2BUFA

Arginine feed-back inhibitable acetylglutamate kinase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
292
Chain Sequence
TLSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRKRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLGLUTAMATE KINASE
publication title Structural Bases of Feed-Back Control of Arginine Biosynthesis, Revealed by the Structure of Two Hexameric N-Acetylglutamate Kinases, from Thermotoga Maritima and Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 88
structure length 292
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2005-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bufA00
2BUFA 3QVHA 2J0XA 3EK6A 2WE5A 2J4LA 3S6KA 2BTYA 3LKKA 2X2WA 3QUNA 4NDRB 3K4OA 4Q1TA 3D40A 4F6TB 4NDPA 4AB7A 2JJXA 2R98A 3ZZGA 2HMFA 3D2PA 4A7WA 3S6HA 4I49A 3C1NA 3NWYA 2JJ4A 3D2MA 2A1FA 2J5TA 2JI5A 2E9YA 3EK5A 2BMUA 3QURA 4AXSA 3QVFA 2AKOA 2IJ9A 4KZTA 1GS5A 4NDPB 3S6GA 2CDQA 3AAWA 2BNEA 3LL5A 3LL9A 2AP9A 2WE4A 2W21A 1OHBA 4NDQB 3K56A 4NDQA 3C1MA 4A7XA 3TVIA 3B8GA 3K52A 3L86A 2WXBA 2R8VA 3K4YA 3U6UA 3KZFA 3C20A 4NDOA 3L76A 4JZ9A 3D41A 4JZ8A 2J5VA 1GSJA 1B7BA 3ZZHA 2VA1A 3WWNA 2BNDA 3QUOA 2OGXB 3AB2A 3WWMA 4NDRA 2OGXA 3AB4A 1OHAA 4JZ7A 2BRIA 4NDOB 4F6TA 2BNFA 2V4YA 2J4JA 2J0WA 2V5HA 2J4KA 1Z9DA 4OLCA 3ZZFA 2RD5A 1E19A 1OH9A 3ZZIA 4USJA 2BRXA 1YBDA 3T7BA
chains in the Genus database with same CATH superfamily
2BUFA 3QVHA 2J0XA 3EK6A 2WE5A 2J4LA 3S6KA 2BTYA 3LKKA 2X2WA 3QUNA 4NDRB 3K4OA 4Q1TA 3D40A 4F6TB 4NDPA 4AB7A 2JJXA 2R98A 3ZZGA 2HMFA 3D2PA 4A7WA 3S6HA 4I49A 3C1NA 3NWYA 2JJ4A 3D2MA 2A1FA 2J5TA 2JI5A 2E9YA 3EK5A 2BMUA 3QURA 4AXSA 3QVFA 2AKOA 2IJ9A 4KZTA 1GS5A 4NDPB 3S6GA 2CDQA 3AAWA 2BNEA 3LL5A 3LL9A 2AP9A 2WE4A 2W21A 1OHBA 4NDQB 3K56A 4NDQA 3C1MA 4A7XA 3TVIA 3B8GA 3K52A 3L86A 2WXBA 2R8VA 3K4YA 3U6UA 3KZFA 3C20A 4NDOA 3L76A 4JZ9A 3D41A 4JZ8A 2J5VA 1GSJA 1B7BA 3ZZHA 2VA1A 3WWNA 2BNDA 3QUOA 2OGXB 3AB2A 3WWMA 4NDRA 2OGXA 3AB4A 1OHAA 4JZ7A 2BRIA 4NDOB 4F6TA 2BNFA 2V4YA 2J4JA 2J0WA 2V5HA 2J4KA 1Z9DA 4OLCA 3ZZFA 2RD5A 1E19A 1OH9A 3ZZIA 4USJA 2BRXA 1YBDA 3T7BA
chains in the Genus database with same CATH topology
2BUFA 3QVHA 2J0XA 3EK6A 2WE5A 2J4LA 3S6KA 2BTYA 3LKKA 2X2WA 3QUNA 4NDRB 3K4OA 4Q1TA 3D40A 4F6TB 4NDPA 4AB7A 2JJXA 2R98A 3ZZGA 2HMFA 3D2PA 4A7WA 3S6HA 4I49A 3C1NA 3NWYA 2JJ4A 3D2MA 2A1FA 2J5TA 2JI5A 2E9YA 3EK5A 2BMUA 3QURA 4AXSA 3QVFA 2AKOA 2IJ9A 4KZTA 1GS5A 4NDPB 3S6GA 2CDQA 3AAWA 2BNEA 3LL5A 3LL9A 2AP9A 2WE4A 2W21A 1OHBA 4NDQB 3K56A 4NDQA 3C1MA 4A7XA 3TVIA 3B8GA 3K52A 3L86A 2WXBA 2R8VA 3K4YA 3U6UA 3KZFA 3C20A 4NDOA 3L76A 4JZ9A 3D41A 4JZ8A 2J5VA 1GSJA 1B7BA 3ZZHA 2VA1A 3WWNA 2BNDA 3QUOA 2OGXB 3AB2A 3WWMA 4NDRA 2OGXA 3AB4A 1OHAA 4JZ7A 2BRIA 4NDOB 4F6TA 2BNFA 2V4YA 2J4JA 2J0WA 2V5HA 2J4KA 1Z9DA 4OLCA 3ZZFA 2RD5A 1E19A 1OH9A 3ZZIA 4USJA 2BRXA 1YBDA 3T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUF A;  3QVH A;  2J0X A;  3EK6 A;  2WE5 A;  2J4L A;  3S6K A;  2BTY A;  3LKK A;  2X2W A;  3QUN A;  4NDR B;  3K4O A;  4Q1T A;  3D40 A;  4F6T B;  4NDP A;  4AB7 A;  2JJX A;  2R98 A;  3ZZG A;  2HMF A;  3D2P A;  4A7W A;  3S6H A;  4I49 A;  3C1N A;  3NWY A;  2JJ4 A;  3D2M A;  2A1F A;  2J5T A;  2JI5 A;  2E9Y A;  3EK5 A;  2BMU A;  3QUR A;  4AXS A;  3QVF A;  2AKO A;  2IJ9 A;  4KZT A;  1GS5 A;  4NDP B;  3S6G A;  2CDQ A;  3AAW A;  2BNE A;  3LL5 A;  3LL9 A;  2AP9 A;  2WE4 A;  2W21 A;  1OHB A;  4NDQ B;  3K56 A;  4NDQ A;  3C1M A;  4A7X A;  3TVI A;  3B8G A;  3K52 A;  3L86 A;  2WXB A;  2R8V A;  3K4Y A;  3U6U A;  3KZF A;  3C20 A;  4NDO A;  3L76 A;  4JZ9 A;  3D41 A;  4JZ8 A;  2J5V A;  1GSJ A;  1B7B A;  3ZZH A;  2VA1 A;  3WWN A;  2BND A;  3QUO A;  2OGX B;  3AB2 A;  3WWM A;  4NDR A;  2OGX A;  3AB4 A;  1OHA A;  4JZ7 A;  2BRI A;  4NDO B;  4F6T A;  2BNF A;  2V4Y A;  2J4J A;  2J0W A;  2V5H A;  2J4K A;  1Z9D A;  4OLC A;  3ZZF A;  2RD5 A;  1E19 A;  1OH9 A;  3ZZI A;  4USJ A;  2BRX A;  1YBD A;  3T7B A; 
#chains in the Genus database with same CATH topology
 2BUF A;  3QVH A;  2J0X A;  3EK6 A;  2WE5 A;  2J4L A;  3S6K A;  2BTY A;  3LKK A;  2X2W A;  3QUN A;  4NDR B;  3K4O A;  4Q1T A;  3D40 A;  4F6T B;  4NDP A;  4AB7 A;  2JJX A;  2R98 A;  3ZZG A;  2HMF A;  3D2P A;  4A7W A;  3S6H A;  4I49 A;  3C1N A;  3NWY A;  2JJ4 A;  3D2M A;  2A1F A;  2J5T A;  2JI5 A;  2E9Y A;  3EK5 A;  2BMU A;  3QUR A;  4AXS A;  3QVF A;  2AKO A;  2IJ9 A;  4KZT A;  1GS5 A;  4NDP B;  3S6G A;  2CDQ A;  3AAW A;  2BNE A;  3LL5 A;  3LL9 A;  2AP9 A;  2WE4 A;  2W21 A;  1OHB A;  4NDQ B;  3K56 A;  4NDQ A;  3C1M A;  4A7X A;  3TVI A;  3B8G A;  3K52 A;  3L86 A;  2WXB A;  2R8V A;  3K4Y A;  3U6U A;  3KZF A;  3C20 A;  4NDO A;  3L76 A;  4JZ9 A;  3D41 A;  4JZ8 A;  2J5V A;  1GSJ A;  1B7B A;  3ZZH A;  2VA1 A;  3WWN A;  2BND A;  3QUO A;  2OGX B;  3AB2 A;  3WWM A;  4NDR A;  2OGX A;  3AB4 A;  1OHA A;  4JZ7 A;  2BRI A;  4NDO B;  4F6T A;  2BNF A;  2V4Y A;  2J4J A;  2J0W A;  2V5H A;  2J4K A;  1Z9D A;  4OLC A;  3ZZF A;  2RD5 A;  1E19 A;  1OH9 A;  3ZZI A;  4USJ A;  2BRX A;  1YBD A;  3T7B A; 
#chains in the Genus database with same CATH homology
 2BUF A;  3QVH A;  2J0X A;  3EK6 A;  2WE5 A;  2J4L A;  3S6K A;  2BTY A;  3LKK A;  2X2W A;  3QUN A;  4NDR B;  3K4O A;  4Q1T A;  3D40 A;  4F6T B;  4NDP A;  4AB7 A;  2JJX A;  2R98 A;  3ZZG A;  2HMF A;  3D2P A;  4A7W A;  3S6H A;  4I49 A;  3C1N A;  3NWY A;  2JJ4 A;  3D2M A;  2A1F A;  2J5T A;  2JI5 A;  2E9Y A;  3EK5 A;  2BMU A;  3QUR A;  4AXS A;  3QVF A;  2AKO A;  2IJ9 A;  4KZT A;  1GS5 A;  4NDP B;  3S6G A;  2CDQ A;  3AAW A;  2BNE A;  3LL5 A;  3LL9 A;  2AP9 A;  2WE4 A;  2W21 A;  1OHB A;  4NDQ B;  3K56 A;  4NDQ A;  3C1M A;  4A7X A;  3TVI A;  3B8G A;  3K52 A;  3L86 A;  2WXB A;  2R8V A;  3K4Y A;  3U6U A;  3KZF A;  3C20 A;  4NDO A;  3L76 A;  4JZ9 A;  3D41 A;  4JZ8 A;  2J5V A;  1GSJ A;  1B7B A;  3ZZH A;  2VA1 A;  3WWN A;  2BND A;  3QUO A;  2OGX B;  3AB2 A;  3WWM A;  4NDR A;  2OGX A;  3AB4 A;  1OHA A;  4JZ7 A;  2BRI A;  4NDO B;  4F6T A;  2BNF A;  2V4Y A;  2J4J A;  2J0W A;  2V5H A;  2J4K A;  1Z9D A;  4OLC A;  3ZZF A;  2RD5 A;  1E19 A;  1OH9 A;  3ZZI A;  4USJ A;  2BRX A;  1YBD A;  3T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...