2BUDA

The solution structure of the chromo barrel domain from the males- absent on the first (mof) protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
GSHMDPLMQKIDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Chromo Barrel Domain from the Mof Acetyltransferase
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords MALES-ABSENT ON THE FIRST PROTEIN
total genus 7
structure length 92
sequence length 92
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2budA00
3P8HA 5C6SA 4IKFA 1RI0A 2B8AA 2L89A 2DIQA 2QQRA 2LRQA 4BE2A 3MP1A 5KCOA 4E7JA 4L59A 2BKDN 2LCCA 1MHNA 2RHYA 3CEYA 3QKJA 4C5GA 5FROA 2K3XA 4ZTJA 3UWNA 5IAYA 2RHIA 5D6WA 4E7LA 4BE1A 5C0MA 3MEUA 3OS1A 2P0KA 3DLMA 5KH6A 4BDYA 5FRNA 3MO8A 4BDZA 2X4YA 2DIGA 2E5QA 2HQXA 2O4XB 3OY9A 1WGSA 4B9XA 2RI2A 3OYBA 3PMTA 2QQSA 3OB9A 4OVAA 2MWOA 3S6WA 4E7KA 2MWPA 3LYIA 3E9GA 4N4HA 4IUQA 4A4EA 3L2QA 1OZ2A 2NLUA 3OYCA 2EFIA 3L2VA 4C5IA 3OYDA 2BIVA 3QBYA 2M16A 2R58A 2D9TA 2L3RA 2WACA 5KCHA 2EQJA 4N4GA 3P8DA 4C5EA 3LH0A 3OYLA 3H6ZA 3MP6A 2GFUA 4BACA 2VYTA 3PNWC 3EAEA 3ME9A 3MEWA 3NTIA 4FU6A 2GFAA 4QQGA 1WJQA 3SD4A 5J26A 2G3RA 3PFSA 1WJSA 3OYHA 4IURA 2M1HA 2RI3A 3LX7A 4QQDA 2RJEA 3QIIA 3FLGA 2R5AA 1KHCA 3PMIA 3FDRA 2GF7A 2RJCA 4ZTFA 3E9FA 5IN1A 3OQ5A 4B9WA 2R5MA 1OYXA 3LGFA 3OYFA 2JZ2A 5CIUA 4Q5WA 3OYEA 1XNIA 3MEVA 2CKKA 3FEOA 1OI1A 3LGLA 2RI5A 2X35A 4N4IA 2PQWA 5FRMA 4EDUA 4X34A 4NS5A 4LD6A 5D6XA 5M9OA 3MEAA 3KUFA 4IUPA 3UT1A 3L2WA 2BUDA 2EKOA 2IG0A 3MP8A 5KE3A 3ASKA 4PL6A 3DB4A 4Z02A 3OYGA 3FC3A 3S3NA 2RHZA 2RJDA 3S3OA 3OMGA 2LVMA 2EQMA 3Q1JA 3META 2RO0A 2XDPA 2L8DA 4RG2A 3H8ZA 3F70A 2JTFA 4GY5A 3DB3A 1WJRA 4QQ6A 2R57A 4QW2A 1H3ZA 2YRVA 3OYMA 5KE2A 3OYAA 2LDMA 4IUTA 4II1A 3S3MA 4A4GA 4QVZA 2EQUA 3OS0A 4UC4A 2X4WA 1SSFA 2RHUA 3L42A 3ZEHA 2HQEA 4PLIA 2M0OA 3BDLA 2RHXA 2E6NA 4HCZA 3OYIA 3L2UA 4IUUA 4E7HA 4BD3A 3NTKA 2LTOA 5J39A 2XK0A 3L2RA 1G5VA 3QJ6A 4E7IA 2O4XA 1OZ3A 3OYJA 3LLRA 1N27A 2X4XA 4IUVA 4C5HA 4PLLA 4CRIA 2EQKA 3O8VA 4FL6A 2K3YA 3OS2A 4BE0A 3OYKA 3C4SA 3OMCA 3OA6A 3M9QA 2FHDA 4A4FA 2F5KA 3OYNA 2DAQA 2RJFA 5D6YA 3GOXA 3NTHA 4A4HA
chains in the Genus database with same CATH superfamily
3FRNA 1T0JA 2RD1A 4C92C 2SRCA 2QTXA 5GANh 4KGZB 4C8QA 5D6WA 2RNAA 2H3EB 1VQPQ 2CSQA 4M7DC 3MO8A 1YJNA 3EFRA 1O75A 3OYBA 1UGPB 1QVFP 1JJ2P 1U1TA 2E3IA 1M8MA 4MZTA 4F14A 5KCHA 3PT9A 3G4ST 1OULA 2NWMA 4RTYA 5GAMe 2E65A 3CMEA 4FU6A 1JXMA 1VQOT 4F7UB 1VQ5A 3FLGA 3OBYA 3FDRA 4FW2A 4C92E 1YN8A 2YDLA 3SEMA 1B7TA 1FX7A 2Z0WA 2EGEA 2MAMA 2C0OA 4BY6C 1U8RA 2EIFA 2CT3A 1VQ6A 2NUPB 1QVGS 1ZBXA 1XJWB 3HKSA 2M9UA 2GQVA 1YJWT 4HCCA 3OMGA 1W6XA 4JRKA 4J6YA 3CPWA 3THKA 1LPLA 2KYMA 4JJNK 5KYUA 2P4RA 1UDLA 4A4GA 1BCOA 3M5AA 1R8OB 2IVWA 2L2PA 1C6VX 1YI2T 2QGGA 5LJ5d 2DD5A 4RTTA 2XK0A 4XTVA 3FIFA 3OYJA 1K9AA 2EYZA 3IQLA 2HL5C 1RADB 2SEMA 4PLLA 1SPKA 3M9QA 4ZNXA 3EG3A 1M30A 4ORZA 2VKNA 2L3QA 4FYXB 4XU0A 2LCCA 5L23A 1KQSA 4J9IA 4RCBA 2EJGA 1YJWA 2P0KA 4FYVB 5A2QE 2E5QA 2LCLA 5GMKl 4JDSA 1AEYA 4M78E 1SKUB 1PHTA 4B9XA 4FT2A 5FWCA 1Q86R 2DJZA 4M75F 3QJYA 2QASA 1J3TA 1M2OA 1Y7XA 2CP3A 3TCJA 3CC7T 3OYDA 5D7UA 2DXTA 1CSKA 2V1QA 1HK9A 2H3JA 5CQYA 3E2UA 1NE8A 4ESRA 1ZUYA 2EYWA 2LZ6B 3MP6A 3TSZA 1G3TA 3EGDB 2DZ9A 2GBQA 4J9BA 4J9HA 3OYFA 4VUBA 3M0TA 5IT9E 1IO6A 2E41A 3QPHA 1ZSZA 3CCMT 2RQRA 2CS7A 1JXOA 4M77F 2LC4A 2VV5A 2F2XA 4M77A 2BTTA 2LVMA 3M0PA 2QEXT 3GBQA 3A1PA 2K79A 2ZGWA 4XU1A 1UHFA 3OW2S 2JUFA 3A8LB 1MNDA 4FSSA 2RMOA 1YIJT 3ZEHA 2ZPGB 5CAIA 1Z9ZA 4F17A 3PVQA 4NL3A 1WA7A 3KFVA 1JEGA 4RTXA 1M90U 3UA7A 1KD1R 2EYXA 2P0PA 3X25B 1K4US 2DK3A 3C95A 4J9CA 1GBQA 4A54A 5AT1B 1Y07A 5J3BA 1M2VB 3BY7A 1JJ2S 2DXUA 2RK1A 3EGXA 1FMVA 1H92A 2DL7A 3MJXA 4RTUA 4ZGDB 4FIBA 3CPWS 1M1GA 2OTLA 1ZBJA 4XQ3A 4D8KA 3OY9A 3X26B 2RI2A 1QKWA 4OVAA 1K9MC 2ABLA 1KC8C 1YJ9A 5LJ5f 3L2QA 3CCJT 1Q7YU 1AWOA 1AVZC 1D0ZA 3I5SA 1MV0B 1RAAB 5GMKe 2YHTA 4M78G 4C0DC 3P8DA 2GNCA 3OBWA 3CC7A 1B07A 4XK8E 2DL8A 1YI2A 1W1FA 2RJCA 4IIMA 3E19A 1PKSA 5CIUA 2QDLA 3EFOB 4N4IA 3ULRB 2XIDA 3E1SA 3QYGB 4GLKA 2DFUA 3KUFA 2B86A 5CQXA 4A4KA 3CCST 4C0FA 2GTJA 3PIPA 3EGXB 1YFNA 1QKXA 1BKBA 1UGQB 3J81E 4RG2A 1K1ZA 4FW1A 2CYZB 2XI9A 3H41A 3EG1A 1KFZA 2QTVA 2DF6A 3OYAA 1NM7A 1OU9A 1ZLMA 2ROLA 1P92A 1UG1A 2RHUA 4PLIA 2XD0A 3NFCA 2PVDB 3H0HA 1QMCA 4RG8A 2O4XA 4DEYA 1UGRB 2P4TA 2YUPA 1PG5B 4HXJA 3R6NA 3O5ZA 2K6DA 3KBGA 4E7SA 2EWNA 2ESWA 2COWA 2DRMA 3JCMX 5FWBA 1N8RC 2A36A 2DIQA 2QQAA 2BKDN 2CREA 4M7AF 4ZGJB 4E7LA 1X69A 3MEUA 1PC0A 4ZN1A 5KH6A 1WHMA 1YHQT 1ZSZB 1CKAA 1JRIA 2X4YA 4M75B 1PRLC 1KG1A 1OPKA 3HSBA 1UEBA 1KC8R 2LX9A 1FWZA 4C92D 5I11A 1W2BS 2D9TA 2FO0A 3CCLQ 1R0CB 2E5KA 4WF2A 2XICA 2XMFA 3A8GB 3MEWA 2DEUA 1K0XA 4L5GA 1WJQA 5KYXA 4M7DB 1T3LA 4YTLA 2RI3A 2VB6A 3JCMe 1VQ4T 2RM4A 2HKQB 2YLBA 2KMTA 3RERA 1ZQ1A 2JN0A 4PJOD 1E6HA 3J7AF 1WPYA 4R0KA 4E7ZA 2HSEB 1N9RA 1C1AA 4LDUA 4E6RA 1I4K1 2QGFB 2LT1A 2X3WD 2DTIA 3I55Q 3U23A 3I56T 4PFOA 1EX4A 1BI0A 2EGCA 3CBPA 3M59A 3QZ9B 3VS4A 4JJBA 2HQEA 2RB6A 2E6NA 2MPXC 4OGCA 2QXFA 5FU6C 2DZCA 1G3SA 5CK9A 1QVFS 1I5LA 3VYHB 1VQ9A 4JPBW 1TWBA 2V26A 4C0GA 3HTRA 3O8VA 4PJJA 1X75C 4M77E 3T9NA 2XKOC 4OMFB 5EG2A 3CMAT 5IH2A 4X9CA 1FXXA 2B8AA 2VXFA 2BZ8A 3M4GA 3CCRA 2JMCA 4MMKA 1D09B 2YT6A 2DYBA 1TU0B 2HSPA 3JB9G 2EVRA 4C92B 2KRSA 2EYQA 2OTJA 4J7FA 2HKNA 2EYYA 3UPUA 5CO7A 5IHNA 2HQHA 4F7UA 4M7AB 3C12A 4XTZA 3HFNA 2WSCE 4OMPA 1JBMA 1VQOQ 1TTHB 2VYTA 1YITA 3CCET 4C92G 3TREA 2C0TA 2E3HA 5IN1A 5AYFA 2AZSA 3VRYA 4LUEA 3CXCS 2J05A 2RI5A 4LNPA 4EDUA 5GMKi 4J7IA 3MP8A 4F16A 1WYXA 1VQ6T 3EGUA 2K3BA 1H8KA 1U1SA 3EG9B 1Q7YC 1T3SA 4GBQA 5KYWA 4F04B 1Q86U 2YSQA 2LQNA 5GAN5 1WJRA 4OB1B 4M75C 3HPWA 5KYYA 1NEGA 1X6GA 1IGQA 4II1A 4M78C 5GAN7 3V8JA 5I2SA 1FYNA 1NEBA 1TSFA 4LDXA 2NUZA 3BDLA 2DBKA 2RH2A 1M3CA 4A53A 4M75G 2QA4A 3QJ6A 2PUOB 3A8MB 1VQPT 2DXCA 4Z8AA 2K3YA 2E6ZA 3PGGA 1BB9A 3RKWA 3TEEA 4A4HA 5LJ5h 4M7AA 3CD6A 1MHNA 5FROA 4AG1C 4ZTJA 4DOVA 1IB8A 1RABB 1I81A 1YBYA 3AT1B 1VQ5Q 5CKBA 4C92A 1MV3A 3BFMA 3CMEQ 2LJ0A 4PJOF 3G71Q 1GL5A 1FMWA 3S6WA 4N4HA 4IUQA 1VQMA 3L2VA 2OTLT 2DETA 4DQ2A 1QVGP 5GAOm 3GIBA 2E64A 2A37A 1M9SA 3LH0A 4K11A 1N9SA 1YJNQ 3OYHA 3VS6A 1YCSB 2M1HA 1B34B 2EJ9A 2CP0A 3TQ7P 1OYXA 1WZOA 3LGFA 2JS0A 1MMGA 1PRMC 4OMNA 2ROTA 3JB9D 5GAN8 1YIJA 2BZXA 2XDBA 1SF9A 2X51A 3OYGA 3CCJA 2RJDA 3JCMV 2FZKB 4PFPA 1X27A 5LJ3f 2IIMA 4QVDA 3F70A 3G1JA 1K9MR 2PU9B 3DB3A 1YHQA 1XTDA 3JCMQ 1ZA2B 2EGAA 4XTWA 3G4SQ 2FEIA 2A0FB 2KE9A 1LNXA 3JCMP 2QAZA 4M7DF 3H9NA 5FU6B 3EHRA 2VGNA 1UB4A 2VGMA 4E7IA 1M27C 1OZ3A 3CD6T 2JTEA 1VQMQ 1IRXA 4FCYA 3OMCA 5I21A 4A4FA 2P84A 1SHFA 2RJFA 3BE3A 1YITT 1G3WA 3EFSA 4RTVA 3CC4T 4HVVA 3CPFA 3VRZA 3QKJA 5GAOr 2FPEA 3EG2A 4L6V5 2M0YA 2KK4A 1UHCA 3X28B 3JB9H 2DTOA 3M0SA 1UECA 2DIGA 3GNFB 3MCAB 4HA8A 4DA4A 3HHTB 1VQKQ 2YUNA 3E9GA 1NLOC 3VJPA 4PKCC 2NUPA 3CC2A 2NUTA 1Q86C 3TVTA 2DKGA 3UATA 2R58A 1I0CA 4JUVA 1RAIB 3H6ZA 3A98A 1Y57A 3ME9A 2MOXA 4Y28E 1VIFA 2RJEA 3QUIA 2KRMA 4OMQA 5HKCA 3CCEA 3E9FA 4CC7A 5GANj 2HEQA 1IREB 2O9SA 4R55A 1AWXA 1WHLA 1BI1A 1M3AA 4OMOA 4CC4B 1EFNA 4M77C 1KC8U 4Z88A 1X6BA 3VUZA 1OX8A 1XQHA 2LJ3A 3QZ5B 1GCQA 4PJMA 3UT1A 1UE9A 1ZSGA 3L2WA 4AFUC 2RQTA 4LN2A 2RHZA 1KD1C 1VQ7T 1W70A 3PE0A 2RO0A 4M7AE 1RACB 4JS5A 4OB2B 2JM8A 2KEAA 2DPPB 2JXBA 4OMMA 1ABOA 4EMKB 2EQUA 1TOVA 3L42A 5GANd 2XHCA 3CCLA 2COZA 5DM7R 2LTOA 3CC2T 2DMOA 2EKHA 2ZPBB 1OX9A 2DLPA 4OMLA 4QVCA 3OS2A 1VQ9T 3C4SA 1Q82R 2DILA 2F5KA 1UTIA 3NTHA 1SSHA 3Q1JA 3CMET 5C6SA 3M56A 2A28A 1AOJA 3CEYA 2LNVA 3PVLA 4C5GA 1D3BA 1RL2A 4HT8A 1BBZA 2K3XA 2K5IA 2YXYA 5GAMh 1YCYA 3VS5A 2DL3A 2FB7A 4WCIA 2JTMA 1YJ9T 1U06A 1M3BA 1Q81C 2DM1A 5IXFA 5GANe 3OB9A 4E7KA 2EAYA 2FZGB 1PSFA 1YJNT 4XTUA 5KYYB 3RBBB 4LDWA 2VVKA 3M0QA 1SRMA 4PJOB 2I0NA 3JB9I 1N8RU 1QQJA 1NLPC 4J9EA 1OPLA 4NOYA 3GLXA 4QQGA 2OI3A 3CCUT 2RQWA 1OV3A 3QIIA 1F1BB 5HK0A 9ATCB 4QT7A 2F69A 4RKUE 4Q5WA 2CP7A 4V2SA 2VUBA 2BE9B 3CXCP 3I9QA 3ER0A 2HL3A 4MDWA 5FRMA 1V29B 2HD0A 4NS5A 4LD6A 1KQ2A 2ENMA 2AKLA 1QCNA 2JMAA 1PD1A 1KJWA 4FYWB 1MMDA 3I55T 4M77B 2HBPA 3RUXA 4AFZC 5CKHA 2XDPA 2L8DA 1S72T 2AKKA 5LJ3e 2KT1A 1X43A 2Y4XA 2VASA 2R57A 1S72A 1YI2Q 2J6OA 1GCPA 2MI6A 2K7AA 4QVZA 3SWNC 3OS0A 1BU1A 2Y90A 4HCZA 1RAGB 1JB0E 4JLGA 4PJOE 3OS5A 2EW3A 3OYKA 1VQ7A 3H0FA 1WHHA 1QLYA 1N6AA 4A63B 5A0GA 1WQWA 2LRQA 4PJOC 1OU8A 4LDVA 1X6OA 4LDYA 1QVPA 1OOTA 5IXBA 4C92F 1VYVA 3M0RA 8AT1B 4J9DA 4ATOA 4BDZA 2D0QB 3CPWP 4F7UG 1SRLA 5HK3A 1NBEB 3RMSA 7AT1B 3CCVA 3L2ZA 1K73C 1RLQC 2NLUA 3OYCA 2EFIA 2DE0X 1WHKA 3QWYA 1WXTA 2AIRB 3SWNB 4KUDK 2CZ1B 2C0IA 2O31A 3I35A 4JRQA 4C8QD 5GJVB 3CCEQ 1Y0MA 3OYLA 2FPDA 2GFAA 3HRTA 2RQUA 1MGQA 1K0SA 5GMKm 4M78F 1EIFA 1TUGB 2GF7A 1M1KU 2F1LA 2MYSA 1G2BA 2QK0A 3MEVA 2MK5A 5CKDA 2DYIA 4LE9A 4EMHA 4M78B 5M9OA 5KYUB 2K2MA 2QEXQ 1TUCA 4DEXA 2IG0A 4ELYC 4BB7A 3FC3A 4M7DA 5KYXB 3QSUA 4EMGA 2KDSA 2ED0A 1AD5A 1G8XA 2ZPFB 1ARKA 1D1BA 2DVJA 4HVUA 3CCUA 1RUWA 4NL2A 3JSCA 1SHGA 4ZN3A 1QVGA 4EPCA 4J6WA 1SSFA 1AZEA 3G6EQ 1VQLT 3OYIA 3AHUA 2OAUA 5J39A 3MKDA 2ZPIB 2L5QA 5GANg 1Z9QA 2KGTA 1CKBA 5IHIA 3L2RA 4M75A 2DD4A 4FL6A 3M54A 1V76A 1YJ9Q 2JVVA 2DTHA 2QQ9A 3VYGA 1X2QA 1RAEB 3G4SA 4JJCA 5DY9A 1HD3A 4Y91A 1KQSP 4P5NA 1YJWQ 2A7YA 3HRSA 2EQIA 2J06A 3JCMd 3LW5E 5FU7B 3ZL7C 3CMAA 2DJQA 1TUDA 2HCKA 2O4XB 1VYTA 3CCJQ 4KGXB 3I56Q 2QDYB 2F2WA 3C0CA 4N0AA 4C8QB 3CCUQ 1GRIA 3OW2A 4A4EA 2X9HA 1LVKA 1K9MU 5EC7A 4IIOA 2CT4A 2WACA 2L0AA 2EQJA 2RA2A 1LOJA 1XOVA 1Y71A 4BACA 1BYMA 4M7AD 2QG9B 5GAOp 5GMKj 2G3RA 3PFSA 2GGRA 3CQTA 4KH0B 4AFSC 3BDUA 1GFCA 5CKFA 1HXDA 1WHGA 3DKMA 3URGA 2ECZA 4X1VA 2CSIA 1B3QA 2CKKA 4M7DG 1QWFA 5LJ3h 3JCMb 3MPUB 2PQWA 4KH1B 2PNIA 2LMJA 5KE3A 3ASKA 4PL6A 4E47A 1BI2A 4X9DA 4M78A 3VV0A 1VQ4A 2OJ2A 2KT8A 2P0QA 5GAMg 1IXDA 2Y4YA 4TVRA 1WDXA 2MF2A 1Q95G 1VA7A 1BIBA 3V8LA 2DVEA 2DXBA 2E4HA 4KBMB 2V8IA 3M58A 2DX1A 3G7ZA 4EMKA 1VQNQ 4HCKA 2KROA 1WNLA 1N27A 1YP5A 2X4JA 3JV3A 2CP2A 2AHJB 1AWJA 2BZYA 3CC4Q 1VQ7Q 3V7RA 2I2LA 1TG0A 2ATCB 1EZZB 3JCMc 4BE2A 2CZ0B 2EBPA 1AZGB 1VQPA 1D0XA 3VS0A 2RHIA 3QDRB 3DLMA 4BDYA 2LQWA 4DBQA 5GAOn 1WGSA 1BK2A 2HZYA 1M4ZA 1WIEA 3RIRA 3JB9J 4C8QC 1NJIR 3VS7A 2QQBA 5L8RE 3I56A 1KHIA 1PCXA 4C5IA 3JCMJ 3X24B 3QBYA 1E7OA 2K4YA 1ABQA 2KY9A 1W2BP 4EMKC 4PFZA 4BUGA 1WJSA 1VQLA 4IURA 3LX7A 1VQOA 3OQ5A 2FYKA 4N0AC 2R5MA 1NPPA 1KSWA 2HMAA 2C06A 1NZ9A 3FEOA 3DLLA 3EH1A 2KRNA 4Y92A 4F7UE 3G71A 5GAN2 1ZA1B 1U5SA 4BI8B 5GAMd 3G71T 2M02A 4JLIA 5I2MA 3EGDA 2DNUA 2HBWA 3A8OB 1BI3A 2DO3A 4C8QG 5LJ5g 2O88A 1JJ2A 2NYSA 1NYFA 2LNHB 2JW4A 4KGVB 4KRTA 2YLCA 2F5TX 2L3SA 2QEXA 2F2VA 1RLPC 1M90C 4PJNA 4RTZA 4M75E 3L2UA 4BD3A 4LXCA 1K8AR 1N8RR 1K73R 2WSFE 2JJ9A 1VQ9Q 2GQIA 3ZBDA 2X4XA 2AT1B 4PJOA 4C5HA 2GTOA 3OYNA 2FL7A 2DAQA 4J5YA 3WXMB 2D8HA 1ZSZC 2K57A 1K76A 2FRYA 2RHYA 3CCSQ 2AZVA 3CXCA 1BCMA 3UWNA 1C0MA 2O2OA 4O6JA 4M4ZA 2DL5A 3QWXX 3QXEB 2DERA 3N5BB 3SHWA 2KVQG 2DL4A 1QVFA 5LJ5e 3CCVQ 3LYIA 5DLQE 1B34A 1QP3A 3KXTA 1PKTA 3HL8A 2E1HA 4HT9A 1QCFA 3CBMA 1R77A 2L3RA 1T0HA 3CCQA 1KIKA 4XTYA 4B6MA 3PNWC 3EAEA 3NTIA 2V8JA 3JAME 1I1JA 1MMAA 4XU2A 3NMZC 3CCRT 1KHCA 4J9GA 4ZTFA 2ZCFB 1GCQC 2YWWA 1IHVA 1KK7A 4FM4B 1SG5A 1Q81U 3OSVA 1XNIA 2H8HA 3QYHB 3CCVT 2J6KA 2JS2A 3LGLA 2RF0A 1Q82U 2ZPHB 3TU4K 3MEAA 1QP2A 3HFOA 3CC4A 1HJDA 2OTJQ 3DB4A 4Z02A 3VS3A 1BIAA 3S3OA 1S72Q 3H0IA 4KULA 3META 1H641 1VQNA 2FZCB 3GF5A 4PNOA 4GY5A 4PK4A 2OAWA 3M55A 4QQ6A 1VQKA 3CCRQ 1M8VA 2KR3A 2O01E 1Y96B 5GMKh 1TS9A 4E2FB 3HP9A 5FLXE 4UC4A 1I07A 4F7UF 1KD1U 4E7HA 3RKYA 5KYNA 3P8BB 1VQ4Q 3LLRA 3M0UA 5LJ3j 4IUVA 1IGUA 4CRIA 1Q7YR 4BE0A 1NJIC 3SB2A 2FHDA 2W10A 4MZMA 5CKEA 4J8OA 5D6YA 3GOXA 3UDCA 3EHQA 4DBRA 2L89A 2CH4W 1AWWA 3RKXA 2A08A 2K9GA 5LL6S 5CR2A 1V1CA 3CCMQ 1Q82C 3VS2A 4XU3A 4CC2A 2V1RA 2FRWA 3PMTA 3FJPA 2QQSA 1VOMA 1DJ7B 1YHQQ 3HRUA 4EIKA 2VC8A 6AT1B 4RUGA 2QYZA 1GXIE 2FG0A 5GANf 1VQ8T 4DOWA 1K73U 4JJDA 4AFQC 4MDXA 4D8DA 1NG2A 1WHJA 1ZUKA 3OYYA 3TSWA 5ECAA 1WFWA 1VUBA 1WXBA 4WTOB 1YIJQ 1QWEA 1JO8A 3MHXA 1PD0A 5FU7C 3LWHA 4QQDA 2MIOA 3CC7Q 2YUQA 3PMIA 3CMAQ 2COYA 3VS1A 1M2VA 1M1KC 1I8FA 3M53A 4HCBA 2D8JA 1ZUUA 1OEBA 4FT4A 2A3LA 4RCCA 2BE7D 2KXCA 4IUPA 1K8AC 3NPFA 2BUDA 1X01A 2ED1A 3NGPA 4HVWA 2DEQA 2JTFA 4MZPA 1FMKA 3QO3A 4QW2A 1N5ZA 4AG2C 1VYUA 4OF1A 2LDMA 2W0ZA 4M77D 2VWFA 3QG1A 2CZ7B 2RHXA 1KQSS 1G3YA 5I22A 4FYYB 1ACMB 1M5Q1 1UFFA 1K8AU 4C0DB 4JS4A 1R0BG 2CZ6B 2V8KA 3P8HA 2WSEE 1W4SA 2YUOA 1NYGA 2QQRA 1MMNA 3L1AA 4E7JA 5GAMf 5GJWB 4J9FA 1WXUA 1VQ8A 1VQKT 2HQXA 3VKIA 4OB0B 1VQNT 5IHKA 2FPFA 4MMLA 1OZ2A 3I5RA 3X20B 2CP5A 3INZA 4M78D 4O5VA 3WVEB 2M16A 2XU8A 3QDFA 3WVDB 5GAN6 4N4GA 4C5EA 2AK5A 2DBMA 5LJ3d 5A0LA 2E10A 2XG8D 4ME7A 3SD4A 5J26A 5LJ3g 1MNEA 3JCMg 3RMQA 5GAMj 2K5LA 2JM9A 3OYEA 3V7CA 4Z89A 1NJIU 1Y96A 1YITQ 2IPOB 3QHSA 1PM3A 4BY6B 4X34A 5D6XA 2OX7A 1D1CA 4JZ4A 2EKOA 1I5OB 3CBOA 3RDVA 4AMCA 2CUBA 2EQMA 4JZ3A 2JOYA 4AT1B 1JQQA 4OB3B 5GAN3 3OW2P 3H8ZA 3G6EA 4LD9K 1H3ZA 4OP0A 2K5FA 2XDDA 5CCAA 3BW1A 1LCKA 1ZX6A 2CH4A 2X4WA 4FSXA 4CC3A 2LX7A 2M0OA 3GPLA 1W2BA 4C0ZA 3M57A 1G5VA 2PZ1A 3CCLT 3EG0A 2KQWA 2YRCA 4M77G 4PJLA 2MMPA 5A0DA 2EQKA 2X3XD 3OA6A 3JCMW 2O9VA 1IHWA 1KQ1A 3JB9F 3CCQT 1RI0A 3VUBA 1S1NA 2CUDA 3RNJA 5KCOA 3M4YA 4R56A 1VQ8Q 5IAYA 4BE1A 5C0MA 3C94A 3D7SB 5CVIA 5DLOA 3V7SA 3UA6A 3A5ZB 2KAFA 1O9SA 2LQ8A 5GAOl 4M7DE 1VQ5T 2MWPA 4ELZC 4OGEA 1X2KA 3I55A 3JCMh 1HSQA 2PVGB 2KI7A 4M7AC 5HY6A 3REAB 2JT4A 3GP8A 2HDAA 1M90R 1PWTA 3CD6Q 1VQMT 2GFUA 4C8QF 3REBB 4KUIA 3NHNA 3FB9A 2NUTB 3EG9A 2KBTA 2R5AA 1GBRA 4B9WA 3JCMf 2ZPEB 2CGHA 2JZ2A 2KNBB 5GAN4 4ANJA 4J83A 1M1KR 2QA4Q 2KSSA 1OI1A 3SWNA 4XTXA 4GLMA 3GNGA 2GCXA 2DRKA 5LJ5j 2RPNA 1U3OA 1IZ6A 1RI9A 2LJ1A 3PIOA 4RTWA 2LT4A 2YRVA 1TXQA 2K2VA 1UUEA 3S3MA 2RQVA 1GFDA 2PVOB 2QA4T 2ZZDA 1PNJA 1PSEA 1SEMA 2JNGA 1AT1B 1M1FA 4BI3A 1VIEA 2MCNA 1LJOA 4QKUA 2CDTA 4IKFA 1Q81R 3LH5A 2EJFA 3MP1A 4PJOG 4L59A 3CCMA 4DBFA 4BI4A 4RMOA 1WQ7A 4J6XA 3JRZA 2G6FX 2RN8A 2E70A 1JU5C 3OS1A 3FJ5A 3CCSA 5FRNA 1OQKA 3UF4A 1UGSB 1RAFB 1ZHIA 1VQ6Q 2MWOA 3RESA 4DBHA 3OSSC 2LCSA 2KYBA 2BIVA 1H3HA 2HNIA 3EH2A 1D1AA 2DA9A 3CC2Q 2L3PA 1A0NB 3V8KA 2J6FA 1G83A 1QW1A 1YWOA 3SDZA 4M7AG 2M51A 1WX6A 2J7IA 1MUZA 2D0NA 5FW9A 2PTKA 3R6OA 1UJYA 1YNZA 3LWIA 1AHJB 1TH7A 1WI7A 1YWPA 4LUDA 4M75D 2VXEA 3A8HB 2X35A 2OTJT 5GAOq 3PTAA 2D1XA 2LP5A 2LQKA 2ZAEA 2YRDA 2E12A 4XAXB 3J80E 3S3NA 4C8QE 2FVUA 1WLPB 4HKEA 4ZGEB 3ZFJA 3VU3C 1QCOA 1NPRA 3EFOA 3RR6A 2RK2A 2PUKB 3OYMA 8ATCB 4JRIA 5KE2A 3G6ET 1VQLQ 4IUTA 1D3BB 2D6FA 4M7DD 5HCKA 2OTLQ 3CCQQ 4IUUA 3NTKA 1RAHB 4KT0E 3SFMA 1D0YA 1E6GA 2CP6A 2KXDA 2QI2A 4D6WA 2EPDA 4CI0C 1UJ0A 1UGVA 2HAXA 4JRPA 5KYWB 1HYOA
chains in the Genus database with same CATH topology
5A0GA 3FRNA 4X9CA 1FXXA 1WQWA 2B8AA 2L89A 2RD1A 2VXFA 3M4GA 2LRQA 4C92C 3CCRA 4LDVA 4PJOC 1X6OA 4LDYA 2QTXA 3RKXA 1QVPA 5GANh 4MMKA 4C8QA 5LL6S 5CR2A 4C92F 5D6WA 1Q82C 4ATOA 4M7DC 3MO8A 4XU3A 4BDZA 2D0QB 3JB9G 4C92B 4F7UG 2EYQA 1YJNA 3EFRA 2OTJA 1O75A 5HK3A 3PMTA 3FJPA 4J7FA 2QQSA 3OYBA 1DJ7B 1UGPB 3RMSA 3CCVA 3HRUA 3L2ZA 1K73C 2VC8A 3UPUA 1GXIE 5GANf 1U1TA 1VQ8T 2NLUA 5CO7A 2EFIA 4DOWA 3OYCA 1K73U 4MZTA 4F7UA 4M7AB 4MDXA 3SWNB 3C12A 4KUDK 4XTZA 2CZ1B 3HFNA 2WSCE 3OYYA 5KCHA 3PT9A 4C8QD 3G4ST 4JRQA 1JBMA 1VUBA 5GAMe 3OYLA 2E65A 2VYTA 3CMEA 4FU6A 2GFAA 3HRTA 1YITA 3MHXA 1VQOT 3CCET 5FU7C 3LWHA 1MGQA 4QQDA 4C92G 4F7UB 1VQ5A 5GMKm 3FLGA 3PMIA 4M78F 3OBYA 3TREA 3FDRA 1EIFA 2GF7A 1M1KU 5IN1A 4C92E 5AYFA 1M1KC 1I8FA 3M53A 4HCBA 3MEVA 1FX7A 3CXCS 2MAMA 4BY6C 5CKDA 2RI5A 4FT4A 4EMHA 2A3LA 1U8RA 4RCCA 4M78B 2EIFA 4EDUA 5M9OA 5GMKi 4IUPA 1VQ6A 1QVGS 1K8AC 1ZBXA 4J7IA 2BUDA 1X01A 3HKSA 2IG0A 3MP8A 2M9UA 2GQVA 4BB7A 4ELYC 3FC3A 1YJWT 4HCCA 1VQ6T 4M7DA 3OMGA 3QSUA 4JRKA 1U1SA 4J6YA 4EMGA 3CPWA 2KDSA 1Q7YC 2ZPFB 4JJNK 2DEQA 1Q86U 2JTFA 5GAN5 4MZPA 3CCUA 1WJRA 3QO3A 4OB1B 4QW2A 4NL2A 4M75C 3HPWA 4OF1A 2LDMA 4M77D 5GAN7 4II1A 4M78C 3V8JA 3QG1A 3JSCA 4A4GA 5I2SA 2CZ7B 4ZN3A 1QVGA 4EPCA 3M5AA 4J6WA 4LDXA 1R8OB 1SSFA 2IVWA 1YI2T 1VQLT 3OYIA 3BDLA 2RHXA 3AHUA 2OAUA 2RH2A 1KQSS 1G3YA 5LJ5d 2DD5A 1M5Q1 4A53A 5J39A 2ZPIB 2L5QA 4M75G 2XK0A 5GANg 4XTVA 3L2RA 3QJ6A 2QA4A 2PUOB 3FIFA 3OYJA 4M75A 2DD4A 3A8MB 4C0DB 1VQPT 4PLLA 2DXCA 4FL6A 2K3YA 3M54A 2E6ZA 3PGGA 3M9QA 2JVVA 3RKWA 4JS4A 4BE1A 2DTHA 3TEEA 2QQ9A 2CZ6B 2V8KA 3P8HA 3VYGA 4A4HA 5LJ5h 2WSEE 1W4SA 3G4SA 5DY9A 2QQRA 4XU0A 4Y91A 4M7AA 3L1AA 4E7JA 4P5NA 3CD6A 2LCCA 1MHNA 1KQSA 5GAMf 5FROA 2A7YA 3HRSA 4ZTJA 4RCBA 4DOVA 3JCMd 1I81A 3LW5E 2EJGA 1VQ8A 1YJWA 2P0KA 1YBYA 5FU7B 3CMAA 1VQKT 5CKBA 5A2QE 2HQXA 2E5QA 2LCLA 2O4XB 4JDSA 4C92A 5GMKl 4M78E 3BFMA 4B9XA 3VKIA 4PJOF 2QDYB 4FT2A 4OB0B 1VQNT 2DJZA 4M75F 3QJYA 3S6WA 4N0AA 4C8QB 1Y7XA 4N4HA 4IUQA 4A4EA 3OW2A 3TCJA 1VQMA 4MMLA 1OZ2A 1K9MU 3CC7T 3X20B 3INZA 4M78D 3L2VA 4O5VA 3OYDA 2OTLT 2DXTA 4DQ2A 3WVEB 5GAOm 3GIBA 2M16A 2XU8A 2WACA 3WVDB 5GAN6 1HK9A 2E64A 2EQJA 2H3JA 2RA2A 4N4GA 3UDCA 1LOJA 1M9SA 5CQYA 3LH0A 4C5EA 1NE8A 1XOVA 1Y71A 3MP6A 4BACA 1BYMA 5A0LA 5LJ3d 1G3TA 2E10A 4M7AD 2XG8D 1N9SA 4ME7A 5J26A 2DZ9A 2G3RA 3PFSA 3SD4A 5GMKj 2M1HA 5GAOp 3OYHA 5LJ3g 3BDUA 1B34B 2EJ9A 5CKFA 1HXDA 3DKMA 3JCMg 3URGA 3RMQA 5GAMj 3OYFA 1OYXA 2K5LA 3LGFA 4VUBA 3OYEA 3V7CA 5IT9E 2CKKA 1NJIU 4M7DG 1Y96A 2E41A 5LJ3h 3QPHA 3JCMb 3QHSA 3CCMT 4BY6B 5GAN8 2PQWA 3JB9D 4X34A 1YIJA 5D6XA 2CS7A 4M77F 2LC4A 2EKOA 5KE3A 2XDBA 3ASKA 4PL6A 3OYGA 3CCJA 3CBOA 2VV5A 2RJDA 4E47A 1BI2A 4M77A 3JCMV 2LVMA 4X9DA 4M78A 3VV0A 2EQMA 2QEXT 1VQ4A 2JOYA 5LJ3f 5GAN3 2P0QA 4OB3B 4QVDA 5GAMg 3H8ZA 3F70A 2Y4YA 2ZGWA 4XU1A 3G6EA 2PU9B 3DB3A 4LD9K 4TVRA 1YHQA 1XTDA 3JCMQ 1H3ZA 4OP0A 3OW2S 2K5FA 2MF2A 2JUFA 2XDDA 5CCAA 4XTWA 3A8LB 3BW1A 1BIBA 3V8LA 1YIJT 2DVEA 2X4WA 4FSXA 2DXBA 1LNXA 2ZPGB 3ZEHA 4KBMB 2M0OA 2V8IA 3M58A 5CAIA 3JCMP 4NL3A 4M7DF 3GPLA 5FU6B 3G7ZA 4C0ZA 1W2BA 2VGNA 1UB4A 1M90U 2VGMA 3M57A 4EMKA 1G5VA 4E7IA 1OZ3A 3CCLT 1WNLA 2KQWA 1N27A 2P0PA 2X4JA 4M77G 3X25B 3CD6T 2MMPA 2DK3A 5A0DA 3C95A 2EQKA 2AHJB 3OMCA 3OA6A 5I21A 3JCMW 4A4FA 3V7RA 2I2LA 2RJFA 1YITT 4A54A 1G3WA 3EFSA 1KQ1A 1Y07A 5J3BA 3JB9F 3BY7A 3CCQT 1RI0A 3JCMc 3VUBA 3CC4T 1JJ2S 2DXUA 4BE2A 5KCOA 2RK1A 3M4YA 3CPFA 2CZ0B 4R56A 3QKJA 1VQPA 5GAOr 4L6V5 5IAYA 2KK4A 2RHIA 3QDRB 4FIBA 3C94A 3X28B 5CVIA 4ZGDB 5C0MA 3CPWS 1M1GA 3DLMA 5DLOA 2DTOA 3V7SA 4BDYA 2OTLA 4XQ3A 2DIGA 3GNFB 3A5ZB 2KAFA 3OY9A 5GAOn 1WGSA 3MCAB 1O9SA 2RI2A 2LQ8A 4HA8A 3X26B 1M4ZA 4DA4A 4OVAA 1K9MC 3HHTB 5GAOl 1KC8C 3RIRA 1VQ5T 3JB9J 1YJ9A 2MWPA 4ELZC 4M7DE 3E9GA 4C8QC 5LJ5f 4OGEA 3L2QA 2QQBA 5L8RE 3VJPA 3I56A 3CCJT 1KHIA 3I55A 4PKCC 1Q7YU 3JCMh 4C5IA 3CC2A 2PVGB 3JCMJ 1Q86C 3X24B 2DKGA 3QBYA 4M7AC 5GMKe 2YHTA 4M78G 5HY6A 2R58A 2K4YA 4C0DC 2KY9A 3GP8A 3P8DA 4JUVA 3OBWA 3H6ZA 3CC7A 2GFUA 1VQMT 3ME9A 4C8QF 4EMKC 4XK8E 4KUIA 4Y28E 4BUGA 3FB9A 1WJSA 1YI2A 4IURA 1VQLA 1VIFA 3LX7A 2RJEA 3QUIA 2R5AA 2RJCA 5HKCA 3CCEA 1VQOA 3E9FA 3OQ5A 2FYKA 4B9WA 5GANj 4N0AC 1IREB 3JCMf 3E19A 2R5MA 1NPPA 2ZPEB 2CGHA 4R55A 2C06A 2JZ2A 5CIUA 1NZ9A 5GAN4 1BI1A 4J83A 4M77C 3FEOA 3DLLA 2KSSA 1KC8U 1OI1A 3VUZA 3SWNA 4XTXA 4N4IA 1XQHA 4F7UE 3QZ5B 2XIDA 3E1SA 3QYGB 3GNGA 4GLKA 3KUFA 3G71A 3UT1A 2GCXA 5GAN2 3L2WA 5CQXA 4A4KA 4BI8B 5GAMd 3CCST 4C0FA 5LJ5j 3PIPA 3G71T 4JLIA 5I2MA 2RHZA 1KD1C 1BKBA 1VQ7T 1UGQB 3A8OB 1IZ6A 3J81E 2RO0A 1BI3A 2DO3A 4RG2A 4C8QG 5LJ5g 4M7AE 3PIOA 1JJ2A 4JS5A 2CYZB 2XI9A 4OB2B 2LT4A 2YRVA 2DPPB 2K2VA 3OYAA 4EMKB 2YLCA 3S3MA 2F5TX 1K8AU 2QEXA 1P92A 2EQUA 1M90C 2RHUA 3L42A 4PLIA 2XD0A 5GANd 2PVOB 2XHCA 4M75E 3L2UA 2QA4T 3CCLA 2ZZDA 3NFCA 4BD3A 5DM7R 2LTOA 3CC2T 2PVDB 1PSEA 2WSFE 4RG8A 2O4XA 1UGRB 2JNGA 3ZBDA 2X4XA 2ZPBB 2P4TA 4PJOA 4C5HA 1M1FA 4BI3A 4QVCA 1VIEA 3OS2A 1VQ9T 3C4SA 3KBGA 1LJOA 3OYNA 2F5KA 2FL7A 2DAQA 4J5YA 2EWNA 3NTHA 3Q1JA 3CMET 3WXMB 5C6SA 4IKFA 1N8RC 3JCMX 2DIQA 3M56A 2EJFA 3MP1A 2K57A 2QQAA 4PJOG 4L59A 2BKDN 2LNVA 2RHYA 3CEYA 1D3BA 1RL2A 4BI4A 4C5GA 3CCMA 4HT8A 2K3XA 4RMOA 1WQ7A 3CXCA 2K5IA 3UWNA 4M7AF 4J6XA 3JRZA 5GAMh 4O6JA 4ZGJB 4E7LA 1YCYA 3MEUA 2E70A 3QXEB 3OS1A 4ZN1A 5KH6A 3CCSA 2FB7A 5FRNA 1YHQT 1JRIA 2X4YA 1UGSB 2JTMA 4M75B 3N5BB 1YJ9T 1KG1A 1Q81C 2KVQG 1ZHIA 5GANe 1QVFA 3OB9A 2MWOA 5LJ5e 4E7KA 3RESA 2EAYA 3LYIA 5DLQE 3HSBA 1UEBA 1B34A 1PSFA 1YJNT 1QP3A 3KXTA 2LX9A 3OSSC 1FWZA 3JB9H 3HL8A 2E1HA 2BIVA 4XTUA 4C92D 4HT9A 2HNIA 3CBMA 4LDWA 1W2BS 2D9TA 2L3RA 3V8KA 4PJOB 1QW1A 3CCQA 3JB9I 1N8RU 4WF2A 4XTYA 2XICA 3A8GB 3PNWC 3EAEA 3GLXA 3MEWA 2V8JA 3NTIA 4NOYA 4L5GA 1WJQA 4QQGA 3SDZA 3JAME 3CCUT 4M7AG 4M7DB 4XU2A 2RI3A 4YTLA 3QIIA 3CCRT 1KHCA 3R6OA 4ZTFA 3JCMe 1VQ4T 2ZCFB 5HK0A 2RM4A 3LWIA 1AHJB 4FM4B 1TH7A 2F69A 2KMTA 2YLBA 3RERA 4RKUE 4Q5WA 1ZQ1A 1Q81U 2JN0A 1XNIA 3OSVA 4PJOD 3J7AF 1WPYA 3QYHB 3CCVT 4M75D 4V2SA 2VUBA 2VXEA 3A8HB 3LGLA 1Q82U 2ZPHB 2X35A 2OTJT 3ER0A 4MDWA 5GAOq 3PTAA 5FRMA 1V29B 2HD0A 4NS5A 4LD6A 1N9RA 2LQKA 3TU4K 3MEAA 1KQ2A 1QP2A 3HFOA 3CC4A 2E12A 4LDUA 3DB4A 4Z02A 4XAXB 3J80E 3I55T 3S3NA 1BIAA 1I4K1 4C8QE 4M77B 3S3OA 2FVUA 2HBPA 4KULA 4HKEA 3RUXA 3META 2LT1A 1H641 1VQNA 5CKHA 4ZGEB 2DTIA 2L8DA 2XDPA 3GF5A 3VU3C 3ZFJA 1S72T 1NPRA 4PNOA 4GY5A 5LJ3e 3M55A 2RK2A 2Y4XA 2PUKB 4QQ6A 2R57A 3I56T 1VQKA 1S72A 1M8VA 2O01E 5KE2A 4JRIA 3OYMA 3G6ET 1Y96B 4IUTA 5GMKh 1D3BB 2D6FA 4M7DD 1BI0A 2MI6A 3HP9A 3CBPA 4QVZA 3SWNC 5FLXE 3M59A 4UC4A 3OS0A 3QZ9B 2Y90A 2HQEA 4F7UF 1KD1U 2RB6A 4HCZA 2E6NA 4E7HA 3RKYA 4IUUA 4OGCA 3NTKA 2QXFA 5FU6C 2DZCA 1G3SA 3P8BB 5CK9A 4KT0E 1I5LA 1QVFS 1JB0E 3SFMA 4JLGA 2QI2A 3VYHB 4D6WA 3LLRA 1VQ9A 5LJ3j 4IUVA 4PJOE 3OS5A 4CI0C 2HAXA 4CRIA 4C0GA 3O8VA 4BE0A 1X75C 4M77E 3SB2A 3T9NA 3OYKA 1NJIC 2FHDA 4JRPA 2XKOC 4OMFB 1VQ7A 5CKEA 4MZMA 5D6YA 4J8OA 5EG2A 3GOXA 1N6AA 3CMAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8H A;  5C6S A;  4IKF A;  1RI0 A;  2B8A A;  2L89 A;  2DIQ A;  2QQR A;  2LRQ A;  4BE2 A;  3MP1 A;  5KCO A;  4E7J A;  4L59 A;  2BKD N;  2LCC A;  1MHN A;  2RHY A;  3CEY A;  3QKJ A;  4C5G A;  5FRO A;  2K3X A;  4ZTJ A;  3UWN A;  5IAY A;  2RHI A;  5D6W A;  4E7L A;  4BE1 A;  5C0M A;  3MEU A;  3OS1 A;  2P0K A;  3DLM A;  5KH6 A;  4BDY A;  5FRN A;  3MO8 A;  4BDZ A;  2X4Y A;  2DIG A;  2E5Q A;  2HQX A;  2O4X B;  3OY9 A;  1WGS A;  4B9X A;  2RI2 A;  3OYB A;  3PMT A;  2QQS A;  3OB9 A;  4OVA A;  2MWO A;  3S6W A;  4E7K A;  2MWP A;  3LYI A;  3E9G A;  4N4H A;  4IUQ A;  4A4E A;  3L2Q A;  1OZ2 A;  2NLU A;  3OYC A;  2EFI A;  3L2V A;  4C5I A;  3OYD A;  2BIV A;  3QBY A;  2M16 A;  2R58 A;  2D9T A;  2L3R A;  2WAC A;  5KCH A;  2EQJ A;  4N4G A;  3P8D A;  4C5E A;  3LH0 A;  3OYL A;  3H6Z A;  3MP6 A;  2GFU A;  4BAC A;  2VYT A;  3PNW C;  3EAE A;  3ME9 A;  3MEW A;  3NTI A;  4FU6 A;  2GFA A;  4QQG A;  1WJQ A;  3SD4 A;  5J26 A;  2G3R A;  3PFS A;  1WJS A;  3OYH A;  4IUR A;  2M1H A;  2RI3 A;  3LX7 A;  4QQD A;  2RJE A;  3QII A;  3FLG A;  2R5A A;  1KHC A;  3PMI A;  3FDR A;  2GF7 A;  2RJC A;  4ZTF A;  3E9F A;  5IN1 A;  3OQ5 A;  4B9W A;  2R5M A;  1OYX A;  3LGF A;  3OYF A;  2JZ2 A;  5CIU A;  4Q5W A;  3OYE A;  1XNI A;  3MEV A;  2CKK A;  3FEO A;  1OI1 A;  3LGL A;  2RI5 A;  2X35 A;  4N4I A;  2PQW A;  5FRM A;  4EDU A;  4X34 A;  4NS5 A;  4LD6 A;  5D6X A;  5M9O A;  3MEA A;  3KUF A;  4IUP A;  3UT1 A;  3L2W A;  2BUD A;  2EKO A;  2IG0 A;  3MP8 A;  5KE3 A;  3ASK A;  4PL6 A;  3DB4 A;  4Z02 A;  3OYG A;  3FC3 A;  3S3N A;  2RHZ A;  2RJD A;  3S3O A;  3OMG A;  2LVM A;  2EQM A;  3Q1J A;  3MET A;  2RO0 A;  2XDP A;  2L8D A;  4RG2 A;  3H8Z A;  3F70 A;  2JTF A;  4GY5 A;  3DB3 A;  1WJR A;  4QQ6 A;  2R57 A;  4QW2 A;  1H3Z A;  2YRV A;  3OYM A;  5KE2 A;  3OYA A;  2LDM A;  4IUT A;  4II1 A;  3S3M A;  4A4G A;  4QVZ A;  2EQU A;  3OS0 A;  4UC4 A;  2X4W A;  1SSF A;  2RHU A;  3L42 A;  3ZEH A;  2HQE A;  4PLI A;  2M0O A;  3BDL A;  2RHX A;  2E6N A;  4HCZ A;  3OYI A;  3L2U A;  4IUU A;  4E7H A;  4BD3 A;  3NTK A;  2LTO A;  5J39 A;  2XK0 A;  3L2R A;  1G5V A;  3QJ6 A;  4E7I A;  2O4X A;  1OZ3 A;  3OYJ A;  3LLR A;  1N27 A;  2X4X A;  4IUV A;  4C5H A;  4PLL A;  4CRI A;  2EQK A;  3O8V A;  4FL6 A;  2K3Y A;  3OS2 A;  4BE0 A;  3OYK A;  3C4S A;  3OMC A;  3OA6 A;  3M9Q A;  2FHD A;  4A4F A;  2F5K A;  3OYN A;  2DAQ A;  2RJF A;  5D6Y A;  3GOX A;  3NTH A;  4A4H A; 
#chains in the Genus database with same CATH topology
 3FRN A;  1T0J A;  2RD1 A;  4C92 C;  2SRC A;  2QTX A;  5GAN h;  4KGZ B;  4C8Q A;  5D6W A;  2RNA A;  2H3E B;  1VQP Q;  2CSQ A;  4M7D C;  3MO8 A;  1YJN A;  3EFR A;  1O75 A;  3OYB A;  1UGP B;  1QVF P;  1JJ2 P;  1U1T A;  2E3I A;  1M8M A;  4MZT A;  4F14 A;  5KCH A;  3PT9 A;  3G4S T;  1OUL A;  2NWM A;  4RTY A;  5GAM e;  2E65 A;  3CME A;  4FU6 A;  1JXM A;  1VQO T;  4F7U B;  1VQ5 A;  3FLG A;  3OBY A;  3FDR A;  4FW2 A;  4C92 E;  1YN8 A;  2YDL A;  3SEM A;  1B7T A;  1FX7 A;  2Z0W A;  2EGE A;  2MAM A;  2C0O A;  4BY6 C;  1U8R A;  2EIF A;  2CT3 A;  1VQ6 A;  2NUP B;  1QVG S;  1ZBX A;  1XJW B;  3HKS A;  2M9U A;  2GQV A;  1YJW T;  4HCC A;  3OMG A;  1W6X A;  4JRK A;  4J6Y A;  3CPW A;  3THK A;  1LPL A;  2KYM A;  4JJN K;  5KYU A;  2P4R A;  1UDL A;  4A4G A;  1BCO A;  3M5A A;  1R8O B;  2IVW A;  2L2P A;  1C6V X;  1YI2 T;  2QGG A;  5LJ5 d;  2DD5 A;  4RTT A;  2XK0 A;  4XTV A;  3FIF A;  3OYJ A;  1K9A A;  2EYZ A;  3IQL A;  2HL5 C;  1RAD B;  2SEM A;  4PLL A;  1SPK A;  3M9Q A;  4ZNX A;  3EG3 A;  1M30 A;  4ORZ A;  2VKN A;  2L3Q A;  4FYX B;  4XU0 A;  2LCC A;  5L23 A;  1KQS A;  4J9I A;  4RCB A;  2EJG A;  1YJW A;  2P0K A;  4FYV B;  5A2Q E;  2E5Q A;  2LCL A;  5GMK l;  4JDS A;  1AEY A;  4M78 E;  1SKU B;  1PHT A;  4B9X A;  4FT2 A;  5FWC A;  1Q86 R;  2DJZ A;  4M75 F;  3QJY A;  2QAS A;  1J3T A;  1M2O A;  1Y7X A;  2CP3 A;  3TCJ A;  3CC7 T;  3OYD A;  5D7U A;  2DXT A;  1CSK A;  2V1Q A;  1HK9 A;  2H3J A;  5CQY A;  3E2U A;  1NE8 A;  4ESR A;  1ZUY A;  2EYW A;  2LZ6 B;  3MP6 A;  3TSZ A;  1G3T A;  3EGD B;  2DZ9 A;  2GBQ A;  4J9B A;  4J9H A;  3OYF A;  4VUB A;  3M0T A;  5IT9 E;  1IO6 A;  2E41 A;  3QPH A;  1ZSZ A;  3CCM T;  2RQR A;  2CS7 A;  1JXO A;  4M77 F;  2LC4 A;  2VV5 A;  2F2X A;  4M77 A;  2BTT A;  2LVM A;  3M0P A;  2QEX T;  3GBQ A;  3A1P A;  2K79 A;  2ZGW A;  4XU1 A;  1UHF A;  3OW2 S;  2JUF A;  3A8L B;  1MND A;  4FSS A;  2RMO A;  1YIJ T;  3ZEH A;  2ZPG B;  5CAI A;  1Z9Z A;  4F17 A;  3PVQ A;  4NL3 A;  1WA7 A;  3KFV A;  1JEG A;  4RTX A;  1M90 U;  3UA7 A;  1KD1 R;  2EYX A;  2P0P A;  3X25 B;  1K4U S;  2DK3 A;  3C95 A;  4J9C A;  1GBQ A;  4A54 A;  5AT1 B;  1Y07 A;  5J3B A;  1M2V B;  3BY7 A;  1JJ2 S;  2DXU A;  2RK1 A;  3EGX A;  1FMV A;  1H92 A;  2DL7 A;  3MJX A;  4RTU A;  4ZGD B;  4FIB A;  3CPW S;  1M1G A;  2OTL A;  1ZBJ A;  4XQ3 A;  4D8K A;  3OY9 A;  3X26 B;  2RI2 A;  1QKW A;  4OVA A;  1K9M C;  2ABL A;  1KC8 C;  1YJ9 A;  5LJ5 f;  3L2Q A;  3CCJ T;  1Q7Y U;  1AWO A;  1AVZ C;  1D0Z A;  3I5S A;  1MV0 B;  1RAA B;  5GMK e;  2YHT A;  4M78 G;  4C0D C;  3P8D A;  2GNC A;  3OBW A;  3CC7 A;  1B07 A;  4XK8 E;  2DL8 A;  1YI2 A;  1W1F A;  2RJC A;  4IIM A;  3E19 A;  1PKS A;  5CIU A;  2QDL A;  3EFO B;  4N4I A;  3ULR B;  2XID A;  3E1S A;  3QYG B;  4GLK A;  2DFU A;  3KUF A;  2B86 A;  5CQX A;  4A4K A;  3CCS T;  4C0F A;  2GTJ A;  3PIP A;  3EGX B;  1YFN A;  1QKX A;  1BKB A;  1UGQ B;  3J81 E;  4RG2 A;  1K1Z A;  4FW1 A;  2CYZ B;  2XI9 A;  3H41 A;  3EG1 A;  1KFZ A;  2QTV A;  2DF6 A;  3OYA A;  1NM7 A;  1OU9 A;  1ZLM A;  2ROL A;  1P92 A;  1UG1 A;  2RHU A;  4PLI A;  2XD0 A;  3NFC A;  2PVD B;  3H0H A;  1QMC A;  4RG8 A;  2O4X A;  4DEY A;  1UGR B;  2P4T A;  2YUP A;  1PG5 B;  4HXJ A;  3R6N A;  3O5Z A;  2K6D A;  3KBG A;  4E7S A;  2EWN A;  2ESW A;  2COW A;  2DRM A;  3JCM X;  5FWB A;  1N8R C;  2A36 A;  2DIQ A;  2QQA A;  2BKD N;  2CRE A;  4M7A F;  4ZGJ B;  4E7L A;  1X69 A;  3MEU A;  1PC0 A;  4ZN1 A;  5KH6 A;  1WHM A;  1YHQ T;  1ZSZ B;  1CKA A;  1JRI A;  2X4Y A;  4M75 B;  1PRL C;  1KG1 A;  1OPK A;  3HSB A;  1UEB A;  1KC8 R;  2LX9 A;  1FWZ A;  4C92 D;  5I11 A;  1W2B S;  2D9T A;  2FO0 A;  3CCL Q;  1R0C B;  2E5K A;  4WF2 A;  2XIC A;  2XMF A;  3A8G B;  3MEW A;  2DEU A;  1K0X A;  4L5G A;  1WJQ A;  5KYX A;  4M7D B;  1T3L A;  4YTL A;  2RI3 A;  2VB6 A;  3JCM e;  1VQ4 T;  2RM4 A;  2HKQ B;  2YLB A;  2KMT A;  3RER A;  1ZQ1 A;  2JN0 A;  4PJO D;  1E6H A;  3J7A F;  1WPY A;  4R0K A;  4E7Z A;  2HSE B;  1N9R A;  1C1A A;  4LDU A;  4E6R A;  1I4K 1;  2QGF B;  2LT1 A;  2X3W D;  2DTI A;  3I55 Q;  3U23 A;  3I56 T;  4PFO A;  1EX4 A;  1BI0 A;  2EGC A;  3CBP A;  3M59 A;  3QZ9 B;  3VS4 A;  4JJB A;  2HQE A;  2RB6 A;  2E6N A;  2MPX C;  4OGC A;  2QXF A;  5FU6 C;  2DZC A;  1G3S A;  5CK9 A;  1QVF S;  1I5L A;  3VYH B;  1VQ9 A;  4JPB W;  1TWB A;  2V26 A;  4C0G A;  3HTR A;  3O8V A;  4PJJ A;  1X75 C;  4M77 E;  3T9N A;  2XKO C;  4OMF B;  5EG2 A;  3CMA T;  5IH2 A;  4X9C A;  1FXX A;  2B8A A;  2VXF A;  2BZ8 A;  3M4G A;  3CCR A;  2JMC A;  4MMK A;  1D09 B;  2YT6 A;  2DYB A;  1TU0 B;  2HSP A;  3JB9 G;  2EVR A;  4C92 B;  2KRS A;  2EYQ A;  2OTJ A;  4J7F A;  2HKN A;  2EYY A;  3UPU A;  5CO7 A;  5IHN A;  2HQH A;  4F7U A;  4M7A B;  3C12 A;  4XTZ A;  3HFN A;  2WSC E;  4OMP A;  1JBM A;  1VQO Q;  1TTH B;  2VYT A;  1YIT A;  3CCE T;  4C92 G;  3TRE A;  2C0T A;  2E3H A;  5IN1 A;  5AYF A;  2AZS A;  3VRY A;  4LUE A;  3CXC S;  2J05 A;  2RI5 A;  4LNP A;  4EDU A;  5GMK i;  4J7I A;  3MP8 A;  4F16 A;  1WYX A;  1VQ6 T;  3EGU A;  2K3B A;  1H8K A;  1U1S A;  3EG9 B;  1Q7Y C;  1T3S A;  4GBQ A;  5KYW A;  4F04 B;  1Q86 U;  2YSQ A;  2LQN A;  5GAN 5;  1WJR A;  4OB1 B;  4M75 C;  3HPW A;  5KYY A;  1NEG A;  1X6G A;  1IGQ A;  4II1 A;  4M78 C;  5GAN 7;  3V8J A;  5I2S A;  1FYN A;  1NEB A;  1TSF A;  4LDX A;  2NUZ A;  3BDL A;  2DBK A;  2RH2 A;  1M3C A;  4A53 A;  4M75 G;  2QA4 A;  3QJ6 A;  2PUO B;  3A8M B;  1VQP T;  2DXC A;  4Z8A A;  2K3Y A;  2E6Z A;  3PGG A;  1BB9 A;  3RKW A;  3TEE A;  4A4H A;  5LJ5 h;  4M7A A;  3CD6 A;  1MHN A;  5FRO A;  4AG1 C;  4ZTJ A;  4DOV A;  1IB8 A;  1RAB B;  1I81 A;  1YBY A;  3AT1 B;  1VQ5 Q;  5CKB A;  4C92 A;  1MV3 A;  3BFM A;  3CME Q;  2LJ0 A;  4PJO F;  3G71 Q;  1GL5 A;  1FMW A;  3S6W A;  4N4H A;  4IUQ A;  1VQM A;  3L2V A;  2OTL T;  2DET A;  4DQ2 A;  1QVG P;  5GAO m;  3GIB A;  2E64 A;  2A37 A;  1M9S A;  3LH0 A;  4K11 A;  1N9S A;  1YJN Q;  3OYH A;  3VS6 A;  1YCS B;  2M1H A;  1B34 B;  2EJ9 A;  2CP0 A;  3TQ7 P;  1OYX A;  1WZO A;  3LGF A;  2JS0 A;  1MMG A;  1PRM C;  4OMN A;  2ROT A;  3JB9 D;  5GAN 8;  1YIJ A;  2BZX A;  2XDB A;  1SF9 A;  2X51 A;  3OYG A;  3CCJ A;  2RJD A;  3JCM V;  2FZK B;  4PFP A;  1X27 A;  5LJ3 f;  2IIM A;  4QVD A;  3F70 A;  3G1J A;  1K9M R;  2PU9 B;  3DB3 A;  1YHQ A;  1XTD A;  3JCM Q;  1ZA2 B;  2EGA A;  4XTW A;  3G4S Q;  2FEI A;  2A0F B;  2KE9 A;  1LNX A;  3JCM P;  2QAZ A;  4M7D F;  3H9N A;  5FU6 B;  3EHR A;  2VGN A;  1UB4 A;  2VGM A;  4E7I A;  1M27 C;  1OZ3 A;  3CD6 T;  2JTE A;  1VQM Q;  1IRX A;  4FCY A;  3OMC A;  5I21 A;  4A4F A;  2P84 A;  1SHF A;  2RJF A;  3BE3 A;  1YIT T;  1G3W A;  3EFS A;  4RTV A;  3CC4 T;  4HVV A;  3CPF A;  3VRZ A;  3QKJ A;  5GAO r;  2FPE A;  3EG2 A;  4L6V 5;  2M0Y A;  2KK4 A;  1UHC A;  3X28 B;  3JB9 H;  2DTO A;  3M0S A;  1UEC A;  2DIG A;  3GNF B;  3MCA B;  4HA8 A;  4DA4 A;  3HHT B;  1VQK Q;  2YUN A;  3E9G A;  1NLO C;  3VJP A;  4PKC C;  2NUP A;  3CC2 A;  2NUT A;  1Q86 C;  3TVT A;  2DKG A;  3UAT A;  2R58 A;  1I0C A;  4JUV A;  1RAI B;  3H6Z A;  3A98 A;  1Y57 A;  3ME9 A;  2MOX A;  4Y28 E;  1VIF A;  2RJE A;  3QUI A;  2KRM A;  4OMQ A;  5HKC A;  3CCE A;  3E9F A;  4CC7 A;  5GAN j;  2HEQ A;  1IRE B;  2O9S A;  4R55 A;  1AWX A;  1WHL A;  1BI1 A;  1M3A A;  4OMO A;  4CC4 B;  1EFN A;  4M77 C;  1KC8 U;  4Z88 A;  1X6B A;  3VUZ A;  1OX8 A;  1XQH A;  2LJ3 A;  3QZ5 B;  1GCQ A;  4PJM A;  3UT1 A;  1UE9 A;  1ZSG A;  3L2W A;  4AFU C;  2RQT A;  4LN2 A;  2RHZ A;  1KD1 C;  1VQ7 T;  1W70 A;  3PE0 A;  2RO0 A;  4M7A E;  1RAC B;  4JS5 A;  4OB2 B;  2JM8 A;  2KEA A;  2DPP B;  2JXB A;  4OMM A;  1ABO A;  4EMK B;  2EQU A;  1TOV A;  3L42 A;  5GAN d;  2XHC A;  3CCL A;  2COZ A;  5DM7 R;  2LTO A;  3CC2 T;  2DMO A;  2EKH A;  2ZPB B;  1OX9 A;  2DLP A;  4OML A;  4QVC A;  3OS2 A;  1VQ9 T;  3C4S A;  1Q82 R;  2DIL A;  2F5K A;  1UTI A;  3NTH A;  1SSH A;  3Q1J A;  3CME T;  5C6S A;  3M56 A;  2A28 A;  1AOJ A;  3CEY A;  2LNV A;  3PVL A;  4C5G A;  1D3B A;  1RL2 A;  4HT8 A;  1BBZ A;  2K3X A;  2K5I A;  2YXY A;  5GAM h;  1YCY A;  3VS5 A;  2DL3 A;  2FB7 A;  4WCI A;  2JTM A;  1YJ9 T;  1U06 A;  1M3B A;  1Q81 C;  2DM1 A;  5IXF A;  5GAN e;  3OB9 A;  4E7K A;  2EAY A;  2FZG B;  1PSF A;  1YJN T;  4XTU A;  5KYY B;  3RBB B;  4LDW A;  2VVK A;  3M0Q A;  1SRM A;  4PJO B;  2I0N A;  3JB9 I;  1N8R U;  1QQJ A;  1NLP C;  4J9E A;  1OPL A;  4NOY A;  3GLX A;  4QQG A;  2OI3 A;  3CCU T;  2RQW A;  1OV3 A;  3QII A;  1F1B B;  5HK0 A;  9ATC B;  4QT7 A;  2F69 A;  4RKU E;  4Q5W A;  2CP7 A;  4V2S A;  2VUB A;  2BE9 B;  3CXC P;  3I9Q A;  3ER0 A;  2HL3 A;  4MDW A;  5FRM A;  1V29 B;  2HD0 A;  4NS5 A;  4LD6 A;  1KQ2 A;  2ENM A;  2AKL A;  1QCN A;  2JMA A;  1PD1 A;  1KJW A;  4FYW B;  1MMD A;  3I55 T;  4M77 B;  2HBP A;  3RUX A;  4AFZ C;  5CKH A;  2XDP A;  2L8D A;  1S72 T;  2AKK A;  5LJ3 e;  2KT1 A;  1X43 A;  2Y4X A;  2VAS A;  2R57 A;  1S72 A;  1YI2 Q;  2J6O A;  1GCP A;  2MI6 A;  2K7A A;  4QVZ A;  3SWN C;  3OS0 A;  1BU1 A;  2Y90 A;  4HCZ A;  1RAG B;  1JB0 E;  4JLG A;  4PJO E;  3OS5 A;  2EW3 A;  3OYK A;  1VQ7 A;  3H0F A;  1WHH A;  1QLY A;  1N6A A;  4A63 B;  5A0G A;  1WQW A;  2LRQ A;  4PJO C;  1OU8 A;  4LDV A;  1X6O A;  4LDY A;  1QVP A;  1OOT A;  5IXB A;  4C92 F;  1VYV A;  3M0R A;  8AT1 B;  4J9D A;  4ATO A;  4BDZ A;  2D0Q B;  3CPW P;  4F7U G;  1SRL A;  5HK3 A;  1NBE B;  3RMS A;  7AT1 B;  3CCV A;  3L2Z A;  1K73 C;  1RLQ C;  2NLU A;  3OYC A;  2EFI A;  2DE0 X;  1WHK A;  3QWY A;  1WXT A;  2AIR B;  3SWN B;  4KUD K;  2CZ1 B;  2C0I A;  2O31 A;  3I35 A;  4JRQ A;  4C8Q D;  5GJV B;  3CCE Q;  1Y0M A;  3OYL A;  2FPD A;  2GFA A;  3HRT A;  2RQU A;  1MGQ A;  1K0S A;  5GMK m;  4M78 F;  1EIF A;  1TUG B;  2GF7 A;  1M1K U;  2F1L A;  2MYS A;  1G2B A;  2QK0 A;  3MEV A;  2MK5 A;  5CKD A;  2DYI A;  4LE9 A;  4EMH A;  4M78 B;  5M9O A;  5KYU B;  2K2M A;  2QEX Q;  1TUC A;  4DEX A;  2IG0 A;  4ELY C;  4BB7 A;  3FC3 A;  4M7D A;  5KYX B;  3QSU A;  4EMG A;  2KDS A;  2ED0 A;  1AD5 A;  1G8X A;  2ZPF B;  1ARK A;  1D1B A;  2DVJ A;  4HVU A;  3CCU A;  1RUW A;  4NL2 A;  3JSC A;  1SHG A;  4ZN3 A;  1QVG A;  4EPC A;  4J6W A;  1SSF A;  1AZE A;  3G6E Q;  1VQL T;  3OYI A;  3AHU A;  2OAU A;  5J39 A;  3MKD A;  2ZPI B;  2L5Q A;  5GAN g;  1Z9Q A;  2KGT A;  1CKB A;  5IHI A;  3L2R A;  4M75 A;  2DD4 A;  4FL6 A;  3M54 A;  1V76 A;  1YJ9 Q;  2JVV A;  2DTH A;  2QQ9 A;  3VYG A;  1X2Q A;  1RAE B;  3G4S A;  4JJC A;  5DY9 A;  1HD3 A;  4Y91 A;  1KQS P;  4P5N A;  1YJW Q;  2A7Y A;  3HRS A;  2EQI A;  2J06 A;  3JCM d;  3LW5 E;  5FU7 B;  3ZL7 C;  3CMA A;  2DJQ A;  1TUD A;  2HCK A;  2O4X B;  1VYT A;  3CCJ Q;  4KGX B;  3I56 Q;  2QDY B;  2F2W A;  3C0C A;  4N0A A;  4C8Q B;  3CCU Q;  1GRI A;  3OW2 A;  4A4E A;  2X9H A;  1LVK A;  1K9M U;  5EC7 A;  4IIO A;  2CT4 A;  2WAC A;  2L0A A;  2EQJ A;  2RA2 A;  1LOJ A;  1XOV A;  1Y71 A;  4BAC A;  1BYM A;  4M7A D;  2QG9 B;  5GAO p;  5GMK j;  2G3R A;  3PFS A;  2GGR A;  3CQT A;  4KH0 B;  4AFS C;  3BDU A;  1GFC A;  5CKF A;  1HXD A;  1WHG A;  3DKM A;  3URG A;  2ECZ A;  4X1V A;  2CSI A;  1B3Q A;  2CKK A;  4M7D G;  1QWF A;  5LJ3 h;  3JCM b;  3MPU B;  2PQW A;  4KH1 B;  2PNI A;  2LMJ A;  5KE3 A;  3ASK A;  4PL6 A;  4E47 A;  1BI2 A;  4X9D A;  4M78 A;  3VV0 A;  1VQ4 A;  2OJ2 A;  2KT8 A;  2P0Q A;  5GAM g;  1IXD A;  2Y4Y A;  4TVR A;  1WDX A;  2MF2 A;  1Q95 G;  1VA7 A;  1BIB A;  3V8L A;  2DVE A;  2DXB A;  2E4H A;  4KBM B;  2V8I A;  3M58 A;  2DX1 A;  3G7Z A;  4EMK A;  1VQN Q;  4HCK A;  2KRO A;  1WNL A;  1N27 A;  1YP5 A;  2X4J A;  3JV3 A;  2CP2 A;  2AHJ B;  1AWJ A;  2BZY A;  3CC4 Q;  1VQ7 Q;  3V7R A;  2I2L A;  1TG0 A;  2ATC B;  1EZZ B;  3JCM c;  4BE2 A;  2CZ0 B;  2EBP A;  1AZG B;  1VQP A;  1D0X A;  3VS0 A;  2RHI A;  3QDR B;  3DLM A;  4BDY A;  2LQW A;  4DBQ A;  5GAO n;  1WGS A;  1BK2 A;  2HZY A;  1M4Z A;  1WIE A;  3RIR A;  3JB9 J;  4C8Q C;  1NJI R;  3VS7 A;  2QQB A;  5L8R E;  3I56 A;  1KHI A;  1PCX A;  4C5I A;  3JCM J;  3X24 B;  3QBY A;  1E7O A;  2K4Y A;  1ABQ A;  2KY9 A;  1W2B P;  4EMK C;  4PFZ A;  4BUG A;  1WJS A;  1VQL A;  4IUR A;  3LX7 A;  1VQO A;  3OQ5 A;  2FYK A;  4N0A C;  2R5M A;  1NPP A;  1KSW A;  2HMA A;  2C06 A;  1NZ9 A;  3FEO A;  3DLL A;  3EH1 A;  2KRN A;  4Y92 A;  4F7U E;  3G71 A;  5GAN 2;  1ZA1 B;  1U5S A;  4BI8 B;  5GAM d;  3G71 T;  2M02 A;  4JLI A;  5I2M A;  3EGD A;  2DNU A;  2HBW A;  3A8O B;  1BI3 A;  2DO3 A;  4C8Q G;  5LJ5 g;  2O88 A;  1JJ2 A;  2NYS A;  1NYF A;  2LNH B;  2JW4 A;  4KGV B;  4KRT A;  2YLC A;  2F5T X;  2L3S A;  2QEX A;  2F2V A;  1RLP C;  1M90 C;  4PJN A;  4RTZ A;  4M75 E;  3L2U A;  4BD3 A;  4LXC A;  1K8A R;  1N8R R;  1K73 R;  2WSF E;  2JJ9 A;  1VQ9 Q;  2GQI A;  3ZBD A;  2X4X A;  2AT1 B;  4PJO A;  4C5H A;  2GTO A;  3OYN A;  2FL7 A;  2DAQ A;  4J5Y A;  3WXM B;  2D8H A;  1ZSZ C;  2K57 A;  1K76 A;  2FRY A;  2RHY A;  3CCS Q;  2AZV A;  3CXC A;  1BCM A;  3UWN A;  1C0M A;  2O2O A;  4O6J A;  4M4Z A;  2DL5 A;  3QWX X;  3QXE B;  2DER A;  3N5B B;  3SHW A;  2KVQ G;  2DL4 A;  1QVF A;  5LJ5 e;  3CCV Q;  3LYI A;  5DLQ E;  1B34 A;  1QP3 A;  3KXT A;  1PKT A;  3HL8 A;  2E1H A;  4HT9 A;  1QCF A;  3CBM A;  1R77 A;  2L3R A;  1T0H A;  3CCQ A;  1KIK A;  4XTY A;  4B6M A;  3PNW C;  3EAE A;  3NTI A;  2V8J A;  3JAM E;  1I1J A;  1MMA A;  4XU2 A;  3NMZ C;  3CCR T;  1KHC A;  4J9G A;  4ZTF A;  2ZCF B;  1GCQ C;  2YWW A;  1IHV A;  1KK7 A;  4FM4 B;  1SG5 A;  1Q81 U;  3OSV A;  1XNI A;  2H8H A;  3QYH B;  3CCV T;  2J6K A;  2JS2 A;  3LGL A;  2RF0 A;  1Q82 U;  2ZPH B;  3TU4 K;  3MEA A;  1QP2 A;  3HFO A;  3CC4 A;  1HJD A;  2OTJ Q;  3DB4 A;  4Z02 A;  3VS3 A;  1BIA A;  3S3O A;  1S72 Q;  3H0I A;  4KUL A;  3MET A;  1H64 1;  1VQN A;  2FZC B;  3GF5 A;  4PNO A;  4GY5 A;  4PK4 A;  2OAW A;  3M55 A;  4QQ6 A;  1VQK A;  3CCR Q;  1M8V A;  2KR3 A;  2O01 E;  1Y96 B;  5GMK h;  1TS9 A;  4E2F B;  3HP9 A;  5FLX E;  4UC4 A;  1I07 A;  4F7U F;  1KD1 U;  4E7H A;  3RKY A;  5KYN A;  3P8B B;  1VQ4 Q;  3LLR A;  3M0U A;  5LJ3 j;  4IUV A;  1IGU A;  4CRI A;  1Q7Y R;  4BE0 A;  1NJI C;  3SB2 A;  2FHD A;  2W10 A;  4MZM A;  5CKE A;  4J8O A;  5D6Y A;  3GOX A;  3UDC A;  3EHQ A;  4DBR A;  2L89 A;  2CH4 W;  1AWW A;  3RKX A;  2A08 A;  2K9G A;  5LL6 S;  5CR2 A;  1V1C A;  3CCM Q;  1Q82 C;  3VS2 A;  4XU3 A;  4CC2 A;  2V1R A;  2FRW A;  3PMT A;  3FJP A;  2QQS A;  1VOM A;  1DJ7 B;  1YHQ Q;  3HRU A;  4EIK A;  2VC8 A;  6AT1 B;  4RUG A;  2QYZ A;  1GXI E;  2FG0 A;  5GAN f;  1VQ8 T;  4DOW A;  1K73 U;  4JJD A;  4AFQ C;  4MDX A;  4D8D A;  1NG2 A;  1WHJ A;  1ZUK A;  3OYY A;  3TSW A;  5ECA A;  1WFW A;  1VUB A;  1WXB A;  4WTO B;  1YIJ Q;  1QWE A;  1JO8 A;  3MHX A;  1PD0 A;  5FU7 C;  3LWH A;  4QQD A;  2MIO A;  3CC7 Q;  2YUQ A;  3PMI A;  3CMA Q;  2COY A;  3VS1 A;  1M2V A;  1M1K C;  1I8F A;  3M53 A;  4HCB A;  2D8J A;  1ZUU A;  1OEB A;  4FT4 A;  2A3L A;  4RCC A;  2BE7 D;  2KXC A;  4IUP A;  1K8A C;  3NPF A;  2BUD A;  1X01 A;  2ED1 A;  3NGP A;  4HVW A;  2DEQ A;  2JTF A;  4MZP A;  1FMK A;  3QO3 A;  4QW2 A;  1N5Z A;  4AG2 C;  1VYU A;  4OF1 A;  2LDM A;  2W0Z A;  4M77 D;  2VWF A;  3QG1 A;  2CZ7 B;  2RHX A;  1KQS S;  1G3Y A;  5I22 A;  4FYY B;  1ACM B;  1M5Q 1;  1UFF A;  1K8A U;  4C0D B;  4JS4 A;  1R0B G;  2CZ6 B;  2V8K A;  3P8H A;  2WSE E;  1W4S A;  2YUO A;  1NYG A;  2QQR A;  1MMN A;  3L1A A;  4E7J A;  5GAM f;  5GJW B;  4J9F A;  1WXU A;  1VQ8 A;  1VQK T;  2HQX A;  3VKI A;  4OB0 B;  1VQN T;  5IHK A;  2FPF A;  4MML A;  1OZ2 A;  3I5R A;  3X20 B;  2CP5 A;  3INZ A;  4M78 D;  4O5V A;  3WVE B;  2M16 A;  2XU8 A;  3QDF A;  3WVD B;  5GAN 6;  4N4G A;  4C5E A;  2AK5 A;  2DBM A;  5LJ3 d;  5A0L A;  2E10 A;  2XG8 D;  4ME7 A;  3SD4 A;  5J26 A;  5LJ3 g;  1MNE A;  3JCM g;  3RMQ A;  5GAM j;  2K5L A;  2JM9 A;  3OYE A;  3V7C A;  4Z89 A;  1NJI U;  1Y96 A;  1YIT Q;  2IPO B;  3QHS A;  1PM3 A;  4BY6 B;  4X34 A;  5D6X A;  2OX7 A;  1D1C A;  4JZ4 A;  2EKO A;  1I5O B;  3CBO A;  3RDV A;  4AMC A;  2CUB A;  2EQM A;  4JZ3 A;  2JOY A;  4AT1 B;  1JQQ A;  4OB3 B;  5GAN 3;  3OW2 P;  3H8Z A;  3G6E A;  4LD9 K;  1H3Z A;  4OP0 A;  2K5F A;  2XDD A;  5CCA A;  3BW1 A;  1LCK A;  1ZX6 A;  2CH4 A;  2X4W A;  4FSX A;  4CC3 A;  2LX7 A;  2M0O A;  3GPL A;  1W2B A;  4C0Z A;  3M57 A;  1G5V A;  2PZ1 A;  3CCL T;  3EG0 A;  2KQW A;  2YRC A;  4M77 G;  4PJL A;  2MMP A;  5A0D A;  2EQK A;  2X3X D;  3OA6 A;  3JCM W;  2O9V A;  1IHW A;  1KQ1 A;  3JB9 F;  3CCQ T;  1RI0 A;  3VUB A;  1S1N A;  2CUD A;  3RNJ A;  5KCO A;  3M4Y A;  4R56 A;  1VQ8 Q;  5IAY A;  4BE1 A;  5C0M A;  3C94 A;  3D7S B;  5CVI A;  5DLO A;  3V7S A;  3UA6 A;  3A5Z B;  2KAF A;  1O9S A;  2LQ8 A;  5GAO l;  4M7D E;  1VQ5 T;  2MWP A;  4ELZ C;  4OGE A;  1X2K A;  3I55 A;  3JCM h;  1HSQ A;  2PVG B;  2KI7 A;  4M7A C;  5HY6 A;  3REA B;  2JT4 A;  3GP8 A;  2HDA A;  1M90 R;  1PWT A;  3CD6 Q;  1VQM T;  2GFU A;  4C8Q F;  3REB B;  4KUI A;  3NHN A;  3FB9 A;  2NUT B;  3EG9 A;  2KBT A;  2R5A A;  1GBR A;  4B9W A;  3JCM f;  2ZPE B;  2CGH A;  2JZ2 A;  2KNB B;  5GAN 4;  4ANJ A;  4J83 A;  1M1K R;  2QA4 Q;  2KSS A;  1OI1 A;  3SWN A;  4XTX A;  4GLM A;  3GNG A;  2GCX A;  2DRK A;  5LJ5 j;  2RPN A;  1U3O A;  1IZ6 A;  1RI9 A;  2LJ1 A;  3PIO A;  4RTW A;  2LT4 A;  2YRV A;  1TXQ A;  2K2V A;  1UUE A;  3S3M A;  2RQV A;  1GFD A;  2PVO B;  2QA4 T;  2ZZD A;  1PNJ A;  1PSE A;  1SEM A;  2JNG A;  1AT1 B;  1M1F A;  4BI3 A;  1VIE A;  2MCN A;  1LJO A;  4QKU A;  2CDT A;  4IKF A;  1Q81 R;  3LH5 A;  2EJF A;  3MP1 A;  4PJO G;  4L59 A;  3CCM A;  4DBF A;  4BI4 A;  4RMO A;  1WQ7 A;  4J6X A;  3JRZ A;  2G6F X;  2RN8 A;  2E70 A;  1JU5 C;  3OS1 A;  3FJ5 A;  3CCS A;  5FRN A;  1OQK A;  3UF4 A;  1UGS B;  1RAF B;  1ZHI A;  1VQ6 Q;  2MWO A;  3RES A;  4DBH A;  3OSS C;  2LCS A;  2KYB A;  2BIV A;  1H3H A;  2HNI A;  3EH2 A;  1D1A A;  2DA9 A;  3CC2 Q;  2L3P A;  1A0N B;  3V8K A;  2J6F A;  1G83 A;  1QW1 A;  1YWO A;  3SDZ A;  4M7A G;  2M51 A;  1WX6 A;  2J7I A;  1MUZ A;  2D0N A;  5FW9 A;  2PTK A;  3R6O A;  1UJY A;  1YNZ A;  3LWI A;  1AHJ B;  1TH7 A;  1WI7 A;  1YWP A;  4LUD A;  4M75 D;  2VXE A;  3A8H B;  2X35 A;  2OTJ T;  5GAO q;  3PTA A;  2D1X A;  2LP5 A;  2LQK A;  2ZAE A;  2YRD A;  2E12 A;  4XAX B;  3J80 E;  3S3N A;  4C8Q E;  2FVU A;  1WLP B;  4HKE A;  4ZGE B;  3ZFJ A;  3VU3 C;  1QCO A;  1NPR A;  3EFO A;  3RR6 A;  2RK2 A;  2PUK B;  3OYM A;  8ATC B;  4JRI A;  5KE2 A;  3G6E T;  1VQL Q;  4IUT A;  1D3B B;  2D6F A;  4M7D D;  5HCK A;  2OTL Q;  3CCQ Q;  4IUU A;  3NTK A;  1RAH B;  4KT0 E;  3SFM A;  1D0Y A;  1E6G A;  2CP6 A;  2KXD A;  2QI2 A;  4D6W A;  2EPD A;  4CI0 C;  1UJ0 A;  1UGV A;  2HAX A;  4JRP A;  5KYW B;  1HYO A; 
#chains in the Genus database with same CATH homology
 5A0G A;  3FRN A;  4X9C A;  1FXX A;  1WQW A;  2B8A A;  2L89 A;  2RD1 A;  2VXF A;  3M4G A;  2LRQ A;  4C92 C;  3CCR A;  4LDV A;  4PJO C;  1X6O A;  4LDY A;  2QTX A;  3RKX A;  1QVP A;  5GAN h;  4MMK A;  4C8Q A;  5LL6 S;  5CR2 A;  4C92 F;  5D6W A;  1Q82 C;  4ATO A;  4M7D C;  3MO8 A;  4XU3 A;  4BDZ A;  2D0Q B;  3JB9 G;  4C92 B;  4F7U G;  2EYQ A;  1YJN A;  3EFR A;  2OTJ A;  1O75 A;  5HK3 A;  3PMT A;  3FJP A;  4J7F A;  2QQS A;  3OYB A;  1DJ7 B;  1UGP B;  3RMS A;  3CCV A;  3HRU A;  3L2Z A;  1K73 C;  2VC8 A;  3UPU A;  1GXI E;  5GAN f;  1U1T A;  1VQ8 T;  2NLU A;  5CO7 A;  2EFI A;  4DOW A;  3OYC A;  1K73 U;  4MZT A;  4F7U A;  4M7A B;  4MDX A;  3SWN B;  3C12 A;  4KUD K;  4XTZ A;  2CZ1 B;  3HFN A;  2WSC E;  3OYY A;  5KCH A;  3PT9 A;  4C8Q D;  3G4S T;  4JRQ A;  1JBM A;  1VUB A;  5GAM e;  3OYL A;  2E65 A;  2VYT A;  3CME A;  4FU6 A;  2GFA A;  3HRT A;  1YIT A;  3MHX A;  1VQO T;  3CCE T;  5FU7 C;  3LWH A;  1MGQ A;  4QQD A;  4C92 G;  4F7U B;  1VQ5 A;  5GMK m;  3FLG A;  3PMI A;  4M78 F;  3OBY A;  3TRE A;  3FDR A;  1EIF A;  2GF7 A;  1M1K U;  5IN1 A;  4C92 E;  5AYF A;  1M1K C;  1I8F A;  3M53 A;  4HCB A;  3MEV A;  1FX7 A;  3CXC S;  2MAM A;  4BY6 C;  5CKD A;  2RI5 A;  4FT4 A;  4EMH A;  2A3L A;  1U8R A;  4RCC A;  4M78 B;  2EIF A;  4EDU A;  5M9O A;  5GMK i;  4IUP A;  1VQ6 A;  1QVG S;  1K8A C;  1ZBX A;  4J7I A;  2BUD A;  1X01 A;  3HKS A;  2IG0 A;  3MP8 A;  2M9U A;  2GQV A;  4BB7 A;  4ELY C;  3FC3 A;  1YJW T;  4HCC A;  1VQ6 T;  4M7D A;  3OMG A;  3QSU A;  4JRK A;  1U1S A;  4J6Y A;  4EMG A;  3CPW A;  2KDS A;  1Q7Y C;  2ZPF B;  4JJN K;  2DEQ A;  1Q86 U;  2JTF A;  5GAN 5;  4MZP A;  3CCU A;  1WJR A;  3QO3 A;  4OB1 B;  4QW2 A;  4NL2 A;  4M75 C;  3HPW A;  4OF1 A;  2LDM A;  4M77 D;  5GAN 7;  4II1 A;  4M78 C;  3V8J A;  3QG1 A;  3JSC A;  4A4G A;  5I2S A;  2CZ7 B;  4ZN3 A;  1QVG A;  4EPC A;  3M5A A;  4J6W A;  4LDX A;  1R8O B;  1SSF A;  2IVW A;  1YI2 T;  1VQL T;  3OYI A;  3BDL A;  2RHX A;  3AHU A;  2OAU A;  2RH2 A;  1KQS S;  1G3Y A;  5LJ5 d;  2DD5 A;  1M5Q 1;  4A53 A;  5J39 A;  2ZPI B;  2L5Q A;  4M75 G;  2XK0 A;  5GAN g;  4XTV A;  3L2R A;  3QJ6 A;  2QA4 A;  2PUO B;  3FIF A;  3OYJ A;  4M75 A;  2DD4 A;  3A8M B;  4C0D B;  1VQP T;  4PLL A;  2DXC A;  4FL6 A;  2K3Y A;  3M54 A;  2E6Z A;  3PGG A;  3M9Q A;  2JVV A;  3RKW A;  4JS4 A;  4BE1 A;  2DTH A;  3TEE A;  2QQ9 A;  2CZ6 B;  2V8K A;  3P8H A;  3VYG A;  4A4H A;  5LJ5 h;  2WSE E;  1W4S A;  3G4S A;  5DY9 A;  2QQR A;  4XU0 A;  4Y91 A;  4M7A A;  3L1A A;  4E7J A;  4P5N A;  3CD6 A;  2LCC A;  1MHN A;  1KQS A;  5GAM f;  5FRO A;  2A7Y A;  3HRS A;  4ZTJ A;  4RCB A;  4DOV A;  3JCM d;  1I81 A;  3LW5 E;  2EJG A;  1VQ8 A;  1YJW A;  2P0K A;  1YBY A;  5FU7 B;  3CMA A;  1VQK T;  5CKB A;  5A2Q E;  2HQX A;  2E5Q A;  2LCL A;  2O4X B;  4JDS A;  4C92 A;  5GMK l;  4M78 E;  3BFM A;  4B9X A;  3VKI A;  4PJO F;  2QDY B;  4FT2 A;  4OB0 B;  1VQN T;  2DJZ A;  4M75 F;  3QJY A;  3S6W A;  4N0A A;  4C8Q B;  1Y7X A;  4N4H A;  4IUQ A;  4A4E A;  3OW2 A;  3TCJ A;  1VQM A;  4MML A;  1OZ2 A;  1K9M U;  3CC7 T;  3X20 B;  3INZ A;  4M78 D;  3L2V A;  4O5V A;  3OYD A;  2OTL T;  2DXT A;  4DQ2 A;  3WVE B;  5GAO m;  3GIB A;  2M16 A;  2XU8 A;  2WAC A;  3WVD B;  5GAN 6;  1HK9 A;  2E64 A;  2EQJ A;  2H3J A;  2RA2 A;  4N4G A;  3UDC A;  1LOJ A;  1M9S A;  5CQY A;  3LH0 A;  4C5E A;  1NE8 A;  1XOV A;  1Y71 A;  3MP6 A;  4BAC A;  1BYM A;  5A0L A;  5LJ3 d;  1G3T A;  2E10 A;  4M7A D;  2XG8 D;  1N9S A;  4ME7 A;  5J26 A;  2DZ9 A;  2G3R A;  3PFS A;  3SD4 A;  5GMK j;  2M1H A;  5GAO p;  3OYH A;  5LJ3 g;  3BDU A;  1B34 B;  2EJ9 A;  5CKF A;  1HXD A;  3DKM A;  3JCM g;  3URG A;  3RMQ A;  5GAM j;  3OYF A;  1OYX A;  2K5L A;  3LGF A;  4VUB A;  3OYE A;  3V7C A;  5IT9 E;  2CKK A;  1NJI U;  4M7D G;  1Y96 A;  2E41 A;  5LJ3 h;  3QPH A;  3JCM b;  3QHS A;  3CCM T;  4BY6 B;  5GAN 8;  2PQW A;  3JB9 D;  4X34 A;  1YIJ A;  5D6X A;  2CS7 A;  4M77 F;  2LC4 A;  2EKO A;  5KE3 A;  2XDB A;  3ASK A;  4PL6 A;  3OYG A;  3CCJ A;  3CBO A;  2VV5 A;  2RJD A;  4E47 A;  1BI2 A;  4M77 A;  3JCM V;  2LVM A;  4X9D A;  4M78 A;  3VV0 A;  2EQM A;  2QEX T;  1VQ4 A;  2JOY A;  5LJ3 f;  5GAN 3;  2P0Q A;  4OB3 B;  4QVD A;  5GAM g;  3H8Z A;  3F70 A;  2Y4Y A;  2ZGW A;  4XU1 A;  3G6E A;  2PU9 B;  3DB3 A;  4LD9 K;  4TVR A;  1YHQ A;  1XTD A;  3JCM Q;  1H3Z A;  4OP0 A;  3OW2 S;  2K5F A;  2MF2 A;  2JUF A;  2XDD A;  5CCA A;  4XTW A;  3A8L B;  3BW1 A;  1BIB A;  3V8L A;  1YIJ T;  2DVE A;  2X4W A;  4FSX A;  2DXB A;  1LNX A;  2ZPG B;  3ZEH A;  4KBM B;  2M0O A;  2V8I A;  3M58 A;  5CAI A;  3JCM P;  4NL3 A;  4M7D F;  3GPL A;  5FU6 B;  3G7Z A;  4C0Z A;  1W2B A;  2VGN A;  1UB4 A;  1M90 U;  2VGM A;  3M57 A;  4EMK A;  1G5V A;  4E7I A;  1OZ3 A;  3CCL T;  1WNL A;  2KQW A;  1N27 A;  2P0P A;  2X4J A;  4M77 G;  3X25 B;  3CD6 T;  2MMP A;  2DK3 A;  5A0D A;  3C95 A;  2EQK A;  2AHJ B;  3OMC A;  3OA6 A;  5I21 A;  3JCM W;  4A4F A;  3V7R A;  2I2L A;  2RJF A;  1YIT T;  4A54 A;  1G3W A;  3EFS A;  1KQ1 A;  1Y07 A;  5J3B A;  3JB9 F;  3BY7 A;  3CCQ T;  1RI0 A;  3JCM c;  3VUB A;  3CC4 T;  1JJ2 S;  2DXU A;  4BE2 A;  5KCO A;  2RK1 A;  3M4Y A;  3CPF A;  2CZ0 B;  4R56 A;  3QKJ A;  1VQP A;  5GAO r;  4L6V 5;  5IAY A;  2KK4 A;  2RHI A;  3QDR B;  4FIB A;  3C94 A;  3X28 B;  5CVI A;  4ZGD B;  5C0M A;  3CPW S;  1M1G A;  3DLM A;  5DLO A;  2DTO A;  3V7S A;  4BDY A;  2OTL A;  4XQ3 A;  2DIG A;  3GNF B;  3A5Z B;  2KAF A;  3OY9 A;  5GAO n;  1WGS A;  3MCA B;  1O9S A;  2RI2 A;  2LQ8 A;  4HA8 A;  3X26 B;  1M4Z A;  4DA4 A;  4OVA A;  1K9M C;  3HHT B;  5GAO l;  1KC8 C;  3RIR A;  1VQ5 T;  3JB9 J;  1YJ9 A;  2MWP A;  4ELZ C;  4M7D E;  3E9G A;  4C8Q C;  5LJ5 f;  4OGE A;  3L2Q A;  2QQB A;  5L8R E;  3VJP A;  3I56 A;  3CCJ T;  1KHI A;  3I55 A;  4PKC C;  1Q7Y U;  3JCM h;  4C5I A;  3CC2 A;  2PVG B;  3JCM J;  1Q86 C;  3X24 B;  2DKG A;  3QBY A;  4M7A C;  5GMK e;  2YHT A;  4M78 G;  5HY6 A;  2R58 A;  2K4Y A;  4C0D C;  2KY9 A;  3GP8 A;  3P8D A;  4JUV A;  3OBW A;  3H6Z A;  3CC7 A;  2GFU A;  1VQM T;  3ME9 A;  4C8Q F;  4EMK C;  4XK8 E;  4KUI A;  4Y28 E;  4BUG A;  3FB9 A;  1WJS A;  1YI2 A;  4IUR A;  1VQL A;  1VIF A;  3LX7 A;  2RJE A;  3QUI A;  2R5A A;  2RJC A;  5HKC A;  3CCE A;  1VQO A;  3E9F A;  3OQ5 A;  2FYK A;  4B9W A;  5GAN j;  4N0A C;  1IRE B;  3JCM f;  3E19 A;  2R5M A;  1NPP A;  2ZPE B;  2CGH A;  4R55 A;  2C06 A;  2JZ2 A;  5CIU A;  1NZ9 A;  5GAN 4;  1BI1 A;  4J83 A;  4M77 C;  3FEO A;  3DLL A;  2KSS A;  1KC8 U;  1OI1 A;  3VUZ A;  3SWN A;  4XTX A;  4N4I A;  1XQH A;  4F7U E;  3QZ5 B;  2XID A;  3E1S A;  3QYG B;  3GNG A;  4GLK A;  3KUF A;  3G71 A;  3UT1 A;  2GCX A;  5GAN 2;  3L2W A;  5CQX A;  4A4K A;  4BI8 B;  5GAM d;  3CCS T;  4C0F A;  5LJ5 j;  3PIP A;  3G71 T;  4JLI A;  5I2M A;  2RHZ A;  1KD1 C;  1BKB A;  1VQ7 T;  1UGQ B;  3A8O B;  1IZ6 A;  3J81 E;  2RO0 A;  1BI3 A;  2DO3 A;  4RG2 A;  4C8Q G;  5LJ5 g;  4M7A E;  3PIO A;  1JJ2 A;  4JS5 A;  2CYZ B;  2XI9 A;  4OB2 B;  2LT4 A;  2YRV A;  2DPP B;  2K2V A;  3OYA A;  4EMK B;  2YLC A;  3S3M A;  2F5T X;  1K8A U;  2QEX A;  1P92 A;  2EQU A;  1M90 C;  2RHU A;  3L42 A;  4PLI A;  2XD0 A;  5GAN d;  2PVO B;  2XHC A;  4M75 E;  3L2U A;  2QA4 T;  3CCL A;  2ZZD A;  3NFC A;  4BD3 A;  5DM7 R;  2LTO A;  3CC2 T;  2PVD B;  1PSE A;  2WSF E;  4RG8 A;  2O4X A;  1UGR B;  2JNG A;  3ZBD A;  2X4X A;  2ZPB B;  2P4T A;  4PJO A;  4C5H A;  1M1F A;  4BI3 A;  4QVC A;  1VIE A;  3OS2 A;  1VQ9 T;  3C4S A;  3KBG A;  1LJO A;  3OYN A;  2F5K A;  2FL7 A;  2DAQ A;  4J5Y A;  2EWN A;  3NTH A;  3Q1J A;  3CME T;  3WXM B;  5C6S A;  4IKF A;  1N8R C;  3JCM X;  2DIQ A;  3M56 A;  2EJF A;  3MP1 A;  2K57 A;  2QQA A;  4PJO G;  4L59 A;  2BKD N;  2LNV A;  2RHY A;  3CEY A;  1D3B A;  1RL2 A;  4BI4 A;  4C5G A;  3CCM A;  4HT8 A;  2K3X A;  4RMO A;  1WQ7 A;  3CXC A;  2K5I A;  3UWN A;  4M7A F;  4J6X A;  3JRZ A;  5GAM h;  4O6J A;  4ZGJ B;  4E7L A;  1YCY A;  3MEU A;  2E70 A;  3QXE B;  3OS1 A;  4ZN1 A;  5KH6 A;  3CCS A;  2FB7 A;  5FRN A;  1YHQ T;  1JRI A;  2X4Y A;  1UGS B;  2JTM A;  4M75 B;  3N5B B;  1YJ9 T;  1KG1 A;  1Q81 C;  2KVQ G;  1ZHI A;  5GAN e;  1QVF A;  3OB9 A;  2MWO A;  5LJ5 e;  4E7K A;  3RES A;  2EAY A;  3LYI A;  5DLQ E;  3HSB A;  1UEB A;  1B34 A;  1PSF A;  1YJN T;  1QP3 A;  3KXT A;  2LX9 A;  3OSS C;  1FWZ A;  3JB9 H;  3HL8 A;  2E1H A;  2BIV A;  4XTU A;  4C92 D;  4HT9 A;  2HNI A;  3CBM A;  4LDW A;  1W2B S;  2D9T A;  2L3R A;  3V8K A;  4PJO B;  1QW1 A;  3CCQ A;  3JB9 I;  1N8R U;  4WF2 A;  4XTY A;  2XIC A;  3A8G B;  3PNW C;  3EAE A;  3GLX A;  3MEW A;  2V8J A;  3NTI A;  4NOY A;  4L5G A;  1WJQ A;  4QQG A;  3SDZ A;  3JAM E;  3CCU T;  4M7A G;  4M7D B;  4XU2 A;  2RI3 A;  4YTL A;  3QII A;  3CCR T;  1KHC A;  3R6O A;  4ZTF A;  3JCM e;  1VQ4 T;  2ZCF B;  5HK0 A;  2RM4 A;  3LWI A;  1AHJ B;  4FM4 B;  1TH7 A;  2F69 A;  2KMT A;  2YLB A;  3RER A;  4RKU E;  4Q5W A;  1ZQ1 A;  1Q81 U;  2JN0 A;  1XNI A;  3OSV A;  4PJO D;  3J7A F;  1WPY A;  3QYH B;  3CCV T;  4M75 D;  4V2S A;  2VUB A;  2VXE A;  3A8H B;  3LGL A;  1Q82 U;  2ZPH B;  2X35 A;  2OTJ T;  3ER0 A;  4MDW A;  5GAO q;  3PTA A;  5FRM A;  1V29 B;  2HD0 A;  4NS5 A;  4LD6 A;  1N9R A;  2LQK A;  3TU4 K;  3MEA A;  1KQ2 A;  1QP2 A;  3HFO A;  3CC4 A;  2E12 A;  4LDU A;  3DB4 A;  4Z02 A;  4XAX B;  3J80 E;  3I55 T;  3S3N A;  1BIA A;  1I4K 1;  4C8Q E;  4M77 B;  3S3O A;  2FVU A;  2HBP A;  4KUL A;  4HKE A;  3RUX A;  3MET A;  2LT1 A;  1H64 1;  1VQN A;  5CKH A;  4ZGE B;  2DTI A;  2L8D A;  2XDP A;  3GF5 A;  3VU3 C;  3ZFJ A;  1S72 T;  1NPR A;  4PNO A;  4GY5 A;  5LJ3 e;  3M55 A;  2RK2 A;  2Y4X A;  2PUK B;  4QQ6 A;  2R57 A;  3I56 T;  1VQK A;  1S72 A;  1M8V A;  2O01 E;  5KE2 A;  4JRI A;  3OYM A;  3G6E T;  1Y96 B;  4IUT A;  5GMK h;  1D3B B;  2D6F A;  4M7D D;  1BI0 A;  2MI6 A;  3HP9 A;  3CBP A;  4QVZ A;  3SWN C;  5FLX E;  3M59 A;  4UC4 A;  3OS0 A;  3QZ9 B;  2Y90 A;  2HQE A;  4F7U F;  1KD1 U;  2RB6 A;  4HCZ A;  2E6N A;  4E7H A;  3RKY A;  4IUU A;  4OGC A;  3NTK A;  2QXF A;  5FU6 C;  2DZC A;  1G3S A;  3P8B B;  5CK9 A;  4KT0 E;  1I5L A;  1QVF S;  1JB0 E;  3SFM A;  4JLG A;  2QI2 A;  3VYH B;  4D6W A;  3LLR A;  1VQ9 A;  5LJ3 j;  4IUV A;  4PJO E;  3OS5 A;  4CI0 C;  2HAX A;  4CRI A;  4C0G A;  3O8V A;  4BE0 A;  1X75 C;  4M77 E;  3SB2 A;  3T9N A;  3OYK A;  1NJI C;  2FHD A;  4JRP A;  2XKO C;  4OMF B;  1VQ7 A;  5CKE A;  4MZM A;  5D6Y A;  4J8O A;  5EG2 A;  3GOX A;  1N6A A;  3CMA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...