2BUFA

Arginine feed-back inhibitable acetylglutamate kinase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
292
Chain Sequence
TLSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRKRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Bases of Feed-Back Control of Arginine Biosynthesis, Revealed by the Structure of Two Hexameric N-Acetylglutamate Kinases, from Thermotoga Maritima and Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords ACETYLGLUTAMATE KINASE
total genus 88
structure length 292
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2005-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bufA00
3C1NA 2V4YA 2R98A 1OH9A 4NDOB 3QUNA 2W21A 1GSJA 2E9YA 4NDOA 3NWYA 2V5HA 1Z9DA 3D2PA 3C1MA 2OGXA 3TVIA 2J4JA 3EK6A 4F6TB 1B7BA 4NDQB 3LKKA 3AB2A 3QUOA 3EK5A 3L76A 4KZTA 1E19A 3WWNA 3S6GA 4I49A 2VA1A 2BRIA 2RD5A 2AKOA 2JJXA 4NDRB 1OHAA 3S6KA 2J0XA 2BTYA 3AAWA 3K56A 4NDPA 3ZZIA 4AXSA 4JZ7A 2BNEA 4A7WA 2HMFA 4NDPB 2BRXA 3K52A 3LL5A 3AB4A 3D2MA 3D41A 4Q1TA 2X2WA 4OLCA 2AP9A 2CDQA 1OHBA 4F6TA 3QURA 3QVFA 1GS5A 4AB7A 3QVHA 4USJA 2OGXB 3K4YA 2WE5A 3KZFA 2J5TA 2JI5A 4A7XA 2BNFA 2A1FA 4NDQA 2WXBA 3C20A 3LL9A 2BUFA 2IJ9A 3ZZGA 2J4LA 3K4OA 2WE4A 3D40A 3S6HA 2JJ4A 2J0WA 4JZ8A 3ZZHA 3L86A 2R8VA 2BNDA 4NDRA 4JZ9A 2J4KA 3U6UA 3WWMA 3ZZFA 1YBDA 2BMUA 2J5VA 3B8GA 3T7BA
chains in the Genus database with same CATH superfamily
3C1NA 2V4YA 2R98A 1OH9A 4NDOB 3QUNA 2W21A 1GSJA 2E9YA 4NDOA 3NWYA 2V5HA 1Z9DA 3D2PA 3C1MA 2OGXA 3TVIA 2J4JA 3EK6A 4F6TB 1B7BA 4NDQB 3LKKA 3AB2A 3QUOA 3EK5A 3L76A 4KZTA 1E19A 3WWNA 3S6GA 4I49A 2VA1A 2BRIA 2RD5A 2AKOA 2JJXA 4NDRB 1OHAA 3S6KA 2J0XA 2BTYA 3AAWA 3K56A 4NDPA 3ZZIA 4AXSA 4JZ7A 2BNEA 4A7WA 2HMFA 4NDPB 2BRXA 3K52A 3LL5A 3AB4A 3D2MA 3D41A 4Q1TA 2X2WA 4OLCA 2AP9A 2CDQA 1OHBA 4F6TA 3QURA 3QVFA 1GS5A 4AB7A 3QVHA 4USJA 2OGXB 3K4YA 2WE5A 3KZFA 2J5TA 2JI5A 4A7XA 2BNFA 2A1FA 4NDQA 2WXBA 3C20A 3LL9A 2BUFA 2IJ9A 3ZZGA 2J4LA 3K4OA 2WE4A 3D40A 3S6HA 2JJ4A 2J0WA 4JZ8A 3ZZHA 3L86A 2R8VA 2BNDA 4NDRA 4JZ9A 2J4KA 3U6UA 3WWMA 3ZZFA 1YBDA 2BMUA 2J5VA 3B8GA 3T7BA
chains in the Genus database with same CATH topology
3C1NA 2V4YA 2R98A 1OH9A 4NDOB 3QUNA 2W21A 1GSJA 2E9YA 4NDOA 3NWYA 2V5HA 1Z9DA 3D2PA 3C1MA 2OGXA 3TVIA 2J4JA 3EK6A 4F6TB 1B7BA 4NDQB 3LKKA 3AB2A 3QUOA 3EK5A 3L76A 4KZTA 1E19A 3WWNA 3S6GA 4I49A 2VA1A 2BRIA 2RD5A 2AKOA 2JJXA 4NDRB 1OHAA 3S6KA 2J0XA 2BTYA 3AAWA 3K56A 4NDPA 3ZZIA 4AXSA 4JZ7A 2BNEA 4A7WA 2HMFA 4NDPB 2BRXA 3K52A 3LL5A 3AB4A 3D2MA 3D41A 4Q1TA 2X2WA 4OLCA 2AP9A 2CDQA 1OHBA 4F6TA 3QURA 3QVFA 1GS5A 4AB7A 3QVHA 4USJA 2OGXB 3K4YA 2WE5A 3KZFA 2J5TA 2JI5A 4A7XA 2BNFA 2A1FA 4NDQA 2WXBA 3C20A 3LL9A 2BUFA 2IJ9A 3ZZGA 2J4LA 3K4OA 2WE4A 3D40A 3S6HA 2JJ4A 2J0WA 4JZ8A 3ZZHA 3L86A 2R8VA 2BNDA 4NDRA 4JZ9A 2J4KA 3U6UA 3WWMA 3ZZFA 1YBDA 2BMUA 2J5VA 3B8GA 3T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1N A;  2V4Y A;  2R98 A;  1OH9 A;  4NDO B;  3QUN A;  2W21 A;  1GSJ A;  2E9Y A;  4NDO A;  3NWY A;  2V5H A;  1Z9D A;  3D2P A;  3C1M A;  2OGX A;  3TVI A;  2J4J A;  3EK6 A;  4F6T B;  1B7B A;  4NDQ B;  3LKK A;  3AB2 A;  3QUO A;  3EK5 A;  3L76 A;  4KZT A;  1E19 A;  3WWN A;  3S6G A;  4I49 A;  2VA1 A;  2BRI A;  2RD5 A;  2AKO A;  2JJX A;  4NDR B;  1OHA A;  3S6K A;  2J0X A;  2BTY A;  3AAW A;  3K56 A;  4NDP A;  3ZZI A;  4AXS A;  4JZ7 A;  2BNE A;  4A7W A;  2HMF A;  4NDP B;  2BRX A;  3K52 A;  3LL5 A;  3AB4 A;  3D2M A;  3D41 A;  4Q1T A;  2X2W A;  4OLC A;  2AP9 A;  2CDQ A;  1OHB A;  4F6T A;  3QUR A;  3QVF A;  1GS5 A;  4AB7 A;  3QVH A;  4USJ A;  2OGX B;  3K4Y A;  2WE5 A;  3KZF A;  2J5T A;  2JI5 A;  4A7X A;  2BNF A;  2A1F A;  4NDQ A;  2WXB A;  3C20 A;  3LL9 A;  2BUF A;  2IJ9 A;  3ZZG A;  2J4L A;  3K4O A;  2WE4 A;  3D40 A;  3S6H A;  2JJ4 A;  2J0W A;  4JZ8 A;  3ZZH A;  3L86 A;  2R8V A;  2BND A;  4NDR A;  4JZ9 A;  2J4K A;  3U6U A;  3WWM A;  3ZZF A;  1YBD A;  2BMU A;  2J5V A;  3B8G A;  3T7B A; 
#chains in the Genus database with same CATH topology
 3C1N A;  2V4Y A;  2R98 A;  1OH9 A;  4NDO B;  3QUN A;  2W21 A;  1GSJ A;  2E9Y A;  4NDO A;  3NWY A;  2V5H A;  1Z9D A;  3D2P A;  3C1M A;  2OGX A;  3TVI A;  2J4J A;  3EK6 A;  4F6T B;  1B7B A;  4NDQ B;  3LKK A;  3AB2 A;  3QUO A;  3EK5 A;  3L76 A;  4KZT A;  1E19 A;  3WWN A;  3S6G A;  4I49 A;  2VA1 A;  2BRI A;  2RD5 A;  2AKO A;  2JJX A;  4NDR B;  1OHA A;  3S6K A;  2J0X A;  2BTY A;  3AAW A;  3K56 A;  4NDP A;  3ZZI A;  4AXS A;  4JZ7 A;  2BNE A;  4A7W A;  2HMF A;  4NDP B;  2BRX A;  3K52 A;  3LL5 A;  3AB4 A;  3D2M A;  3D41 A;  4Q1T A;  2X2W A;  4OLC A;  2AP9 A;  2CDQ A;  1OHB A;  4F6T A;  3QUR A;  3QVF A;  1GS5 A;  4AB7 A;  3QVH A;  4USJ A;  2OGX B;  3K4Y A;  2WE5 A;  3KZF A;  2J5T A;  2JI5 A;  4A7X A;  2BNF A;  2A1F A;  4NDQ A;  2WXB A;  3C20 A;  3LL9 A;  2BUF A;  2IJ9 A;  3ZZG A;  2J4L A;  3K4O A;  2WE4 A;  3D40 A;  3S6H A;  2JJ4 A;  2J0W A;  4JZ8 A;  3ZZH A;  3L86 A;  2R8V A;  2BND A;  4NDR A;  4JZ9 A;  2J4K A;  3U6U A;  3WWM A;  3ZZF A;  1YBD A;  2BMU A;  2J5V A;  3B8G A;  3T7B A; 
#chains in the Genus database with same CATH homology
 3C1N A;  2V4Y A;  2R98 A;  1OH9 A;  4NDO B;  3QUN A;  2W21 A;  1GSJ A;  2E9Y A;  4NDO A;  3NWY A;  2V5H A;  1Z9D A;  3D2P A;  3C1M A;  2OGX A;  3TVI A;  2J4J A;  3EK6 A;  4F6T B;  1B7B A;  4NDQ B;  3LKK A;  3AB2 A;  3QUO A;  3EK5 A;  3L76 A;  4KZT A;  1E19 A;  3WWN A;  3S6G A;  4I49 A;  2VA1 A;  2BRI A;  2RD5 A;  2AKO A;  2JJX A;  4NDR B;  1OHA A;  3S6K A;  2J0X A;  2BTY A;  3AAW A;  3K56 A;  4NDP A;  3ZZI A;  4AXS A;  4JZ7 A;  2BNE A;  4A7W A;  2HMF A;  4NDP B;  2BRX A;  3K52 A;  3LL5 A;  3AB4 A;  3D2M A;  3D41 A;  4Q1T A;  2X2W A;  4OLC A;  2AP9 A;  2CDQ A;  1OHB A;  4F6T A;  3QUR A;  3QVF A;  1GS5 A;  4AB7 A;  3QVH A;  4USJ A;  2OGX B;  3K4Y A;  2WE5 A;  3KZF A;  2J5T A;  2JI5 A;  4A7X A;  2BNF A;  2A1F A;  4NDQ A;  2WXB A;  3C20 A;  3LL9 A;  2BUF A;  2IJ9 A;  3ZZG A;  2J4L A;  3K4O A;  2WE4 A;  3D40 A;  3S6H A;  2JJ4 A;  2J0W A;  4JZ8 A;  3ZZH A;  3L86 A;  2R8V A;  2BND A;  4NDR A;  4JZ9 A;  2J4K A;  3U6U A;  3WWM A;  3ZZF A;  1YBD A;  2BMU A;  2J5V A;  3B8G A;  3T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...