT 2W10A 4OMQA 3FIFA 4FT2A 3JSCA 2A36A 3QG1A 1CSKA 4OB3B 3LWHA 2RO0A 1YNZA 3CCLT 3JCMJ 1YHQA 3SWNB 4DEYA 2CS7A 1M2OA 3L1AA 3QYHB 2HQEA 4JUVA 3VS5A 3VS1A 1Q7YU 1BIAA 3PE0A 1W2BP 1WX6A 1ZUKA 1XNIA 3WVDB 3CCUA 1VYUA 1Y71A 1S72A 4M77D 1MV3A 2J6FA 2RQVA 3O8VA 3CCEQ 3LH5A 2VGNA 2F5TX 2JT4A 2GCXA 2ZPHB 5GAOq 3CCUT 3I5SA 2LJ1A 2RJCA 2FZGB 1S72T 2M0YA 3Q1JA 1RAEB 2QA4A 2MAMA 2EYXA 3SEMA 1SSHA 1QCOA 3D7SB 3JB9J 1M1GA 3J80E 1I1JA 3V8JA 1VQ4A 2LVMA 2LQ8A 4JZ4A 5GAOp 3FDRA 5KYUA 2QA4T 4E2FB 1RI9A 2CSQA 1Q81U 1NJIR 1MNDA 2K3YA 3CCRQ 3PMIA 4X9CA 5GANg 2NUPB 2AZSA 3TSZA 1Y96B 4NL2A 4BI3A 2DTHA 2KXDA 2K2MA 4M78F 3HPWA 3C94A 4M78G 2BE7D 1NYGA 1BK2A 1MMNA 1NLPC 1AOJA 2KYMA 1RAHB 1XJWB 3EH1A 4BDZA 2R5MA 4KH1B 3M54A 5A0DA 1K0XA 1D1CA 1RAGB 2DL3A 1RLQC 2DILA 4KH0B 4RCCA 2Y90A 3VRZA 4XTWA 4YTLA 2X4WA 3SFMA 1YJNQ 4M78B 3SD4A 2LQKA 2L8DA 2JN0A 4RTUA 3PMTA 4KUIA 2QDYB 4BUGA 5CK9A 3O5ZA 4N0AA 2WSEE 1ZBJA 3OYCA 2CUBA 2F1LA 2IVWA 4JRQA 3OYLA 1Y07A 3KBGA 2C0TA 2YUPA 3OS2A 3M0TA 4ANJA 3H6ZA 1VQMT 3JCMe 2BUDA 4M4ZA 4M78C 5IH2A 4GBQA 4FM4B 1I5LA 1EFNA 1OX8A 1VQ8Q 2L3QA 2ENMA 1Z9ZA 4RTVA 2EFIA 2DJZA 3ULRB 1D3BA 1HK9A 3M56A 3JCMb 1JJ2P 1ABQA 3IQLA 1VQKQ 5KYXB 5J3BA 3OW2P 2DM1A 2E64A 3FRNA 5D6WA 5CO7A 1WNLA 3TQ7P 4D8DA 1RACB 3RMQA 1ZBXA 2AZVA 5CCAA 1K8AR 3VYHB 2NUTA 2VV5A 1C1AA 1NLOC 2JM8A 3JB9G 1W2BS 4LDXA 1NEGA 4M7AA 5KCHA 1Q86U 4QT7A 4BD3A 3CXCA 3CPWA 1VQNA 4QKUA 3CC2A 1T3LA 3LH0A 4LE9A 1B34B 4M7AE 3WXMB 3LLRA 5LJ3f 3EFOB 4OMPA 2LNHB 2YHTA 3MKDA 2KROA 1ZA2B 5CKFA 3LWIA 3M0RA 1FXXA 3QJ6A 3T9NA 3CCET 1VQPA 1UGVA 5IAYA 1FX7A 3CMEA 1BYMA 2QDLA 1TXQA 3EGDA 1MHNA 3NMZC 2RMOA 5IHIA 1X2KA 1LCKA 3OYKA 3MPUB 3RUXA 1XQHA 2HNIA 2K5FA 3CCRA 2CZ6B 1RUWA 1V1CA 1JXMA 2ATCB 4J9BA 1YI2Q 4PJJA 4C8QD 1JO8A 5LJ3j 2DNUA 2KSSA 5GANf 5GAMh 3CPFA 1N8RU 2XG8D 4M75F 4M75G 1OPKA 2HAXA 1JEGA 1W70A 3CCRT 1TWBA 3MEAA 4OB1B 3MCAB 2VXFA 2ZPGB 3OMGA 1VQ5A 1WXTA 1PD0A 2HBWA 1GCQC 2AT1B 2EAYA 4WF2A 2EYYA 4M75B 2RQUA 2QGGA 1UHCA 1I0CA 1NJIU 1QKXA 1G83A 2FYKA 4J7FA 2FL7A 2R5AA 1YIJQ 3BE3A 3GLXA 3GOXA 1KC8C 4TVRA 1YJNT 4AFZC 2K9GA 3MP6A 1SHGA 1H92A 2VYTA 3PFSA 3BDUA 1X6GA 2YDLA 2YUOA 4JJNK 1QVFP 2XDPA 4MZPA 1M4ZA 2SEMA 4M75C 4D8KA 1B7TA 4LNPA 2LP5A 3BDLA 5I11A 3C95A 3R6OA 1UJ0A 2W0ZA 2KDSA 1PHTA 4FL6A 4F16A 3OYEA 2P0PA 1YFNA 5I2MA 5FU6B 2OI3A 4XTZA 2MI6A 1BI0A 2RI5A 4JRPA 4ZTJA 4F7UG 2B86A 1VQ8T 2HD0A 1JJ2S 2GNCA 4C5HA 3OYAA 2DO3A 5LL6S 2DYBA 2LCCA 2ZPIB 4BE2A 1K4US 3TCJA 1M3AA 4OB0B 3OW2S 4NS5A 3HHTB 2XD0A 1PRMC 3GNGA 4DBFA 2RHYA 2MPXC 4LD6A 1VQ6A 2RQRA 1X6OA 1WLPB 3CD6Q 1Q7YR 4F7UB 3RNJA 3VS6A 1E6GA 2DIQA 2RNAA 5C0MA 1VQKT 1N9SA 5CQXA 3ZL7C 5GJWB 3VRYA 5L23A 4B9WA 5FU6C 4E47A 4C92F 2CT3A 2QYZA 3CCJQ 4E7HA 2LZ6B 4C92G 2RJDA 1K9MU 1NG2A 1UEBA 1Q82C 1D0YA 2GTOA 1NZ9A 2GQIA 1RADB 2D0NA 3I9QA 1SSFA 1JB0E 2PUKB 1RI0A 2ZCFB 1NM7A 1XOVA 1NBEB 1RLPC 1IB8A 1WQWA 1KJWA 1OEBA 2C0OA 4DEXA 4C92B 4OB2B 3EG0A 4AMCA 2QTXA 4RG2A 4LUEA 3MEVA 1ZUYA 4QQGA 1QCNA 3SHWA 1ZSZB 2I0NA 1R77A 2LTOA 2M9UA 1K73C 2YRCA 2COZA 1Q81R 1WDXA 3BFMA 4J9GA 1G5VA 1IHWA 5HK0A 3KUFA 3OYHA 2RHXA 2LT4A 2KRNA 2KK4A 4PJOA 2OTLA 2HL3A 2RD1A 3LX7A 1AZEA 4AFSC 1TUCA 4AT1B 2MYSA 4J6WA 1YI2A 4N4HA 1K9AA 3A8LB 1UTIA 2KAFA 4PJOE 4C92C 1Y7XA 3JAME 3CC4A 1X69A 2CUDA 2LMJA 5DLQE 2EKOA 5LJ5h 3UA7A 2EJ9A 2L3PA 2DBKA 1WHJA 3BW1A 3HRSA 1GFCA 2IPOB 2LCSA 1X2QA 1LJOA 4ZGDB 4QVZA 1ZSZC 3G6EQ 4C0ZA 3M0UA 2L3SA 3JCMf 2D9TA 3ER0A 1YI2T 2HDAA 4KUDK 2EYWA 3OS5A 3HRUA 1BI2A 4M7DF 2DE0X 4HVVA 1WIEA 4JS5A 1KQSP 1TUDA 4FT4A 3PIPA 1X75C 4M7AD 4C0FA 1R8OB 4HCCA 1PM3A 2CP2A 1M8VA 3OYBA 4J9EA 2GF7A 5GJVB 1YWOA 5KYWB 2XMFA 3EG9A 3DKMA 2HZYA 2RA2A 4OMMA 2DTOA 4J83A 4LXCA 1GXIE 3X25B 3EFSA 1YIJT 1QVFS 2O01E 2DETA 4NOYA 4DBRA 2ESWA 4E6RA 3JCMW 3KXTA 1QWFA 5FRMA 3MP8A 3OYFA 5CQYA 1O75A 4ZN1A 4Q5WA 1VA7A 3EHRA 2P84A 3CCMQ 3NHNA 1TOVA 1G3WA 3FJ5A 4M7DC 3UPUA 1GL5A 3S3MA 2J06A 3G4SQ 4DBHA 2QASA 1YCYA 4ELYC 1M90C 1T3SA 5A0LA 1PKSA 2RHZA 1OPLA 3CD6A 4Y28E 4JJCA 1U06A 4DBQA 2RH2A 3OQ5A 2E1HA 3H41A 4UC4A 1Q86R 2FZKB 4XQ3A 2QQ9A 2Y4XA 3INZA 3S6WA 2DRMA 3VS3A 3JB9I 3A8HB 4E7SA 2X51A 4RTWA 5CKHA 1ZHIA 2F2WA 1KIKA 4OGEA 2DXUA 2JW4A 1YITQ 5I22A 3CD6T 2F69A 1OV3A 1M2VB 3RKXA 3FB9A 3EH2A 2IIMA 2MMPA 2YWWA 3CCJT 2FPFA 4OMFB 2VB6A 1ZX6A 2VXEA 5GMKi 1G3TA 2KR3A 4E7LA 3OA6A 5LJ3g 2L89A 4JDSA 1TUGB 1KD1C 2KE9A 3M57A 2MIOA 1K76A 2VKNA 4M78A 5AYFA 2NUZA 5LJ3d 2HCKA 2HQHA 3AHUA 2X4YA 2CZ0B 2PQWA 5IT9E 5A0GA 3OW2A 2MK5A 4M78E 1N8RR 5AT1B 3SWNC 4ZTFA 2M02A 1QLYA 1HYOA 3OYDA 5IHNA 4LDVA 3UT1A 2X3WD 4C8QG 3G6EA 3GF5A 4JLIA 3EGXB 3EGUA 2MWPA 1OU9A 5C6SA 3OBYA 3A98A 3QPHA 4B6MA 2K3BA 2OJ2A 4J8OA 1KQSS 4RTYA 1AWOA 2H3EB 5FLXE 3G6ET 2DK3A 4AFQC 2BE9B 4C8QB 1TSFA 2JUFA 5CAIA 5GANd 2K7AA 4DQ2A 1QKWA 2RQTA 3S3OA 3SDZA 1PRLC 3RKWA 2YUNA 4EMGA 1BI1A 3RDVA 2EWNA 3OYMA 5KYXA 5D6XA 2B8AA 2E65A 2QK0A 4OF1A 3A8MB 1WI7A 1OOTA 4XAXB 1GBRA 3I5RA 1ACMB 1DJ7B 1VQMA 2EJGA 2P4TA 5KE3A 2DAQA 3CCMA 1FMVA 1QP3A 3OYGA 5GAMe 3PVLA 4PJOD 1GFDA 2K3XA 2Y4YA 1EZZB 2HSEB 1BKBA 2PNIA 3EFOA 4XTXA 2XICA 2FHDA 2CP5A 2O2OA 3CCMT 5GAN5 2DL8A 2KQWA 4R0KA 1KHIA 4IKFA 3QYGB 1VIEA 4IUUA 3V8KA 4F17A 2DVEA 5GAOr 2KT1A 3G4ST 3G1JA 1OULA 1UGQB 2V26A 1K9MR 1VQ9Q 2DX1A 3CCQQ 1AD5A 2DA9A 4JRKA 4MMKA 2E4HA 3M0SA 3QO3A 1GCQA 3U23A 1I4K1 3VS2A 2BZ8A 1T0HA 1IXDA 2DL5A 3L2RA 2NYSA 4VUBA 2O4XA 2HSPA 3S3NA 2JTEA 4C5EA 1WZOA 1QVFA 3RR6A 2RHUA 2CP7A 2SRCA 3I35A 2M51A 2LRQA 1YITT 4V2SA 3JB9F 4C0GA 4RTZA 5KE2A 4D6WA 5GAOl 2QEXQ 2DD5A 3QIIA 1UJYA 2EQJA 3H9NA 3MJXA 1NYFA 2K6DA 3L2ZA 2ECZA 2YRVA 2EQIA 3VU3C 3UWNA 3R6NA 4N4GA 3CCEA 2E5KA 4RTTA 4M75A 2OAUA 2L0AA 1BBZA 2JMCA 2A28A 4MDXA 2GBQA 2CP6A 2DMOA 4R56A 4CC7A 3UDCA 5GMKh 4N4IA 4E7ZA 3JCMP 4KGZB 1U5SA 3G7ZA 3EHQA 1LVKA 4GLMA 3DLLA 1WA7A 1MMDA 4PFZA 1ZUUA 5A2QE 4J9CA 2E5QA 2CZ7B 3HL8A 4NL3A 2DIGA 2DYIA 3ZEHA 1SPKA 3OB9A 2JTFA 4CC4B 4HVWA 4BI4A 2DRKA 3EG3A 5GAMg 2K57A 3GIBA 3CBOA 4RUGA 1OZ3A 3JCMg 1D09B 1G3SA 1GBQA 4Y91A 2OX7A 2JXBA 4M7AG 4XTUA 3JCMd 2VGMA 2XDDA 4FIBA 2FEIA 2FRYA 5GAN2 2E6NA 2LDMA 4HXJA 1KC8U 1YJNA 2RJFA 1AT1B 2GGRA 2OTJQ 1RAFB 2MOXA 3TVTA 3M0PA 2RN8A 1VYVA 4M7AB 1W4SA 3VKIA 2J6KA 3FEOA 4PKCC 4GLKA 1KG1A 3V7SA 2D1XA 3PGGA 2LT1A 4M78D 1M27C 2DLPA 1KK7A 8AT1B 2F5KA 4A4GA 3PIOA 4C0DB 4X1VA 5LJ5e 5IXFA 2CT4A 1JRIA 3ZFJA 3N5BB 6AT1B 3QHSA 4B9XA 2VWFA 4DOVA 1VQ8A 2KNBB 5D6YA 4C92A 1H3ZA 4KGVB 3PNWC 1KQSA 3P8BB 3EGDB 2O9VA 1I07A 1PWTA 3RBBB 1I8FA 5GAN8 1BCMA 1MMGA 1WHGA 4C92E 1ZSZA 2EVRA 4JS4A 4L5GA 4CRIA 4F7UF 2BZYA 4QVCA 3CCQA 4EMHA 3C12A 2DZCA 3CC7Q 4C0DC 2PVGB 2EYZA 3DLMA 4BDYA 1VQKA 3G71Q 2ZPEB 4RKUE 4A54A 1K0SA 2K5LA 4CC2A 4IUVA 2JNGA 2LJ3A 5GAN6 1VQ9T 2XK0A 5FU7B 3CCQT 3CCSQ 3OS0A 1NPRA 1Q82U 4FYYB 3URGA 2QI2A 5J26A 2LC4A 1V29B 2MCNA 2X3XD 4JJBA 2QEXA 2EYQA 4GY5A 1LNXA 2EKHA 2JZ2A 2V8JA 3GPLA 4CI0C 3QXEB 3C4SA 3NTKA 1NPPA 1WJQA 2VC8A 4KBMB 2PVOB 2DVJA 4M77F 2PTKA 4FCYA 2QEXT 3JCMV 4M77G 2BZXA 1K73U 1NEBA 2D8HA 5FU7C 2VUBA 3LW5E 4PJNA 3X28B 1EIFA 1D1AA 1WHKA 4XU2A 2A3LA 1VQLQ 3VV0A 3NFCA 2ZGWA 2XDBA 3A8OB 1VYTA 4M7DA 1Z9QA 3A5ZB 2KEAA 2D6FA 3J7AF 4ME7A 1RAAB 4M77B 2BTTA 2L2PA 1YHQQ 2D8JA 3E9GA 2EGAA 4M7DE 1HJDA 3X26B 2JVVA 2DD4A 2WACA 4IIOA 4RG8A 2X35A 3HRTA 2EQKA 3JRZA 1MMAA 2YT6A 3ME9A 2A7YA 1WFWA 2A0FB 4FYVB 5GAMf 1G2BA 3TU4K 4QVDA 2DFUA 1YJ9Q 1K8AC 2K2VA 5KYYA 1W2BA 1OYXA 2CDTA 4M77C 2GTJA 1E7OA 1FYNA 2ED1A 3X20B 1H8KA 4HT8A 2GQVA 2O31A 2O88A 2EPDA 3M58A 1GRIA 1M30A 1X01A 4DOWA 3F70A 2OTJA 2M1HA 1VQ7Q 1VQ4Q 4A4EA 2AKKA 4XU1A 2DL7A 1QQJA 3X24B 3FJPA 1U8RA 2Z0WA 4LUDA 4RTXA 3QKJA 1YIJA 1QP2A 2QAZA 4ZN3A 3JCMQ 4M75D 3P8HA 4HA8A 3I56Q 1HXDA 2OTJT 4XU0A 5GAMj 3H0HA 2K4YA 1M1FA 1ZQ1A 2HKQB 2QQSA 5CR2A 5FROA 5FWCA 3REAB 1QVGP 1M2VA 3JCMX 1Q95G 4J9HA 3MEWA 1C6VX 4IURA 3A8GB 3SWNA 4PJMA 1QMCA 1PNJA 1OX9A 1WPYA 3VJPA 4PNOA 1TS9A 4EMKB 3H0FA 4F14A 3JV3A 1JXOA 3VUBA 5I2SA 4FYWB 1M90U 3C0CA 2GFUA 3CEYA 1WJRA 4K11A 3QJYA 2NWMA 2DXTA 2VASA 1SF9A 1O9SA 1IGUA 4E7IA 3G71A 2COYA 3L2WA 5DM7R 2LX9A 3CMAT 4IUPA 1HD3A 5GAN7 2PU9B 4A4FA 5GAN3 3UF4A 3CCSA 2XIDA 4LDYA 1AHJB 2CH4A 3CC7T 3M0QA 4EMKC 2X9HA 4BB7A 3G71T 3PT9A 3VYGA 1X27A 2ABLA 1A0NB 2K79A 1TTHB 3VS0A 2JS0A 2DL4A 3CCJA 1N6AA 3CCST 2AK5A 4Z89A 2FZCB 4PJLA 3QDFA 4JZ3A 2ZPBB 1YN8A 2NUPA 3OMCA 1Y96A 3QZ9B 4FSXA 2E41A 8ATCB 1WGSA 2DEQA 1KD1U 1T0JA 1IGQA 5FW9A 2E10A 3M4YA 1WHLA 4HCKA 4EPCA 1R0BG 3SB2A 1D0XA 2R58A 4PFPA 2DBMA 3E2UA 4C92D 1JJ2A 4OGCA 3CQTA 1VQLT 3E9FA 3HFNA 1VUBA 2ROLA 3V7RA 5HCKA 4ELZC 1UFFA 1QWEA 2RF0A 1VQNQ 1N27A 5IN1A 3CC2Q 1D0ZA 1YHQT 1AZGB 2QXFA 1H641 3L2UA 1SEMA 3GNFB 5LJ3h 2V1QA 5CKBA 5LJ5f 1Q7YC 1WHHA 2G6FX 4C8QF 1YJ9A 1EX4A 2KI7A 5KYNA 1UGSB 1KC8R 3THKA 5HK3A 5GAOn 1AVZC 2EIFA 1LPLA 2EJFA 2L5QA 1F1BB 1VQPQ 4LD9K 2EQUA 3MO8A 1PG5B 1BCOA 3OYNA 1YJ9T 3CMEQ 1M8MA 5FWBA 1VQ7A 4IIMA 4MZMA 1M1KU 1UDLA 3FC3A 2KRSA 2CSIA 4WTOB 3KFVA 3NTHA 2D0QB 5GMKe 2DEUA 2XI9A 3LYIA 1H3HA 3I56A 2K5IA 3FLGA 1WYXA 2ZAEA 4WCIA 3V8LA 1VQ7T 1VQ4T 2KT8A 1QVGS 2LX7A 5LJ5j 1M1KC 1AWXA 5GANh 4KRTA 4ZGJB 1YBYA 2DTIA 2KRMA 2M0OA 3TSWA 1U1SA 1Q81C 2RJEA 2ROTA 3I56T 4M7DD 2MF2A 4HCZA 2LJ0A 4C8QC 1UGPB 4X9DA 1VQ5Q 1I81A 4OMNA 2BKDN 4LDWA 5ECAA 5HY6A 1KSWA 4IUTA 1B3QA 1B34A 2PVDB 2DXCA 1ZSGA 2EW3A 3G4SA 2X4JA 1U3OA 4BE1A 2FRWA 4EIKA 4JRIA 4BY6B 3META 1Q82R 4HT9A 4PLIA 3GP8A 1MGQA 2E3IA 2DERA 4KT0E 2CKKA 2XHCA 4PL6A 4XTYA 3QWXX 2FO0A 5KYUB 4R55A 1Y57A 2RI2A 3RMSA 4AFUC 4BACA 2KY9A 3VS7A 4QQDA 1AEYA 1YITA 2O9SA 2WSCE 1MNEA 5M9OA 2LQNA 3OYJA 2JJ9A 1SKUB 4J7IA 1K73R 2ZPFB 1AWWA 4BY6C 4RCBA 1M3CA 4CC3A 4EDUA 5EG2A 1KQ2A 3P8DA 5IXBA 2LQWA 2QQRA 1VIFA 1UB4A 1BU1A 3AT1B 1M5Q1 4OVAA 2FG0A 1V76A 3OBWA 1VQ6Q 2QG9B 4OP0A 1NE8A 2MWOA 4LDUA 1ZA1B 2IG0A 2V1RA 1Y0MA 4XK8E 3CBMA 1J3TA 2HMAA 3A1PA 2JOYA 5CIUA 1FMWA 1WJSA 2H8HA 1BIBA 1QW1A 3BY7A 4M75E 5DLOA 2COWA 2CGHA 4RMOA 1IHVA 4AG1C 4PLLA 4A4KA 3L2VA 3RKYA 1MV0B 2KXCA 4A63B 1RL2A 3QSUA 2DF6A 1JU5C 2RB6A 4Z8AA 1Q86C 3E19A 2WSFE 2XKOC 2HQXA 1VQNT 3M5AA 2QQAA 3CC2T 1YP5A 2C0IA 4HCBA 2DJQA 4N0AC 2F2XA 3CCVQ 3I55Q 1RABB 2ZZDA 1XTDA 1KFZA 1D3BB 3QWYA 2J05A 4P5NA 5HKCA 2RM4A 3GBQA 5GAMd 1SHFA 4PK4A 4II1A 1VQPT 2OTLQ 4M7AF 1KQ1A 2CZ1B 3CMET 2O4XB 3J81E 1ABOA 1E6HA 1PSEA 2QQBA 3QBYA 3VS4A 3RESA 2DXBA 3CC4Q 1N5ZA 2NUTB 4L6V5 4J6YA 4QQ6A 5GAN4 2H3JA 2BIVA 1SG5A 7AT1B 1N9RA 1FMKA 2RHIA 1KHCA 2YLBA 4F7UA 1GCPA 2PUOB 4BE0A 2P0KA 3JCMh 1M90R
chains in the Genus database with same CATH topology
2F2VA 2YT6A 1M3BA 2RQWA 1WFWA 4M4ZA 2IIMA 5IH2A 4GBQA 1G2BA 4ESRA 2FPFA 1EFNA 2L3QA 2ENMA 4AG2C 1ZX6A 1WXBA 1Z9ZA 4RTVA 4J9FA 2CDTA 2KR3A 2GTJA 1E7OA 1FYNA 1PKTA 2ED1A 1H8KA 3ULRB 2O31A 2O88A 2EPDA 1JQQA 2JS2A 2KE9A 2MIOA 1GRIA 1K76A 2VKNA 1ABQA 1M30A 2NUZA 3IQLA 2HCKA 2AKKA 2HEQA 2DM1A 1HSQA 2DL7A 4LUDA 4RTXA 4D8DA 4LN2A 1UG1A 1QLYA 2AZVA 5IHNA 1W1FA 3H0HA 2KYBA 1NLOC 2JM8A 2EBPA 5FWCA 2X3WD 3REAB 1NEGA 1UUEA 4J9HA 4QT7A 3EGUA 1W6XA 1T3LA 3PVQA 3H0IA 4LE9A 2VVKA 3NPFA 3NGPA 3A98A 1PNJA 2K3BA 2OJ2A 4FSSA 4RTYA 1AWOA 1QCFA 4OMPA 3H0FA 1UE9A 2LNHB 4AFQC 4F14A 2KROA 1JXOA 3JV3A 4JJDA 3M0RA 3C0CA 1AWJA 2EGEA 2K7AA 4K11A 1QKWA 2RQTA 1PRLC 2NWMA 2YUNA 1UGVA 4ZNXA 2QDLA 3EG1A 5EC7A 3NMZC 2RMOA 5IHIA 2KGTA 1HD3A 1X2KA 1LCKA 4ORZA 1TG0A 1WI7A 3UF4A 1X43A 2CH4W 2CH4A 3M0QA 2P4RA 1OOTA 1RUWA 1V1CA 1JXMA 1GBRA 2RPNA 4J9BA 3I5RA 1X27A 1JO8A 2ABLA 1A0NB 2DNUA 2K79A 2OAWA 3VS0A 2JS0A 2DL4A 1OPKA 2CREA 1JEGA 3PVLA 1W70A 1GFDA 2AK5A 4Z89A 4JZ3A 2PNIA 1YN8A 1IO6A 4OMOA 1WXTA 2HBWA 1GCQC 2O2OA 1T0JA 2FPEA 5FW9A 2DL8A 2EYYA 2RQUA 4HCKA 1ARKA 1UHCA 4OMLA 1I0CA 4R0KA 1QKXA 3REBB 4J9DA 4F17A 2A37A 2KT1A 1G83A 2DX1A 2DBMA 1AD5A 2DA9A 4AFZC 1UECA 2K9GA 1CKAA 3M0SA 3U23A 1GCQA 3VS2A 1SHGA 2BZ8A 1H92A 3EG2A 1T0HA 3CQTA 2FPDA 1X6GA 2ROLA 5HCKA 1WXUA 2YDLA 2DL5A 2YUOA 2KBTA 1YWPA 1UFFA 1QWEA 2HSPA 2RF0A 2JTEA 2SEMA 4D8KA 1AZGB 2SRCA 3I35A 2JMAA 1SEMA 2M51A 1CKBA 4LNPA 2V1QA 2G6FX 2LP5A 5I11A 4RTZA 1UJ0A 1UJYA 2W0ZA 2ED0A 1NYFA 1PHTA 2K6DA 4F16A 1ZLMA 2ECZA 3THKA 2EQIA 1AVZC 2OI3A 3R6NA 2B86A 2E5KA 4RTTA 2GNCA 1M8MA 2DYBA 5FWBA 2L0AA 2J6OA 2JMCA 1BBZA 1K4US 2A28A 2GBQA 1M3AA 4IIMA 1UDLA 1PRMC 2DMOA 4CC7A 1MUZA 2KRSA 2RQRA 4Y92A 2CSIA 1WLPB 1SRMA 3KFVA 1U5SA 1YCSB 3EHQA 3RNJA 3VS6A 4GLMA 1E6GA 1H3HA 1WA7A 2RNAA 4WCIA 1WYXA 1ZUUA 4J9CA 3UATA 3ZL7C 5GJWB 3VRYA 2KT8A 1B07A 2LX7A 5L23A 1AWXA 1S1NA 4KRTA 2CT3A 2LZ6B 4JPBW 2KRMA 3TSWA 1NG2A 2GTOA 1SPKA 2GQIA 2ROTA 4CC4B 4HVWA 4Z88A 1K1ZA 3I9QA 2D0NA 2DRKA 3UA6A 2LJ0A 3EG3A 2YSQA 1NM7A 2A08A 1XOVA 1RLPC 4OMNA 1KJWA 4RUGA 5ECAA 1OEBA 2JM9A 2C0OA 1KSWA 4DEXA 2EGCA 1UHFA 1SRLA 3EG0A 2J7IA 1B3QA 1GBQA 4LUEA 1ZSGA 2JXBA 1ZUYA 2YUQA 2EW3A 3SHWA 1U3OA 2I0NA 2FRWA 2PZ1A 1X6BA 2FEIA 2FRYA 4J9IA 4EIKA 1WDXA 4HXJA 4J9GA 1BB9A 2AKLA 2GGRA 2KRNA 2MOXA 3TVTA 3M0PA 4HVUA 5IHKA 2RN8A 2W10A 1VYVA 4OMQA 1AZEA 4AFSC 2A36A 1TUCA 1CSKA 3QWXX 2FO0A 2J6KA 1YNZA 1K9AA 1UTIA 1Y57A 4AFUC 2D1XA 1X69A 2CUDA 4DEYA 1M27C 2LMJA 3VS7A 2DLPA 1AEYA 3UA7A 2L3PA 2O9SA 3VS5A 2DBKA 3VS1A 3PE0A 1GFCA 2LQNA 2LCSA 1X2QA 1WX6A 4X1VA 1ZUKA 3M0UA 2L3SA 5IXFA 1AWWA 1VYUA 2HDAA 2CT4A 2EYWA 1MV3A 2J6FA 2RQVA 1M3CA 2VWFA 4CC3A 2DE0X 4HVVA 2KNBB 3LH5A 1WIEA 1TUDA 2JT4A 5IXBA 2LQWA 2O9VA 1I07A 1PWTA 1BU1A 3I5SA 2LJ1A 3RBBB 2M0YA 2EVRA 2FG0A 2BZYA 2EYXA 4J9EA 3SEMA 1SSHA 5GJVB 1YWOA 2V1RA 2EYZA 2XMFA 1I1JA 1Y0MA 1J3TA 4OMMA 1K0SA 2H8HA 4JZ4A 4CC2A 2LJ3A 2ESWA 1RI9A 2CSQA 4E6RA 4AG1C 1QWFA 1MV0B 2KXCA 2MCNA 4A63B 3TSZA 2AZSA 2X3XD 1VA7A 4JJBA 3EHRA 2DF6A 1JU5C 2KXDA 4Z8AA 2EKHA 2K2MA 3NHNA 1NYGA 1YP5A 1BK2A 2C0IA 3FJ5A 1NLPC 1AOJA 2KYMA 2DJQA 2F2XA 1GL5A 1K0XA 2J06A 2DVJA 2PTKA 1KFZA 2DL3A 1RLQC 2DILA 3VRZA 3QWYA 2J05A 2BZXA 1T3SA 1NEBA 2D8HA 3GBQA 1PKSA 1SHFA 1OPLA 4JJCA 1U06A 4RTUA 1VYTA 3H41A 1Z9QA 2KEAA 3O5ZA 1ZBJA 2DRMA 2CUBA 1ABOA 1E6HA 3VS3A 2BTTA 4RTWA 2L2PA 3VS4A 2F2WA 1KIKA 2D8JA 1N5ZA 2EGAA 1HJDA 2JW4A 2C0TA 5I22A 2YUPA 4IIOA 1FMKA 1OV3A 1GCPA 3M0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2V A;  2YT6 A;  1M3B A;  2RQW A;  1WFW A;  4M4Z A;  2IIM A;  5IH2 A;  4GBQ A;  1G2B A;  4ESR A;  2FPF A;  1EFN A;  2L3Q A;  2ENM A;  4AG2 C;  1ZX6 A;  1WXB A;  1Z9Z A;  4RTV A;  4J9F A;  2CDT A;  2KR3 A;  2GTJ A;  1E7O A;  1FYN A;  1PKT A;  2ED1 A;  1H8K A;  3ULR B;  2O31 A;  2O88 A;  2EPD A;  1JQQ A;  2JS2 A;  2KE9 A;  2MIO A;  1GRI A;  1K76 A;  2VKN A;  1ABQ A;  1M30 A;  2NUZ A;  3IQL A;  2HCK A;  2AKK A;  2HEQ A;  2DM1 A;  1HSQ A;  2DL7 A;  4LUD A;  4RTX A;  4D8D A;  4LN2 A;  1UG1 A;  1QLY A;  2AZV A;  5IHN A;  1W1F A;  3H0H A;  2KYB A;  1NLO C;  2JM8 A;  2EBP A;  5FWC A;  2X3W D;  3REA B;  1NEG A;  1UUE A;  4J9H A;  4QT7 A;  3EGU A;  1W6X A;  1T3L A;  3PVQ A;  3H0I A;  4LE9 A;  2VVK A;  3NPF A;  3NGP A;  3A98 A;  1PNJ A;  2K3B A;  2OJ2 A;  4FSS A;  4RTY A;  1AWO A;  1QCF A;  4OMP A;  3H0F A;  1UE9 A;  2LNH B;  4AFQ C;  4F14 A;  2KRO A;  1JXO A;  3JV3 A;  4JJD A;  3M0R A;  3C0C A;  1AWJ A;  2EGE A;  2K7A A;  4K11 A;  1QKW A;  2RQT A;  1PRL C;  2NWM A;  2YUN A;  1UGV A;  4ZNX A;  2QDL A;  3EG1 A;  5EC7 A;  3NMZ C;  2RMO A;  5IHI A;  2KGT A;  1HD3 A;  1X2K A;  1LCK A;  4ORZ A;  1TG0 A;  1WI7 A;  3UF4 A;  1X43 A;  2CH4 W;  2CH4 A;  3M0Q A;  2P4R A;  1OOT A;  1RUW A;  1V1C A;  1JXM A;  1GBR A;  2RPN A;  4J9B A;  3I5R A;  1X27 A;  1JO8 A;  2ABL A;  1A0N B;  2DNU A;  2K79 A;  2OAW A;  3VS0 A;  2JS0 A;  2DL4 A;  1OPK A;  2CRE A;  1JEG A;  3PVL A;  1W70 A;  1GFD A;  2AK5 A;  4Z89 A;  4JZ3 A;  2PNI A;  1YN8 A;  1IO6 A;  4OMO A;  1WXT A;  2HBW A;  1GCQ C;  2O2O A;  1T0J A;  2FPE A;  5FW9 A;  2DL8 A;  2EYY A;  2RQU A;  4HCK A;  1ARK A;  1UHC A;  4OML A;  1I0C A;  4R0K A;  1QKX A;  3REB B;  4J9D A;  4F17 A;  2A37 A;  2KT1 A;  1G83 A;  2DX1 A;  2DBM A;  1AD5 A;  2DA9 A;  4AFZ C;  1UEC A;  2K9G A;  1CKA A;  3M0S A;  3U23 A;  1GCQ A;  3VS2 A;  1SHG A;  2BZ8 A;  1H92 A;  3EG2 A;  1T0H A;  3CQT A;  2FPD A;  1X6G A;  2ROL A;  5HCK A;  1WXU A;  2YDL A;  2DL5 A;  2YUO A;  2KBT A;  1YWP A;  1UFF A;  1QWE A;  2HSP A;  2RF0 A;  2JTE A;  2SEM A;  4D8K A;  1AZG B;  2SRC A;  3I35 A;  2JMA A;  1SEM A;  2M51 A;  1CKB A;  4LNP A;  2V1Q A;  2G6F X;  2LP5 A;  5I11 A;  4RTZ A;  1UJ0 A;  1UJY A;  2W0Z A;  2ED0 A;  1NYF A;  1PHT A;  2K6D A;  4F16 A;  1ZLM A;  2ECZ A;  3THK A;  2EQI A;  1AVZ C;  2OI3 A;  3R6N A;  2B86 A;  2E5K A;  4RTT A;  2GNC A;  1M8M A;  2DYB A;  5FWB A;  2L0A A;  2J6O A;  2JMC A;  1BBZ A;  1K4U S;  2A28 A;  2GBQ A;  1M3A A;  4IIM A;  1UDL A;  1PRM C;  2DMO A;  4CC7 A;  1MUZ A;  2KRS A;  2RQR A;  4Y92 A;  2CSI A;  1WLP B;  1SRM A;  3KFV A;  1U5S A;  1YCS B;  3EHQ A;  3RNJ A;  3VS6 A;  4GLM A;  1E6G A;  1H3H A;  1WA7 A;  2RNA A;  4WCI A;  1WYX A;  1ZUU A;  4J9C A;  3UAT A;  3ZL7 C;  5GJW B;  3VRY A;  2KT8 A;  1B07 A;  2LX7 A;  5L23 A;  1AWX A;  1S1N A;  4KRT A;  2CT3 A;  2LZ6 B;  4JPB W;  2KRM A;  3TSW A;  1NG2 A;  2GTO A;  1SPK A;  2GQI A;  2ROT A;  4CC4 B;  4HVW A;  4Z88 A;  1K1Z A;  3I9Q A;  2D0N A;  2DRK A;  3UA6 A;  2LJ0 A;  3EG3 A;  2YSQ A;  1NM7 A;  2A08 A;  1XOV A;  1RLP C;  4OMN A;  1KJW A;  4RUG A;  5ECA A;  1OEB A;  2JM9 A;  2C0O A;  1KSW A;  4DEX A;  2EGC A;  1UHF A;  1SRL A;  3EG0 A;  2J7I A;  1B3Q A;  1GBQ A;  4LUE A;  1ZSG A;  2JXB A;  1ZUY A;  2YUQ A;  2EW3 A;  3SHW A;  1U3O A;  2I0N A;  2FRW A;  2PZ1 A;  1X6B A;  2FEI A;  2FRY A;  4J9I A;  4EIK A;  1WDX A;  4HXJ A;  4J9G A;  1BB9 A;  2AKL A;  2GGR A;  2KRN A;  2MOX A;  3TVT A;  3M0P A;  4HVU A;  5IHK A;  2RN8 A;  2W10 A;  1VYV A;  4OMQ A;  1AZE A;  4AFS C;  2A36 A;  1TUC A;  1CSK A;  3QWX X;  2FO0 A;  2J6K A;  1YNZ A;  1K9A A;  1UTI A;  1Y57 A;  4AFU C;  2D1X A;  1X69 A;  2CUD A;  4DEY A;  1M27 C;  2LMJ A;  3VS7 A;  2DLP A;  1AEY A;  3UA7 A;  2L3P A;  2O9S A;  3VS5 A;  2DBK A;  3VS1 A;  3PE0 A;  1GFC A;  2LQN A;  2LCS A;  1X2Q A;  1WX6 A;  4X1V A;  1ZUK A;  3M0U A;  2L3S A;  5IXF A;  1AWW A;  1VYU A;  2HDA A;  2CT4 A;  2EYW A;  1MV3 A;  2J6F A;  2RQV A;  1M3C A;  2VWF A;  4CC3 A;  2DE0 X;  4HVV A;  2KNB B;  3LH5 A;  1WIE A;  1TUD A;  2JT4 A;  5IXB A;  2LQW A;  2O9V A;  1I07 A;  1PWT A;  1BU1 A;  3I5S A;  2LJ1 A;  3RBB B;  2M0Y A;  2EVR A;  2FG0 A;  2BZY A;  2EYX A;  4J9E A;  3SEM A;  1SSH A;  5GJV B;  1YWO A;  2V1R A;  2EYZ A;  2XMF A;  1I1J A;  1Y0M A;  1J3T A;  4OMM A;  1K0S A;  2H8H A;  4JZ4 A;  4CC2 A;  2LJ3 A;  2ESW A;  1RI9 A;  2CSQ A;  4E6R A;  4AG1 C;  1QWF A;  1MV0 B;  2KXC A;  2MCN A;  4A63 B;  3TSZ A;  2AZS A;  2X3X D;  1VA7 A;  4JJB A;  3EHR A;  2DF6 A;  1JU5 C;  2KXD A;  4Z8A A;  2EKH A;  2K2M A;  3NHN A;  1NYG A;  1YP5 A;  1BK2 A;  2C0I A;  3FJ5 A;  1NLP C;  1AOJ A;  2KYM A;  2DJQ A;  2F2X A;  1GL5 A;  1K0X A;  2J06 A;  2DVJ A;  2PTK A;  1KFZ A;  2DL3 A;  1RLQ C;  2DIL A;  3VRZ A;  3QWY A;  2J05 A;  2BZX A;  1T3S A;  1NEB A;  2D8H A;  3GBQ A;  1PKS A;  1SHF A;  1OPL A;  4JJC A;  1U06 A;  4RTU A;  1VYT A;  3H41 A;  1Z9Q A;  2KEA A;  3O5Z A;  1ZBJ A;  2DRM A;  2CUB A;  1ABO A;  1E6H A;  3VS3 A;  2BTT A;  4RTW A;  2L2P A;  3VS4 A;  2F2W A;  1KIK A;  2D8J A;  1N5Z A;  2EGA A;  1HJD A;  2JW4 A;  2C0T A;  5I22 A;  2YUP A;  4IIO A;  1FMK A;  1OV3 A;  1GCP A;  3M0T A; 
#chains in the Genus database with same CATH topology
 2DPP B;  2RI3 A;  2F2V A;  1WHM A;  1M3B A;  2RQW A;  2E70 A;  4FU6 A;  4F7U E;  2P0Q A;  3RIR A;  1N8R C;  4ESR A;  2KVQ G;  4AG2 C;  1YJW Q;  1WXB A;  4KGX B;  3ASK A;  4J9F A;  3HSB A;  2I2L A;  3DB4 A;  3PTA A;  1PKT A;  3QZ5 B;  4O6J A;  5GAO m;  3EAE A;  1VQ5 T;  4C5I A;  2YXY A;  3HFO A;  1JQQ A;  2JS2 A;  3OSS C;  5GAN j;  1NJI C;  4M7A C;  4QW2 A;  1G3Y A;  2HEQ A;  1G8X A;  1HSQ A;  3CMA Q;  3QDR B;  4PFO A;  1VQ9 A;  2E12 A;  4M77 A;  4Z02 A;  4LN2 A;  1UG1 A;  3RER A;  2QGF B;  1OQK A;  1C0M A;  1W1F A;  2KYB A;  3M55 A;  3M53 A;  2EBP A;  4M77 E;  1QVP A;  3HP9 A;  2DKG A;  1QVG A;  1UUE A;  1KD1 R;  3CXC P;  3CPW P;  4FW2 A;  1W6X A;  5L8R E;  5GMK l;  1TH7 A;  3PVQ A;  3H0I A;  1I5O B;  1PCX A;  2VVK A;  2DZ9 A;  3NPF A;  3NGP A;  3EFR A;  2M16 A;  4FSS A;  1QCF A;  2CP0 A;  4X34 A;  1UE9 A;  4JJD A;  2HL5 C;  3E1S A;  1AWJ A;  2EGE A;  2E6Z A;  3H8Z A;  3HKS A;  4ZNX A;  1VQO Q;  4E7J A;  1P92 A;  3LGF A;  3EG1 A;  3CCL Q;  5EC7 A;  2C06 A;  2HBP A;  3TEE A;  3OSV A;  4MDW A;  2KGT A;  4J6X A;  1VOM A;  4ORZ A;  1VQ6 T;  1TG0 A;  4IUQ A;  3MEU A;  5KH6 A;  1X43 A;  3V7C A;  2CH4 W;  1BI3 A;  1IRX A;  2P4R A;  1WQ7 A;  2RPN A;  4E7K A;  5KYW A;  3JB9 D;  3MP1 A;  5DY9 A;  4O5V A;  2RK2 A;  2OAW A;  3NTI A;  1OI1 A;  5D7U A;  5I21 A;  3OS1 A;  3VUZ A;  2R57 A;  3CBP A;  1K9M C;  2CRE A;  1K8A U;  5J39 A;  3CCV A;  3I55 A;  2GFA A;  1M1K R;  3CCU Q;  2AHJ B;  1S72 Q;  4EMK A;  1IO6 A;  4OMO A;  5LJ5 g;  2L3R A;  2FPE A;  4KUL A;  2AIR B;  1JBM A;  1ARK A;  4OML A;  5LJ5 d;  3REB B;  3CCV T;  3JB9 H;  3I55 T;  4J9D A;  5GMK j;  3WVE B;  2A37 A;  3HTR A;  2V8I A;  1OU8 A;  4ZGE B;  1TU0 B;  2QA4 Q;  3OY9 A;  1PSF A;  1UEC A;  1CKA A;  1IRE B;  2LCL A;  2OTL T;  3EG2 A;  2FPD A;  5CKD A;  1WXU A;  4BI8 B;  2G3R A;  2KBT A;  1YWP A;  5CVI A;  3M59 A;  1PC0 A;  4C5G A;  2YLC A;  3QUI A;  3CC4 T;  1D1B A;  2V8K A;  2JMA A;  3JCM c;  4FW1 A;  5GMK m;  1CKB A;  2QTV A;  4M7D G;  4HKE A;  1YJW A;  1FWZ A;  4XU3 A;  2XU8 A;  5LJ3 e;  4MZT A;  2ED0 A;  1ZLM A;  5CKE A;  4PJO F;  4PJO G;  1UGR B;  3MHX A;  2X4X A;  5FRN A;  4DA4 A;  3L2Q A;  4M7D B;  3ZBD A;  1YJW T;  4F04 B;  4MML A;  2J6O A;  3M9Q A;  4JLG A;  3CMA A;  3DB3 A;  1M9S A;  4A53 A;  1MUZ A;  4Y92 A;  1PD1 A;  1SRM A;  4PJO B;  4A4H A;  1YCS B;  1IZ6 A;  3CC7 A;  2CYZ B;  5KCO A;  3UAT A;  1VQM Q;  1B07 A;  3TRE A;  3OYY A;  1S1N A;  4J5Y A;  3CXC S;  3CPW S;  1R0C B;  4JPB W;  2NLU A;  5GAN e;  9ATC B;  5KYY B;  4Z88 A;  1K1Z A;  3LGL A;  3UA6 A;  4ATO A;  4FYX B;  2RK1 A;  2YSQ A;  2A08 A;  2LNV A;  2FB7 A;  3EGX A;  2JM9 A;  4PJO C;  1U1T A;  1OZ2 A;  1LOJ A;  2EGC A;  1UHF A;  1SRL A;  4L59 A;  2J7I A;  4XTV A;  1RAI B;  2KMT A;  1VQO A;  2FVU A;  2YUQ A;  3OYI A;  2EQM A;  3L42 A;  3M4G A;  2PZ1 A;  4C8Q A;  1X6B A;  2E3H A;  3CCL A;  2CP3 A;  4J9I A;  1BB9 A;  2YRD A;  2AKL A;  3EG9 B;  2JTM A;  4C8Q E;  4HVU A;  2HKN A;  5IHK A;  1VQL A;  1VQO T;  2W10 A;  4OMQ A;  3FIF A;  4FT2 A;  3JSC A;  2A36 A;  3QG1 A;  1CSK A;  4OB3 B;  3LWH A;  2RO0 A;  1YNZ A;  3CCL T;  3JCM J;  1YHQ A;  3SWN B;  4DEY A;  2CS7 A;  1M2O A;  3L1A A;  3QYH B;  2HQE A;  4JUV A;  3VS5 A;  3VS1 A;  1Q7Y U;  1BIA A;  3PE0 A;  1W2B P;  1WX6 A;  1ZUK A;  1XNI A;  3WVD B;  3CCU A;  1VYU A;  1Y71 A;  1S72 A;  4M77 D;  1MV3 A;  2J6F A;  2RQV A;  3O8V A;  3CCE Q;  3LH5 A;  2VGN A;  2F5T X;  2JT4 A;  2GCX A;  2ZPH B;  5GAO q;  3CCU T;  3I5S A;  2LJ1 A;  2RJC A;  2FZG B;  1S72 T;  2M0Y A;  3Q1J A;  1RAE B;  2QA4 A;  2MAM A;  2EYX A;  3SEM A;  1SSH A;  1QCO A;  3D7S B;  3JB9 J;  1M1G A;  3J80 E;  1I1J A;  3V8J A;  1VQ4 A;  2LVM A;  2LQ8 A;  4JZ4 A;  5GAO p;  3FDR A;  5KYU A;  2QA4 T;  4E2F B;  1RI9 A;  2CSQ A;  1Q81 U;  1NJI R;  1MND A;  2K3Y A;  3CCR Q;  3PMI A;  4X9C A;  5GAN g;  2NUP B;  2AZS A;  3TSZ A;  1Y96 B;  4NL2 A;  4BI3 A;  2DTH A;  2KXD A;  2K2M A;  4M78 F;  3HPW A;  3C94 A;  4M78 G;  2BE7 D;  1NYG A;  1BK2 A;  1MMN A;  1NLP C;  1AOJ A;  2KYM A;  1RAH B;  1XJW B;  3EH1 A;  4BDZ A;  2R5M A;  4KH1 B;  3M54 A;  5A0D A;  1K0X A;  1D1C A;  1RAG B;  2DL3 A;  1RLQ C;  2DIL A;  4KH0 B;  4RCC A;  2Y90 A;  3VRZ A;  4XTW A;  4YTL A;  2X4W A;  3SFM A;  1YJN Q;  4M78 B;  3SD4 A;  2LQK A;  2L8D A;  2JN0 A;  4RTU A;  3PMT A;  4KUI A;  2QDY B;  4BUG A;  5CK9 A;  3O5Z A;  4N0A A;  2WSE E;  1ZBJ A;  3OYC A;  2CUB A;  2F1L A;  2IVW A;  4JRQ A;  3OYL A;  1Y07 A;  3KBG A;  2C0T A;  2YUP A;  3OS2 A;  3M0T A;  4ANJ A;  3H6Z A;  1VQM T;  3JCM e;  2BUD A;  4M4Z A;  4M78 C;  5IH2 A;  4GBQ A;  4FM4 B;  1I5L A;  1EFN A;  1OX8 A;  1VQ8 Q;  2L3Q A;  2ENM A;  1Z9Z A;  4RTV A;  2EFI A;  2DJZ A;  3ULR B;  1D3B A;  1HK9 A;  3M56 A;  3JCM b;  1JJ2 P;  1ABQ A;  3IQL A;  1VQK Q;  5KYX B;  5J3B A;  3OW2 P;  2DM1 A;  2E64 A;  3FRN A;  5D6W A;  5CO7 A;  1WNL A;  3TQ7 P;  4D8D A;  1RAC B;  3RMQ A;  1ZBX A;  2AZV A;  5CCA A;  1K8A R;  3VYH B;  2NUT A;  2VV5 A;  1C1A A;  1NLO C;  2JM8 A;  3JB9 G;  1W2B S;  4LDX A;  1NEG A;  4M7A A;  5KCH A;  1Q86 U;  4QT7 A;  4BD3 A;  3CXC A;  3CPW A;  1VQN A;  4QKU A;  3CC2 A;  1T3L A;  3LH0 A;  4LE9 A;  1B34 B;  4M7A E;  3WXM B;  3LLR A;  5LJ3 f;  3EFO B;  4OMP A;  2LNH B;  2YHT A;  3MKD A;  2KRO A;  1ZA2 B;  5CKF A;  3LWI A;  3M0R A;  1FXX A;  3QJ6 A;  3T9N A;  3CCE T;  1VQP A;  1UGV A;  5IAY A;  1FX7 A;  3CME A;  1BYM A;  2QDL A;  1TXQ A;  3EGD A;  1MHN A;  3NMZ C;  2RMO A;  5IHI A;  1X2K A;  1LCK A;  3OYK A;  3MPU B;  3RUX A;  1XQH A;  2HNI A;  2K5F A;  3CCR A;  2CZ6 B;  1RUW A;  1V1C A;  1JXM A;  2ATC B;  4J9B A;  1YI2 Q;  4PJJ A;  4C8Q D;  1JO8 A;  5LJ3 j;  2DNU A;  2KSS A;  5GAN f;  5GAM h;  3CPF A;  1N8R U;  2XG8 D;  4M75 F;  4M75 G;  1OPK A;  2HAX A;  1JEG A;  1W70 A;  3CCR T;  1TWB A;  3MEA A;  4OB1 B;  3MCA B;  2VXF A;  2ZPG B;  3OMG A;  1VQ5 A;  1WXT A;  1PD0 A;  2HBW A;  1GCQ C;  2AT1 B;  2EAY A;  4WF2 A;  2EYY A;  4M75 B;  2RQU A;  2QGG A;  1UHC A;  1I0C A;  1NJI U;  1QKX A;  1G83 A;  2FYK A;  4J7F A;  2FL7 A;  2R5A A;  1YIJ Q;  3BE3 A;  3GLX A;  3GOX A;  1KC8 C;  4TVR A;  1YJN T;  4AFZ C;  2K9G A;  3MP6 A;  1SHG A;  1H92 A;  2VYT A;  3PFS A;  3BDU A;  1X6G A;  2YDL A;  2YUO A;  4JJN K;  1QVF P;  2XDP A;  4MZP A;  1M4Z A;  2SEM A;  4M75 C;  4D8K A;  1B7T A;  4LNP A;  2LP5 A;  3BDL A;  5I11 A;  3C95 A;  3R6O A;  1UJ0 A;  2W0Z A;  2KDS A;  1PHT A;  4FL6 A;  4F16 A;  3OYE A;  2P0P A;  1YFN A;  5I2M A;  5FU6 B;  2OI3 A;  4XTZ A;  2MI6 A;  1BI0 A;  2RI5 A;  4JRP A;  4ZTJ A;  4F7U G;  2B86 A;  1VQ8 T;  2HD0 A;  1JJ2 S;  2GNC A;  4C5H A;  3OYA A;  2DO3 A;  5LL6 S;  2DYB A;  2LCC A;  2ZPI B;  4BE2 A;  1K4U S;  3TCJ A;  1M3A A;  4OB0 B;  3OW2 S;  4NS5 A;  3HHT B;  2XD0 A;  1PRM C;  3GNG A;  4DBF A;  2RHY A;  2MPX C;  4LD6 A;  1VQ6 A;  2RQR A;  1X6O A;  1WLP B;  3CD6 Q;  1Q7Y R;  4F7U B;  3RNJ A;  3VS6 A;  1E6G A;  2DIQ A;  2RNA A;  5C0M A;  1VQK T;  1N9S A;  5CQX A;  3ZL7 C;  5GJW B;  3VRY A;  5L23 A;  4B9W A;  5FU6 C;  4E47 A;  4C92 F;  2CT3 A;  2QYZ A;  3CCJ Q;  4E7H A;  2LZ6 B;  4C92 G;  2RJD A;  1K9M U;  1NG2 A;  1UEB A;  1Q82 C;  1D0Y A;  2GTO A;  1NZ9 A;  2GQI A;  1RAD B;  2D0N A;  3I9Q A;  1SSF A;  1JB0 E;  2PUK B;  1RI0 A;  2ZCF B;  1NM7 A;  1XOV A;  1NBE B;  1RLP C;  1IB8 A;  1WQW A;  1KJW A;  1OEB A;  2C0O A;  4DEX A;  4C92 B;  4OB2 B;  3EG0 A;  4AMC A;  2QTX A;  4RG2 A;  4LUE A;  3MEV A;  1ZUY A;  4QQG A;  1QCN A;  3SHW A;  1ZSZ B;  2I0N A;  1R77 A;  2LTO A;  2M9U A;  1K73 C;  2YRC A;  2COZ A;  1Q81 R;  1WDX A;  3BFM A;  4J9G A;  1G5V A;  1IHW A;  5HK0 A;  3KUF A;  3OYH A;  2RHX A;  2LT4 A;  2KRN A;  2KK4 A;  4PJO A;  2OTL A;  2HL3 A;  2RD1 A;  3LX7 A;  1AZE A;  4AFS C;  1TUC A;  4AT1 B;  2MYS A;  4J6W A;  1YI2 A;  4N4H A;  1K9A A;  3A8L B;  1UTI A;  2KAF A;  4PJO E;  4C92 C;  1Y7X A;  3JAM E;  3CC4 A;  1X69 A;  2CUD A;  2LMJ A;  5DLQ E;  2EKO A;  5LJ5 h;  3UA7 A;  2EJ9 A;  2L3P A;  2DBK A;  1WHJ A;  3BW1 A;  3HRS A;  1GFC A;  2IPO B;  2LCS A;  1X2Q A;  1LJO A;  4ZGD B;  4QVZ A;  1ZSZ C;  3G6E Q;  4C0Z A;  3M0U A;  2L3S A;  3JCM f;  2D9T A;  3ER0 A;  1YI2 T;  2HDA A;  4KUD K;  2EYW A;  3OS5 A;  3HRU A;  1BI2 A;  4M7D F;  2DE0 X;  4HVV A;  1WIE A;  4JS5 A;  1KQS P;  1TUD A;  4FT4 A;  3PIP A;  1X75 C;  4M7A D;  4C0F A;  1R8O B;  4HCC A;  1PM3 A;  2CP2 A;  1M8V A;  3OYB A;  4J9E A;  2GF7 A;  5GJV B;  1YWO A;  5KYW B;  2XMF A;  3EG9 A;  3DKM A;  2HZY A;  2RA2 A;  4OMM A;  2DTO A;  4J83 A;  4LXC A;  1GXI E;  3X25 B;  3EFS A;  1YIJ T;  1QVF S;  2O01 E;  2DET A;  4NOY A;  4DBR A;  2ESW A;  4E6R A;  3JCM W;  3KXT A;  1QWF A;  5FRM A;  3MP8 A;  3OYF A;  5CQY A;  1O75 A;  4ZN1 A;  4Q5W A;  1VA7 A;  3EHR A;  2P84 A;  3CCM Q;  3NHN A;  1TOV A;  1G3W A;  3FJ5 A;  4M7D C;  3UPU A;  1GL5 A;  3S3M A;  2J06 A;  3G4S Q;  4DBH A;  2QAS A;  1YCY A;  4ELY C;  1M90 C;  1T3S A;  5A0L A;  1PKS A;  2RHZ A;  1OPL A;  3CD6 A;  4Y28 E;  4JJC A;  1U06 A;  4DBQ A;  2RH2 A;  3OQ5 A;  2E1H A;  3H41 A;  4UC4 A;  1Q86 R;  2FZK B;  4XQ3 A;  2QQ9 A;  2Y4X A;  3INZ A;  3S6W A;  2DRM A;  3VS3 A;  3JB9 I;  3A8H B;  4E7S A;  2X51 A;  4RTW A;  5CKH A;  1ZHI A;  2F2W A;  1KIK A;  4OGE A;  2DXU A;  2JW4 A;  1YIT Q;  5I22 A;  3CD6 T;  2F69 A;  1OV3 A;  1M2V B;  3RKX A;  3FB9 A;  3EH2 A;  2IIM A;  2MMP A;  2YWW A;  3CCJ T;  2FPF A;  4OMF B;  2VB6 A;  1ZX6 A;  2VXE A;  5GMK i;  1G3T A;  2KR3 A;  4E7L A;  3OA6 A;  5LJ3 g;  2L89 A;  4JDS A;  1TUG B;  1KD1 C;  2KE9 A;  3M57 A;  2MIO A;  1K76 A;  2VKN A;  4M78 A;  5AYF A;  2NUZ A;  5LJ3 d;  2HCK A;  2HQH A;  3AHU A;  2X4Y A;  2CZ0 B;  2PQW A;  5IT9 E;  5A0G A;  3OW2 A;  2MK5 A;  4M78 E;  1N8R R;  5AT1 B;  3SWN C;  4ZTF A;  2M02 A;  1QLY A;  1HYO A;  3OYD A;  5IHN A;  4LDV A;  3UT1 A;  2X3W D;  4C8Q G;  3G6E A;  3GF5 A;  4JLI A;  3EGX B;  3EGU A;  2MWP A;  1OU9 A;  5C6S A;  3OBY A;  3A98 A;  3QPH A;  4B6M A;  2K3B A;  2OJ2 A;  4J8O A;  1KQS S;  4RTY A;  1AWO A;  2H3E B;  5FLX E;  3G6E T;  2DK3 A;  4AFQ C;  2BE9 B;  4C8Q B;  1TSF A;  2JUF A;  5CAI A;  5GAN d;  2K7A A;  4DQ2 A;  1QKW A;  2RQT A;  3S3O A;  3SDZ A;  1PRL C;  3RKW A;  2YUN A;  4EMG A;  1BI1 A;  3RDV A;  2EWN A;  3OYM A;  5KYX A;  5D6X A;  2B8A A;  2E65 A;  2QK0 A;  4OF1 A;  3A8M B;  1WI7 A;  1OOT A;  4XAX B;  1GBR A;  3I5R A;  1ACM B;  1DJ7 B;  1VQM A;  2EJG A;  2P4T A;  5KE3 A;  2DAQ A;  3CCM A;  1FMV A;  1QP3 A;  3OYG A;  5GAM e;  3PVL A;  4PJO D;  1GFD A;  2K3X A;  2Y4Y A;  1EZZ B;  2HSE B;  1BKB A;  2PNI A;  3EFO A;  4XTX A;  2XIC A;  2FHD A;  2CP5 A;  2O2O A;  3CCM T;  5GAN 5;  2DL8 A;  2KQW A;  4R0K A;  1KHI A;  4IKF A;  3QYG B;  1VIE A;  4IUU A;  3V8K A;  4F17 A;  2DVE A;  5GAO r;  2KT1 A;  3G4S T;  3G1J A;  1OUL A;  1UGQ B;  2V26 A;  1K9M R;  1VQ9 Q;  2DX1 A;  3CCQ Q;  1AD5 A;  2DA9 A;  4JRK A;  4MMK A;  2E4H A;  3M0S A;  3QO3 A;  1GCQ A;  3U23 A;  1I4K 1;  3VS2 A;  2BZ8 A;  1T0H A;  1IXD A;  2DL5 A;  3L2R A;  2NYS A;  4VUB A;  2O4X A;  2HSP A;  3S3N A;  2JTE A;  4C5E A;  1WZO A;  1QVF A;  3RR6 A;  2RHU A;  2CP7 A;  2SRC A;  3I35 A;  2M51 A;  2LRQ A;  1YIT T;  4V2S A;  3JB9 F;  4C0G A;  4RTZ A;  5KE2 A;  4D6W A;  5GAO l;  2QEX Q;  2DD5 A;  3QII A;  1UJY A;  2EQJ A;  3H9N A;  3MJX A;  1NYF A;  2K6D A;  3L2Z A;  2ECZ A;  2YRV A;  2EQI A;  3VU3 C;  3UWN A;  3R6N A;  4N4G A;  3CCE A;  2E5K A;  4RTT A;  4M75 A;  2OAU A;  2L0A A;  1BBZ A;  2JMC A;  2A28 A;  4MDX A;  2GBQ A;  2CP6 A;  2DMO A;  4R56 A;  4CC7 A;  3UDC A;  5GMK h;  4N4I A;  4E7Z A;  3JCM P;  4KGZ B;  1U5S A;  3G7Z A;  3EHQ A;  1LVK A;  4GLM A;  3DLL A;  1WA7 A;  1MMD A;  4PFZ A;  1ZUU A;  5A2Q E;  4J9C A;  2E5Q A;  2CZ7 B;  3HL8 A;  4NL3 A;  2DIG A;  2DYI A;  3ZEH A;  1SPK A;  3OB9 A;  2JTF A;  4CC4 B;  4HVW A;  4BI4 A;  2DRK A;  3EG3 A;  5GAM g;  2K57 A;  3GIB A;  3CBO A;  4RUG A;  1OZ3 A;  3JCM g;  1D09 B;  1G3S A;  1GBQ A;  4Y91 A;  2OX7 A;  2JXB A;  4M7A G;  4XTU A;  3JCM d;  2VGM A;  2XDD A;  4FIB A;  2FEI A;  2FRY A;  5GAN 2;  2E6N A;  2LDM A;  4HXJ A;  1KC8 U;  1YJN A;  2RJF A;  1AT1 B;  2GGR A;  2OTJ Q;  1RAF B;  2MOX A;  3TVT A;  3M0P A;  2RN8 A;  1VYV A;  4M7A B;  1W4S A;  3VKI A;  2J6K A;  3FEO A;  4PKC C;  4GLK A;  1KG1 A;  3V7S A;  2D1X A;  3PGG A;  2LT1 A;  4M78 D;  1M27 C;  2DLP A;  1KK7 A;  8AT1 B;  2F5K A;  4A4G A;  3PIO A;  4C0D B;  4X1V A;  5LJ5 e;  5IXF A;  2CT4 A;  1JRI A;  3ZFJ A;  3N5B B;  6AT1 B;  3QHS A;  4B9X A;  2VWF A;  4DOV A;  1VQ8 A;  2KNB B;  5D6Y A;  4C92 A;  1H3Z A;  4KGV B;  3PNW C;  1KQS A;  3P8B B;  3EGD B;  2O9V A;  1I07 A;  1PWT A;  3RBB B;  1I8F A;  5GAN 8;  1BCM A;  1MMG A;  1WHG A;  4C92 E;  1ZSZ A;  2EVR A;  4JS4 A;  4L5G A;  4CRI A;  4F7U F;  2BZY A;  4QVC A;  3CCQ A;  4EMH A;  3C12 A;  2DZC A;  3CC7 Q;  4C0D C;  2PVG B;  2EYZ A;  3DLM A;  4BDY A;  1VQK A;  3G71 Q;  2ZPE B;  4RKU E;  4A54 A;  1K0S A;  2K5L A;  4CC2 A;  4IUV A;  2JNG A;  2LJ3 A;  5GAN 6;  1VQ9 T;  2XK0 A;  5FU7 B;  3CCQ T;  3CCS Q;  3OS0 A;  1NPR A;  1Q82 U;  4FYY B;  3URG A;  2QI2 A;  5J26 A;  2LC4 A;  1V29 B;  2MCN A;  2X3X D;  4JJB A;  2QEX A;  2EYQ A;  4GY5 A;  1LNX A;  2EKH A;  2JZ2 A;  2V8J A;  3GPL A;  4CI0 C;  3QXE B;  3C4S A;  3NTK A;  1NPP A;  1WJQ A;  2VC8 A;  4KBM B;  2PVO B;  2DVJ A;  4M77 F;  2PTK A;  4FCY A;  2QEX T;  3JCM V;  4M77 G;  2BZX A;  1K73 U;  1NEB A;  2D8H A;  5FU7 C;  2VUB A;  3LW5 E;  4PJN A;  3X28 B;  1EIF A;  1D1A A;  1WHK A;  4XU2 A;  2A3L A;  1VQL Q;  3VV0 A;  3NFC A;  2ZGW A;  2XDB A;  3A8O B;  1VYT A;  4M7D A;  1Z9Q A;  3A5Z B;  2KEA A;  2D6F A;  3J7A F;  4ME7 A;  1RAA B;  4M77 B;  2BTT A;  2L2P A;  1YHQ Q;  2D8J A;  3E9G A;  2EGA A;  4M7D E;  1HJD A;  3X26 B;  2JVV A;  2DD4 A;  2WAC A;  4IIO A;  4RG8 A;  2X35 A;  3HRT A;  2EQK A;  3JRZ A;  1MMA A;  2YT6 A;  3ME9 A;  2A7Y A;  1WFW A;  2A0F B;  4FYV B;  5GAM f;  1G2B A;  3TU4 K;  4QVD A;  2DFU A;  1YJ9 Q;  1K8A C;  2K2V A;  5KYY A;  1W2B A;  1OYX A;  2CDT A;  4M77 C;  2GTJ A;  1E7O A;  1FYN A;  2ED1 A;  3X20 B;  1H8K A;  4HT8 A;  2GQV A;  2O31 A;  2O88 A;  2EPD A;  3M58 A;  1GRI A;  1M30 A;  1X01 A;  4DOW A;  3F70 A;  2OTJ A;  2M1H A;  1VQ7 Q;  1VQ4 Q;  4A4E A;  2AKK A;  4XU1 A;  2DL7 A;  1QQJ A;  3X24 B;  3FJP A;  1U8R A;  2Z0W A;  4LUD A;  4RTX A;  3QKJ A;  1YIJ A;  1QP2 A;  2QAZ A;  4ZN3 A;  3JCM Q;  4M75 D;  3P8H A;  4HA8 A;  3I56 Q;  1HXD A;  2OTJ T;  4XU0 A;  5GAM j;  3H0H A;  2K4Y A;  1M1F A;  1ZQ1 A;  2HKQ B;  2QQS A;  5CR2 A;  5FRO A;  5FWC A;  3REA B;  1QVG P;  1M2V A;  3JCM X;  1Q95 G;  4J9H A;  3MEW A;  1C6V X;  4IUR A;  3A8G B;  3SWN A;  4PJM A;  1QMC A;  1PNJ A;  1OX9 A;  1WPY A;  3VJP A;  4PNO A;  1TS9 A;  4EMK B;  3H0F A;  4F14 A;  3JV3 A;  1JXO A;  3VUB A;  5I2S A;  4FYW B;  1M90 U;  3C0C A;  2GFU A;  3CEY A;  1WJR A;  4K11 A;  3QJY A;  2NWM A;  2DXT A;  2VAS A;  1SF9 A;  1O9S A;  1IGU A;  4E7I A;  3G71 A;  2COY A;  3L2W A;  5DM7 R;  2LX9 A;  3CMA T;  4IUP A;  1HD3 A;  5GAN 7;  2PU9 B;  4A4F A;  5GAN 3;  3UF4 A;  3CCS A;  2XID A;  4LDY A;  1AHJ B;  2CH4 A;  3CC7 T;  3M0Q A;  4EMK C;  2X9H A;  4BB7 A;  3G71 T;  3PT9 A;  3VYG A;  1X27 A;  2ABL A;  1A0N B;  2K79 A;  1TTH B;  3VS0 A;  2JS0 A;  2DL4 A;  3CCJ A;  1N6A A;  3CCS T;  2AK5 A;  4Z89 A;  2FZC B;  4PJL A;  3QDF A;  4JZ3 A;  2ZPB B;  1YN8 A;  2NUP A;  3OMC A;  1Y96 A;  3QZ9 B;  4FSX A;  2E41 A;  8ATC B;  1WGS A;  2DEQ A;  1KD1 U;  1T0J A;  1IGQ A;  5FW9 A;  2E10 A;  3M4Y A;  1WHL A;  4HCK A;  4EPC A;  1R0B G;  3SB2 A;  1D0X A;  2R58 A;  4PFP A;  2DBM A;  3E2U A;  4C92 D;  1JJ2 A;  4OGC A;  3CQT A;  1VQL T;  3E9F A;  3HFN A;  1VUB A;  2ROL A;  3V7R A;  5HCK A;  4ELZ C;  1UFF A;  1QWE A;  2RF0 A;  1VQN Q;  1N27 A;  5IN1 A;  3CC2 Q;  1D0Z A;  1YHQ T;  1AZG B;  2QXF A;  1H64 1;  3L2U A;  1SEM A;  3GNF B;  5LJ3 h;  2V1Q A;  5CKB A;  5LJ5 f;  1Q7Y C;  1WHH A;  2G6F X;  4C8Q F;  1YJ9 A;  1EX4 A;  2KI7 A;  5KYN A;  1UGS B;  1KC8 R;  3THK A;  5HK3 A;  5GAO n;  1AVZ C;  2EIF A;  1LPL A;  2EJF A;  2L5Q A;  1F1B B;  1VQP Q;  4LD9 K;  2EQU A;  3MO8 A;  1PG5 B;  1BCO A;  3OYN A;  1YJ9 T;  3CME Q;  1M8M A;  5FWB A;  1VQ7 A;  4IIM A;  4MZM A;  1M1K U;  1UDL A;  3FC3 A;  2KRS A;  2CSI A;  4WTO B;  3KFV A;  3NTH A;  2D0Q B;  5GMK e;  2DEU A;  2XI9 A;  3LYI A;  1H3H A;  3I56 A;  2K5I A;  3FLG A;  1WYX A;  2ZAE A;  4WCI A;  3V8L A;  1VQ7 T;  1VQ4 T;  2KT8 A;  1QVG S;  2LX7 A;  5LJ5 j;  1M1K C;  1AWX A;  5GAN h;  4KRT A;  4ZGJ B;  1YBY A;  2DTI A;  2KRM A;  2M0O A;  3TSW A;  1U1S A;  1Q81 C;  2RJE A;  2ROT A;  3I56 T;  4M7D D;  2MF2 A;  4HCZ A;  2LJ0 A;  4C8Q C;  1UGP B;  4X9D A;  1VQ5 Q;  1I81 A;  4OMN A;  2BKD N;  4LDW A;  5ECA A;  5HY6 A;  1KSW A;  4IUT A;  1B3Q A;  1B34 A;  2PVD B;  2DXC A;  1ZSG A;  2EW3 A;  3G4S A;  2X4J A;  1U3O A;  4BE1 A;  2FRW A;  4EIK A;  4JRI A;  4BY6 B;  3MET A;  1Q82 R;  4HT9 A;  4PLI A;  3GP8 A;  1MGQ A;  2E3I A;  2DER A;  4KT0 E;  2CKK A;  2XHC A;  4PL6 A;  4XTY A;  3QWX X;  2FO0 A;  5KYU B;  4R55 A;  1Y57 A;  2RI2 A;  3RMS A;  4AFU C;  4BAC A;  2KY9 A;  3VS7 A;  4QQD A;  1AEY A;  1YIT A;  2O9S A;  2WSC E;  1MNE A;  5M9O A;  2LQN A;  3OYJ A;  2JJ9 A;  1SKU B;  4J7I A;  1K73 R;  2ZPF B;  1AWW A;  4BY6 C;  4RCB A;  1M3C A;  4CC3 A;  4EDU A;  5EG2 A;  1KQ2 A;  3P8D A;  5IXB A;  2LQW A;  2QQR A;  1VIF A;  1UB4 A;  1BU1 A;  3AT1 B;  1M5Q 1;  4OVA A;  2FG0 A;  1V76 A;  3OBW A;  1VQ6 Q;  2QG9 B;  4OP0 A;  1NE8 A;  2MWO A;  4LDU A;  1ZA1 B;  2IG0 A;  2V1R A;  1Y0M A;  4XK8 E;  3CBM A;  1J3T A;  2HMA A;  3A1P A;  2JOY A;  5CIU A;  1FMW A;  1WJS A;  2H8H A;  1BIB A;  1QW1 A;  3BY7 A;  4M75 E;  5DLO A;  2COW A;  2CGH A;  4RMO A;  1IHV A;  4AG1 C;  4PLL A;  4A4K A;  3L2V A;  3RKY A;  1MV0 B;  2KXC A;  4A63 B;  1RL2 A;  3QSU A;  2DF6 A;  1JU5 C;  2RB6 A;  4Z8A A;  1Q86 C;  3E19 A;  2WSF E;  2XKO C;  2HQX A;  1VQN T;  3M5A A;  2QQA A;  3CC2 T;  1YP5 A;  2C0I A;  4HCB A;  2DJQ A;  4N0A C;  2F2X A;  3CCV Q;  3I55 Q;  1RAB B;  2ZZD A;  1XTD A;  1KFZ A;  1D3B B;  3QWY A;  2J05 A;  4P5N A;  5HKC A;  2RM4 A;  3GBQ A;  5GAM d;  1SHF A;  4PK4 A;  4II1 A;  1VQP T;  2OTL Q;  4M7A F;  1KQ1 A;  2CZ1 B;  3CME T;  2O4X B;  3J81 E;  1ABO A;  1E6H A;  1PSE A;  2QQB A;  3QBY A;  3VS4 A;  3RES A;  2DXB A;  3CC4 Q;  1N5Z A;  2NUT B;  4L6V 5;  4J6Y A;  4QQ6 A;  5GAN 4;  2H3J A;  2BIV A;  1SG5 A;  7AT1 B;  1N9R A;  1FMK A;  2RHI A;  1KHC A;  2YLB A;  4F7U A;  1GCP A;  2PUO B;  4BE0 A;  2P0K A;  3JCM h;  1M90 R; 
#chains in the Genus database with same CATH homology
 2F2V A;  2YT6 A;  1M3B A;  2RQW A;  1WFW A;  4M4Z A;  2IIM A;  5IH2 A;  4GBQ A;  1G2B A;  4ESR A;  2FPF A;  1EFN A;  2L3Q A;  2ENM A;  4AG2 C;  1ZX6 A;  1WXB A;  1Z9Z A;  4RTV A;  4J9F A;  2CDT A;  2KR3 A;  2GTJ A;  1E7O A;  1FYN A;  1PKT A;  2ED1 A;  1H8K A;  3ULR B;  2O31 A;  2O88 A;  2EPD A;  1JQQ A;  2JS2 A;  2KE9 A;  2MIO A;  1GRI A;  1K76 A;  2VKN A;  1ABQ A;  1M30 A;  2NUZ A;  3IQL A;  2HCK A;  2AKK A;  2HEQ A;  2DM1 A;  1HSQ A;  2DL7 A;  4LUD A;  4RTX A;  4D8D A;  4LN2 A;  1UG1 A;  1QLY A;  2AZV A;  5IHN A;  1W1F A;  3H0H A;  2KYB A;  1NLO C;  2JM8 A;  2EBP A;  5FWC A;  2X3W D;  3REA B;  1NEG A;  1UUE A;  4J9H A;  4QT7 A;  3EGU A;  1W6X A;  1T3L A;  3PVQ A;  3H0I A;  4LE9 A;  2VVK A;  3NPF A;  3NGP A;  3A98 A;  1PNJ A;  2K3B A;  2OJ2 A;  4FSS A;  4RTY A;  1AWO A;  1QCF A;  4OMP A;  3H0F A;  1UE9 A;  2LNH B;  4AFQ C;  4F14 A;  2KRO A;  1JXO A;  3JV3 A;  4JJD A;  3M0R A;  3C0C A;  1AWJ A;  2EGE A;  2K7A A;  4K11 A;  1QKW A;  2RQT A;  1PRL C;  2NWM A;  2YUN A;  1UGV A;  4ZNX A;  2QDL A;  3EG1 A;  5EC7 A;  3NMZ C;  2RMO A;  5IHI A;  2KGT A;  1HD3 A;  1X2K A;  1LCK A;  4ORZ A;  1TG0 A;  1WI7 A;  3UF4 A;  1X43 A;  2CH4 W;  2CH4 A;  3M0Q A;  2P4R A;  1OOT A;  1RUW A;  1V1C A;  1JXM A;  1GBR A;  2RPN A;  4J9B A;  3I5R A;  1X27 A;  1JO8 A;  2ABL A;  1A0N B;  2DNU A;  2K79 A;  2OAW A;  3VS0 A;  2JS0 A;  2DL4 A;  1OPK A;  2CRE A;  1JEG A;  3PVL A;  1W70 A;  1GFD A;  2AK5 A;  4Z89 A;  4JZ3 A;  2PNI A;  1YN8 A;  1IO6 A;  4OMO A;  1WXT A;  2HBW A;  1GCQ C;  2O2O A;  1T0J A;  2FPE A;  5FW9 A;  2DL8 A;  2EYY A;  2RQU A;  4HCK A;  1ARK A;  1UHC A;  4OML A;  1I0C A;  4R0K A;  1QKX A;  3REB B;  4J9D A;  4F17 A;  2A37 A;  2KT1 A;  1G83 A;  2DX1 A;  2DBM A;  1AD5 A;  2DA9 A;  4AFZ C;  1UEC A;  2K9G A;  1CKA A;  3M0S A;  3U23 A;  1GCQ A;  3VS2 A;  1SHG A;  2BZ8 A;  1H92 A;  3EG2 A;  1T0H A;  3CQT A;  2FPD A;  1X6G A;  2ROL A;  5HCK A;  1WXU A;  2YDL A;  2DL5 A;  2YUO A;  2KBT A;  1YWP A;  1UFF A;  1QWE A;  2HSP A;  2RF0 A;  2JTE A;  2SEM A;  4D8K A;  1AZG B;  2SRC A;  3I35 A;  2JMA A;  1SEM A;  2M51 A;  1CKB A;  4LNP A;  2V1Q A;  2G6F X;  2LP5 A;  5I11 A;  4RTZ A;  1UJ0 A;  1UJY A;  2W0Z A;  2ED0 A;  1NYF A;  1PHT A;  2K6D A;  4F16 A;  1ZLM A;  2ECZ A;  3THK A;  2EQI A;  1AVZ C;  2OI3 A;  3R6N A;  2B86 A;  2E5K A;  4RTT A;  2GNC A;  1M8M A;  2DYB A;  5FWB A;  2L0A A;  2J6O A;  2JMC A;  1BBZ A;  1K4U S;  2A28 A;  2GBQ A;  1M3A A;  4IIM A;  1UDL A;  1PRM C;  2DMO A;  4CC7 A;  1MUZ A;  2KRS A;  2RQR A;  4Y92 A;  2CSI A;  1WLP B;  1SRM A;  3KFV A;  1U5S A;  1YCS B;  3EHQ A;  3RNJ A;  3VS6 A;  4GLM A;  1E6G A;  1H3H A;  1WA7 A;  2RNA A;  4WCI A;  1WYX A;  1ZUU A;  4J9C A;  3UAT A;  3ZL7 C;  5GJW B;  3VRY A;  2KT8 A;  1B07 A;  2LX7 A;  5L23 A;  1AWX A;  1S1N A;  4KRT A;  2CT3 A;  2LZ6 B;  4JPB W;  2KRM A;  3TSW A;  1NG2 A;  2GTO A;  1SPK A;  2GQI A;  2ROT A;  4CC4 B;  4HVW A;  4Z88 A;  1K1Z A;  3I9Q A;  2D0N A;  2DRK A;  3UA6 A;  2LJ0 A;  3EG3 A;  2YSQ A;  1NM7 A;  2A08 A;  1XOV A;  1RLP C;  4OMN A;  1KJW A;  4RUG A;  5ECA A;  1OEB A;  2JM9 A;  2C0O A;  1KSW A;  4DEX A;  2EGC A;  1UHF A;  1SRL A;  3EG0 A;  2J7I A;  1B3Q A;  1GBQ A;  4LUE A;  1ZSG A;  2JXB A;  1ZUY A;  2YUQ A;  2EW3 A;  3SHW A;  1U3O A;  2I0N A;  2FRW A;  2PZ1 A;  1X6B A;  2FEI A;  2FRY A;  4J9I A;  4EIK A;  1WDX A;  4HXJ A;  4J9G A;  1BB9 A;  2AKL A;  2GGR A;  2KRN A;  2MOX A;  3TVT A;  3M0P A;  4HVU A;  5IHK A;  2RN8 A;  2W10 A;  1VYV A;  4OMQ A;  1AZE A;  4AFS C;  2A36 A;  1TUC A;  1CSK A;  3QWX X;  2FO0 A;  2J6K A;  1YNZ A;  1K9A A;  1UTI A;  1Y57 A;  4AFU C;  2D1X A;  1X69 A;  2CUD A;  4DEY A;  1M27 C;  2LMJ A;  3VS7 A;  2DLP A;  1AEY A;  3UA7 A;  2L3P A;  2O9S A;  3VS5 A;  2DBK A;  3VS1 A;  3PE0 A;  1GFC A;  2LQN A;  2LCS A;  1X2Q A;  1WX6 A;  4X1V A;  1ZUK A;  3M0U A;  2L3S A;  5IXF A;  1AWW A;  1VYU A;  2HDA A;  2CT4 A;  2EYW A;  1MV3 A;  2J6F A;  2RQV A;  1M3C A;  2VWF A;  4CC3 A;  2DE0 X;  4HVV A;  2KNB B;  3LH5 A;  1WIE A;  1TUD A;  2JT4 A;  5IXB A;  2LQW A;  2O9V A;  1I07 A;  1PWT A;  1BU1 A;  3I5S A;  2LJ1 A;  3RBB B;  2M0Y A;  2EVR A;  2FG0 A;  2BZY A;  2EYX A;  4J9E A;  3SEM A;  1SSH A;  5GJV B;  1YWO A;  2V1R A;  2EYZ A;  2XMF A;  1I1J A;  1Y0M A;  1J3T A;  4OMM A;  1K0S A;  2H8H A;  4JZ4 A;  4CC2 A;  2LJ3 A;  2ESW A;  1RI9 A;  2CSQ A;  4E6R A;  4AG1 C;  1QWF A;  1MV0 B;  2KXC A;  2MCN A;  4A63 B;  3TSZ A;  2AZS A;  2X3X D;  1VA7 A;  4JJB A;  3EHR A;  2DF6 A;  1JU5 C;  2KXD A;  4Z8A A;  2EKH A;  2K2M A;  3NHN A;  1NYG A;  1YP5 A;  1BK2 A;  2C0I A;  3FJ5 A;  1NLP C;  1AOJ A;  2KYM A;  2DJQ A;  2F2X A;  1GL5 A;  1K0X A;  2J06 A;  2DVJ A;  2PTK A;  1KFZ A;  2DL3 A;  1RLQ C;  2DIL A;  3VRZ A;  3QWY A;  2J05 A;  2BZX A;  1T3S A;  1NEB A;  2D8H A;  3GBQ A;  1PKS A;  1SHF A;  1OPL A;  4JJC A;  1U06 A;  4RTU A;  1VYT A;  3H41 A;  1Z9Q A;  2KEA A;  3O5Z A;  1ZBJ A;  2DRM A;  2CUB A;  1ABO A;  1E6H A;  3VS3 A;  2BTT A;  4RTW A;  2L2P A;  3VS4 A;  2F2W A;  1KIK A;  2D8J A;  1N5Z A;  2EGA A;  1HJD A;  2JW4 A;  2C0T A;  5I22 A;  2YUP A;  4IIO A;  1FMK A;  1OV3 A;  1GCP A;  3M0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...