2BUDA

The solution structure of the chromo barrel domain from the males- absent on the first (mof) protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
GSHMDPLMQKIDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Chromo Barrel Domain from the Mof Acetyltransferase
pubmed doi rcsb
molecule keywords MALES-ABSENT ON THE FIRST PROTEIN
molecule tags Transferase
source organism Drosophila melanogaster
total genus 7
structure length 92
sequence length 92
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2budA00
1RI0A 2BIVA 3OYGA 3S3MA 3L2UA 4PLIA 4B9WA 2RHXA 3KUFA 3LGFA 5FRMA 2G3RA 1WJSA 5KE3A 3PMIA 2D9TA 2E5QA 2DIGA 3FC3A 4BE0A 3P8DA 3MEAA 3OYNA 3FEOA 3BDLA 3LX7A 4IUUA 2X35A 4QVZA 5FROA 2X4XA 1WJQA 2L89A 3F70A 4FL6A 4ZTFA 4PL6A 5KCHA 3EAEA 3OYKA 3L42A 3LH0A 2QQRA 3OYHA 1OZ2A 4LD6A 5C6SA 3LGLA 4IUTA 4ZTJA 2K3YA 2R58A 3NTIA 3P8HA 3OYCA 3FLGA 3PNWC 4CRIA 2EQJA 2QQSA 3MEWA 2RI5A 5M9OA 5FRNA 2P0KA 2EQUA 2DAQA 2XK0A 3NTHA 3QIIA 3S3OA 4NS5A 3GOXA 3H6ZA 3OMCA 3Q1JA 4Z02A 2LVMA 4A4GA 3NTKA 3E9FA 5D6YA 3OYDA 2B8AA 1MHNA 4QW2A 2RI3A 2L3RA 2X4WA 3L2VA 2EKOA 4UC4A 2LCCA 3S3NA 2K3XA 3MEVA 1WGSA 4X34A 2RHZA 2GFUA 3C4SA 2R57A 2HQEA 4BE1A 4E7LA 3E9GA 2F5KA 5KH6A 2DIQA 4E7KA 2MWPA 2RJDA 4E7IA 3QBYA 4N4IA 3LYIA 3H8ZA 3CEYA 2R5MA 2BUDA 3META 5IAYA 1KHCA 2RHYA 2CKKA 4BDZA 2MWOA 5CIUA 3OYIA 3DLMA 3OA6A 3S6WA 4E7JA 2IG0A 2LRQA 4C5GA 3MEUA 2RHUA 4A4HA 2LTOA 3L2QA 3MO8A 4GY5A 3OYBA 2M16A 2RJEA 3QJ6A 2PQWA 2JTFA 2VYTA 3OYAA 2RJCA 2NLUA 4OVAA 4FU6A 4IURA 4B9XA 4C5EA 3OYJA 4E7HA 4IKFA 2GFAA 4HCZA 2R5AA 2EFIA 3SD4A 2M0OA 3FDRA 4IUPA 4QQDA 3OYLA 3OS1A 3MP6A 3PFSA 4BD3A 3MP8A 4N4HA 2YRVA 4BDYA 4II1A 4C5HA 3LLRA 4A4FA 3ASKA 3M9QA 3L2RA 3L2WA 4Q5WA 2BKDN 3PMTA 4BE2A 3OYEA 3OB9A 2LDMA 1XNIA 4N4GA 3OS0A 2GF7A 3DB3A 5D6XA 2E6NA 5J39A 3QKJA 5KCOA 1OYXA 3O8VA 3ZEHA 3MP1A 2L8DA 2RJFA 3ME9A 1OI1A 3OQ5A 2M1HA 4L59A 5J26A 1H3ZA 5KE2A 5D6WA 4QQGA 2O4XA 2XDPA 5C0MA 3OS2A 3OYMA 3OMGA 4QQ6A 2HQXA 1WJRA 2JZ2A 1OZ3A 2WACA 3UWNA 2EQMA 1G5VA 2EQKA 3DB4A 2RHIA 3OYFA 4EDUA 4PLLA 4BACA 5IN1A 3OY9A 2RI2A 2RO0A 4C5IA 4RG2A 2X4YA 1SSFA 2FHDA 4A4EA 1N27A 2O4XB 4IUQA 4IUVA 3UT1A
chains in the Genus database with same CATH superfamily
1Y57A 2HDAA 5GANh 1RABB 2QQ9A 3HRSA 3CCLQ 5IXBA 4LDUA 5GAN7 4F17A 1MMGA 1RAEB 1NPRA 2DNUA 3OYKA 5DLOA 3NMZC 2J7IA 1Q86U 2BZXA 2CS7A 1GBRA 4O6JA 2LJ3A 1ZSZC 2VXEA 3CXCS 5GAOm 2XK0A 1R8OB 2FG0A 3GIBA 1PG5B 3CBPA 2LVMA 1IO6A 2H3EB 1SHFA 1MGQA 1W70A 4L6V5 1C0MA 2IVWA 5KYWA 2QQBA 1PRMC 1RACB 4OB3B 2H8HA 3E9GA 1M2VA 4JLIA 1RUWA 2P0QA 2DXCA 2ZPGB 2IG0A 1WNLA 3I55T 2RJEA 3RUXA 2EGCA 3PIPA 3CC2A 2K5LA 3CCRA 3FB9A 2CZ7B 2YRCA 4RUGA 4J6YA 3HTRA 1YCYA 3X25B 1VQOA 4AG2C 4OB2B 4BE2A 3G71A 4XK8E 2E6NA 1K0XA 4NOYA 5CCAA 2PVGB 4M7DA 3OQ5A 4LDXA 4QQGA 1QKWA 3OW2S 2ZPBB 1OZ3A 2BTTA 2OTLA 3OYFA 2ABLA 2KROA 3M0TA 1UG1A 4BACA 3GNGA 1VQ9Q 4BY6B 4HKEA 3SDZA 4ELYC 1S72Q 3MJXA 1EZZB 5ECAA 2BE9B 3V8LA 1ZLMA 2G3RA 2OX7A 2COWA 4BI3A 3CC7T 1YHQA 4PL6A 1Q95G 5LJ5d 1M4ZA 3L42A 4RCCA 1B34B 3CCUQ 4RTWA 4M77E 4N0AC 4AMCA 2EQUA 4LD9K 1UGPB 4A63B 2COYA 3CD6Q 3ZFJA 1H3HA 1KC8R 2DTOA 2AIRB 2CP6A 3JV3A 1B3QA 4PJOA 1NEBA 1M3CA 2PUKB 2QG9B 1LVKA 2I2LA 2EWNA 4AFUC 4C0FA 4XTWA 2MAMA 3LH5A 1AD5A 3VJPA 4J9GA 2EJGA 3V8KA 1D1AA 2V8JA 2HEQA 1GCPA 1YI2T 5CK9A 2YT6A 2XMFA 3MO8A 2L0AA 1QWEA 3M58A 1VA7A 2EYYA 1Q7YU 1OQKA 2VVKA 1KQ1A 3VS5A 1RAIB 3EHRA 5GMKm 1P92A 4M75E 2K9GA 1UGSB 2XIDA 2CT4A 3OB9A 1XNIA 2GF7A 1ZA2B 3M54A 5J26A 3MKDA 5FWBA 2W10A 3C12A 5LJ3d 1UUEA 4C92C 1QVPA 3H9NA 2L2PA 3WVDB 1FYNA 1PWTA 1ZUYA 2PVDB 2CP5A 3CCSA 4M78D 3NHNA 2X4XA 2L89A 3F70A 4J7IA 3JCMh 2DEUA 4RTTA 1PHTA 1YITA 2WSEE 4AFQC 5C6SA 2R58A 2EQJA 1ARKA 1KHIA 3S3OA 3GPLA 1CKBA 2DL5A 2GCXA 2RK1A 4JS5A 4DBRA 4KGVB 3L2VA 2LX9A 4F7UE 3MEVA 1VQNA 1N8RR 2QEXQ 1AZGB 3VS4A 3R6NA 3A8GB 3VV0A 1UGQB 2P0PA 2DPPB 1W2BS 4JRPA 2LJ0A 3V7RA 5FU7C 4JRKA 2RQVA 3OYYA 4C0ZA 3JCMb 1BIBA 2KRMA 3A1PA 1NM7A 1GXIE 5GAMd 1M1KU 4C92G 1IHWA 2JM9A 3FDRA 1VQLQ 2E1HA 1X27A 2KYBA 3MP6A 1BU1A 1VQMQ 1YNZA 2DYIA 3MP8A 4D8KA 4II1A 2NWMA 3JCMP 3PMTA 2DMOA 4M77F 3SFMA 4DOWA 2JM8A 1AWWA 5D6XA 1T3SA 2NUZA 3EGXB 2YLBA 3O8VA 4PKCC 1N5ZA 1AWOA 7AT1B 4OF1A 5D6WA 2XDPA 1V29B 1VQ5T 3MCAB 2DZCA 2QXFA 3QYHB 1WJRA 1T3LA 1HJDA 2WSCE 2FRYA 3VS3A 4MMKA 3I56A 3SEMA 1JJ2P 5IHNA 4KBMB 1YJ9Q 4IUVA 1BK2A 1VQ8T 4B9WA 4X9DA 3IQLA 4OMLA 1C1AA 2AT1B 5KYNA 2QDYB 5GANg 3OYNA 2LMJA 3I5SA 2P4TA 1MUZA 4C92B 1QVFS 4PFOA 4ZGJB 3CBMA 2YSQA 1I0CA 3E1SA 2CP2A 1FMVA 4J9HA 2XDBA 3P8HA 3NTIA 3QYGB 5FRNA 1JEGA 1TG0A 2LQKA 4FT4A 2LT1A 1R0BG 4K11A 4UC4A 3RIRA 1YBYA 8ATCB 2RHZA 1OU8A 2GFUA 3AHUA 1T0HA 4FCYA 2JTEA 1IZ6A 2ZCFB 3JCMQ 4M7DC 3META 4MMLA 3CCQT 5KYYA 4HCCA 5CIUA 3QPHA 1SHGA 4E7JA 3GNFB 1CSKA 3CPFA 1Y96B 4PNOA 1XOVA 2KR3A 3AT1B 3GLXA 2I0NA 3RMSA 1Q81U 2JTFA 2IIMA 3G4SQ 4HCZA 3JCMV 1NZ9A 2CREA 2ECZA 2KXCA 5FU7B 3CPWA 3X26B 4MZMA 2CP3A 1WYXA 1TOVA 1SG5A 4C0GA 1K1ZA 1YIJQ 2EKHA 3LWHA 4LDWA 4BI4A 5GANe 1KQ2A 2ZAEA 1WHHA 2HAXA 3OYMA 2V1RA 2YUOA 5CO7A 3FIFA 1SSHA 4O5VA 4C5IA 4JZ4A 3RDVA 3UDCA 4MZTA 2L3PA 1YJWA 3HL8A 2AHJB 4PJOC 3OYGA 1WQWA 3V7SA 3QO3A 3G1JA 1M90U 1U3OA 3CXCP 2DF6A 3FEOA 3JB9G 4M75C 4M7DG 1OX8A 1YJNQ 4GLMA 3D7SB 1QCNA 2DRMA 1O9SA 3LGLA 1NLPC 2FRWA 1G3SA 3URGA 3MEWA 2P0KA 3PVQA 5KYWB 1YCSB 3OMCA 4V2SA 3EG3A 4ME7A 3CMAA 4E7SA 4M7AA 2XICA 1JXMA 2V8IA 4J5YA 1Y0MA 1AT1B 1WGSA 3CC2T 3CCRT 2DTIA 1WI7A 3CC4Q 2R5MA 4E7ZA 1VQOT 2CKKA 1EFNA 2DK3A 2HNIA 3M0RA 3G71T 3I35A 1TSFA 2C0OA 3QZ9B 1Y71A 4R0KA 1CKAA 2VYTA 4DA4A 2F2XA 2ZPFB 2HCKA 1VQKA 1M30A 3CCJT 4IUPA 1XQHA 2FL7A 2OTLT 2YRVA 1I5LA 4M7DB 3CQTA 2E12A 4N4GA 1D3BA 4C92E 1JRIA 2CZ6B 2H3JA 2HMAA 4KULA 1B07A 3MP1A 1QCFA 1G2BA 2C0IA 3CMEA 5LJ5g 5KE2A 2EYWA 4A53A 3A5ZB 4M75G 2AKLA 3RESA 2J05A 3RERA 2Y4YA 4ATOA 4QVDA 1M8VA 1UDLA 1SRMA 3I5RA 4J9CA 4RTUA 1YHQT 3JCMW 3CCQA 2X51A 3RMQA 1RL2A 2RF0A 1MMNA 4Y91A 1TXQA 4CC2A 2CSIA 1K73U 1X43A 3P8BB 2KI7A 1Q82C 3KUFA 3VRZA 3PMIA 3C0CA 2CT3A 2QI2A 2M51A 2DETA 2QA4A 2NUPA 1WJQA 2DJQA 4DBFA 1OX9A 3VS6A 2CUDA 1NJIU 2SEMA 2K2MA 1X6GA 2RI5A 3QIIA 1QVGA 2DL3A 1QWFA 2K2VA 3CCMQ 1YFNA 1PC0A 1U1TA 4AFSC 2EJFA 2L3RA 3BW1A 2M02A 3JB9D 2AZVA 2K3XA 4M75B 4RTVA 1I1JA 4C8QE 2MF2A 3HP9A 2LCLA 1D09B 1JBMA 2RN8A 3HKSA 5HK0A 1E6GA 2DIQA 4HVVA 3LYIA 3H8ZA 2RB6A 5A2QE 4JJDA 3A98A 2RQWA 1MMAA 1QQJA 3LWIA 4F7UG 3CCVA 1UE9A 3J80E 3A8MB 4B6MA 1G83A 2EJ9A 4GY5A 2XU8A 2VWFA 2M16A 5I2MA 4VUBA 1PSEA 5LJ3g 1LPLA 4M77D 4C5EA 2DYBA 4ZN3A 5GJVB 5A0GA 4JUVA 5GAN8 1PD0A 3C95A 1ZSGA 3CC2Q 2YHTA 2VUBA 2A7YA 3CCRQ 3M9QA 3NPFA 1D0YA 3L2WA 3G7ZA 1K8AC 1KD1U 4E6RA 1VQOQ 5CQXA 4RTXA 2L8DA 1LOJA 1WHKA 2JT4A 2RA2A 3EG9A 3PT9A 3G71Q 5C0MA 3CCST 2L3SA 2RNAA 4YTLA 2D6FA 1LJOA 4KH1B 5GJWB 5DLQE 5DM7R 3JCMe 1PM3A 2RM4A 1VQ7Q 5GMKj 3G6EA 2RO0A 1FMKA 2DFUA 1YITT 5GMKh 4GLKA 2PTKA 4QKUA 2F2VA 1HXDA 1BI2A 1VQ4Q 4F7UB 3CCEQ 2FZGB 5CVIA 4PJMA 3PIOA 2LP5A 1SF9A 2XD0A 5GAOq 4OMQA 5FROA 3CCJA 3DKMA 3TEEA 2VXFA 4OMFB 3UPUA 2FVUA 2DEQA 1VQNT 2KRNA 2LQNA 2Y4XA 5DY9A 3JCMX 1YHQQ 2DX1A 1VQPA 4ZTJA 4C92F 1K76A 5FU6B 2OAWA 1YWPA 2RMOA 5GAMg 2DZ9A 1W2BP 4M7DE 1PSFA 3EG1A 1KQSA 4IIOA 1J3TA 1V76A 2DXUA 2FPEA 3BDUA 4JDSA 2QYZA 2OI3A 2YLCA 4L5GA 3RKXA 1GCQA 3PTAA 3EH2A 4XQ3A 3N5BB 3A8OB 4PJNA 2HKNA 4XU1A 3U23A 5KYXA 1GL5A 4DEXA 2E3HA 2JMCA 3RKWA 2HKQB 2BE7D 3BE3A 3O5ZA 5I21A 1S72A 4Y92A 5GAOl 4OMPA 3I56T 2O31A 1ZSZB 2XG8D 3SWNC 1OULA 4JLGA 1I07A 1K9MU 4Z8AA 2KBTA 2EBPA 4ORZA 5KCOA 3ZBDA 1OI1A 4PJOE 1YWOA 2LX7A 1Q86C 1K9AA 1QCOA 2EW3A 9ATCB 4RTYA 2FYKA 2MCNA 2DKGA 2K7AA 3CD6A 5LJ5j 3KFVA 4M7AC 2DL8A 5LJ5h 1QVFP 1WLPB 1KSWA 1ZHIA 5HY6A 3I55Q 2DJZA 1X6OA 1XJWB 4QT7A 4FW2A 2ZGWA 1D0ZA 4JZ3A 3CCSQ 2HZYA 2A3LA 5AYFA 4JJBA 2HQHA 2KDSA 3FJPA 1RI9A 2CH4W 2JW4A 1S1NA 1Y07A 1UHCA 1G8XA 3NTHA 1BBZA 1NEGA 2LQWA 4MDXA 2A37A 5D6YA 3EFSA 3GBQA 2GTOA 4ZN1A 2VKNA 1Y7XA 2JMAA 5KYYB 3X20B 1WHGA 3QXEB 2R57A 2G6FX 3QDFA 1RLPC 1H8KA 4E7IA 1Q82R 1VQNQ 3TU4K 3VS7A 4ZGEB 2ZZDA 4DEYA 3TVTA 1HSQA 5IAYA 1GBQA 2M9UA 4OMOA 2CYZB 2JS2A 3DLMA 2KXDA 1AEYA 2RHUA 2CP0A 3JSCA 4A4HA 4HT8A 3JB9I 2HD0A 1C6VX 4FU6A 2EPDA 1WX6A 4IURA 2JJ9A 1UGVA 1M1GA 2EFIA 3M55A 3CC7Q 2ZPEB 4M7AG 1IRXA 4J9DA 3L2RA 3ER0A 5LJ3j 3JB9F 4KUIA 1NBEB 3DB3A 3QUIA 5LJ3h 2D0NA 1YJWT 3QG1A 4M7DF 4J6XA 3ME9A 2KQWA 2EAYA 4Z89A 4C8QC 4D8DA 2JZ2A 4FYXB 2K5IA 2RHIA 3RKYA 4EMKC 3MPUB 1VQ6A 3SWNB 2CZ0B 2YRDA 5D7UA 4XTYA 1FXXA 4OP0A 4CC3A 4IUQA 4E47A 4PLIA 1B34A 3LGFA 5FRMA 2QEXA 1YI2Q 2O9SA 4HCKA 3CMAT 1TUDA 3BDLA 5GMKl 3EFOB 1AVZC 1K8AR 3TQ7P 1QW1A 3X28B 4IUTA 4M78A 2K3YA 4M7AB 3PNWC 4AT1B 1KC8U 1DJ7B 3QZ5B 3H6ZA 1Q7YC 4Z88A 1VQLA 1ZA1B 2ZPIB 1VQMA 4FM4B 1UEBA 3PVLA 1FWZA 3EGUA 2VB6A 4E7LA 3BY7A 1X75C 1VQKT 1MV3A 5GAMj 1RAAB 4AG1C 4M75F 5GAMh 4RG8A 1BI3A 4C8QG 4LN2A 4XTVA 2ED0A 4E2FB 3QJ6A 1UGRB 3M56A 1I8FA 2C06A 2JTMA 2QTVA 1BI1A 3CMET 3VKIA 5IT9E 2R5AA 2K6DA 1D3BB 4ZNXA 1AOJA 1SEMA 4N4HA 5J3BA 2ROTA 5GAN6 2DL7A 3JB9H 2LDMA 5IH2A 1U06A 4LXCA 2OAUA 2X3XD 5EC7A 4QQ6A 4BUGA 2FB7A 3QDRB 5FW9A 2QA4T 3JCMf 1PKTA 3OY9A 2K5FA 2X4YA 4D6WA 3HFOA 1SSFA 1E7OA 2YUNA 2ENMA 2D0QB 2O4XB 5GAN2 1F1BB 1G3WA 2E3IA 1WZOA 1KIKA 2NUPB 3TSWA 2BIVA 2EYZA 1UJ0A 1OV3A 2X9HA 1O75A 3M4YA 2CZ1B 4C8QB 1WFWA 2DIGA 1W4SA 1GCQC 4XTUA 1MNEA 3LX7A 5CKHA 2YUPA 3VS1A 4ZTFA 4EMKB 4C92D 4F7UF 1ZBXA 2CUBA 2E4HA 2DXTA 3VUZA 1OZ2A 2OTJA 2KGTA 3BFMA 1M1FA 4J9FA 2J6OA 4FYYB 1Q86R 1I4K1 3GOXA 1M1KC 2DLPA 4LDYA 3CCVT 3NTKA 1IXDA 1M9SA 3OYDA 2YWWA 2P84A 1N8RU 1JU5C 5GAN3 1JJ2A 3EG0A 1VQ5Q 1I81A 1OPKA 2E65A 4OMMA 1RADB 3KXTA 3VRYA 2FEIA 2BZ8A 3CPWS 3VYHB 4LUEA 4DBHA 2VV5A 4OB0B 1V1CA 2CGHA 1WHMA 1OU9A 1VQ8Q 4JPBW 1M2VB 1ZBJA 4B9XA 3EGXA 4A4KA 3VUBA 3HSBA 2W0ZA 2EQIA 2O9VA 4BD3A 4BB7A 3HPWA 3HRUA 2FO0A 1VQKQ 1QMCA 1UECA 3G6ET 2DE0X 2DILA 2GTJA 1OEBA 5GMKe 4FW1A 5GAN4 4M7AE 2M1HA 2JNGA 2DXBA 2BZYA 1YJNA 3OMGA 4EPCA 2RD1A 1JXOA 1AZEA 2EQMA 1X2QA 4HXJA 3DB4A 1NYGA 1BB9A 2MOXA 4EMGA 3VU3C 4PJOG 1M3AA 2K79A 2DRKA 4DQ2A 4CRIA 5GAOr 1VQPT 4C92A 3EG2A 3L2UA 3CCQQ 3TCJA 2KE9A 4XTZA 3HFNA 1BCMA 5IXFA 3CC4A 4FL6A 2EVRA 4LNPA 2E64A 2QA4Q 1GFCA 2DTHA 1Q81C 1QP2A 5L23A 2QQSA 2X4JA 2GBQA 1VYTA 4XU0A 4QVCA 5CKDA 2OJ2A 1Y96A 4KUDK 1TUCA 2HQEA 4RKUE 3H41A 1MV0B 5KH6A 5KYXB 4X1VA 1S72T 4CI0C 1GRIA 1TTHB 4BY6C 1HK9A 1U1SA 3CXCA 4PJOB 4Y28E 1IGQA 2XDDA 3QWXX 1MMDA 2KNBB 3UA6A 2PVOB 2PQWA 3CCVQ 3T9NA 1I5OB 1LCKA 1OPLA 2LC4A 1WXBA 1M2OA 1WHJA 2GFAA 3SD4A 1IREB 4WTOB 1Z9ZA 4M7DD 2VGNA 2JOYA 2EYXA 4BDYA 1M90C 1VOMA 2GQIA 4KT0E 4CC7A 1SKUB 2F1LA 2D8HA 5HCKA 1IB8A 2F69A 3OYEA 3CD6T 2MIOA 4OGCA 5LJ5e 2RJFA 5CR2A 5I11A 2K3BA 4PFPA 5IHKA 1ABOA 1UFFA 2LNHB 3NGPA 3OBWA 4M78C 2EQKA 2COZA 5GAOp 1EIFA 5IN1A 1TUGB 3GF5A 3M59A 3EH1A 1YP5A 3CCMA 1K4US 5A0DA 3CCLA 4R56A 3G6EQ 1QVGS 1X2KA 2QAZA 1NG2A 1SPKA 2RHXA 3QSUA 3RNJA 4BE0A 2PZ1A 4ELZC 3P8DA 3OW2A 2VASA 2ROLA 1BIAA 5EG2A 4FYVB 3R6OA 1E6HA 3CCJQ 4LD6A 4PJOD 1NPPA 2OTLQ 2HBWA 3RR6A 4F14A 5GAN5 5M9OA 4PJJA 4NS5A 3Q1JA 1VQPQ 1ZQ1A 4M7AF 2F2WA 1RAGB 4HA8A 4QW2A 4M75D 2MK5A 2JS0A 3I9QA 2FPFA 3E2UA 2CH4A 2Z0WA 3REBB 1PRLC 4OMNA 4F04B 3THKA 1U8RA 2GQVA 2HBPA 2E41A 4R55A 1PNJA 5KYUA 3OYIA 4FYWB 4BI8B 1ACMB 4C5GA 4KH0B 3EGDA 4FT2A 5LJ3e 2LTOA 1FMWA 4M78G 6AT1B 1PKSA 1VQ7A 2RJCA 1QKXA 4OVAA 4E7HA 2YUQA 3CBOA 1R77A 3OYLA 1K73C 5HKCA 4AFZC 1JQQA 1M1KR 4C5HA 1VQ4A 3FRNA 3CCEA 4KRTA 1VQ6T 2GNCA 4M77A 1OYXA 4C0DC 4DBQA 2PNIA 1RAHB 4NL3A 2Y90A 2QEXT 1NJIC 3H0HA 1G5VA 1Z9QA 2KRSA 2LZ6B 1VQ9A 4EDUA 4HVUA 1ZUUA 5A0LA 1RLQC 2ZPHB 2KSSA 2FHDA 3X24B 1AWJA 2YDLA 3M5AA 1RI0A 2KYMA 1VIEA 3OS5A 1KQSS 2MMPA 1M8MA 4A54A 1UTIA 5KE3A 5GANf 2NUTA 2E5QA 1VQLT 4M78B 2X35A 2CDTA 1VQMT 3GP8A 3CCUA 4P5NA 2XHCA 4C8QF 3JCMJ 4LE9A 4M75A 2MPXC 3HHTB 3PGGA 5GAMe 3JCMd 4OGEA 3JRZA 3VS0A 2EGEA 4DOVA 4J9IA 3WVEB 2KMTA 2B8AA 2DA9A 3TSZA 4JJNK 5I2SA 2QTXA 2E70A 3OSSC 1AWXA 4J83A 1KD1C 4CC4B 4BE1A 1YJ9T 3ULRB 1OOTA 1XTDA 2DL4A 3L1AA 3S6WA 1TU0B 2LRQA 1YITQ 4FSXA 2KEAA 2FZKB 3EHQA 3L2QA 2J6FA 2O01E 2RQTA 1M27C 1NLOC 3OYAA 2V1QA 1Q81R 1BI0A 3A8HB 1X01A 4XU2A 3OS1A 3V7CA 2AK5A 3LLRA 1W2BA 5CQYA 5GMKi 3I55A 3ZEHA 1MNDA 4TVRA 2PUOB 2GGRA 3QWYA 2DO3A 1H3ZA 4OB1B 2FPDA 2AKKA 2WACA 4F7UA 5IHIA 3M0SA 1ZX6A 2KK4A 4RG2A 1N9SA 4GBQA 2OTJT 3UT1A 4C0DB 1VQ6Q 3S3MA 3L2ZA 1FX7A 2MI6A 3G4ST 1WJSA 2DBMA 2HL5C 5HK3A 1WQ7A 4ESRA 2V26A 3LW5E 4X9CA 1M90R 4QVZA 2QGGA 2XKOC 1JO8A 3HRTA 4JRQA 2JUFA 1KG1A 1LNXA 5I22A 3OYCA 1D1BA 1YIJT 1WPYA 3I56Q 2AZSA 5CAIA 2EGAA 3VS2A 3CPWP 4XAXB 3CC7A 1MHNA 1WIEA 4ANJA 3M57A 3S3NA 3H0FA 3M0QA 2HSEB 1VYUA 3FJ5A 2VC8A 4HVWA 1K9MC 1KK7A 5CKBA 2F5KA 1QVFA 4E7KA 1HD3A 4N4IA 4LDVA 4RMOA 2A28A 2QK0A 2BUDA 4WCIA 1KHCA 4EIKA 3REAB 4BDZA 2KAFA 3RBBB 4FIBA 3MEUA 2RQRA 3ZL7C 1ZSZA 3OYBA 2YXYA 4PJOF 3OYJA 1KJWA 2X3WD 1YJNT 2QQAA 2D8JA 2M0OA 2XI9A 5GAOn 2E10A 3J7AF 3PFSA 4M78E 1ABQA 3KBGA 5FLXE 4Q5WA 3UATA 1QLYA 1YI2A 3J81E 3QKJA 2DVEA 5LJ5f 1BCOA 4L59A 3SHWA 2HQXA 2QDLA 2J6KA 1HYOA 2P4RA 1YJ9A 2CSQA 3CC4T 4IIMA 2WSFE 2A08A 1VYVA 3PE0A 1IHVA 2ATCB 1RAFB 4A4EA 2HL3A 4NL2A 1WDXA 2E6ZA 1K73R 3A8LB 2D9TA 1YN8A 3FC3A 1QP3A 2DD5A 3MEAA 2DERA 1N6AA 3DLLA 4XU3A 5KCHA 3QHSA 3EAEA 5CKFA 3LH0A 4M7AD 2IPOB 2QQRA 3OYHA 2MYSA 3WXMB 2EIFA 3FLGA 8AT1B 1AHJB 1NJIR 2ED1A 5L8RE 2OTJQ 4A4GA 4XTXA 2JXBA 3E9FA 3JCMc 4FSSA 1YJWQ 1WA7A 2X4WA 2SRCA 4F16A 1W1FA 2KT8A 3C4SA 1Q82U 1A0NB 4M77C 1X69A 2RJDA 2RHYA 1IGUA 2MWOA 2KY9A 4PFZA 2LJ1A 1M3BA 3G4SA 4WF2A 3JB9J 5LJ3f 3M4GA 4N0AA 2D1XA 3M53A 3UA7A 1NYFA 3EFRA 2A36A 3QJYA 3CMAQ 4MZPA 4QQDA 1TS9A 5LL6S 4ZGDB 1N9RA 2L3QA 1YIJA 3OSVA 3OS0A 5J39A 3CCMT 1ZUKA 3CCLT 2RH2A 2DM1A 3SWNA 1KD1R 1WHLA 2LNVA 4M4ZA 1QVGP 3C94A 3INZA 1KC8C 1JB0E 1X6BA 3SB2A 1BKBA 2V8KA 2F5TX 1B7TA 1K0SA 3UF4A 3EFOA 3EG9B 2JN0A 1W6XA 2ESWA 1N27A 4JJCA 2J06A 1D0XA 4J7FA 1VQ5A 4C8QD 1U5SA 2RQUA 3M0PA 2B86A 4HCBA 4J6WA 1JJ2S 1K8AU 2EYQA 4M77G 2CP7A 4PJLA 4IUUA 2LCSA 2K57A 4J9BA 3CMEQ 4MDWA 1PCXA 1G3YA 2L5QA 1GFDA 1UB4A 4M78F 3JAME 1SRLA 1H641 1EX4A 4J8OA 1TH7A 5FWCA 1G3TA 1VQ8A 3NFCA 4JRIA 2PU9B 2DAQA 1UJYA 2FZCB 5GAMf 4HT9A 1TWBA 4Z02A 1NE8A 2E5KA 4KGZB 2DBKA 2RI3A 2EKOA 2LCCA 1WXTA 4X34A 1VQ7T 1WXUA 2RK2A 3VYGA 5KYUB 2K4YA 4RTZA 2A0FB 3OW2P 2RPNA 5GANd 3EGDB 2MWPA 3H0IA 3QBYA 4EMHA 3CEYA 3V8JA 1VQ4T 4LUDA 3OA6A 3CCET 4JS4A 5CKEA 1VIFA 2QGFB 2NLUA 4IKFA 4PK4A 2LQ8A 1D1CA 3E19A 4M77B 2QASA 1VQ9T 2DVJA 2HSPA 4A4FA 1KFZA 3ASKA 3OBYA 2BKDN 2M0YA 2KVQG 4RCBA 2O2OA 5FU6C 1R0CB 1K9MR 1T0JA 2O4XA 4KGXB 3OS2A 5AT1B 1BYMA 1PD1A 2VGMA 3UWNA 2KT1A 1KQSP 1UHFA 1H92A 3MHXA 3TREA 4PLLA 4C8QA 1VUBA 3JCMg 3CCUT 2RI2A 2JVVA 2O88A 2LT4A 1Q7YR 2NYSA 4EMKA 2NUTB 1N8RC 5GANj 1M5Q1 2C0TA 3M0UA 4J9EA 2DD4A
chains in the Genus database with same CATH topology
4PJOC 1RI0A 3OYGA 1WQWA 3V7SA 3QO3A 4E47A 1VIEA 2QQ9A 3OS5A 4PLIA 5GANh 1M90U 1B34A 1KQSS 3HRSA 2MMPA 3LGFA 4A54A 2QEXA 5FRMA 5KE3A 5GANf 2E5QA 4LDUA 1VQLT 3CMAT 3FEOA 3BDLA 4M78B 2X35A 3JB9G 1VQMT 5GMKl 5GAN7 3GP8A 3CCUA 1NPRA 4P5NA 4M75C 4M7DG 3OYKA 2XHCA 4C8QF 5DLOA 3JCMJ 1QW1A 1O9SA 3X28B 3LGLA 4IUTA 4M78A 1Q86U 2K3YA 2CS7A 1G3SA 4M75A 4M7AB 4O6JA 3HHTB 2VXEA 3URGA 3PNWC 3CXCS 1KC8U 3MEWA 5GAOm 2P0KA 3PGGA 1DJ7B 1R8OB 2XK0A 3QZ5B 4OGEA 5GAMe 3JRZA 4DOVA 3JCMd 3H6ZA 3OMCA 3GIBA 4V2SA 1Q7YC 3CBPA 3WVEB 2LVMA 4ME7A 3CMAA 1VQLA 1MGQA 2KMTA 2ZPIB 2B8AA 2XICA 1VQMA 4FM4B 2V8IA 4M7AA 4L6V5 4J5YA 1UEBA 1FWZA 4JJNK 5I2SA 2IVWA 2QQBA 2QTXA 1WGSA 2E70A 3OSSC 3CC2T 4J83A 1KD1C 3CCRT 4OB3B 4BE1A 3BY7A 4E7LA 1X75C 3E9GA 1YJ9T 1VQKT 4JLIA 2DTIA 5GAMj 2P0QA 2R5MA 4M75F 1VQOT 1XTDA 2CKKA 5GAMh 2DXCA 2ZPGB 2DK3A 2HNIA 3L1AA 4RG8A 3S6WA 2IG0A 2LRQA 4FSXA 1WNLA 1BI3A 3I55T 3G71T 4C8QG 4XTVA 3L2QA 3QZ9B 1Y71A 2RJEA 3QJ6A 1UGRB 3M56A 1I8FA 2C06A 2JTMA 2O01E 2VYTA 3RUXA 3OYAA 1BI1A 3CMET 2ZPFB 3VKIA 4DA4A 3PIPA 3CC2A 5IT9E 2K5LA 3CCRA 2R5AA 3FB9A 1BI0A 1VQKA 2CZ7B 3A8HB 3CCJT 1X01A 1D3BB 1XQHA 4IUPA 4XU2A 4J6YA 3OS1A 2FL7A 1YCYA 3V7CA 4N4HA 3X25B 2YRVA 2OTLT 1I5LA 5J3BA 1VQOA 4OB2B 4M7DB 3LLRA 1W2BA 5GAN6 4BE2A 5CQYA 5GMKi 3I55A 3JB9H 2E12A 2LDMA 4N4GA 1D3BA 3G71A 4XK8E 4C92E 1JRIA 2CZ6B 2E6NA 2H3JA 4KULA 3ZEHA 4NOYA 5CCAA 3MP1A 2PVGB 4TVRA 2PUOB 4M7DA 3OQ5A 3CMEA 2OAUA 4LDXA 2DO3A 5LJ5g 1H3ZA 4OB1B 5KE2A 4QQGA 3OW2S 4A53A 3A5ZB 4QQ6A 4M75G 4BUGA 2ZPBB 2FB7A 1OZ3A 3RESA 2WACA 3RERA 2Y4YA 3QDRB 4F7UA 4QVDA 2OTLA 4ATOA 1M8VA 3OYFA 2QA4T 3JCMf 4BACA 1YHQT 3OY9A 2K5FA 3JCMW 3GNGA 2KK4A 3CCQA 4RG2A 2X4YA 3RMQA 1N9SA 1RL2A 3HFOA 1SSFA 4Y91A 4D6WA 4BY6B 2D0QB 2O4XB 4HKEA 3SDZA 5GAN2 1K73U 2OTJT 1G3WA 3UT1A 4C0DB 4ELYC 2BIVA 3P8BB 3S3MA 3L2ZA 1FX7A 3V8LA 1Q82C 2MI6A 1O75A 3KUFA 3M4YA 2G3RA 1WJSA 5HK3A 3G4ST 3PMIA 1WQ7A 2CZ1B 4C8QB 2QI2A 2DIGA 4BI3A 1W4SA 3LW5E 4X9CA 4XTUA 3LX7A 4QVZA 5CKHA 3CC7T 2QA4A 1WJQA 4ZTFA 4EMKB 1YHQA 2XKOC 4PL6A 3HRTA 4C92D 4F7UF 4JRQA 5LJ5d 1ZBXA 1M4ZA 3L42A 2DXTA 2JUFA 3VUZA 1KG1A 1LNXA 1NJIU 1OZ2A 4RCCA 1B34B 2OTJA 3OYCA 4M77E 3BFMA 1YIJT 1M1FA 1WPYA 2RI5A 4N0AC 2EQUA 5CAIA 3QIIA 1QVGA 4LD9K 1I4K1 3GOXA 1M1KC 1UGPB 4LDYA 3CCVT 3ZFJA 3NTKA 2K2VA 1M9SA 2DTOA 4XAXB 3OYDA 3CC7A 1MHNA 1U1TA 1N8RU 2EJFA 2L3RA 3BW1A 5GAN3 1JJ2A 4PJOA 3M57A 2PUKB 3S3NA 3JB9D 2K3XA 2I2LA 2EWNA 2VC8A 4M75B 4C0FA 1I81A 2E65A 4XTWA 2MAMA 4C8QE 1K9MC 2MF2A 3HP9A 2LCLA 3HKSA 1JBMA 5CKBA 5HK0A 2F5KA 1QVFA 2DIQA 3KXTA 4E7KA 3VJPA 3CPWS 2EJGA 4N4IA 3LYIA 3H8ZA 4LDVA 3VYHB 2VV5A 3V8KA 2RB6A 2BUDA 4RMOA 5A2QE 4OB0B 1KHCA 4BDZA 2KAFA 2V8JA 3LWIA 4F7UG 3CCVA 3J80E 2CGHA 3A8MB 1YI2T 4FIBA 3MEUA 2EJ9A 5CK9A 3MO8A 4GY5A 2XU8A 5I2MA 2M16A 3OYBA 4VUBA 1PSEA 5LJ3g 4PJOF 3M58A 4B9XA 4M77D 4C5EA 5A0GA 4ZN3A 5GAN8 3OYJA 4JUVA 1YJNT 2QQAA 3C95A 3VUBA 2M0OA 4A4KA 1Q7YU 3HSBA 2XI9A 5GAOn 2E10A 3J7AF 3PFSA 4BD3A 4BB7A 1KQ1A 3HPWA 3HRUA 2YHTA 2VUBA 2A7YA 3KBGA 4M78E 5GMKm 1P92A 5FLXE 3M9QA 4M75E 3L2WA 4Q5WA 1UGSB 2XIDA 3G7ZA 3G6ET 1YI2A 1K8AC 3OB9A 3J81E 1XNIA 1KD1U 2GF7A 5GMKe 5CQXA 3QKJA 2DVEA 2L8DA 5LJ5f 5GAN4 1LOJA 2M1HA 2RA2A 3M54A 4L59A 3PT9A 5J26A 4M7AE 2JNGA 2DXBA 5C0MA 1YJNA 3OMGA 3CCST 4EPCA 2HQXA 2RD1A 3C12A 2EQMA 4YTLA 1LJOA 2D6FA 1YJ9A 3DB4A 5DLQE 5DM7R 3JCMe 5LJ3d 3CC4T 2RM4A 5GMKj 2WSFE 3G6EA 4C92C 2RO0A 1QVPA 4EMGA 3VU3C 1YITT 4PJOG 5GMKh 4A4EA 3WVDB 4GLKA 5GAOr 4DQ2A 4NL2A 4CRIA 1VQPT 4C92A 3L2UA 1HXDA 1BI2A 2PVDB 2E6ZA 3TCJA 4F7UB 3CCSA 3A8LB 5CVIA 3PIOA 2D9TA 4M78D 4XTZA 3FC3A 1QP3A 2DD5A 3HFNA 3MEAA 2XD0A 1N6AA 5GAOq 3DLLA 5FROA 3CCJA 3CC4A 2X4XA 2L89A 3DKMA 3F70A 4FL6A 4J7IA 4XU3A 3JCMh 5KCHA 3TEEA 3QHSA 3EAEA 2VXFA 4OMFB 3UPUA 2FVUA 2DEQA 1VQNT 1YITA 4IUQA 2WSEE 2E64A 3LH0A 5CKFA 4M7AD 2QQRA 2Y4XA 5DY9A 3WXMB 3JCMX 2DTHA 5C6SA 3OYHA 1VQPA 1Q81C 4ZTJA 1QP2A 2EIFA 2R58A 3FLGA 2EQJA 2QQSA 1AHJB 1KHIA 4C92F 3S3OA 5FU6B 5L8RE 3GPLA 4M7DE 5GAMg 2DZ9A 2X4JA 1PSFA 4A4GA 4XTXA 1KQSA 3E9FA 3JCMc 2DXUA 2GCXA 2RK1A 3BDUA 4XU0A 4QVCA 5CKDA 2X4WA 4JS5A 3L2VA 2LX9A 4JDSA 4F7UE 3MEVA 1Y96A 1VQNA 4KUDK 3C4SA 1Q82U 2HQEA 4RKUE 2YLCA 3A8GB 4L5GA 1UGQB 2P0PA 4M77C 3RKXA 3VV0A 5KH6A 2RJDA 2DPPB 3PTAA 1W2BS 4XQ3A 4JRPA 3N5BB 3V7RA 3A8OB 1S72T 4CI0C 5FU7C 2RHYA 4JRKA 3OYYA 4BY6C 1HK9A 2MWOA 1U1SA 4XU1A 4C0ZA 3CXCA 3JCMb 2KY9A 4PJOB 1BIBA 4Y28E 3G4SA 4WF2A 2XDDA 3JB9J 5LJ3f 3M4GA 2PVOB 2PQWA 4N0AA 1GXIE 3T9NA 3M53A 2LC4A 3RKWA 3EFRA 2GFAA 5GAMd 1M1KU 4C92G 3QJYA 3SD4A 3FDRA 1IREB 4MZPA 4QQDA 2E1HA 5LL6S 4ZGDB 3MP6A 5I21A 4M7DD 1S72A 1N9RA 2VGNA 2JOYA 3MP8A 5GAOl 4II1A 4BDYA 3I56T 1M90C 3JCMP 4KT0E 1YIJA 3PMTA 2XG8D 4M77F 3SWNC 4JLGA 2F69A 3OSVA 3SFMA 4DOWA 3OS0A 3OYEA 1K9MU 3CD6T 5D6XA 5J39A 3CCMT 5KCOA 3O8VA 2YLBA 3CCLT 4PKCC 2RH2A 4OGCA 3ZBDA 2RJFA 3SWNA 5LJ5e 1OI1A 5CR2A 4OF1A 2LNVA 5D6WA 2XDPA 1V29B 1VQ5T 4PJOE 3MCAB 2DZCA 2QXFA 3QYHB 1WJRA 3C94A 3INZA 1Q86C 2WSCE 3OBWA 4M78C 2EQKA 5GAOp 4MMKA 1EIFA 1KC8C 1JB0E 3I56A 5IN1A 3SB2A 2FYKA 2DKGA 3GF5A 1BKBA 3M59A 4KBMB 2V8KA 2F5TX 3CD6A 2JN0A 5LJ5j 1N27A 3CCMA 5A0DA 3CCLA 4M7AC 4R56A 4IUVA 1QVGS 5LJ5h 1VQ8T 4J7FA 1ZHIA 1VQ5A 4C8QD 4B9WA 2RHXA 4X9DA 3QSUA 5HY6A 4HCBA 4J6WA 1JJ2S 2DJZA 1X6OA 4BE0A 2EYQA 1K8AU 2QDYB 4ELZC 3P8DA 5GANg 3OYNA 4M77G 3OW2A 4IUUA 2ZGWA 2K57A 1BIAA 5EG2A 2P4TA 4MDWA 1G3YA 2A3LA 2L5QA 3R6OA 5AYFA 4C92B 4ZGJB 1QVFS 3CBMA 2KDSA 3FJPA 1UB4A 4M78F 3E1SA 3JAME 4LD6A 1H641 2XDBA 4PJOD 4J8OA 1NPPA 1TH7A 3P8HA 3NTIA 1Y07A 1G3TA 1VQ8A 3QYGB 3NFCA 5GAN5 5FRNA 5M9OA 4JRIA 2PU9B 3NTHA 2DAQA 5GAMf 4HT9A 2LQKA 4NS5A 3Q1JA 4FT4A 4Z02A 4MDXA 1NE8A 1ZQ1A 4M7AF 5D6YA 3EFSA 2LT1A 4HA8A 4QW2A 2RI3A 4M75D 4ZN1A 2EKOA 4UC4A 2LCCA 3RIRA 1YBYA 1Y7XA 4X34A 2RHZA 1VQ7T 2RK2A 2GFUA 3VYGA 3X20B 3QXEB 2K4YA 3AHUA 2R57A 5GANd 1IZ6A 2MWPA 4E7IA 2GQVA 1U8RA 2ZCFB 3QBYA 4EMHA 2HBPA 3CEYA 3TU4K 2E41A 4ZGEB 3JCMQ 2ZZDA 3META 4MMLA 5IAYA 3V8JA 4R55A 3CCQT 2M9UA 4M7DC 1VQ4T 2CYZB 4HCCA 5CIUA 3QPHA 3DLMA 4BI8B 3OYIA 3OA6A 4E7JA 3GNFB 3CCET 4C5GA 4JS4A 3CPFA 5CKEA 1Y96B 1VIFA 1XOVA 4PNOA 2RHUA 3JSCA 4A4HA 4FT2A 5LJ3e 2LTOA 3GLXA 3RMSA 1Q81U 4M78G 4HT8A 3JB9I 2HD0A 2JTFA 1VQ7A 2RJCA 2NLUA 4OVAA 4FU6A 4IURA 4E7HA 4IKFA 2LQ8A 3E19A 3CBOA 4HCZA 1M1GA 2EFIA 4M77B 3JCMV 3M55A 1NZ9A 3OYLA 1K73C 5HKCA 2ZPEB 4M7AG 1VQ9T 4C5HA 5FU7B 4A4FA 3FRNA 3ASKA 3OBYA 3CPWA 3L2RA 3CCEA 1VQ4A 2BKDN 3X26B 4MZMA 3ER0A 5LJ3j 1VQ6T 2KVQG 3JB9F 4M77A 4KUIA 3DB3A 3QUIA 4RCBA 4C0GA 5LJ3h 1OYXA 4C0DC 5FU6C 3QG1A 1YJWT 4M7DF 3LWHA 4J6XA 3ME9A 4LDWA 4BI4A 4NL3A 5GANe 1KQ2A 2HAXA 3OYMA 2O4XA 3OS2A 2KQWA 1BYMA 2EAYA 2Y90A 2QEXT 1NJIC 4C8QC 5CO7A 2VGMA 2JZ2A 1G5VA 3UWNA 2K5IA 3FIFA 2RHIA 3RKYA 1VQ9A 3MHXA 4EDUA 4EMKC 3TREA 4PLLA 4C8QA 1VUBA 3JCMg 3CCUT 4O5VA 5A0LA 2RI2A 2JVVA 1VQ6A 4C5IA 3UDCA 2LT4A 3SWNB 4MZTA 2CZ0B 2ZPHB 2KSSA 2FHDA 3X24B 4EMKA 4XTYA 1N8RC 1FXXA 1M5Q1 4OP0A 5GANj 3HL8A 1YJWA 2AHJB 3M5AA 2DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RI0 A;  2BIV A;  3OYG A;  3S3M A;  3L2U A;  4PLI A;  4B9W A;  2RHX A;  3KUF A;  3LGF A;  5FRM A;  2G3R A;  1WJS A;  5KE3 A;  3PMI A;  2D9T A;  2E5Q A;  2DIG A;  3FC3 A;  4BE0 A;  3P8D A;  3MEA A;  3OYN A;  3FEO A;  3BDL A;  3LX7 A;  4IUU A;  2X35 A;  4QVZ A;  5FRO A;  2X4X A;  1WJQ A;  2L89 A;  3F70 A;  4FL6 A;  4ZTF A;  4PL6 A;  5KCH A;  3EAE A;  3OYK A;  3L42 A;  3LH0 A;  2QQR A;  3OYH A;  1OZ2 A;  4LD6 A;  5C6S A;  3LGL A;  4IUT A;  4ZTJ A;  2K3Y A;  2R58 A;  3NTI A;  3P8H A;  3OYC A;  3FLG A;  3PNW C;  4CRI A;  2EQJ A;  2QQS A;  3MEW A;  2RI5 A;  5M9O A;  5FRN A;  2P0K A;  2EQU A;  2DAQ A;  2XK0 A;  3NTH A;  3QII A;  3S3O A;  4NS5 A;  3GOX A;  3H6Z A;  3OMC A;  3Q1J A;  4Z02 A;  2LVM A;  4A4G A;  3NTK A;  3E9F A;  5D6Y A;  3OYD A;  2B8A A;  1MHN A;  4QW2 A;  2RI3 A;  2L3R A;  2X4W A;  3L2V A;  2EKO A;  4UC4 A;  2LCC A;  3S3N A;  2K3X A;  3MEV A;  1WGS A;  4X34 A;  2RHZ A;  2GFU A;  3C4S A;  2R57 A;  2HQE A;  4BE1 A;  4E7L A;  3E9G A;  2F5K A;  5KH6 A;  2DIQ A;  4E7K A;  2MWP A;  2RJD A;  4E7I A;  3QBY A;  4N4I A;  3LYI A;  3H8Z A;  3CEY A;  2R5M A;  2BUD A;  3MET A;  5IAY A;  1KHC A;  2RHY A;  2CKK A;  4BDZ A;  2MWO A;  5CIU A;  3OYI A;  3DLM A;  3OA6 A;  3S6W A;  4E7J A;  2IG0 A;  2LRQ A;  4C5G A;  3MEU A;  2RHU A;  4A4H A;  2LTO A;  3L2Q A;  3MO8 A;  4GY5 A;  3OYB A;  2M16 A;  2RJE A;  3QJ6 A;  2PQW A;  2JTF A;  2VYT A;  3OYA A;  2RJC A;  2NLU A;  4OVA A;  4FU6 A;  4IUR A;  4B9X A;  4C5E A;  3OYJ A;  4E7H A;  4IKF A;  2GFA A;  4HCZ A;  2R5A A;  2EFI A;  3SD4 A;  2M0O A;  3FDR A;  4IUP A;  4QQD A;  3OYL A;  3OS1 A;  3MP6 A;  3PFS A;  4BD3 A;  3MP8 A;  4N4H A;  2YRV A;  4BDY A;  4II1 A;  4C5H A;  3LLR A;  4A4F A;  3ASK A;  3M9Q A;  3L2R A;  3L2W A;  4Q5W A;  2BKD N;  3PMT A;  4BE2 A;  3OYE A;  3OB9 A;  2LDM A;  1XNI A;  4N4G A;  3OS0 A;  2GF7 A;  3DB3 A;  5D6X A;  2E6N A;  5J39 A;  3QKJ A;  5KCO A;  1OYX A;  3O8V A;  3ZEH A;  3MP1 A;  2L8D A;  2RJF A;  3ME9 A;  1OI1 A;  3OQ5 A;  2M1H A;  4L59 A;  5J26 A;  1H3Z A;  5KE2 A;  5D6W A;  4QQG A;  2O4X A;  2XDP A;  5C0M A;  3OS2 A;  3OYM A;  3OMG A;  4QQ6 A;  2HQX A;  1WJR A;  2JZ2 A;  1OZ3 A;  2WAC A;  3UWN A;  2EQM A;  1G5V A;  2EQK A;  3DB4 A;  2RHI A;  3OYF A;  4EDU A;  4PLL A;  4BAC A;  5IN1 A;  3OY9 A;  2RI2 A;  2RO0 A;  4C5I A;  4RG2 A;  2X4Y A;  1SSF A;  2FHD A;  4A4E A;  1N27 A;  2O4X B;  4IUQ A;  4IUV A;  3UT1 A; 
#chains in the Genus database with same CATH topology
 1Y57 A;  2HDA A;  5GAN h;  1RAB B;  2QQ9 A;  3HRS A;  3CCL Q;  5IXB A;  4LDU A;  5GAN 7;  4F17 A;  1MMG A;  1RAE B;  1NPR A;  2DNU A;  3OYK A;  5DLO A;  3NMZ C;  2J7I A;  1Q86 U;  2BZX A;  2CS7 A;  1GBR A;  4O6J A;  2LJ3 A;  1ZSZ C;  2VXE A;  3CXC S;  5GAO m;  2XK0 A;  1R8O B;  2FG0 A;  3GIB A;  1PG5 B;  3CBP A;  2LVM A;  1IO6 A;  2H3E B;  1SHF A;  1MGQ A;  1W70 A;  4L6V 5;  1C0M A;  2IVW A;  5KYW A;  2QQB A;  1PRM C;  1RAC B;  4OB3 B;  2H8H A;  3E9G A;  1M2V A;  4JLI A;  1RUW A;  2P0Q A;  2DXC A;  2ZPG B;  2IG0 A;  1WNL A;  3I55 T;  2RJE A;  3RUX A;  2EGC A;  3PIP A;  3CC2 A;  2K5L A;  3CCR A;  3FB9 A;  2CZ7 B;  2YRC A;  4RUG A;  4J6Y A;  3HTR A;  1YCY A;  3X25 B;  1VQO A;  4AG2 C;  4OB2 B;  4BE2 A;  3G71 A;  4XK8 E;  2E6N A;  1K0X A;  4NOY A;  5CCA A;  2PVG B;  4M7D A;  3OQ5 A;  4LDX A;  4QQG A;  1QKW A;  3OW2 S;  2ZPB B;  1OZ3 A;  2BTT A;  2OTL A;  3OYF A;  2ABL A;  2KRO A;  3M0T A;  1UG1 A;  4BAC A;  3GNG A;  1VQ9 Q;  4BY6 B;  4HKE A;  3SDZ A;  4ELY C;  1S72 Q;  3MJX A;  1EZZ B;  5ECA A;  2BE9 B;  3V8L A;  1ZLM A;  2G3R A;  2OX7 A;  2COW A;  4BI3 A;  3CC7 T;  1YHQ A;  4PL6 A;  1Q95 G;  5LJ5 d;  1M4Z A;  3L42 A;  4RCC A;  1B34 B;  3CCU Q;  4RTW A;  4M77 E;  4N0A C;  4AMC A;  2EQU A;  4LD9 K;  1UGP B;  4A63 B;  2COY A;  3CD6 Q;  3ZFJ A;  1H3H A;  1KC8 R;  2DTO A;  2AIR B;  2CP6 A;  3JV3 A;  1B3Q A;  4PJO A;  1NEB A;  1M3C A;  2PUK B;  2QG9 B;  1LVK A;  2I2L A;  2EWN A;  4AFU C;  4C0F A;  4XTW A;  2MAM A;  3LH5 A;  1AD5 A;  3VJP A;  4J9G A;  2EJG A;  3V8K A;  1D1A A;  2V8J A;  2HEQ A;  1GCP A;  1YI2 T;  5CK9 A;  2YT6 A;  2XMF A;  3MO8 A;  2L0A A;  1QWE A;  3M58 A;  1VA7 A;  2EYY A;  1Q7Y U;  1OQK A;  2VVK A;  1KQ1 A;  3VS5 A;  1RAI B;  3EHR A;  5GMK m;  1P92 A;  4M75 E;  2K9G A;  1UGS B;  2XID A;  2CT4 A;  3OB9 A;  1XNI A;  2GF7 A;  1ZA2 B;  3M54 A;  5J26 A;  3MKD A;  5FWB A;  2W10 A;  3C12 A;  5LJ3 d;  1UUE A;  4C92 C;  1QVP A;  3H9N A;  2L2P A;  3WVD B;  1FYN A;  1PWT A;  1ZUY A;  2PVD B;  2CP5 A;  3CCS A;  4M78 D;  3NHN A;  2X4X A;  2L89 A;  3F70 A;  4J7I A;  3JCM h;  2DEU A;  4RTT A;  1PHT A;  1YIT A;  2WSE E;  4AFQ C;  5C6S A;  2R58 A;  2EQJ A;  1ARK A;  1KHI A;  3S3O A;  3GPL A;  1CKB A;  2DL5 A;  2GCX A;  2RK1 A;  4JS5 A;  4DBR A;  4KGV B;  3L2V A;  2LX9 A;  4F7U E;  3MEV A;  1VQN A;  1N8R R;  2QEX Q;  1AZG B;  3VS4 A;  3R6N A;  3A8G B;  3VV0 A;  1UGQ B;  2P0P A;  2DPP B;  1W2B S;  4JRP A;  2LJ0 A;  3V7R A;  5FU7 C;  4JRK A;  2RQV A;  3OYY A;  4C0Z A;  3JCM b;  1BIB A;  2KRM A;  3A1P A;  1NM7 A;  1GXI E;  5GAM d;  1M1K U;  4C92 G;  1IHW A;  2JM9 A;  3FDR A;  1VQL Q;  2E1H A;  1X27 A;  2KYB A;  3MP6 A;  1BU1 A;  1VQM Q;  1YNZ A;  2DYI A;  3MP8 A;  4D8K A;  4II1 A;  2NWM A;  3JCM P;  3PMT A;  2DMO A;  4M77 F;  3SFM A;  4DOW A;  2JM8 A;  1AWW A;  5D6X A;  1T3S A;  2NUZ A;  3EGX B;  2YLB A;  3O8V A;  4PKC C;  1N5Z A;  1AWO A;  7AT1 B;  4OF1 A;  5D6W A;  2XDP A;  1V29 B;  1VQ5 T;  3MCA B;  2DZC A;  2QXF A;  3QYH B;  1WJR A;  1T3L A;  1HJD A;  2WSC E;  2FRY A;  3VS3 A;  4MMK A;  3I56 A;  3SEM A;  1JJ2 P;  5IHN A;  4KBM B;  1YJ9 Q;  4IUV A;  1BK2 A;  1VQ8 T;  4B9W A;  4X9D A;  3IQL A;  4OML A;  1C1A A;  2AT1 B;  5KYN A;  2QDY B;  5GAN g;  3OYN A;  2LMJ A;  3I5S A;  2P4T A;  1MUZ A;  4C92 B;  1QVF S;  4PFO A;  4ZGJ B;  3CBM A;  2YSQ A;  1I0C A;  3E1S A;  2CP2 A;  1FMV A;  4J9H A;  2XDB A;  3P8H A;  3NTI A;  3QYG B;  5FRN A;  1JEG A;  1TG0 A;  2LQK A;  4FT4 A;  2LT1 A;  1R0B G;  4K11 A;  4UC4 A;  3RIR A;  1YBY A;  8ATC B;  2RHZ A;  1OU8 A;  2GFU A;  3AHU A;  1T0H A;  4FCY A;  2JTE A;  1IZ6 A;  2ZCF B;  3JCM Q;  4M7D C;  3MET A;  4MML A;  3CCQ T;  5KYY A;  4HCC A;  5CIU A;  3QPH A;  1SHG A;  4E7J A;  3GNF B;  1CSK A;  3CPF A;  1Y96 B;  4PNO A;  1XOV A;  2KR3 A;  3AT1 B;  3GLX A;  2I0N A;  3RMS A;  1Q81 U;  2JTF A;  2IIM A;  3G4S Q;  4HCZ A;  3JCM V;  1NZ9 A;  2CRE A;  2ECZ A;  2KXC A;  5FU7 B;  3CPW A;  3X26 B;  4MZM A;  2CP3 A;  1WYX A;  1TOV A;  1SG5 A;  4C0G A;  1K1Z A;  1YIJ Q;  2EKH A;  3LWH A;  4LDW A;  4BI4 A;  5GAN e;  1KQ2 A;  2ZAE A;  1WHH A;  2HAX A;  3OYM A;  2V1R A;  2YUO A;  5CO7 A;  3FIF A;  1SSH A;  4O5V A;  4C5I A;  4JZ4 A;  3RDV A;  3UDC A;  4MZT A;  2L3P A;  1YJW A;  3HL8 A;  2AHJ B;  4PJO C;  3OYG A;  1WQW A;  3V7S A;  3QO3 A;  3G1J A;  1M90 U;  1U3O A;  3CXC P;  2DF6 A;  3FEO A;  3JB9 G;  4M75 C;  4M7D G;  1OX8 A;  1YJN Q;  4GLM A;  3D7S B;  1QCN A;  2DRM A;  1O9S A;  3LGL A;  1NLP C;  2FRW A;  1G3S A;  3URG A;  3MEW A;  2P0K A;  3PVQ A;  5KYW B;  1YCS B;  3OMC A;  4V2S A;  3EG3 A;  4ME7 A;  3CMA A;  4E7S A;  4M7A A;  2XIC A;  1JXM A;  2V8I A;  4J5Y A;  1Y0M A;  1AT1 B;  1WGS A;  3CC2 T;  3CCR T;  2DTI A;  1WI7 A;  3CC4 Q;  2R5M A;  4E7Z A;  1VQO T;  2CKK A;  1EFN A;  2DK3 A;  2HNI A;  3M0R A;  3G71 T;  3I35 A;  1TSF A;  2C0O A;  3QZ9 B;  1Y71 A;  4R0K A;  1CKA A;  2VYT A;  4DA4 A;  2F2X A;  2ZPF B;  2HCK A;  1VQK A;  1M30 A;  3CCJ T;  4IUP A;  1XQH A;  2FL7 A;  2OTL T;  2YRV A;  1I5L A;  4M7D B;  3CQT A;  2E12 A;  4N4G A;  1D3B A;  4C92 E;  1JRI A;  2CZ6 B;  2H3J A;  2HMA A;  4KUL A;  1B07 A;  3MP1 A;  1QCF A;  1G2B A;  2C0I A;  3CME A;  5LJ5 g;  5KE2 A;  2EYW A;  4A53 A;  3A5Z B;  4M75 G;  2AKL A;  3RES A;  2J05 A;  3RER A;  2Y4Y A;  4ATO A;  4QVD A;  1M8V A;  1UDL A;  1SRM A;  3I5R A;  4J9C A;  4RTU A;  1YHQ T;  3JCM W;  3CCQ A;  2X51 A;  3RMQ A;  1RL2 A;  2RF0 A;  1MMN A;  4Y91 A;  1TXQ A;  4CC2 A;  2CSI A;  1K73 U;  1X43 A;  3P8B B;  2KI7 A;  1Q82 C;  3KUF A;  3VRZ A;  3PMI A;  3C0C A;  2CT3 A;  2QI2 A;  2M51 A;  2DET A;  2QA4 A;  2NUP A;  1WJQ A;  2DJQ A;  4DBF A;  1OX9 A;  3VS6 A;  2CUD A;  1NJI U;  2SEM A;  2K2M A;  1X6G A;  2RI5 A;  3QII A;  1QVG A;  2DL3 A;  1QWF A;  2K2V A;  3CCM Q;  1YFN A;  1PC0 A;  1U1T A;  4AFS C;  2EJF A;  2L3R A;  3BW1 A;  2M02 A;  3JB9 D;  2AZV A;  2K3X A;  4M75 B;  4RTV A;  1I1J A;  4C8Q E;  2MF2 A;  3HP9 A;  2LCL A;  1D09 B;  1JBM A;  2RN8 A;  3HKS A;  5HK0 A;  1E6G A;  2DIQ A;  4HVV A;  3LYI A;  3H8Z A;  2RB6 A;  5A2Q E;  4JJD A;  3A98 A;  2RQW A;  1MMA A;  1QQJ A;  3LWI A;  4F7U G;  3CCV A;  1UE9 A;  3J80 E;  3A8M B;  4B6M A;  1G83 A;  2EJ9 A;  4GY5 A;  2XU8 A;  2VWF A;  2M16 A;  5I2M A;  4VUB A;  1PSE A;  5LJ3 g;  1LPL A;  4M77 D;  4C5E A;  2DYB A;  4ZN3 A;  5GJV B;  5A0G A;  4JUV A;  5GAN 8;  1PD0 A;  3C95 A;  1ZSG A;  3CC2 Q;  2YHT A;  2VUB A;  2A7Y A;  3CCR Q;  3M9Q A;  3NPF A;  1D0Y A;  3L2W A;  3G7Z A;  1K8A C;  1KD1 U;  4E6R A;  1VQO Q;  5CQX A;  4RTX A;  2L8D A;  1LOJ A;  1WHK A;  2JT4 A;  2RA2 A;  3EG9 A;  3PT9 A;  3G71 Q;  5C0M A;  3CCS T;  2L3S A;  2RNA A;  4YTL A;  2D6F A;  1LJO A;  4KH1 B;  5GJW B;  5DLQ E;  5DM7 R;  3JCM e;  1PM3 A;  2RM4 A;  1VQ7 Q;  5GMK j;  3G6E A;  2RO0 A;  1FMK A;  2DFU A;  1YIT T;  5GMK h;  4GLK A;  2PTK A;  4QKU A;  2F2V A;  1HXD A;  1BI2 A;  1VQ4 Q;  4F7U B;  3CCE Q;  2FZG B;  5CVI A;  4PJM A;  3PIO A;  2LP5 A;  1SF9 A;  2XD0 A;  5GAO q;  4OMQ A;  5FRO A;  3CCJ A;  3DKM A;  3TEE A;  2VXF A;  4OMF B;  3UPU A;  2FVU A;  2DEQ A;  1VQN T;  2KRN A;  2LQN A;  2Y4X A;  5DY9 A;  3JCM X;  1YHQ Q;  2DX1 A;  1VQP A;  4ZTJ A;  4C92 F;  1K76 A;  5FU6 B;  2OAW A;  1YWP A;  2RMO A;  5GAM g;  2DZ9 A;  1W2B P;  4M7D E;  1PSF A;  3EG1 A;  1KQS A;  4IIO A;  1J3T A;  1V76 A;  2DXU A;  2FPE A;  3BDU A;  4JDS A;  2QYZ A;  2OI3 A;  2YLC A;  4L5G A;  3RKX A;  1GCQ A;  3PTA A;  3EH2 A;  4XQ3 A;  3N5B B;  3A8O B;  4PJN A;  2HKN A;  4XU1 A;  3U23 A;  5KYX A;  1GL5 A;  4DEX A;  2E3H A;  2JMC A;  3RKW A;  2HKQ B;  2BE7 D;  3BE3 A;  3O5Z A;  5I21 A;  1S72 A;  4Y92 A;  5GAO l;  4OMP A;  3I56 T;  2O31 A;  1ZSZ B;  2XG8 D;  3SWN C;  1OUL A;  4JLG A;  1I07 A;  1K9M U;  4Z8A A;  2KBT A;  2EBP A;  4ORZ A;  5KCO A;  3ZBD A;  1OI1 A;  4PJO E;  1YWO A;  2LX7 A;  1Q86 C;  1K9A A;  1QCO A;  2EW3 A;  9ATC B;  4RTY A;  2FYK A;  2MCN A;  2DKG A;  2K7A A;  3CD6 A;  5LJ5 j;  3KFV A;  4M7A C;  2DL8 A;  5LJ5 h;  1QVF P;  1WLP B;  1KSW A;  1ZHI A;  5HY6 A;  3I55 Q;  2DJZ A;  1X6O A;  1XJW B;  4QT7 A;  4FW2 A;  2ZGW A;  1D0Z A;  4JZ3 A;  3CCS Q;  2HZY A;  2A3L A;  5AYF A;  4JJB A;  2HQH A;  2KDS A;  3FJP A;  1RI9 A;  2CH4 W;  2JW4 A;  1S1N A;  1Y07 A;  1UHC A;  1G8X A;  3NTH A;  1BBZ A;  1NEG A;  2LQW A;  4MDX A;  2A37 A;  5D6Y A;  3EFS A;  3GBQ A;  2GTO A;  4ZN1 A;  2VKN A;  1Y7X A;  2JMA A;  5KYY B;  3X20 B;  1WHG A;  3QXE B;  2R57 A;  2G6F X;  3QDF A;  1RLP C;  1H8K A;  4E7I A;  1Q82 R;  1VQN Q;  3TU4 K;  3VS7 A;  4ZGE B;  2ZZD A;  4DEY A;  3TVT A;  1HSQ A;  5IAY A;  1GBQ A;  2M9U A;  4OMO A;  2CYZ B;  2JS2 A;  3DLM A;  2KXD A;  1AEY A;  2RHU A;  2CP0 A;  3JSC A;  4A4H A;  4HT8 A;  3JB9 I;  2HD0 A;  1C6V X;  4FU6 A;  2EPD A;  1WX6 A;  4IUR A;  2JJ9 A;  1UGV A;  1M1G A;  2EFI A;  3M55 A;  3CC7 Q;  2ZPE B;  4M7A G;  1IRX A;  4J9D A;  3L2R A;  3ER0 A;  5LJ3 j;  3JB9 F;  4KUI A;  1NBE B;  3DB3 A;  3QUI A;  5LJ3 h;  2D0N A;  1YJW T;  3QG1 A;  4M7D F;  4J6X A;  3ME9 A;  2KQW A;  2EAY A;  4Z89 A;  4C8Q C;  4D8D A;  2JZ2 A;  4FYX B;  2K5I A;  2RHI A;  3RKY A;  4EMK C;  3MPU B;  1VQ6 A;  3SWN B;  2CZ0 B;  2YRD A;  5D7U A;  4XTY A;  1FXX A;  4OP0 A;  4CC3 A;  4IUQ A;  4E47 A;  4PLI A;  1B34 A;  3LGF A;  5FRM A;  2QEX A;  1YI2 Q;  2O9S A;  4HCK A;  3CMA T;  1TUD A;  3BDL A;  5GMK l;  3EFO B;  1AVZ C;  1K8A R;  3TQ7 P;  1QW1 A;  3X28 B;  4IUT A;  4M78 A;  2K3Y A;  4M7A B;  3PNW C;  4AT1 B;  1KC8 U;  1DJ7 B;  3QZ5 B;  3H6Z A;  1Q7Y C;  4Z88 A;  1VQL A;  1ZA1 B;  2ZPI B;  1VQM A;  4FM4 B;  1UEB A;  3PVL A;  1FWZ A;  3EGU A;  2VB6 A;  4E7L A;  3BY7 A;  1X75 C;  1VQK T;  1MV3 A;  5GAM j;  1RAA B;  4AG1 C;  4M75 F;  5GAM h;  4RG8 A;  1BI3 A;  4C8Q G;  4LN2 A;  4XTV A;  2ED0 A;  4E2F B;  3QJ6 A;  1UGR B;  3M56 A;  1I8F A;  2C06 A;  2JTM A;  2QTV A;  1BI1 A;  3CME T;  3VKI A;  5IT9 E;  2R5A A;  2K6D A;  1D3B B;  4ZNX A;  1AOJ A;  1SEM A;  4N4H A;  5J3B A;  2ROT A;  5GAN 6;  2DL7 A;  3JB9 H;  2LDM A;  5IH2 A;  1U06 A;  4LXC A;  2OAU A;  2X3X D;  5EC7 A;  4QQ6 A;  4BUG A;  2FB7 A;  3QDR B;  5FW9 A;  2QA4 T;  3JCM f;  1PKT A;  3OY9 A;  2K5F A;  2X4Y A;  4D6W A;  3HFO A;  1SSF A;  1E7O A;  2YUN A;  2ENM A;  2D0Q B;  2O4X B;  5GAN 2;  1F1B B;  1G3W A;  2E3I A;  1WZO A;  1KIK A;  2NUP B;  3TSW A;  2BIV A;  2EYZ A;  1UJ0 A;  1OV3 A;  2X9H A;  1O75 A;  3M4Y A;  2CZ1 B;  4C8Q B;  1WFW A;  2DIG A;  1W4S A;  1GCQ C;  4XTU A;  1MNE A;  3LX7 A;  5CKH A;  2YUP A;  3VS1 A;  4ZTF A;  4EMK B;  4C92 D;  4F7U F;  1ZBX A;  2CUB A;  2E4H A;  2DXT A;  3VUZ A;  1OZ2 A;  2OTJ A;  2KGT A;  3BFM A;  1M1F A;  4J9F A;  2J6O A;  4FYY B;  1Q86 R;  1I4K 1;  3GOX A;  1M1K C;  2DLP A;  4LDY A;  3CCV T;  3NTK A;  1IXD A;  1M9S A;  3OYD A;  2YWW A;  2P84 A;  1N8R U;  1JU5 C;  5GAN 3;  1JJ2 A;  3EG0 A;  1VQ5 Q;  1I81 A;  1OPK A;  2E65 A;  4OMM A;  1RAD B;  3KXT A;  3VRY A;  2FEI A;  2BZ8 A;  3CPW S;  3VYH B;  4LUE A;  4DBH A;  2VV5 A;  4OB0 B;  1V1C A;  2CGH A;  1WHM A;  1OU9 A;  1VQ8 Q;  4JPB W;  1M2V B;  1ZBJ A;  4B9X A;  3EGX A;  4A4K A;  3VUB A;  3HSB A;  2W0Z A;  2EQI A;  2O9V A;  4BD3 A;  4BB7 A;  3HPW A;  3HRU A;  2FO0 A;  1VQK Q;  1QMC A;  1UEC A;  3G6E T;  2DE0 X;  2DIL A;  2GTJ A;  1OEB A;  5GMK e;  4FW1 A;  5GAN 4;  4M7A E;  2M1H A;  2JNG A;  2DXB A;  2BZY A;  1YJN A;  3OMG A;  4EPC A;  2RD1 A;  1JXO A;  1AZE A;  2EQM A;  1X2Q A;  4HXJ A;  3DB4 A;  1NYG A;  1BB9 A;  2MOX A;  4EMG A;  3VU3 C;  4PJO G;  1M3A A;  2K79 A;  2DRK A;  4DQ2 A;  4CRI A;  5GAO r;  1VQP T;  4C92 A;  3EG2 A;  3L2U A;  3CCQ Q;  3TCJ A;  2KE9 A;  4XTZ A;  3HFN A;  1BCM A;  5IXF A;  3CC4 A;  4FL6 A;  2EVR A;  4LNP A;  2E64 A;  2QA4 Q;  1GFC A;  2DTH A;  1Q81 C;  1QP2 A;  5L23 A;  2QQS A;  2X4J A;  2GBQ A;  1VYT A;  4XU0 A;  4QVC A;  5CKD A;  2OJ2 A;  1Y96 A;  4KUD K;  1TUC A;  2HQE A;  4RKU E;  3H41 A;  1MV0 B;  5KH6 A;  5KYX B;  4X1V A;  1S72 T;  4CI0 C;  1GRI A;  1TTH B;  4BY6 C;  1HK9 A;  1U1S A;  3CXC A;  4PJO B;  4Y28 E;  1IGQ A;  2XDD A;  3QWX X;  1MMD A;  2KNB B;  3UA6 A;  2PVO B;  2PQW A;  3CCV Q;  3T9N A;  1I5O B;  1LCK A;  1OPL A;  2LC4 A;  1WXB A;  1M2O A;  1WHJ A;  2GFA A;  3SD4 A;  1IRE B;  4WTO B;  1Z9Z A;  4M7D D;  2VGN A;  2JOY A;  2EYX A;  4BDY A;  1M90 C;  1VOM A;  2GQI A;  4KT0 E;  4CC7 A;  1SKU B;  2F1L A;  2D8H A;  5HCK A;  1IB8 A;  2F69 A;  3OYE A;  3CD6 T;  2MIO A;  4OGC A;  5LJ5 e;  2RJF A;  5CR2 A;  5I11 A;  2K3B A;  4PFP A;  5IHK A;  1ABO A;  1UFF A;  2LNH B;  3NGP A;  3OBW A;  4M78 C;  2EQK A;  2COZ A;  5GAO p;  1EIF A;  5IN1 A;  1TUG B;  3GF5 A;  3M59 A;  3EH1 A;  1YP5 A;  3CCM A;  1K4U S;  5A0D A;  3CCL A;  4R56 A;  3G6E Q;  1QVG S;  1X2K A;  2QAZ A;  1NG2 A;  1SPK A;  2RHX A;  3QSU A;  3RNJ A;  4BE0 A;  2PZ1 A;  4ELZ C;  3P8D A;  3OW2 A;  2VAS A;  2ROL A;  1BIA A;  5EG2 A;  4FYV B;  3R6O A;  1E6H A;  3CCJ Q;  4LD6 A;  4PJO D;  1NPP A;  2OTL Q;  2HBW A;  3RR6 A;  4F14 A;  5GAN 5;  5M9O A;  4PJJ A;  4NS5 A;  3Q1J A;  1VQP Q;  1ZQ1 A;  4M7A F;  2F2W A;  1RAG B;  4HA8 A;  4QW2 A;  4M75 D;  2MK5 A;  2JS0 A;  3I9Q A;  2FPF A;  3E2U A;  2CH4 A;  2Z0W A;  3REB B;  1PRL C;  4OMN A;  4F04 B;  3THK A;  1U8R A;  2GQV A;  2HBP A;  2E41 A;  4R55 A;  1PNJ A;  5KYU A;  3OYI A;  4FYW B;  4BI8 B;  1ACM B;  4C5G A;  4KH0 B;  3EGD A;  4FT2 A;  5LJ3 e;  2LTO A;  1FMW A;  4M78 G;  6AT1 B;  1PKS A;  1VQ7 A;  2RJC A;  1QKX A;  4OVA A;  4E7H A;  2YUQ A;  3CBO A;  1R77 A;  3OYL A;  1K73 C;  5HKC A;  4AFZ C;  1JQQ A;  1M1K R;  4C5H A;  1VQ4 A;  3FRN A;  3CCE A;  4KRT A;  1VQ6 T;  2GNC A;  4M77 A;  1OYX A;  4C0D C;  4DBQ A;  2PNI A;  1RAH B;  4NL3 A;  2Y90 A;  2QEX T;  1NJI C;  3H0H A;  1G5V A;  1Z9Q A;  2KRS A;  2LZ6 B;  1VQ9 A;  4EDU A;  4HVU A;  1ZUU A;  5A0L A;  1RLQ C;  2ZPH B;  2KSS A;  2FHD A;  3X24 B;  1AWJ A;  2YDL A;  3M5A A;  1RI0 A;  2KYM A;  1VIE A;  3OS5 A;  1KQS S;  2MMP A;  1M8M A;  4A54 A;  1UTI A;  5KE3 A;  5GAN f;  2NUT A;  2E5Q A;  1VQL T;  4M78 B;  2X35 A;  2CDT A;  1VQM T;  3GP8 A;  3CCU A;  4P5N A;  2XHC A;  4C8Q F;  3JCM J;  4LE9 A;  4M75 A;  2MPX C;  3HHT B;  3PGG A;  5GAM e;  3JCM d;  4OGE A;  3JRZ A;  3VS0 A;  2EGE A;  4DOV A;  4J9I A;  3WVE B;  2KMT A;  2B8A A;  2DA9 A;  3TSZ A;  4JJN K;  5I2S A;  2QTX A;  2E70 A;  3OSS C;  1AWX A;  4J83 A;  1KD1 C;  4CC4 B;  4BE1 A;  1YJ9 T;  3ULR B;  1OOT A;  1XTD A;  2DL4 A;  3L1A A;  3S6W A;  1TU0 B;  2LRQ A;  1YIT Q;  4FSX A;  2KEA A;  2FZK B;  3EHQ A;  3L2Q A;  2J6F A;  2O01 E;  2RQT A;  1M27 C;  1NLO C;  3OYA A;  2V1Q A;  1Q81 R;  1BI0 A;  3A8H B;  1X01 A;  4XU2 A;  3OS1 A;  3V7C A;  2AK5 A;  3LLR A;  1W2B A;  5CQY A;  5GMK i;  3I55 A;  3ZEH A;  1MND A;  4TVR A;  2PUO B;  2GGR A;  3QWY A;  2DO3 A;  1H3Z A;  4OB1 B;  2FPD A;  2AKK A;  2WAC A;  4F7U A;  5IHI A;  3M0S A;  1ZX6 A;  2KK4 A;  4RG2 A;  1N9S A;  4GBQ A;  2OTJ T;  3UT1 A;  4C0D B;  1VQ6 Q;  3S3M A;  3L2Z A;  1FX7 A;  2MI6 A;  3G4S T;  1WJS A;  2DBM A;  2HL5 C;  5HK3 A;  1WQ7 A;  4ESR A;  2V26 A;  3LW5 E;  4X9C A;  1M90 R;  4QVZ A;  2QGG A;  2XKO C;  1JO8 A;  3HRT A;  4JRQ A;  2JUF A;  1KG1 A;  1LNX A;  5I22 A;  3OYC A;  1D1B A;  1YIJ T;  1WPY A;  3I56 Q;  2AZS A;  5CAI A;  2EGA A;  3VS2 A;  3CPW P;  4XAX B;  3CC7 A;  1MHN A;  1WIE A;  4ANJ A;  3M57 A;  3S3N A;  3H0F A;  3M0Q A;  2HSE B;  1VYU A;  3FJ5 A;  2VC8 A;  4HVW A;  1K9M C;  1KK7 A;  5CKB A;  2F5K A;  1QVF A;  4E7K A;  1HD3 A;  4N4I A;  4LDV A;  4RMO A;  2A28 A;  2QK0 A;  2BUD A;  4WCI A;  1KHC A;  4EIK A;  3REA B;  4BDZ A;  2KAF A;  3RBB B;  4FIB A;  3MEU A;  2RQR A;  3ZL7 C;  1ZSZ A;  3OYB A;  2YXY A;  4PJO F;  3OYJ A;  1KJW A;  2X3W D;  1YJN T;  2QQA A;  2D8J A;  2M0O A;  2XI9 A;  5GAO n;  2E10 A;  3J7A F;  3PFS A;  4M78 E;  1ABQ A;  3KBG A;  5FLX E;  4Q5W A;  3UAT A;  1QLY A;  1YI2 A;  3J81 E;  3QKJ A;  2DVE A;  5LJ5 f;  1BCO A;  4L59 A;  3SHW A;  2HQX A;  2QDL A;  2J6K A;  1HYO A;  2P4R A;  1YJ9 A;  2CSQ A;  3CC4 T;  4IIM A;  2WSF E;  2A08 A;  1VYV A;  3PE0 A;  1IHV A;  2ATC B;  1RAF B;  4A4E A;  2HL3 A;  4NL2 A;  1WDX A;  2E6Z A;  1K73 R;  3A8L B;  2D9T A;  1YN8 A;  3FC3 A;  1QP3 A;  2DD5 A;  3MEA A;  2DER A;  1N6A A;  3DLL A;  4XU3 A;  5KCH A;  3QHS A;  3EAE A;  5CKF A;  3LH0 A;  4M7A D;  2IPO B;  2QQR A;  3OYH A;  2MYS A;  3WXM B;  2EIF A;  3FLG A;  8AT1 B;  1AHJ B;  1NJI R;  2ED1 A;  5L8R E;  2OTJ Q;  4A4G A;  4XTX A;  2JXB A;  3E9F A;  3JCM c;  4FSS A;  1YJW Q;  1WA7 A;  2X4W A;  2SRC A;  4F16 A;  1W1F A;  2KT8 A;  3C4S A;  1Q82 U;  1A0N B;  4M77 C;  1X69 A;  2RJD A;  2RHY A;  1IGU A;  2MWO A;  2KY9 A;  4PFZ A;  2LJ1 A;  1M3B A;  3G4S A;  4WF2 A;  3JB9 J;  5LJ3 f;  3M4G A;  4N0A A;  2D1X A;  3M53 A;  3UA7 A;  1NYF A;  3EFR A;  2A36 A;  3QJY A;  3CMA Q;  4MZP A;  4QQD A;  1TS9 A;  5LL6 S;  4ZGD B;  1N9R A;  2L3Q A;  1YIJ A;  3OSV A;  3OS0 A;  5J39 A;  3CCM T;  1ZUK A;  3CCL T;  2RH2 A;  2DM1 A;  3SWN A;  1KD1 R;  1WHL A;  2LNV A;  4M4Z A;  1QVG P;  3C94 A;  3INZ A;  1KC8 C;  1JB0 E;  1X6B A;  3SB2 A;  1BKB A;  2V8K A;  2F5T X;  1B7T A;  1K0S A;  3UF4 A;  3EFO A;  3EG9 B;  2JN0 A;  1W6X A;  2ESW A;  1N27 A;  4JJC A;  2J06 A;  1D0X A;  4J7F A;  1VQ5 A;  4C8Q D;  1U5S A;  2RQU A;  3M0P A;  2B86 A;  4HCB A;  4J6W A;  1JJ2 S;  1K8A U;  2EYQ A;  4M77 G;  2CP7 A;  4PJL A;  4IUU A;  2LCS A;  2K57 A;  4J9B A;  3CME Q;  4MDW A;  1PCX A;  1G3Y A;  2L5Q A;  1GFD A;  1UB4 A;  4M78 F;  3JAM E;  1SRL A;  1H64 1;  1EX4 A;  4J8O A;  1TH7 A;  5FWC A;  1G3T A;  1VQ8 A;  3NFC A;  4JRI A;  2PU9 B;  2DAQ A;  1UJY A;  2FZC B;  5GAM f;  4HT9 A;  1TWB A;  4Z02 A;  1NE8 A;  2E5K A;  4KGZ B;  2DBK A;  2RI3 A;  2EKO A;  2LCC A;  1WXT A;  4X34 A;  1VQ7 T;  1WXU A;  2RK2 A;  3VYG A;  5KYU B;  2K4Y A;  4RTZ A;  2A0F B;  3OW2 P;  2RPN A;  5GAN d;  3EGD B;  2MWP A;  3H0I A;  3QBY A;  4EMH A;  3CEY A;  3V8J A;  1VQ4 T;  4LUD A;  3OA6 A;  3CCE T;  4JS4 A;  5CKE A;  1VIF A;  2QGF B;  2NLU A;  4IKF A;  4PK4 A;  2LQ8 A;  1D1C A;  3E19 A;  4M77 B;  2QAS A;  1VQ9 T;  2DVJ A;  2HSP A;  4A4F A;  1KFZ A;  3ASK A;  3OBY A;  2BKD N;  2M0Y A;  2KVQ G;  4RCB A;  2O2O A;  5FU6 C;  1R0C B;  1K9M R;  1T0J A;  2O4X A;  4KGX B;  3OS2 A;  5AT1 B;  1BYM A;  1PD1 A;  2VGM A;  3UWN A;  2KT1 A;  1KQS P;  1UHF A;  1H92 A;  3MHX A;  3TRE A;  4PLL A;  4C8Q A;  1VUB A;  3JCM g;  3CCU T;  2RI2 A;  2JVV A;  2O88 A;  2LT4 A;  1Q7Y R;  2NYS A;  4EMK A;  2NUT B;  1N8R C;  5GAN j;  1M5Q 1;  2C0T A;  3M0U A;  4J9E A;  2DD4 A; 
#chains in the Genus database with same CATH homology
 4PJO C;  1RI0 A;  3OYG A;  1WQW A;  3V7S A;  3QO3 A;  4E47 A;  1VIE A;  2QQ9 A;  3OS5 A;  4PLI A;  5GAN h;  1M90 U;  1B34 A;  1KQS S;  3HRS A;  2MMP A;  3LGF A;  4A54 A;  2QEX A;  5FRM A;  5KE3 A;  5GAN f;  2E5Q A;  4LDU A;  1VQL T;  3CMA T;  3FEO A;  3BDL A;  4M78 B;  2X35 A;  3JB9 G;  1VQM T;  5GMK l;  5GAN 7;  3GP8 A;  3CCU A;  1NPR A;  4P5N A;  4M75 C;  4M7D G;  3OYK A;  2XHC A;  4C8Q F;  5DLO A;  3JCM J;  1QW1 A;  1O9S A;  3X28 B;  3LGL A;  4IUT A;  4M78 A;  1Q86 U;  2K3Y A;  2CS7 A;  1G3S A;  4M75 A;  4M7A B;  4O6J A;  3HHT B;  2VXE A;  3URG A;  3PNW C;  3CXC S;  1KC8 U;  3MEW A;  5GAO m;  2P0K A;  3PGG A;  1DJ7 B;  1R8O B;  2XK0 A;  3QZ5 B;  4OGE A;  5GAM e;  3JRZ A;  4DOV A;  3JCM d;  3H6Z A;  3OMC A;  3GIB A;  4V2S A;  1Q7Y C;  3CBP A;  3WVE B;  2LVM A;  4ME7 A;  3CMA A;  1VQL A;  1MGQ A;  2KMT A;  2ZPI B;  2B8A A;  2XIC A;  1VQM A;  4FM4 B;  2V8I A;  4M7A A;  4L6V 5;  4J5Y A;  1UEB A;  1FWZ A;  4JJN K;  5I2S A;  2IVW A;  2QQB A;  2QTX A;  1WGS A;  2E70 A;  3OSS C;  3CC2 T;  4J83 A;  1KD1 C;  3CCR T;  4OB3 B;  4BE1 A;  3BY7 A;  4E7L A;  1X75 C;  3E9G A;  1YJ9 T;  1VQK T;  4JLI A;  2DTI A;  5GAM j;  2P0Q A;  2R5M A;  4M75 F;  1VQO T;  1XTD A;  2CKK A;  5GAM h;  2DXC A;  2ZPG B;  2DK3 A;  2HNI A;  3L1A A;  4RG8 A;  3S6W A;  2IG0 A;  2LRQ A;  4FSX A;  1WNL A;  1BI3 A;  3I55 T;  3G71 T;  4C8Q G;  4XTV A;  3L2Q A;  3QZ9 B;  1Y71 A;  2RJE A;  3QJ6 A;  1UGR B;  3M56 A;  1I8F A;  2C06 A;  2JTM A;  2O01 E;  2VYT A;  3RUX A;  3OYA A;  1BI1 A;  3CME T;  2ZPF B;  3VKI A;  4DA4 A;  3PIP A;  3CC2 A;  5IT9 E;  2K5L A;  3CCR A;  2R5A A;  3FB9 A;  1BI0 A;  1VQK A;  2CZ7 B;  3A8H B;  3CCJ T;  1X01 A;  1D3B B;  1XQH A;  4IUP A;  4XU2 A;  4J6Y A;  3OS1 A;  2FL7 A;  1YCY A;  3V7C A;  4N4H A;  3X25 B;  2YRV A;  2OTL T;  1I5L A;  5J3B A;  1VQO A;  4OB2 B;  4M7D B;  3LLR A;  1W2B A;  5GAN 6;  4BE2 A;  5CQY A;  5GMK i;  3I55 A;  3JB9 H;  2E12 A;  2LDM A;  4N4G A;  1D3B A;  3G71 A;  4XK8 E;  4C92 E;  1JRI A;  2CZ6 B;  2E6N A;  2H3J A;  4KUL A;  3ZEH A;  4NOY A;  5CCA A;  3MP1 A;  2PVG B;  4TVR A;  2PUO B;  4M7D A;  3OQ5 A;  3CME A;  2OAU A;  4LDX A;  2DO3 A;  5LJ5 g;  1H3Z A;  4OB1 B;  5KE2 A;  4QQG A;  3OW2 S;  4A53 A;  3A5Z B;  4QQ6 A;  4M75 G;  4BUG A;  2ZPB B;  2FB7 A;  1OZ3 A;  3RES A;  2WAC A;  3RER A;  2Y4Y A;  3QDR B;  4F7U A;  4QVD A;  2OTL A;  4ATO A;  1M8V A;  3OYF A;  2QA4 T;  3JCM f;  4BAC A;  1YHQ T;  3OY9 A;  2K5F A;  3JCM W;  3GNG A;  2KK4 A;  3CCQ A;  4RG2 A;  2X4Y A;  3RMQ A;  1N9S A;  1RL2 A;  3HFO A;  1SSF A;  4Y91 A;  4D6W A;  4BY6 B;  2D0Q B;  2O4X B;  4HKE A;  3SDZ A;  5GAN 2;  1K73 U;  2OTJ T;  1G3W A;  3UT1 A;  4C0D B;  4ELY C;  2BIV A;  3P8B B;  3S3M A;  3L2Z A;  1FX7 A;  3V8L A;  1Q82 C;  2MI6 A;  1O75 A;  3KUF A;  3M4Y A;  2G3R A;  1WJS A;  5HK3 A;  3G4S T;  3PMI A;  1WQ7 A;  2CZ1 B;  4C8Q B;  2QI2 A;  2DIG A;  4BI3 A;  1W4S A;  3LW5 E;  4X9C A;  4XTU A;  3LX7 A;  4QVZ A;  5CKH A;  3CC7 T;  2QA4 A;  1WJQ A;  4ZTF A;  4EMK B;  1YHQ A;  2XKO C;  4PL6 A;  3HRT A;  4C92 D;  4F7U F;  4JRQ A;  5LJ5 d;  1ZBX A;  1M4Z A;  3L42 A;  2DXT A;  2JUF A;  3VUZ A;  1KG1 A;  1LNX A;  1NJI U;  1OZ2 A;  4RCC A;  1B34 B;  2OTJ A;  3OYC A;  4M77 E;  3BFM A;  1YIJ T;  1M1F A;  1WPY A;  2RI5 A;  4N0A C;  2EQU A;  5CAI A;  3QII A;  1QVG A;  4LD9 K;  1I4K 1;  3GOX A;  1M1K C;  1UGP B;  4LDY A;  3CCV T;  3ZFJ A;  3NTK A;  2K2V A;  1M9S A;  2DTO A;  4XAX B;  3OYD A;  3CC7 A;  1MHN A;  1U1T A;  1N8R U;  2EJF A;  2L3R A;  3BW1 A;  5GAN 3;  1JJ2 A;  4PJO A;  3M57 A;  2PUK B;  3S3N A;  3JB9 D;  2K3X A;  2I2L A;  2EWN A;  2VC8 A;  4M75 B;  4C0F A;  1I81 A;  2E65 A;  4XTW A;  2MAM A;  4C8Q E;  1K9M C;  2MF2 A;  3HP9 A;  2LCL A;  3HKS A;  1JBM A;  5CKB A;  5HK0 A;  2F5K A;  1QVF A;  2DIQ A;  3KXT A;  4E7K A;  3VJP A;  3CPW S;  2EJG A;  4N4I A;  3LYI A;  3H8Z A;  4LDV A;  3VYH B;  2VV5 A;  3V8K A;  2RB6 A;  2BUD A;  4RMO A;  5A2Q E;  4OB0 B;  1KHC A;  4BDZ A;  2KAF A;  2V8J A;  3LWI A;  4F7U G;  3CCV A;  3J80 E;  2CGH A;  3A8M B;  1YI2 T;  4FIB A;  3MEU A;  2EJ9 A;  5CK9 A;  3MO8 A;  4GY5 A;  2XU8 A;  5I2M A;  2M16 A;  3OYB A;  4VUB A;  1PSE A;  5LJ3 g;  4PJO F;  3M58 A;  4B9X A;  4M77 D;  4C5E A;  5A0G A;  4ZN3 A;  5GAN 8;  3OYJ A;  4JUV A;  1YJN T;  2QQA A;  3C95 A;  3VUB A;  2M0O A;  4A4K A;  1Q7Y U;  3HSB A;  2XI9 A;  5GAO n;  2E10 A;  3J7A F;  3PFS A;  4BD3 A;  4BB7 A;  1KQ1 A;  3HPW A;  3HRU A;  2YHT A;  2VUB A;  2A7Y A;  3KBG A;  4M78 E;  5GMK m;  1P92 A;  5FLX E;  3M9Q A;  4M75 E;  3L2W A;  4Q5W A;  1UGS B;  2XID A;  3G7Z A;  3G6E T;  1YI2 A;  1K8A C;  3OB9 A;  3J81 E;  1XNI A;  1KD1 U;  2GF7 A;  5GMK e;  5CQX A;  3QKJ A;  2DVE A;  2L8D A;  5LJ5 f;  5GAN 4;  1LOJ A;  2M1H A;  2RA2 A;  3M54 A;  4L59 A;  3PT9 A;  5J26 A;  4M7A E;  2JNG A;  2DXB A;  5C0M A;  1YJN A;  3OMG A;  3CCS T;  4EPC A;  2HQX A;  2RD1 A;  3C12 A;  2EQM A;  4YTL A;  1LJO A;  2D6F A;  1YJ9 A;  3DB4 A;  5DLQ E;  5DM7 R;  3JCM e;  5LJ3 d;  3CC4 T;  2RM4 A;  5GMK j;  2WSF E;  3G6E A;  4C92 C;  2RO0 A;  1QVP A;  4EMG A;  3VU3 C;  1YIT T;  4PJO G;  5GMK h;  4A4E A;  3WVD B;  4GLK A;  5GAO r;  4DQ2 A;  4NL2 A;  4CRI A;  1VQP T;  4C92 A;  3L2U A;  1HXD A;  1BI2 A;  2PVD B;  2E6Z A;  3TCJ A;  4F7U B;  3CCS A;  3A8L B;  5CVI A;  3PIO A;  2D9T A;  4M78 D;  4XTZ A;  3FC3 A;  1QP3 A;  2DD5 A;  3HFN A;  3MEA A;  2XD0 A;  1N6A A;  5GAO q;  3DLL A;  5FRO A;  3CCJ A;  3CC4 A;  2X4X A;  2L89 A;  3DKM A;  3F70 A;  4FL6 A;  4J7I A;  4XU3 A;  3JCM h;  5KCH A;  3TEE A;  3QHS A;  3EAE A;  2VXF A;  4OMF B;  3UPU A;  2FVU A;  2DEQ A;  1VQN T;  1YIT A;  4IUQ A;  2WSE E;  2E64 A;  3LH0 A;  5CKF A;  4M7A D;  2QQR A;  2Y4X A;  5DY9 A;  3WXM B;  3JCM X;  2DTH A;  5C6S A;  3OYH A;  1VQP A;  1Q81 C;  4ZTJ A;  1QP2 A;  2EIF A;  2R58 A;  3FLG A;  2EQJ A;  2QQS A;  1AHJ B;  1KHI A;  4C92 F;  3S3O A;  5FU6 B;  5L8R E;  3GPL A;  4M7D E;  5GAM g;  2DZ9 A;  2X4J A;  1PSF A;  4A4G A;  4XTX A;  1KQS A;  3E9F A;  3JCM c;  2DXU A;  2GCX A;  2RK1 A;  3BDU A;  4XU0 A;  4QVC A;  5CKD A;  2X4W A;  4JS5 A;  3L2V A;  2LX9 A;  4JDS A;  4F7U E;  3MEV A;  1Y96 A;  1VQN A;  4KUD K;  3C4S A;  1Q82 U;  2HQE A;  4RKU E;  2YLC A;  3A8G B;  4L5G A;  1UGQ B;  2P0P A;  4M77 C;  3RKX A;  3VV0 A;  5KH6 A;  2RJD A;  2DPP B;  3PTA A;  1W2B S;  4XQ3 A;  4JRP A;  3N5B B;  3V7R A;  3A8O B;  1S72 T;  4CI0 C;  5FU7 C;  2RHY A;  4JRK A;  3OYY A;  4BY6 C;  1HK9 A;  2MWO A;  1U1S A;  4XU1 A;  4C0Z A;  3CXC A;  3JCM b;  2KY9 A;  4PJO B;  1BIB A;  4Y28 E;  3G4S A;  4WF2 A;  2XDD A;  3JB9 J;  5LJ3 f;  3M4G A;  2PVO B;  2PQW A;  4N0A A;  1GXI E;  3T9N A;  3M53 A;  2LC4 A;  3RKW A;  3EFR A;  2GFA A;  5GAM d;  1M1K U;  4C92 G;  3QJY A;  3SD4 A;  3FDR A;  1IRE B;  4MZP A;  4QQD A;  2E1H A;  5LL6 S;  4ZGD B;  3MP6 A;  5I21 A;  4M7D D;  1S72 A;  1N9R A;  2VGN A;  2JOY A;  3MP8 A;  5GAO l;  4II1 A;  4BDY A;  3I56 T;  1M90 C;  3JCM P;  4KT0 E;  1YIJ A;  3PMT A;  2XG8 D;  4M77 F;  3SWN C;  4JLG A;  2F69 A;  3OSV A;  3SFM A;  4DOW A;  3OS0 A;  3OYE A;  1K9M U;  3CD6 T;  5D6X A;  5J39 A;  3CCM T;  5KCO A;  3O8V A;  2YLB A;  3CCL T;  4PKC C;  2RH2 A;  4OGC A;  3ZBD A;  2RJF A;  3SWN A;  5LJ5 e;  1OI1 A;  5CR2 A;  4OF1 A;  2LNV A;  5D6W A;  2XDP A;  1V29 B;  1VQ5 T;  4PJO E;  3MCA B;  2DZC A;  2QXF A;  3QYH B;  1WJR A;  3C94 A;  3INZ A;  1Q86 C;  2WSC E;  3OBW A;  4M78 C;  2EQK A;  5GAO p;  4MMK A;  1EIF A;  1KC8 C;  1JB0 E;  3I56 A;  5IN1 A;  3SB2 A;  2FYK A;  2DKG A;  3GF5 A;  1BKB A;  3M59 A;  4KBM B;  2V8K A;  2F5T X;  3CD6 A;  2JN0 A;  5LJ5 j;  1N27 A;  3CCM A;  5A0D A;  3CCL A;  4M7A C;  4R56 A;  4IUV A;  1QVG S;  5LJ5 h;  1VQ8 T;  4J7F A;  1ZHI A;  1VQ5 A;  4C8Q D;  4B9W A;  2RHX A;  4X9D A;  3QSU A;  5HY6 A;  4HCB A;  4J6W A;  1JJ2 S;  2DJZ A;  1X6O A;  4BE0 A;  2EYQ A;  1K8A U;  2QDY B;  4ELZ C;  3P8D A;  5GAN g;  3OYN A;  4M77 G;  3OW2 A;  4IUU A;  2ZGW A;  2K57 A;  1BIA A;  5EG2 A;  2P4T A;  4MDW A;  1G3Y A;  2A3L A;  2L5Q A;  3R6O A;  5AYF A;  4C92 B;  4ZGJ B;  1QVF S;  3CBM A;  2KDS A;  3FJP A;  1UB4 A;  4M78 F;  3E1S A;  3JAM E;  4LD6 A;  1H64 1;  2XDB A;  4PJO D;  4J8O A;  1NPP A;  1TH7 A;  3P8H A;  3NTI A;  1Y07 A;  1G3T A;  1VQ8 A;  3QYG B;  3NFC A;  5GAN 5;  5FRN A;  5M9O A;  4JRI A;  2PU9 B;  3NTH A;  2DAQ A;  5GAM f;  4HT9 A;  2LQK A;  4NS5 A;  3Q1J A;  4FT4 A;  4Z02 A;  4MDX A;  1NE8 A;  1ZQ1 A;  4M7A F;  5D6Y A;  3EFS A;  2LT1 A;  4HA8 A;  4QW2 A;  2RI3 A;  4M75 D;  4ZN1 A;  2EKO A;  4UC4 A;  2LCC A;  3RIR A;  1YBY A;  1Y7X A;  4X34 A;  2RHZ A;  1VQ7 T;  2RK2 A;  2GFU A;  3VYG A;  3X20 B;  3QXE B;  2K4Y A;  3AHU A;  2R57 A;  5GAN d;  1IZ6 A;  2MWP A;  4E7I A;  2GQV A;  1U8R A;  2ZCF B;  3QBY A;  4EMH A;  2HBP A;  3CEY A;  3TU4 K;  2E41 A;  4ZGE B;  3JCM Q;  2ZZD A;  3MET A;  4MML A;  5IAY A;  3V8J A;  4R55 A;  3CCQ T;  2M9U A;  4M7D C;  1VQ4 T;  2CYZ B;  4HCC A;  5CIU A;  3QPH A;  3DLM A;  4BI8 B;  3OYI A;  3OA6 A;  4E7J A;  3GNF B;  3CCE T;  4C5G A;  4JS4 A;  3CPF A;  5CKE A;  1Y96 B;  1VIF A;  1XOV A;  4PNO A;  2RHU A;  3JSC A;  4A4H A;  4FT2 A;  5LJ3 e;  2LTO A;  3GLX A;  3RMS A;  1Q81 U;  4M78 G;  4HT8 A;  3JB9 I;  2HD0 A;  2JTF A;  1VQ7 A;  2RJC A;  2NLU A;  4OVA A;  4FU6 A;  4IUR A;  4E7H A;  4IKF A;  2LQ8 A;  3E19 A;  3CBO A;  4HCZ A;  1M1G A;  2EFI A;  4M77 B;  3JCM V;  3M55 A;  1NZ9 A;  3OYL A;  1K73 C;  5HKC A;  2ZPE B;  4M7A G;  1VQ9 T;  4C5H A;  5FU7 B;  4A4F A;  3FRN A;  3ASK A;  3OBY A;  3CPW A;  3L2R A;  3CCE A;  1VQ4 A;  2BKD N;  3X26 B;  4MZM A;  3ER0 A;  5LJ3 j;  1VQ6 T;  2KVQ G;  3JB9 F;  4M77 A;  4KUI A;  3DB3 A;  3QUI A;  4RCB A;  4C0G A;  5LJ3 h;  1OYX A;  4C0D C;  5FU6 C;  3QG1 A;  1YJW T;  4M7D F;  3LWH A;  4J6X A;  3ME9 A;  4LDW A;  4BI4 A;  4NL3 A;  5GAN e;  1KQ2 A;  2HAX A;  3OYM A;  2O4X A;  3OS2 A;  2KQW A;  1BYM A;  2EAY A;  2Y90 A;  2QEX T;  1NJI C;  4C8Q C;  5CO7 A;  2VGM A;  2JZ2 A;  1G5V A;  3UWN A;  2K5I A;  3FIF A;  2RHI A;  3RKY A;  1VQ9 A;  3MHX A;  4EDU A;  4EMK C;  3TRE A;  4PLL A;  4C8Q A;  1VUB A;  3JCM g;  3CCU T;  4O5V A;  5A0L A;  2RI2 A;  2JVV A;  1VQ6 A;  4C5I A;  3UDC A;  2LT4 A;  3SWN B;  4MZT A;  2CZ0 B;  2ZPH B;  2KSS A;  2FHD A;  3X24 B;  4EMK A;  4XTY A;  1N8R C;  1FXX A;  1M5Q 1;  4OP0 A;  5GAN j;  3HL8 A;  1YJW A;  2AHJ B;  3M5A A;  2DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...