2BTXA

Solution nmr structure of the complex of alpha-bungarotoxin with a library derived peptide, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title Three-dimensional solution structure of the complex of alpha-bungarotoxin with a library-derived peptide.
pubmed doi rcsb
molecule tags Complex (toxin/peptide)
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1998-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2btxA00
1JBDA 1UG4A 4ZQYA 1ES7B 1FRAA 1VB0A 2UWRA 2HLQA 1BTEA 2MJ4A 1YWHA 4OM5A 4FAOE 1KS6A 1FF4A 2PJYB 1LXGA 1I02A 3EBXA 1NTXA 1CDTA 3QB4B 4HQPF 1FSCA 1KXIA 1KBTA 1KU6B 2H7ZA 2K3GA 1NEAA 1TXBA 3U74U 1ONJA 2X8BB 1QKDA 2ERAA 1IDLA 2I9BE 2NBTA 3NDSA 5IMTD 1CDSA 2PJYC 1IDGA 4AEAA 2LCRA 2BTXA 1IDHA 2L03A 1CDQA 1MAHF 2CTXA 4RUDA 1TXAA 2CCXA 1CXOA 1HAAA 4DO8A 4UY2C 1IQ9A 1G6MA 1REWC 1V6PA 2H62D 1FSSB 1KBAA 2VLWA 1LSIA 1LX5B 1NYSA 2MHYA 2MJYA 3ERAA 2QJAC 1ABTA 4BDTB 2MUPA 1KFHA 1XT3A 2H5FA 1IJCA 2MUOA 1KTZB 1HOYA 1B41B 5DZ5A 1RGJA 2JVEA 1CODA 1F94A 1M9ZA 2MJ0A 2LA1A 2OFSA 1LXHA 1BXPA 2CRTA 3LAQU 3BT2U 1CRFA 1HC9B 4BIKB 1S4YA 5IMYC 3BT1U 2GOOC 1MR6A 3PLCA 1IK8A 2HLRA 1HAJA 4OM4A 1COEA 1TGXA 4XJJA 1NYUA 4LFTA 3NH7A 1CDRA 3VTSA 2CRSA 1F8UB 1NXBA 1JE9A 3KFDE 1LJZA 2H64B 1CHVS 4P7UA 1RL5A 2JQPA 1CXNA 2GOOB 1HC9A 1CCQA 3FEVA 1NTNA 3HH7A 2BHIA 3EVSC 5EBXA 1ZADA 2QC1A 1FFJA 2QJBC 1FASA 4IYEA 2H64C 2QJ9C 2FD6U 2N99A 2ABXA 1L4WA 1QKEA 3KFDI 1H0JA 2UX2A 5DO6A 1KBSA 1CB9A 1IDIA 4QTIU 1CVOA 1JGKA 1KC4A 2CDXA 1CTXA 1ERGA 1PLOA 6EBXA 1IKCA 2H8UA 1DRSA 2H62C 4EY8B 2J8BA 1KL8A 3U73U 1W6BA 2L5SA 3NEQA 1QM7A 1CREA 1TFSA 2H7ZB 2MFAA 4FAOC 1NORA 5DU1A 1ERAA
chains in the Genus database with same CATH superfamily
4KSNA 1JBDA 1UG4A 4ZQYA 1ES7B 1FRAA 1VB0A 2UWRA 2HLQA 1BTEA 2MJ4A 1YWHA 4OM5A 4FAOE 1KS6A 1FF4A 2PJYB 1LXGA 1I02A 3EBXA 1NTXA 1CDTA 3QB4B 4HQPF 1FSCA 1KXIA 1KBTA 1KU6B 2H7ZA 2K3GA 1NEAA 1TXBA 3U74U 1ONJA 2X8BB 1QKDA 2ERAA 1IDLA 2I9BE 2NBTA 3NDSA 5IMTD 1CDSA 2PJYC 1IDGA 4AEAA 2LCRA 2BTXA 1IDHA 2L03A 1CDQA 1MAHF 2CTXA 4RUDA 1TXAA 2CCXA 1CXOA 1HAAA 4DO8A 4UY2C 1IQ9A 1G6MA 1REWC 1V6PA 2H62D 1FSSB 1KBAA 2VLWA 1LSIA 1LX5B 1NYSA 2MHYA 2MJYA 3ERAA 2QJAC 1ABTA 4BDTB 2MUPA 1KFHA 1XT3A 2H5FA 1IJCA 2MUOA 1KTZB 1HOYA 1B41B 5DZ5A 1RGJA 2JVEA 1CODA 1F94A 1M9ZA 2MJ0A 2LA1A 2OFSA 1LXHA 1BXPA 2CRTA 3LAQU 3BT2U 1CRFA 1HC9B 4BIKB 1S4YA 5IMYC 3BT1U 2GOOC 1MR6A 3PLCA 1IK8A 2HLRA 1HAJA 4OM4A 1COEA 1TGXA 4XJJA 1NYUA 4LFTA 3NH7A 1CDRA 3VTSA 2CRSA 1F8UB 1NXBA 1JE9A 3KFDE 1LJZA 2H64B 1CHVS 4P7UA 1RL5A 2JQPA 1CXNA 2GOOB 1HC9A 1CCQA 3FEVA 1NTNA 3HH7A 2BHIA 3EVSC 5EBXA 1ZADA 2QC1A 1FFJA 2QJBC 1FASA 4IYEA 2H64C 2QJ9C 2FD6U 2N99A 2ABXA 1L4WA 1QKEA 3KFDI 1H0JA 2UX2A 5DO6A 1KBSA 1CB9A 1IDIA 4QTIU 1CVOA 1JGKA 1KC4A 2CDXA 1CTXA 1ERGA 1PLOA 6EBXA 1IKCA 2H8UA 1DRSA 2H62C 4EY8B 2J8BA 1KL8A 3U73U 1W6BA 2L5SA 3NEQA 1QM7A 1CREA 1TFSA 2H7ZB 2MFAA 4FAOC 1NORA 5DU1A 1ERAA
chains in the Genus database with same CATH topology
4KSNA 1JBDA 1UG4A 4ZQYA 1ES7B 1FRAA 1VB0A 2UWRA 2HLQA 1BTEA 2MJ4A 1YWHA 4OM5A 4FAOE 1KS6A 1FF4A 2PJYB 1LXGA 1I02A 3EBXA 1NTXA 1CDTA 3QB4B 4HQPF 1FSCA 1KXIA 1KBTA 1KU6B 2H7ZA 2K3GA 1NEAA 1TXBA 3U74U 1ONJA 2X8BB 1QKDA 2ERAA 1IDLA 2I9BE 2NBTA 3NDSA 5IMTD 1CDSA 2PJYC 1IDGA 4AEAA 2LCRA 2BTXA 1IDHA 2L03A 1CDQA 1MAHF 2CTXA 4RUDA 1TXAA 2CCXA 1CXOA 1HAAA 4DO8A 4UY2C 1IQ9A 1G6MA 1REWC 1V6PA 2H62D 1FSSB 1KBAA 2VLWA 1LSIA 1LX5B 1NYSA 2MHYA 2MJYA 3ERAA 2QJAC 1ABTA 4BDTB 2MUPA 1KFHA 1XT3A 2H5FA 1IJCA 2MUOA 1KTZB 1HOYA 1B41B 5DZ5A 1RGJA 2JVEA 1CODA 1F94A 1M9ZA 2MJ0A 2LA1A 2OFSA 1LXHA 1BXPA 2CRTA 3LAQU 3BT2U 1CRFA 1HC9B 4BIKB 1S4YA 5IMYC 3BT1U 2GOOC 1MR6A 3PLCA 1IK8A 2HLRA 1HAJA 4OM4A 1COEA 1TGXA 4XJJA 1NYUA 4LFTA 3NH7A 1CDRA 3VTSA 2CRSA 1F8UB 1NXBA 1JE9A 3KFDE 1LJZA 2H64B 1CHVS 4P7UA 1RL5A 2JQPA 1CXNA 2GOOB 1HC9A 1CCQA 3FEVA 1NTNA 3HH7A 2BHIA 3EVSC 5EBXA 1ZADA 2QC1A 1FFJA 2QJBC 1FASA 4IYEA 2H64C 2QJ9C 2FD6U 2N99A 2ABXA 1L4WA 1QKEA 3KFDI 1H0JA 2UX2A 5DO6A 1KBSA 1CB9A 1IDIA 4QTIU 1CVOA 1JGKA 1KC4A 2CDXA 1CTXA 1ERGA 1PLOA 6EBXA 1IKCA 2H8UA 1DRSA 2H62C 4EY8B 2J8BA 1KL8A 3U73U 1W6BA 2L5SA 3NEQA 1QM7A 1CREA 1TFSA 2H7ZB 2MFAA 4FAOC 1NORA 5DU1A 1ERAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBD A;  1UG4 A;  4ZQY A;  1ES7 B;  1FRA A;  1VB0 A;  2UWR A;  2HLQ A;  1BTE A;  2MJ4 A;  1YWH A;  4OM5 A;  4FAO E;  1KS6 A;  1FF4 A;  2PJY B;  1LXG A;  1I02 A;  3EBX A;  1NTX A;  1CDT A;  3QB4 B;  4HQP F;  1FSC A;  1KXI A;  1KBT A;  1KU6 B;  2H7Z A;  2K3G A;  1NEA A;  1TXB A;  3U74 U;  1ONJ A;  2X8B B;  1QKD A;  2ERA A;  1IDL A;  2I9B E;  2NBT A;  3NDS A;  5IMT D;  1CDS A;  2PJY C;  1IDG A;  4AEA A;  2LCR A;  2BTX A;  1IDH A;  2L03 A;  1CDQ A;  1MAH F;  2CTX A;  4RUD A;  1TXA A;  2CCX A;  1CXO A;  1HAA A;  4DO8 A;  4UY2 C;  1IQ9 A;  1G6M A;  1REW C;  1V6P A;  2H62 D;  1FSS B;  1KBA A;  2VLW A;  1LSI A;  1LX5 B;  1NYS A;  2MHY A;  2MJY A;  3ERA A;  2QJA C;  1ABT A;  4BDT B;  2MUP A;  1KFH A;  1XT3 A;  2H5F A;  1IJC A;  2MUO A;  1KTZ B;  1HOY A;  1B41 B;  5DZ5 A;  1RGJ A;  2JVE A;  1COD A;  1F94 A;  1M9Z A;  2MJ0 A;  2LA1 A;  2OFS A;  1LXH A;  1BXP A;  2CRT A;  3LAQ U;  3BT2 U;  1CRF A;  1HC9 B;  4BIK B;  1S4Y A;  5IMY C;  3BT1 U;  2GOO C;  1MR6 A;  3PLC A;  1IK8 A;  2HLR A;  1HAJ A;  4OM4 A;  1COE A;  1TGX A;  4XJJ A;  1NYU A;  4LFT A;  3NH7 A;  1CDR A;  3VTS A;  2CRS A;  1F8U B;  1NXB A;  1JE9 A;  3KFD E;  1LJZ A;  2H64 B;  1CHV S;  4P7U A;  1RL5 A;  2JQP A;  1CXN A;  2GOO B;  1HC9 A;  1CCQ A;  3FEV A;  1NTN A;  3HH7 A;  2BHI A;  3EVS C;  5EBX A;  1ZAD A;  2QC1 A;  1FFJ A;  2QJB C;  1FAS A;  4IYE A;  2H64 C;  2QJ9 C;  2FD6 U;  2N99 A;  2ABX A;  1L4W A;  1QKE A;  3KFD I;  1H0J A;  2UX2 A;  5DO6 A;  1KBS A;  1CB9 A;  1IDI A;  4QTI U;  1CVO A;  1JGK A;  1KC4 A;  2CDX A;  1CTX A;  1ERG A;  1PLO A;  6EBX A;  1IKC A;  2H8U A;  1DRS A;  2H62 C;  4EY8 B;  2J8B A;  1KL8 A;  3U73 U;  1W6B A;  2L5S A;  3NEQ A;  1QM7 A;  1CRE A;  1TFS A;  2H7Z B;  2MFA A;  4FAO C;  1NOR A;  5DU1 A;  1ERA A; 
#chains in the Genus database with same CATH topology
 4KSN A;  1JBD A;  1UG4 A;  4ZQY A;  1ES7 B;  1FRA A;  1VB0 A;  2UWR A;  2HLQ A;  1BTE A;  2MJ4 A;  1YWH A;  4OM5 A;  4FAO E;  1KS6 A;  1FF4 A;  2PJY B;  1LXG A;  1I02 A;  3EBX A;  1NTX A;  1CDT A;  3QB4 B;  4HQP F;  1FSC A;  1KXI A;  1KBT A;  1KU6 B;  2H7Z A;  2K3G A;  1NEA A;  1TXB A;  3U74 U;  1ONJ A;  2X8B B;  1QKD A;  2ERA A;  1IDL A;  2I9B E;  2NBT A;  3NDS A;  5IMT D;  1CDS A;  2PJY C;  1IDG A;  4AEA A;  2LCR A;  2BTX A;  1IDH A;  2L03 A;  1CDQ A;  1MAH F;  2CTX A;  4RUD A;  1TXA A;  2CCX A;  1CXO A;  1HAA A;  4DO8 A;  4UY2 C;  1IQ9 A;  1G6M A;  1REW C;  1V6P A;  2H62 D;  1FSS B;  1KBA A;  2VLW A;  1LSI A;  1LX5 B;  1NYS A;  2MHY A;  2MJY A;  3ERA A;  2QJA C;  1ABT A;  4BDT B;  2MUP A;  1KFH A;  1XT3 A;  2H5F A;  1IJC A;  2MUO A;  1KTZ B;  1HOY A;  1B41 B;  5DZ5 A;  1RGJ A;  2JVE A;  1COD A;  1F94 A;  1M9Z A;  2MJ0 A;  2LA1 A;  2OFS A;  1LXH A;  1BXP A;  2CRT A;  3LAQ U;  3BT2 U;  1CRF A;  1HC9 B;  4BIK B;  1S4Y A;  5IMY C;  3BT1 U;  2GOO C;  1MR6 A;  3PLC A;  1IK8 A;  2HLR A;  1HAJ A;  4OM4 A;  1COE A;  1TGX A;  4XJJ A;  1NYU A;  4LFT A;  3NH7 A;  1CDR A;  3VTS A;  2CRS A;  1F8U B;  1NXB A;  1JE9 A;  3KFD E;  1LJZ A;  2H64 B;  1CHV S;  4P7U A;  1RL5 A;  2JQP A;  1CXN A;  2GOO B;  1HC9 A;  1CCQ A;  3FEV A;  1NTN A;  3HH7 A;  2BHI A;  3EVS C;  5EBX A;  1ZAD A;  2QC1 A;  1FFJ A;  2QJB C;  1FAS A;  4IYE A;  2H64 C;  2QJ9 C;  2FD6 U;  2N99 A;  2ABX A;  1L4W A;  1QKE A;  3KFD I;  1H0J A;  2UX2 A;  5DO6 A;  1KBS A;  1CB9 A;  1IDI A;  4QTI U;  1CVO A;  1JGK A;  1KC4 A;  2CDX A;  1CTX A;  1ERG A;  1PLO A;  6EBX A;  1IKC A;  2H8U A;  1DRS A;  2H62 C;  4EY8 B;  2J8B A;  1KL8 A;  3U73 U;  1W6B A;  2L5S A;  3NEQ A;  1QM7 A;  1CRE A;  1TFS A;  2H7Z B;  2MFA A;  4FAO C;  1NOR A;  5DU1 A;  1ERA A; 
#chains in the Genus database with same CATH homology
 4KSN A;  1JBD A;  1UG4 A;  4ZQY A;  1ES7 B;  1FRA A;  1VB0 A;  2UWR A;  2HLQ A;  1BTE A;  2MJ4 A;  1YWH A;  4OM5 A;  4FAO E;  1KS6 A;  1FF4 A;  2PJY B;  1LXG A;  1I02 A;  3EBX A;  1NTX A;  1CDT A;  3QB4 B;  4HQP F;  1FSC A;  1KXI A;  1KBT A;  1KU6 B;  2H7Z A;  2K3G A;  1NEA A;  1TXB A;  3U74 U;  1ONJ A;  2X8B B;  1QKD A;  2ERA A;  1IDL A;  2I9B E;  2NBT A;  3NDS A;  5IMT D;  1CDS A;  2PJY C;  1IDG A;  4AEA A;  2LCR A;  2BTX A;  1IDH A;  2L03 A;  1CDQ A;  1MAH F;  2CTX A;  4RUD A;  1TXA A;  2CCX A;  1CXO A;  1HAA A;  4DO8 A;  4UY2 C;  1IQ9 A;  1G6M A;  1REW C;  1V6P A;  2H62 D;  1FSS B;  1KBA A;  2VLW A;  1LSI A;  1LX5 B;  1NYS A;  2MHY A;  2MJY A;  3ERA A;  2QJA C;  1ABT A;  4BDT B;  2MUP A;  1KFH A;  1XT3 A;  2H5F A;  1IJC A;  2MUO A;  1KTZ B;  1HOY A;  1B41 B;  5DZ5 A;  1RGJ A;  2JVE A;  1COD A;  1F94 A;  1M9Z A;  2MJ0 A;  2LA1 A;  2OFS A;  1LXH A;  1BXP A;  2CRT A;  3LAQ U;  3BT2 U;  1CRF A;  1HC9 B;  4BIK B;  1S4Y A;  5IMY C;  3BT1 U;  2GOO C;  1MR6 A;  3PLC A;  1IK8 A;  2HLR A;  1HAJ A;  4OM4 A;  1COE A;  1TGX A;  4XJJ A;  1NYU A;  4LFT A;  3NH7 A;  1CDR A;  3VTS A;  2CRS A;  1F8U B;  1NXB A;  1JE9 A;  3KFD E;  1LJZ A;  2H64 B;  1CHV S;  4P7U A;  1RL5 A;  2JQP A;  1CXN A;  2GOO B;  1HC9 A;  1CCQ A;  3FEV A;  1NTN A;  3HH7 A;  2BHI A;  3EVS C;  5EBX A;  1ZAD A;  2QC1 A;  1FFJ A;  2QJB C;  1FAS A;  4IYE A;  2H64 C;  2QJ9 C;  2FD6 U;  2N99 A;  2ABX A;  1L4W A;  1QKE A;  3KFD I;  1H0J A;  2UX2 A;  5DO6 A;  1KBS A;  1CB9 A;  1IDI A;  4QTI U;  1CVO A;  1JGK A;  1KC4 A;  2CDX A;  1CTX A;  1ERG A;  1PLO A;  6EBX A;  1IKC A;  2H8U A;  1DRS A;  2H62 C;  4EY8 B;  2J8B A;  1KL8 A;  3U73 U;  1W6B A;  2L5S A;  3NEQ A;  1QM7 A;  1CRE A;  1TFS A;  2H7Z B;  2MFA A;  4FAO C;  1NOR A;  5DU1 A;  1ERA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...