2BUFA

Arginine feed-back inhibitable acetylglutamate kinase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
292
Chain Sequence
TLSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRKRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Bases of Feed-Back Control of Arginine Biosynthesis, Revealed by the Structure of Two Hexameric N-Acetylglutamate Kinases, from Thermotoga Maritima and Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords ACETYLGLUTAMATE KINASE
total genus 88
structure length 292
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2005-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bufA00
3ZZGA 4NDRA 4Q1TA 3WWMA 2BMUA 1OHBA 3K4OA 2J0XA 3U6UA 1Z9DA 3S6KA 2BUFA 4NDQA 2R98A 4F6TB 3B8GA 1OH9A 4F6TA 2JI5A 4A7WA 2BNFA 2BRXA 2IJ9A 4USJA 3K52A 2RD5A 4NDQB 2R8VA 4AB7A 2J5TA 2OGXB 3C1NA 2CDQA 3S6GA 4OLCA 2BNEA 2BNDA 3AB4A 3LKKA 4A7XA 2J0WA 1YBDA 2W21A 3AB2A 3L76A 1GSJA 1B7BA 1GS5A 2J5VA 2VA1A 4NDOB 3TVIA 3AAWA 4JZ7A 3LL5A 3K56A 3C1MA 2X2WA 2WE4A 3ZZIA 3D41A 4NDPA 3QVHA 3L86A 3QUNA 3QVFA 3C20A 2V4YA 3D2PA 3ZZHA 4AXSA 3EK6A 2E9YA 1E19A 2AKOA 3EK5A 2HMFA 4JZ9A 2BRIA 2JJ4A 2J4KA 2WXBA 3D40A 3QUOA 2AP9A 2BTYA 2OGXA 3NWYA 3D2MA 4I49A 2V5HA 2A1FA 4KZTA 4NDOA 3QURA 2J4JA 3T7BA 2J4LA 3LL9A 4NDRB 3KZFA 4NDPB 3WWNA 3K4YA 1OHAA 2WE5A 4JZ8A 3S6HA 2JJXA 3ZZFA
chains in the Genus database with same CATH superfamily
3ZZGA 4NDRA 4Q1TA 3WWMA 2BMUA 1OHBA 3K4OA 2J0XA 3U6UA 1Z9DA 3S6KA 2BUFA 4NDQA 2R98A 4F6TB 3B8GA 1OH9A 4F6TA 2JI5A 4A7WA 2BNFA 2BRXA 2IJ9A 4USJA 3K52A 2RD5A 4NDQB 2R8VA 4AB7A 2J5TA 2OGXB 3C1NA 2CDQA 3S6GA 4OLCA 2BNEA 2BNDA 3AB4A 3LKKA 4A7XA 2J0WA 1YBDA 2W21A 3AB2A 3L76A 1GSJA 1B7BA 1GS5A 2J5VA 2VA1A 4NDOB 3TVIA 3AAWA 4JZ7A 3LL5A 3K56A 3C1MA 2X2WA 2WE4A 3ZZIA 3D41A 4NDPA 3QVHA 3L86A 3QUNA 3QVFA 3C20A 2V4YA 3D2PA 3ZZHA 4AXSA 3EK6A 2E9YA 1E19A 2AKOA 3EK5A 2HMFA 4JZ9A 2BRIA 2JJ4A 2J4KA 2WXBA 3D40A 3QUOA 2AP9A 2BTYA 2OGXA 3NWYA 3D2MA 4I49A 2V5HA 2A1FA 4KZTA 4NDOA 3QURA 2J4JA 3T7BA 2J4LA 3LL9A 4NDRB 3KZFA 4NDPB 3WWNA 3K4YA 1OHAA 2WE5A 4JZ8A 3S6HA 2JJXA 3ZZFA
chains in the Genus database with same CATH topology
3ZZGA 4NDRA 4Q1TA 3WWMA 2BMUA 1OHBA 3K4OA 2J0XA 3U6UA 1Z9DA 3S6KA 2BUFA 4NDQA 2R98A 4F6TB 3B8GA 1OH9A 4F6TA 2JI5A 4A7WA 2BNFA 2BRXA 2IJ9A 4USJA 3K52A 2RD5A 4NDQB 2R8VA 4AB7A 2J5TA 2OGXB 3C1NA 2CDQA 3S6GA 4OLCA 2BNEA 2BNDA 3AB4A 3LKKA 4A7XA 2J0WA 1YBDA 2W21A 3AB2A 3L76A 1GSJA 1B7BA 1GS5A 2J5VA 2VA1A 4NDOB 3TVIA 3AAWA 4JZ7A 3LL5A 3K56A 3C1MA 2X2WA 2WE4A 3ZZIA 3D41A 4NDPA 3QVHA 3L86A 3QUNA 3QVFA 3C20A 2V4YA 3D2PA 3ZZHA 4AXSA 3EK6A 2E9YA 1E19A 2AKOA 3EK5A 2HMFA 4JZ9A 2BRIA 2JJ4A 2J4KA 2WXBA 3D40A 3QUOA 2AP9A 2BTYA 2OGXA 3NWYA 3D2MA 4I49A 2V5HA 2A1FA 4KZTA 4NDOA 3QURA 2J4JA 3T7BA 2J4LA 3LL9A 4NDRB 3KZFA 4NDPB 3WWNA 3K4YA 1OHAA 2WE5A 4JZ8A 3S6HA 2JJXA 3ZZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZG A;  4NDR A;  4Q1T A;  3WWM A;  2BMU A;  1OHB A;  3K4O A;  2J0X A;  3U6U A;  1Z9D A;  3S6K A;  2BUF A;  4NDQ A;  2R98 A;  4F6T B;  3B8G A;  1OH9 A;  4F6T A;  2JI5 A;  4A7W A;  2BNF A;  2BRX A;  2IJ9 A;  4USJ A;  3K52 A;  2RD5 A;  4NDQ B;  2R8V A;  4AB7 A;  2J5T A;  2OGX B;  3C1N A;  2CDQ A;  3S6G A;  4OLC A;  2BNE A;  2BND A;  3AB4 A;  3LKK A;  4A7X A;  2J0W A;  1YBD A;  2W21 A;  3AB2 A;  3L76 A;  1GSJ A;  1B7B A;  1GS5 A;  2J5V A;  2VA1 A;  4NDO B;  3TVI A;  3AAW A;  4JZ7 A;  3LL5 A;  3K56 A;  3C1M A;  2X2W A;  2WE4 A;  3ZZI A;  3D41 A;  4NDP A;  3QVH A;  3L86 A;  3QUN A;  3QVF A;  3C20 A;  2V4Y A;  3D2P A;  3ZZH A;  4AXS A;  3EK6 A;  2E9Y A;  1E19 A;  2AKO A;  3EK5 A;  2HMF A;  4JZ9 A;  2BRI A;  2JJ4 A;  2J4K A;  2WXB A;  3D40 A;  3QUO A;  2AP9 A;  2BTY A;  2OGX A;  3NWY A;  3D2M A;  4I49 A;  2V5H A;  2A1F A;  4KZT A;  4NDO A;  3QUR A;  2J4J A;  3T7B A;  2J4L A;  3LL9 A;  4NDR B;  3KZF A;  4NDP B;  3WWN A;  3K4Y A;  1OHA A;  2WE5 A;  4JZ8 A;  3S6H A;  2JJX A;  3ZZF A; 
#chains in the Genus database with same CATH topology
 3ZZG A;  4NDR A;  4Q1T A;  3WWM A;  2BMU A;  1OHB A;  3K4O A;  2J0X A;  3U6U A;  1Z9D A;  3S6K A;  2BUF A;  4NDQ A;  2R98 A;  4F6T B;  3B8G A;  1OH9 A;  4F6T A;  2JI5 A;  4A7W A;  2BNF A;  2BRX A;  2IJ9 A;  4USJ A;  3K52 A;  2RD5 A;  4NDQ B;  2R8V A;  4AB7 A;  2J5T A;  2OGX B;  3C1N A;  2CDQ A;  3S6G A;  4OLC A;  2BNE A;  2BND A;  3AB4 A;  3LKK A;  4A7X A;  2J0W A;  1YBD A;  2W21 A;  3AB2 A;  3L76 A;  1GSJ A;  1B7B A;  1GS5 A;  2J5V A;  2VA1 A;  4NDO B;  3TVI A;  3AAW A;  4JZ7 A;  3LL5 A;  3K56 A;  3C1M A;  2X2W A;  2WE4 A;  3ZZI A;  3D41 A;  4NDP A;  3QVH A;  3L86 A;  3QUN A;  3QVF A;  3C20 A;  2V4Y A;  3D2P A;  3ZZH A;  4AXS A;  3EK6 A;  2E9Y A;  1E19 A;  2AKO A;  3EK5 A;  2HMF A;  4JZ9 A;  2BRI A;  2JJ4 A;  2J4K A;  2WXB A;  3D40 A;  3QUO A;  2AP9 A;  2BTY A;  2OGX A;  3NWY A;  3D2M A;  4I49 A;  2V5H A;  2A1F A;  4KZT A;  4NDO A;  3QUR A;  2J4J A;  3T7B A;  2J4L A;  3LL9 A;  4NDR B;  3KZF A;  4NDP B;  3WWN A;  3K4Y A;  1OHA A;  2WE5 A;  4JZ8 A;  3S6H A;  2JJX A;  3ZZF A; 
#chains in the Genus database with same CATH homology
 3ZZG A;  4NDR A;  4Q1T A;  3WWM A;  2BMU A;  1OHB A;  3K4O A;  2J0X A;  3U6U A;  1Z9D A;  3S6K A;  2BUF A;  4NDQ A;  2R98 A;  4F6T B;  3B8G A;  1OH9 A;  4F6T A;  2JI5 A;  4A7W A;  2BNF A;  2BRX A;  2IJ9 A;  4USJ A;  3K52 A;  2RD5 A;  4NDQ B;  2R8V A;  4AB7 A;  2J5T A;  2OGX B;  3C1N A;  2CDQ A;  3S6G A;  4OLC A;  2BNE A;  2BND A;  3AB4 A;  3LKK A;  4A7X A;  2J0W A;  1YBD A;  2W21 A;  3AB2 A;  3L76 A;  1GSJ A;  1B7B A;  1GS5 A;  2J5V A;  2VA1 A;  4NDO B;  3TVI A;  3AAW A;  4JZ7 A;  3LL5 A;  3K56 A;  3C1M A;  2X2W A;  2WE4 A;  3ZZI A;  3D41 A;  4NDP A;  3QVH A;  3L86 A;  3QUN A;  3QVF A;  3C20 A;  2V4Y A;  3D2P A;  3ZZH A;  4AXS A;  3EK6 A;  2E9Y A;  1E19 A;  2AKO A;  3EK5 A;  2HMF A;  4JZ9 A;  2BRI A;  2JJ4 A;  2J4K A;  2WXB A;  3D40 A;  3QUO A;  2AP9 A;  2BTY A;  2OGX A;  3NWY A;  3D2M A;  4I49 A;  2V5H A;  2A1F A;  4KZT A;  4NDO A;  3QUR A;  2J4J A;  3T7B A;  2J4L A;  3LL9 A;  4NDR B;  3KZF A;  4NDP B;  3WWN A;  3K4Y A;  1OHA A;  2WE5 A;  4JZ8 A;  3S6H A;  2JJX A;  3ZZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...