2BV4A

1.0a structure of chromobacterium violaceum lectin in complex with alpha-methyl-mannoside
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
b'AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSGNVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN CV-IIL
molecule tags Lectin
source organism Chromobacterium violaceum
publication title Unusual Entropy Driven Affinity of Chromobacterium Violaceum Lectin Cv-Iil Towards Fucose and Mannose
pubmed doi rcsb
total genus 25
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bv4A00
5A6XA 4UT5A 1OUXA 2JDUA 1UZVA 1W8HA 5D2AA 5A70A 2BV4A 4AOCA 5HCHA 2XR4A 5A3OA 1OVSA 1OUSA 1OXCA 5A6QA 2JDPA 2JDYA 2VUDA 2BOJA 1W8FA 2JDHA 2BOIA 2JDMA 3ZDVA 4CE8A 1OVPA 2JDNA 2JDKA 1UQXA 1GZTA 2WRAA 3DCQA 5A6YA 2BP6A 2VUCA 2WR9A 2CHHA 2VNVA 5A6ZA 1OURA
chains in the Genus database with same CATH superfamily
1FV2A 5JUVA 3RI9A 3OD0A 2W94A 3BVCA 1UZVA 2J1VA 2R1BA 4I09A 1IPJA 1NCQA 1O8SA 4YGEA 1AR62 4AZZA 5FP4A 3UL2A 5CIRA 4RHV3 4LE4A 2P37A 2DU1A 4ASMB 3HBZA 3HQXA 1NLSA 1PGW2 4NHKA 5IVCA 2E53A 1FNYA 1O4TA 2YHJA 3NL1A 3TEZA 4XHBA 1ULEA 2F17A 2NPIA 5LEJA 1H6XA 4QM8A 3I2HA 4BDVB 3I2FA 5J7MA 1R091 4M01A 3ZSLA 2FQPA 1VBE3 2VULA 4LO8A 5FMOS 4Q4V1 4A4AA 1JTZX 2HEYF 2WNUC 4CCCA 2XL9A 3OBZA 3MV11 4Y20A 1GNZA 2XGXA 1HRV1 5DXDA 5APAA 1IQAA 1S0BA 2QQVA 2BNMA 3BGAA 5DDJ1 4NN0A 2JG9C 1RUC1 3SQOA 2A75A 4DIQA 3N4MA 4K1YA 5JMOA 1WCUA 4CP2A 2VW0A 2G1MA 2QFEA 1OVSA 1DQ6A 4YVWB 4ITCA 2EXIA 2J1TA 2WZEA 3T2OA 3U1XA 3DKQA 5GLVA 1ZBA3 4JGZC 4XVHA 3CO2A 4HPKA 3ZYPA 5T50A 1H8TC 2HWC3 1AX1A 3SEEA 2G9FA 1RB8G 3EQEA 5KHKA 1PK6B 1QXRA 4JCKA 4OFGA 3DPRA 1RXGA 2E51A 1XNTA 3AVSA 3HNMA 3VKLA 3POYA 1A6CA 1X9TA 2DUOA 1ZA4A 3IDCB 1XU2A 3FBYA 4FPGA 2YPDA 3IN9A 3KSCA 1J83A 3G6JB 4D69A 4DMIA 3AP7A 2A6YA 5FOJB 1RHI1 3BTZA 4EN9B 3PIGA 4BK5A 3MDPA 3K75B 4QU1A 3JB4C 3ZO0B 4GB31 2PAMA 3NW4A 2YB7A 2QQUA 4GB32 3R6SA 1HIXA 1S0CA 3ACHA 1UKRA 4IEUA 4LK6A 3ZXEA 5A7OA 2VZTA 5A3LA 2WFF2 3N9LA 2YGMA 3LDBA 4EN7B 3NAPB 4HK9A 3R0RA 2LW8A 3DXTA 3T09A 4QXKA 1MVEA 2D6PA 4UF0B 1CR7A 1JW6A 1QJU1 3HR9A 4QMAA 2VCMA 4WZCA 3DL3A 2XWJB 3A0NA 3AK0A 4DXZA 3OEAA 5A3UA 2C0ZA 3K3NA 2HYXA 2N7GA 3UGFA 2CYFA 5KXBA 5GZCA 1OA4A 2TEPA 1PM7A 4A3XA 4OQ9A 2JENA 1OMIA 5HCBA 5GJ6A 2GSYA 4XTPA 4Q4Y3 4FFFA 4PHZA 2BP6A 1UZ0A 2WR9A 1UX7A 1LOAA 1TVGA 3RJRA 3D6EA 4LULA 4IV1A 1OPMA 1W8TA 1YQ5A 4PJYA 4H14A 1W3VA 5C6CA 5ANNA 3UETA 1K5MB 3GXUA 4NAOA 3VBSC 4FP3A 3JD72 5L36A 3LDRA 3LQCA 3S5QA 5BNPC 5GZFA 2PYTA 2WS92 2DUPA 4QPIB 5LA0A 1R1A1 3FHAA 2VBBA 4G4FA 3T2QA 1MQTA 4FPCA 4UBHA 2D6KA 4BCUA 1R082 4QGNA 1QH6A 1YWKA 4QX2A 4QX7A 4P02B 1IHMA 2ZGUA 5FQ0B 1XSRA 5EPAA 1ND2B 3WP3A 1EUTA 2CGNA 2TBVA 3MW3A 4PDWB 3D3AA 1CN1A 5KBFA 1AXKA 3KD4A 4HANA 2RS53 5FMDA 2DBNA 1JYWA 1JZ6A 4FFHA 1UNBA 2BTVC 4IV1B 4C90A 5CFDA 3N9OA 1N3OA 1LEDA 5LATA 2R1DA 3IMNA 2VMEA 4YW1A 1IS5A 4A6OA 1WA6X 1X36A 5FPBA 2RM23 1VB4A 2O1QA 3GDBA 5A6QA 3I49A 3M7AA 4M4RA 2CAVA 2R0HA 3Q8FA 2IXCA 4UW6A 5CU1A 3TRSB 2EXHA 3K51A 4BJ0A 4RR3A 1QH7A 2VAUA 1OOPC 2R043 1T6GC 3W59A 3ZOIA 4CPBD 4I3PA 4B8EA 4QDSA 2IXJA 3IWZA 2P2KA 1LU1A 3HT2A 2PMWB 1YJKA 4XHXA 4FPFA 4OCTA 2P1BA 3LZZA 3NNLA 5JIAA 4N53B 4C0BA 1AJKA 5ANQA 1CESA 2VMCA 3GYDA 3I3BA 1BVVA 5D21A 1RUD1 2WT2A 1JYIA 1CAUB 1V6IA 2Z2SB 3PUAA 4N7IA 2FD8A 4ES9A 2BV4A 1OFNA 3M4FA 3FFQA 1OOPB 2QQPA 5FYBA 3OYWB 5DUVA 3VBUC 5DAXA 4XAEA 1N3QA 1QIQA 4CDQA 4AAXA 4O9GA 4A7ZA 1C4RA 5AFEA 1C8M3 3U11A 1MS8A 2KD7A 4UOJA 4ZONA 2Q1FA 1ODMA 3OY8A 2B42B 3K48A 5L9RA 2ZKNA 1ALYA 2YU2A 4AE2A 2PQSA 2XUMA 5CFCA 2JG9B 1JOJA 2QQLA 1NT0A 2VOXA 2XONA 3LEMA 2RDNA 4FPEA 2HYKA 1APNA 2Q4SA 1AR83 3ZLIA 1JZ4A 2CGOA 4K6BA 2QQOA 3TEXA 2YROA 1Q56A 4HN0A 1Y7BA 2V5YA 5FYTA 2IZWA 1ZZBA 2W47A 1NLQA 1TMF1 2ET7A 4QPWA 2XR4A 4XCAA 3ZXGA 1P8JA 2V4VA 2VJXA 5FZEA 4AG4A 4PLNA 4Y1XA 5FREA 3P5BA 2XLGA 4Q2FA 2ZGOA 4I30A 2HJIA 3JCIA 2ATFA 1MQTC 1KS5A 2DUQA 3CBNA 1PK6C 2ZEXA 3ES1A 2E31A 1LTEA 3JB8A 2D5FA 4NRQA 2BFUS 2WT0A 5T5OA 4CCEA 1BXHA 3I4IA 2ZGTA 3K46A 4QHOA 4BZ4A 2HWF2 1JYVA 1C57A 3ZN4A 1NLRA 1GKBA 2X10A 1SEFA 3WQBA 2ZHLA 2QNKA 1EP0A 1YI9A 3H1MA 4OLLA 3VBUA 4PQ9A 3IM0A 4XPVA 1DQ5A 1QQP2 3DKWA 3AX4A 2JDYA 3MIBA 4YM0A 5HXMA 4LBJA 1Z78A 3AKSA 3UKNA 3B9IA 4NO4A 3EJKA 1GP4A 3MLKA 5FPAA 1NXMA 1XE7A 1Q8VA 2H0VA 2WYFA 2X53S 5FZ1A 1D2QA 2WQ4A 2ZMNA 1UOGA 4KWUA 1GQPA 4N8MA 2EALA 2OS2A 1GP6A 2ZGKA 1NXD1 5BNNB 2AUYA 4AVTA 2JD9A 1XPWA 3O14A 4KG8A 1H4HA 2AYHA 3IMMA 3N7LA 3H8UA 4Y20B 5D2AA 2CU5A 5H9SA 2BEOA 4COZA 1HQNA 3KWVA 1GZCA 1TZOA 3UV9A 4BOWA 4KWKA 2Y6HA 1R1A3 2ZGMA 4EWDA 1H9PA 1Z0HA 4BHPA 1XE8A 2RMU2 4QB6A 1EYBA 1PO12 2PHLA 3AP9A 3PL0A 1MACA 3NO8A 1FX5A 3ACLA 5HPOA 5FLJA 3FLRA 3B69A 5JZGA 1C5IA 5FO8B 2YXSA 4BLIA 1CPNA 1OBNA 1YI7A 4CEYA 4EJRA 1OQEA 3IIAA 1GOHA 5A70A 5A7SA 2Y38A 3PMSA 2Y26A 4UXAA 1FMD2 4FTEA 1QXJA 1LOCA 4K7JA 3RSJA 4MO3M 2Y33A 2XL7A 1UN1A 1KXGA 2CSGA 1ZBA1 1D0GA 3USSA 4CZSA 1W2OA 5FBZA 1ONAA 4LA3A 4XDOA 3UK9A 4DEVA 1RUI3 1V00A 1UD1A 4LIVA 1AX0A 2WAAA 3ITQA 5SV8A 3K4AA 1S2KA 4E27A 1BK0A 2EAAA 1HQLA 2JB4A 4UW5A 1LGNA 3MFCA 2B39A 4AQ6A 1PO11 2VTXA 4BXFA 3PUQA 1M4WA 1NA1B 2QDNA 4RS5A 3GF6A 5CKQA 3HVDA 1W9TA 3I2OA 4S2GA 1ZA7A 2OQ7A 5FMOL 3RZZA 1TQ5A 1KRIA 2DTYA 2QE3A 3J26N 4OMCA 1O5UA 3CDZB 3VBRC 3ST7A 3CMGA 3O7OA 3KQ4B 3UESA 2VW1A 2XDVA 4BQ5A 1S55A 5BYNA 1ZREA 4RD7A 5J1XA 4CUAA 5A7PA 2FDIA 1NQJA 3NAPA 5IWFA 1AX2A 2W52A 2VZ1A 3GCWA 5FJKA 3USUB 1SDWA 3EXUA 3FL7A 5AVPA 3ZFFB 2ZABA 4C0HA 3SC7X 4KI5M 1POV0 1COV2 2WN3A 2ZZQA 5GLWA 5LB6A 4BK4A 1QDOA 1JN2P 1PO22 3S7IA 5DN2A 2EXKA 5FZBA 3BALA 4AQTA 4DUXA 1N1TA 3VDDB 3V0AA 5IK8A 1CIWA 1VIWB 2W1WA 4U36A 1RUG3 1W2UA 1HRI1 3VZMA 3PVEA 3KGZA 2QQMA 2VZ3A 2X8KA 1X7NA 4P9JA 1ENRA 2PHDA 4A42A 3MICA 5C70A 1PVC2 2GC0A 3B3QE 3LA7A 3N9QA 1UY4A 2BYVE 4LKSA 2AH2A 1D4M3 2FBEA 4XJZA 1SQ4A 2TNFA 4Y33A 4JDNA 4Y4YA 4XF1A 1H0BA 5CKMA 2HWE3 3K4DA 1Q8PA 1JYTA 1OH3A 5IFTA 4PT6A 2ZXQA 3PTRB 2DCKA 1LOEA 2E32A 4UFHA 4XDQA 1HXS2 2HEWF 1UX6A 1SLAA 2ZOEB 3RNSA 4AFDA 1GR3A 3CJIB 5JXGA 3I8TA 2CDPA 3ZDVA 3OSDA 2A3WA 3I3EA 5I0DA 4XABA 1W6QB 1WW6A 1X8MA 4YG0A 1WLTA 2DFBA 4AVBA 1ZBE2 2VQAA 4Y22A 2E7AA 4W4ZA 4CDXA 5J98B 3DGTA 5IVJA 3POFA 2RDQA 4I02A 1GBGA 2ARXA 5IAVA 1NZCA 2GP3A 3Q9OA 1UOBA 3J8F1 3OGGA 4J25A 4KBZA 1G86A 4META 2DYCA 4X8PA 3VV1A 1ZX5A 4Y5Z0 1LRHA 3OBTA 3TNPB 1W8NA 3ZSMA 4PBOA 1AR63 1GUIA 5JOZA 3RWKX 1SLIA 4LMFA 5JXHA 3I59B 4JGYA 4DO0A 3PURA 4PLOA 4HT1T 2HKXA 3WQ0A 5DAWA 1UXXX 3DUIA 5CG8A 5K9YA 4YVSA 3PTYA 5EIYB 3ELNA 3CEWA 4IEPA 5LRRA 5M0TA 2P17A 2FDKA 2UY9A 3CLPA 3E6CC 3AMMA 3ZFGA 3O1MA 3AP4A 5G05L 4XUPA 1O3QA 5FP7A 4A7KA 1EV11 4XF4A 4EZ4A 4CCOA 3I54A 2AENA 5EYYA 1ZZ6A 4UWDA 2G9ZA 1RUC2 4P9GA 2HWB1 2E6VA 3WNMA 1WW7A 5A7WA 4CRQA 2QZ3A 2WABA 1MS5A 1ND3B 3CQOA 4FOYA 5JI7A 4FTBA 4M3CF 4IEQA 1FATA 3ZMNA 5H9PA 1MEC2 3ORJA 2VR4A 4I0AA 4N9IA 2GNBA 4QPGA 3D5OA 3POSA 3WR0A 2W1UA 4FP2A 2I07B 4IW3A 4CDWB 3I59A 1RUNA 5CYYA 1AR71 4CUCA 1HB2A 3ACFA 1N1VA 3C7EA 4QKBA 4XZUG 2YMZA 4FO9A 1UYXA 1RHI3 1FYUA 4K9SA 3CZJA 2HWC2 3DCQA 4BISA 2YU1A 4LT5A 3P6BA 2W91A 4K1ZA 1U5YA 4LITA 1TNFA 3TB0A 4X6RB 5BNNA 4COVA 1EAH2 3VD7A 3IPVB 4B3NA 1X82A 1KITA 3MLJA 1W0OA 2WS93 1V0AA 2P3IA 2JDZA 4XUQA 2A1XA 2X5IA 1MS9A 1O8PA 4RA0A 4FI9A 5EP9A 3RZMA 1T2XA 5F5IA 3N7JA 4AHWA 1NCQB 1XXNA 1DU3D 2ARAA 3PJYA 4OZXA 1IKPA 1AYN1 4LO5B 3MIEA 4GWJA 4XF0A 2BNOA 4YG6A 4YVSC 2RR12 5DZFA 4YZ5A 3NWKA 3MIGA 3APBA 5CNAA 5K4LA 5CAZA 3OD4A 2Q8CA 2JECA 5BNQA 1H1IA 1L7LA 1QHDA 2LTNA 3MPBA 4GB33 2RHPA 3HPNA 5GZEA 4GD4A 4K21A 3SH3A 3VBFC 3TYJA 2ZPXA 1RUC3 3VZLA 5FZAA 3W21A 4AGRA 1JU4A 1XNKA 5JZGB 5FY1A 5FMBA 3OUHA 4PIZA 5DZGA 1W8ZA 1YFUA 3IT8A 2I45A 1FV3A 4JHZA 1WCDJ 2R062 4CCJA 3O1UA 1SBFA 4H55A 1VLNA 1QJZA 4Q4W2 3G7DA 2V72A 2X05A 3DPRC 5FP8A 4WBBA 1YNAA 4QQHA 4M00A 1AYM2 1W8FA 2P6CA 2JX9A 4FSJA 1EV12 4YVWA 1CQ9A 4LOTA 3W20A 4AEDC 3WCRA 4IV3A 1ND2A 3SH4A 3RZLA 1BHGA 3POIA 4N53A 4Y1YA 4NPRA 2CAUA 5DABA 2YBSA 5FZ0A 4AI1A 4CDUB 4P08A 3M3CA 3HN1A 3OOXA 5J36A 3ZX7A 3LDKA 5EV7A 1ULFA 4QPYA 3ZM8A 2B8MA 1SLCA 2VGDA 4LBMA 4TLFA 4D94A 1VBA3 4NRPA 2WFF1 2VTXJ 4TTGA 1ZBE3 3EO6A 2E7QA 2BFUL 2KR2A 1S2EA 2V09A 4LKDA 2WFPA 5F8PA 4D0QA 3EHKA 1H8TA 3H42B 5HV0A 2FDJA 2WJSA 4CPBA 2FMYA 3J7HA 5IAXA 2ADDA 1ZRFA 4NHXA 5IUQA 2BVVA 2J1SA 3NJXA 3VBOA 1W6PB 4CDUC 3B9CA 3NKTA 4AVCA 1YFWA 1Y4WA 1SFPA 4E4ZA 4ZXEA 4AGVA 5AC91 1I9RA 3S57A 1NOVA 1R083 1S0JA 2QCSB 2QJVA 2EAKA 2CY6A 5FPXA 5FCCA 1Z7S2 1ZRRA 3AL5A 4O61A 5FXVA 1OH4A 4XUOA 1H1AA 2PHWA 2WSUA 2ORZA 3BODA 3LAGA 4AK3A 5C3OA 1PZ8A 2EF6A 2RS51 2XBO3 3EBRA 4Y24A 2JD4A 4MX3A 3TEYA 1DQ4A 4XBQA 1DQ0A 4P9XA 5DAPA 3A0KA 5C9AB 1RUOA 4AAPA 1NE4A 3IBMA 5ABJC 1AR93 3B01A 1PVC1 2O8OA 2Y0OA 1LOFC 2PQQA 3WG3A 5FMCA 2JDMA 5A3TA 3GZEA 2AGSA 3E1F1 1W2NA 2VXJA 3FLTA 2WO3A 3KT1A 2HWD1 3B93A 2J1EA 4QX0A 5KC6A 3PU3A 2R073 5A1AA 2RM21 2A6VA 2BPA2 1RUE3 4S2DA 4XFBA 4KQ7A 3Q8CA 3JQWA 3ZYIB 3RGBA 3WG4A 4CXWA 1KFUL 3KT7A 4MADA 2WL1A 2XWBB 4W6YA 1RTVA 4LXLA 1C5HA 5LK5A 4QPIA 4YPJA 5FO9B 4IE0A 2R071 1B09A 4GMP0 3CF6E 3D82A 1QJX2 3C3VA 1MQTB 1MS0A 4XMAA 4LO6B 1DYPA 3WDXA 5TSWA 3M3OA 2XQXA 5B2GB 3R4UA 1JUHA 5FZOA 4XQWA 1LESA 1G8WA 3IKWA 5CFDC 4R9DA 1DF0A 4OI1A 4AEDA 4WVMB 3AJZA 1PVXA 4RSUA 3QCWA 1LENA 2QBXA 5C3QA 1QMJA 1TE1B 4CEYC 1RIRA 2PHUA 3KCCA 3RMYA 3WF3A 4CTEA 1Y9MA 3J8F2 2A6ZA 1IQDC 2BGPA 2Q0AA 3I2DA 4PLMA 3T4VA 1DZQA 2QTWB 2P5BA 4L0PA 2HWF3 1LGBA 1S4CA 4IDZA 5FZ6A 4XAAA 5FZIA 4JKMA 3WY6A 5F6KA 4IEXA 1OUXA 3POWA 4QXHA 1RUF1 2D6NA 1GNYA 1H2KA 3AYAA 4CU8A 1QF3A 1K42A 3KGLA 1VMFA 4F8AA 4AFCA 2JXAA 1IZ3A 4I0BA 1O7FA 1GQGA 4XOGA 4FAGA 1IG0A 4LO4B 5K0UC 4N90A 4BYYA 3WNKA 5DG1A 4M3CA 1UQXA 5DQ0A 2KA3A 3TN92 1GZWB 3OEBA 1NX9A 3PUSA 3ZN6B 4GMP3 4FT8A 5A7WB 5FYZA 3RJ2X 2VU9A 4OHWA 4ZU7A 3DYMA 5JAXA 5A6XA 3E6BA 3WEZA 1DLLA 2YZ4A 5IATA 1PIV2 4JKLA 1O3SA 3FLPA 1UAIA 5JOXA 1DZTA 1XYNA 5K0UB 2QUOA 4ASKA 3WQ1A 1MS3A 2RS11 2V5DA 3AZWA 3BOWA 1VBA2 1NA1A 3WF1A 2WYSA 1C1FA 3FBMA 3WW1A 1W6PA 1YUDA 4RFRB 1LAJA 2HWD2 1WGPA 1QQP3 5LA9A 3ZDSA 4NAMA 4HVQA 1BYHA 1AL23 5FLHA 1XBFA 1AUYA 4PIYA 3O1OA 4PBPA 3U10A 1I3HA 2OUJA 2JG9A 2BQPA 4CU9A 1W03A 3VZKA 5KXCA 2VBPA 2W3JA 3OGVA 2G19A 4OUMA 1W9SA 1DYKA 1POV1 2B45X 1OLMA 2G4IA 4UT5A 2ZGPA 2HBUA 3OUIA 4A2UA 5GKAC 5H9RA 1GICA 3DPRB 5T5LA 3WNXA 2Z79A 3MUZ1 3OB8A 3VDBA 1ZVFA 3SCGA 1X50A 3POEA 1YO8A 2E7TA 4XIKA 2XJPA 4DOUA 1JS9A 2BNNA 4BQXA 2XVKA 1YJLA 3B94A 2J42A 1ZZ9A 5K0UA 3VDCA 2XPJA 4FOVA 4AFBA 2WSVA 3T2TA 3H3ZA 2WUHA 3AKQA 3GBFA 3O1VA 2DWRA 4XILA 4Q29A 1PGL1 2DCJA 3FX3A 3ZYRA 1R1A2 3LE0A 3AYDA 1L7QA 2XVGA 3I2KA 5EJ1B 2WLPA 5LBBA 2Q8DA 1CZTA 3T3YA 4DS0A 1COV3 1MZ5A 3LOIA 4JGZB 4LBQB 4CCLA 2A5ZA 4HXCA 1YIFA 2B7YA 3LA2A 4O7XA 3KCXA 1OC1A 3JD71 4BQYA 1F8VA 1Q8OA 3WF0A 1CAXA 1FXZA 2R072 5T5JA 1LHNA 3M1HA 3ENRA 3P3NA 3KM5A 2B9VA 3VD5A 4YGCA 2ZTNA 2FCTA 5I8YA 1ZBA2 3MYXA 4AI2A 1EPWA 3BPSA 2PLV1 2VCBA 4ISRA 1FMD3 1PM4A 1WLWA 5GLZA 1OA2A 2W08A 4LBNA 1AYN2 1PVC3 3K4ZA 1VBD2 3WG1A 3U78A 4DRVA 4MGTA 1JBCA 1IOAA 2RS33 2VNRA 3JQXA 5FIXA 2VVEA 3S7EA 2WNVC 3UJOA 5CEHA 4GIQA 3FHIB 4IEZA 2VNVA 1JOBA 3W5NA 1AR61 3IAPA 3WDYA 1H30A 4WVWA 1J3QA 4B7EA 1GU3A 3VBHA 2Q30A 3NNGA 5T3NA 1JU3A 3JZVA 4DXRA 5LW9A 1YEWA 4YNIA 3MBWA 4Z8BA 2FDGA 1RUE1 4M0HA 2VZPA 3HQRA 5DUUA 5FPVA 2XJRA 3V65A 4AHXA 1Z7S1 2VQ0A 4TXWA 3HJRA 3ILNA 4QWNA 1BJQA 1AYM1 4XF9A 4CCNA 5A1LA 4AI9A 3HN3A 2IXKA 3GHNA 4X8NA 3WQ7A 1MZ6A 3ME2A 2EICA 1OT5A 2WINB 4QX3A 2JG8A 2VNOA 4AI0A 2P3KA 4W65A 5GALA 2BZDA 1OSGA 2A3XA 4NHLA 2W1QA 4CCDA 2CNAA 3VZJA 1OF3A 1PO23 1R1ZA 4AR2A 5C33A 3MF6A 2OT7A 1C28A 3M8LA 5C8CB 2GN3A 3T4HB 4S2HA 1XQNA 2HWC1 2B5HA 3LIHA 4MYEA 4RGKA 2WO2A 5CADA 2UURA 1RUG2 3V56A 4DNYA 3QH7A 4Q4Y2 2BOIA 1LU2A 3UGHA 3ZPYA 1W8WA 1V9U1 5F6LB 1CVNA 3F2ZA 4XFAA 3TEWA 3AXEA 1IG3A 4UF0A 1VAMA 2DBIA 2VBDA 3VBRA 2ZX2A 1SPPA 2HWE1 4W8JA 3NNMA 1H4GA 3TAYA 3ECQA 3FZ3A 4OI4A 4RFT0 4Y22B 1KEXA 4COUA 1OOPA 2ZJCA 1VBB2 2WWSA 3O5SA 3R4SA 4UW3A 1W05A 1HN1A 5KR7A 4YZ2A 4L97A 4YGBA 1CAUA 4BIOA 4CCMA 3M3EA 1BMV2 2RJ2A 1QOSA 4P9IA 1GLHA 3VHPA 3GGLA 1V9U2 3BB6A 5IYYA 4Q1RA 4WM8B 5A1FA 1ACCA 2ES3A 2XB6C 1QWRA 1DP0A 3AKRA 4YW7A 3N9MA 4ISQA 1PHMA 1RUG1 4XEZA 5KXDA 3VB9A 1CZVA 4BMBA 2BU9A 2ZX1A 1CAXB 2RS13 2RS52 4MHUA 5FPUA 4K40A 1QU0A 1SHWB 1TG7A 1SLTA 5FZ3A 1NYWA 4RQPB 1RUJ3 3AXDA 4B1LA 5LA1A 3LEIA 5FYVA 2ENRA 3BYWA 3VBHC 4G9SB 2UYBA 3VBFB 2ZEYA 1JXNA 5AVAA 4N53C 3GBWA 3L2YA 4GMP1 4CDWC 4F83A 3FE5A 1JYCA 2VZSA 2GNTA 3LEKA 3KMHA 2XG3A 4JX0A 3ES4A 1TME3 4QKNA 4NIIA 4ZZ5A 3ZXDA 1MPXA 1VBC1 2YY1A 2ZX4A 4NROA 3TNQA 5L7OB 2VZOA 1XNAA 1CJDA 2JDKA 1RHI2 4RGGA 1QQP1 2DU0A 2VQUA 2FZ2A 2GMEA 1DGWX 1RUD2 4OHVA 5FXWA 4HKOA 5DMYA 2LM3A 2XLAA 4LUKA 5ISLA 2EVXA 2XMLA 4IE7A 4IQPA 3NJYA 2YFZA 4AF9A 1WCKA 1H9WA 4TYSA 3WV6A 4NIHA 1UYZA 2VZUA 2ZBJA 4FPYA 1SACA 3AMNA 4WM7C 2E33A 4AOCA 2C26A 3VLBB 2F4LA 3ZYHA 1HW5A 2VUJA 4LR4A 1C8M2 2J1RA 2XHKA 4QDQA 4COYA 1QJY2 1R093 5B4NA 3FHQA 3OJBA 4YG3A 2P3YA 4UAPA 1WBFA 2RR13 2W46A 3MV01 4XQDA 2ZEZA 2YBKA 1HB4A 1AR73 4PI0A 1KD7A 3U07A 1HB3A 1HRI2 4HLTA 1GV9A 2WBKA 2ZA9A 2B4KA 3WW3A 2Z42A 2VC9A 3LIGA 1Q8SA 2DVBA 5FYYA 1YIPA 3PVOA 5E8AA 1R64A 4EWEA 1ZRDA 3J9SA 5J37A 4NIDA 4YM1A 5CBLA 5BNOC 1YLLA 4NJ4A 5KHGA 3FJSA 1V6JA 1GZWA 3H1WA 4CYDA 4XJUA 1HRV2 2XJUA 4L9BA 3WLUA 4WZFA 1C3HA 1UYPA 3PDQA 5DUWA 3WZ1A 3AYEA 3OY8B 4YSFA 1W6OA 3AC0A 1PMIA 5E89A 2BBVA 3WVJA 4CDXC 2RM22 4YRDA 4OHZA 3SISA 2OVUA 1V70A 4NHYA 3TBDA 1Z7S3 2W68A 3PHMA 3THCA 1B35B 5D1IA 5ABJB 5LZ6A 2JDNA 3CJXA 2BVBA 2C4XA 2O0OA 4LHNA 1OA3A 4IGOA 1CAWA 5EJ3A 1IKQA 3ACIA 3R05A 3VD4A 1ENSA 5DZEA 1LJ7A 4CU6A 1RMU3 1G9AA 3KQRA 3ZSJA 2CGPA 4OI2A 2HWB3 5BUVA 3VHNA 1S0DA 4MGKE 1GOFA 5JMCA 3T0AA 2R063 3RZHA 1CAVB 3GHMA 3QOPA 5BNNC 5J09A 1J1LA 1G9DA 3UNPA 3RVHA 4V1PA 3AP5A 1C8NA 3EMRA 3MO4A 4U2AA 4HOOA 5DUXA 5FTTC 1YQ8A 5FV3A 1AYM3 4Q27A 1W9FA 4QX8A 3ZYJB 2HBTA 3LFIA 1Q43A 5FYIA 1UYYA 4NWWA 4Q0QA 3WUCA 5JSOA 1O5LA 3HNYM 5L73A 2PHXA 5C9AC 5KHIA 1DG6A 4SBVA 1QJX3 5LY2A 2V73A 3FN9A 3KVBA 1DHKB 4UFJA 1UKGA 3NJVA 4EN6B 2OKXA 1ZNPA 4E2SA 2CWMA 3VBFA 2OW4A 2NYYA 5CFCC 1LHVA 1YC61 2GC1A 4FXGB 1I6XA 3MIFA 5JSPA 1SCSA 4BXSV 4GWIA 3HT1A 2XHNA 3LA3A 2MHFA 1F9KA 4O9EA 4KL1A 2F6BA 2YUEA 4FPJA 1WW4A 2GN7A 2BGCA 2MEV1 5I0UA 2X5IC 1FT9A 3U4XA 1AXYA 3Q8BA 4NOTA 2QDRA 2OUHA 5CISA 2UWAA 5F3IA 1DGRA 1RMU2 4NUBA 5A33B 3O1SA 2YGLA 5F5QA 1ZBE1 3E5XA 1F31A 3AP6A 5A3NA 2FZ1A 3BPZA 2VZVA 4NHMA 4IE4A 2TUNA 2WWJA 1FI2A 3BU7A 2ZAAA 3VBSA 4MXWA 2WNOA 1JMUB 2YV8A 1W3XA 4BM8A 1HDKA 1T6BX 2MEV3 1K5JA 3WNNA 3FFZA 5CZKA 1JZ8A 3B5LB 5HCFA 1BZWA 2XLFA 1AR92 5F5CA 1RVF3 4DUWA 3WNPA 1GANA 5JZGC 2WZPP 3ZR5A 1V6KA 2YPJA 3BN6A 4AVAA 2WZ8A 2AC1A 4F3JA 3KV6A 1MR5A 4AYUA 3W9AA 2WRAA 3VBRB 4LBKA 4H7LA 2PXJA 2Y6FA 1XNBA 3N3HA 1UU5A 3OBAA 1KJRA 4Q4X3 3VBOC 5A32B 2ZAHA 4P5YA 4XQ4A 1UZYA 4E2GA 1NCQC 4IEWA 1DGRN 1HV1A 2ADEA 1F5FA 2ZS6B 4XDPA 5LA2A 3JBG1 3ZXAC 3N36A 2HWF1 3JU9A 1AL22 1ASJ2 5FZ4A 4YM3A 4OHXA 1ND3A 2WA3A 2D93A 3MZHA 5FR3A 1ST8A 5IFPA 1UCXA 5C5TA 3SEPA 3TOJA 2LS6A 2L9LA 4XCBA 2VQTA 4UFLA 4XJ8A 5D8AA 2Y60A 5KHJA 2VE1A 3FUOA 3VD3A 4FQ4A 3N7MA 3E6DA 4PI2A 2VZQA 5J96B 1D7PM 2VOVA 5IT6A 2Z4FA 5FZ7A 1U5XA 3H50A 5FZKA 3U4SA 1LOGA 4LOSA 1PO13 1UY0A 1XRUA 2CWSA 4EZHA 2R49A 2A71A 3M70A 3WSOA 3I2IA 4I01A 2YC2A 1PMJX 4P9YA 1QJU2 1W2AX 2DVFA 3UGGA 3E5QA 4LJHA 1EY2A 2HWB2 5FY7A 3HOBA 3LEGA 1K5MA 1WMXA 5LBEA 2HWD3 3AZZA 3WDTA 3ZYBA 4BMEA 4X6QB 3MIHA 5F3EA 4BE3A 4URTA 5L7OA 1DBNA 3BU0A 3HEIA 3AKPA 3ZIXA 1WD4A 2PHTA 2IXIA 3HD8B 5A3MA 5FUPA 1GYKA 1VE0A 4LHSA 5BNOB 3X29B 1UPSA 4ONUA 2Y8KA 2JE9A 1S2BA 3WHTA 1FOD3 4M4PA 3ZMOA 4MGSA 4Z2WA 4GALA 3C7OA 1OURA 4OUEA 1F15A 4D3WA 1Y9GA 1IS3A 3ON7A 4YW4A 2PELA 3ZSKA 1MZEA 2WNVB 1OPOA 4A3ZA 4XETA 1RUF3 2ZX3A 4E4DX 3HQUA 1N1SA 2OZ6A 4KBBA 2VY0A 3O0XA 3ZIWA 2A73B 4LA2A 3QD6A 4ATEA 2Y34A 2ZGLA 3VZNA 1VBD3 4LIUA 5GZDA 5JPNB 3B7MA 1IPSA 2A6WA 3CZUA 1WUVA 3HBKA 5IVYA 4QKDA 5FY5A 1VRH1 2EIEA 4JGZA 1G9BA 3HWJA 3WP6A 1ZM1A 4LBOA 2O14A 1OLME 2ZGNA 4LHLA 1X8EA 2DVDA 4QXBA 1H8VA 3C8XA 1RC6A 4Y1VA 3LCPA 2XXZA 1SG3A 1QJFA 4XFCA 3U14A 1NCRA 1GWKA 4MXWB 3KZ4C 5FY8A 4URAA 1OD5A 1DGWA 1ZZCA 3I2GA 5FZLA 4A44A 5GZGA 5JXIA 4OI0A 5HCHA 4LPLA 2WZR2 2ZHNA 4Q1PA 4XXAA 4DB5A 1ND3C 2D6MA 2K46A 4GAZA 5CKNA 4GULA 3WXPA 1YHFA 1UU4A 4HMZA 4LE3A 1QGLA 1RXFA 2YFUA 1S0FA 2VCAA 3FC0A 3ZYFA 2ZACA 2D43A 4NMIA 1PK6A 1RVF2 4IETA 4JQRA 3THTA 1YYNA 1I5PA 1TMF3 4XIOA 4D7TA 2YC4A 2XOMA 3OTFA 4DQAA 1UIKA 2ZX0A 3I7DA 2B46X 5FZGA 4ARYA 1YFYA 5C8CA 1CD3G 2A70A 4R9CA 4YW6A 4DPNA 1V6OA 3PJQA 4Q4X1 1DQ1A 3VGIA 2JWPA 1NE6A 1COV1 1Y43B 2ET1A 5FKCA 1OFSA 1QEXA 3IDAA 4GWNA 4MGIE 1F4HA 1O4YA 1R081 2ZGSA 1K5MC 2BGOA 4IEOA 5F5AA 4QHBA 3ACGA 4RL7A 2JIJA 4QQLA 4AXOA 4A6SA 4R8HA 3C7HA 5FZMA 1AL21 3IDBB 1RUH1 1YFXA 4BA6A 1URXA 3QLQA 4CDWA 3VUOA 2RS32 4WM8C 4W6XA 1OLQA 5FAXA 1CPMA 4RYDA 4L92A 2HEVF 4KU8A 2DVAA 2D6OX 3AMHA 4TLGA 4Y1ZA 4IGQA 2GMPA 5IJRA 1UMIA 4DXSA 1HB1A 3I3DA 4GZ9A 4IV3C 3UT0A 5K7PA 1AJOA 3BKZA 1CAVA 2WKKA 3B02A 3RG0A 3LGRA 4BQWA 1DCSA 2R7EB 3AFKA 4B7KA 3WX5A 2R16A 4RS5B 3H1YA 4RN5A 1FNZA 4C8DA 5EWSA 5FWJA 5T54A 1NAEA 1OQDA 4R9BA 3BUCA 4KH9A 4QB2A 1ZYBA 4JQTA 2MPFA 1LNSA 1VBE2 3WNOA 2W92A 4FQZA 1VAKA 3ZFEB 3VBOB 5A7QA 3WG2A 4YVSB 5IK7A 2RG4A 1DIWA 2XJSA 1F4AA 4TN7A 4UYBA 5FZOB 5H9QA 1ZRCA 2AR6A 4NRMA 4ZZ8A 1VRH2 3KB5A 4AEDB 1WLCA 2CHHA 2KM2A 3ZKUA 3AB0A 3LPGA 1UZWA 4D7YA 1GZ9A 1W0PA 2R061 3BTYA 5FKBA 2DV9A 1IPKA 2WS91 3ASIA 3T0BA 4YFZA 5JXJA 4RS5C 2B9UA 3USUA 5JPMB 5IVFA 4DZGA 4ZS2A 3ZYGA 4Q4W3 1UF2C 2WNVA 4KMQA 5E6HA 5E1RA 4IL7A 4L99A 1HN0A 4AHYA 1EV13 3GJAA 4Y3OA 4FFGA 1WZXA 1V9U3 2OIIA 4WM7B 3P1IA 4HBNA 4B29A 4P14A 5BY5A 1SZBA 4XXPA 4D8MA 5C4WA 3CNAA 4PDWA 4EWAA 4JDOA 4XTMA 4MHRA 5L19A 2EIBA 1I1EA 2AZ5A 2VUCA 4XZPA 3UYJA 3MIDA 4KWJA 4ORFA 5FZ8A 1CWPA 4AW7A 4QHZA 4BB3A 1UOJA 3POGA 3RYPA 5I91A 4XFFA 2BRTA 2EIDA 4BIFA 4DEQA 4HVOA 1LOFA 5E88A 4LQRA 4YZ4A 1JZ2A 1ULDA 1VBB3 2C24A 1J59A 2UWCA 1QXPA 1LODA 3IIIA 2VMGA 2SBAA 2JKXA 2RVAA 2FCUA 2NP0A 2XUEA 4LBLA 4I0WB 4AEMA 3GM8A 4DY5A 5JR2A 4CP9B 2HH9A 1NY71 2WNUB 5FZHA 5HBAA 1W90A 3MW2A 3OF1A 1W06A 1E5IA 4HK8A 4BLJA 4EN8B 5FUIA 4CDXB 2VTFA 2Y6KA 2VMDA 2VZRA 1JHNA 2LROA 4J6GA 2D3PA 1BKZA 3SLIA 1Q3EA 3U0ZA 4A41A 1D4M2 1PMHX 1J1TA 4HSJA 5T52A 1VBA1 1ASJ1 3NQHA 4OVEA 2EIGA 5FY4A 5IVEA 1BEV2 4XC9A 2HWE2 2J1UA 2A3YA 5LASA 5EJZB 3SKJE 4AVVA 3AYCA 5F37A 2JDAA 3QACA 3C7GA 3HMYA 3NJZA 1CZSA 2VMIA 1QJY3 1R092 1B35A 2ZZJA 5HXVA 2K0GA 2P34A 4AGGA 3TWIA 5C9AA 4GJZA 5KHHA 4E4HA 1KJLA 4B4RA 1HQWA 4I2OA 3PLQA 1QNWA 2C9AA 3J7MA 4L11A 1REEA 2R32A 1HRI3 5A32A 4Q0UA 2PA7A 5A6YA 4GJYA 4E4SA 1W2TA 2LUWA 2PAKA 4N9HA 4OUSA 3W5MA 2IC1A 4Q5OA 1STMA 4HKLA 3T2PA 1OKQA 2C1FA 2JIGA 2VCCA 3O0VA 4P9LA 5IW0A 1UZZA 4G3YC 2JDUA 5C7GA 5JSRA 5E16A 4EQVA 4FPHA 4OYUA 1XU1A 3RQ0A 1UY2A 1RUJ1 1POV3 2EXJA 3DF0A 1PGL2 1WD3A 1SLLA 4ZKTB 1UY1A 2W0XA 1OQ1A 4XFGA 4LK7A 2ID4A 4PCRA 3AFGA 3V0AB 4Y5SA 3E5UA 1DLCA 5C8WA 2BERA 4ET7A 1AL0G 2FCVA 3NNJA 5FXXA 1ENQA 3LD8A 4F7ZA 3NVCA 5LK7B 2RR11 1HXS1 1ULGA 5FP3A 1JH5A 1PX4A 5EYXA 1WKYA 4RHV1 1K45A 2W39A 4WVMA 3K77A 3ALQA 2WN2A 2Q5TA 3DN7A 4E8DA 3HIFA 3JBG3 4TZDA 3MI8A 2WFF3 2X5IB 1LGCA 4AWDA 4CEWB 4HZFA 3NV4A 4YW3A 1HRV3 4JZRA 2BWAA 1XJAA 1MEC3 1HKDA 1A34A 5JOYA 1XYPA 1U12A 2JDPA 2ZHKA 3JUUA 4OQ8A 1H6YA 5C4WB 1RUI1 4ES8A 2IFRA 4HN1A 4BQ3A 3K3OA 2NQYA 4WM7A 1VR3A 2NMNA 3KVAA 2NN8A 2VO5A 4CU7A 5F9TA 1JHJA 4A45A 5I93A 2IXLA 4JKKA 1LKNA 2OX0A 2ZGRA 3WF4A 4CEWA 4HG6B 4FTSA 4OHYA 2R30A 4QQOA 2YC0A 3OGRA 1EAH3 3ILRA 1MEC1 4HETA 2ETEA 3ABZA 4N43B 1RUE2 2WZR1 2HLEA 1JZ5A 2XVLA 4CP0A 4IUGA 2XKOA 3SITA 4WV8A 5IVVA 1KGYA 3RZKA 4C1WA 4V2VA 4UFMA 3N9PA 3UKTA 1OI6A 4BQ1A 4D6RA 3PIJA 1VB2A 4QPGC 3ZFGB 1UIJA 5FQ0A 2JDHA 3H3LA 1NQDA 4HVRA 4R4ZA 4FAHA 3PU8A 4GA9A 1VBC2 3AMQA 3CIHA 1PX3A 1RGSA 3OPWA 4GKYA 4LNVA 4RQPC 1VBD1 5FK8A 4KWLA 3T30A 4CUBA 2J1AA 5A3PA 2VUAA 2W95A 4HL0A 4D6QA 4Y5TA 3WCSA 3WP4A 3VBSB 1HX6A 4NE9A 3CU7A 3M3IA 4C91A 3S6PA 5LCWL 2D3SA 1GQHA 1ASJ3 4GKXA 5BNPB 5JR7B 3KV9A 4O65A 2YYOA 5A33A 2X09A 1MVQA 1AVBA 1SPPB 4JRAA 1XC6A 2Q8EA 1W6OB 2VD7A 4KG0A 4R4XA 5F1RA 3QH6A 5GLUA 3BIEA 1LECA 2VUDA 4AEKA 4E8CA 3MFAA 2GC3A 3WDUA 1ND2C 2OZJA 1JI6A 3GALA 1VP6A 2RJKA 3VD9A 2VVDA 3WDWA 5ACA3 1C1LA 1YQ2A 2WNEA 3MHZA 4QD2A 5C71A 2R042 3NV2A 4JDMA 5FFOC 1LULA 3C7FA 1KQRA 1X33A 3O1RA 3WUDA 4YWAA 1BQPA 3AMPA 3TN93 3ZN6A 1QJU3 4V2WA 1JODA 2PN5A 5FPLA 3AJYA 1D4M1 1W8HA 3VBUB 1WWYA 1UO9A 4S2FA 1US2A 1U0AA 3ZR6A 4B1MA 2VECA 1GSLA 3M3QA 3KF5A 1RL3A 5FP9A 2RMU1 3GCXA 4KGGA 3WW4A 1O6UA 4J1XA 4FPOB 1LCLA 2ORXA 1HJFA 3VKMA 5FY0A 4XF3A 5G04L 3SKVA 3DXUA 4YVWC 3WD5A 3UKVA 1LB2A 5LRSA 3WP5A 3VDAA 1YXWA 2J7MA 4L8QA 3RWNA 1S0EA 2W1SA 2R6QA 2DCZA 3KHBA 3OGSA 3VHOA 4UFIA 3OBRA 2WA4A 1G9CA 3SHRA 2XJTA 5CVRA 4RR3C 4NIGA 2VNGA 2XBO1 3ILFA 2Y64A 4JC1A 2EA7A 4DINB 5FZFA 2GALA 1AR82 2JJ6A 4Z82A 1DDLA 1IS6A 1WW5A 1BCXA 2F4PA 1BVP1 1J3PA 1W9WA 3D0JA 5JWPA 1HXS3 1A78A 2UWBA 1X9PA 3MF9A 1RUH3 4Z2AA 5FYMA 5AC93 5C8CC 4PF5A 1E57A 3H0OA 4CDUA 3I97A 3LWCA 2IWGB 4RQPA 2D6LX 2PLV3 1TME1 4RR3B 2FMDA 1U5IA 4YFWA 4XACA 1W99A 4P9WA 3O1PA 3GBGA 5FYSA 2AEZA 5AFBA 4EYUA 5LWBA 2A7AA 2JICA 4C1XA 2WZR3 3T1LA 5LBCA 2DCYA 4XE9A 4AQSA 1JUIA 4SLIA 2JG8B 1OHFA 4D6SA 4QGLA 3ATGA 3CJIA 2JE7A 2D44A 4GWMA 3N7KA 1J58A 1DFQA 4LLFA 2PFWA 4JVAA 2P3JA 1PGSA 1KDMA 3IB3A 3L9JT 2RDRA 1QOOA 2VH9A 1AYN3 2NZ9A 3AKTA 2GAUA 3OUJA 1W39A 2D3RA 3LSDA 1FOD2 3BCWA 2JEMA 3AL6A 3THDA 1EUUA 3VN4A 1GWMA 1BEV1 4GH4C 5FYHA 5K8SA 1UWWA 3H7JA 3OPZA 5IK5A 1ULOA 4K8RB 5JDBA 2YG0A 2IVJA 1OLRA 4DUVA 1H2MA 1W04A 3SXWA 5CFDB 5JOWA 3SMHA 3PUIA 1ODNA 3AZVA 1RUH2 5L9VA 2OYZA 5AC92 5J3UA 1HV0A 4LHKA 1D2SA 5D8AB 3GZAA 4E9KA 1H2LA 4EV0A 4GXLA 2I74A 1UOFA 2RS12 2PLV2 2WAOA 1W9YA 3L2HA 4EN0A 4Q0VA 4NWVA 4YARA 2WT1A 1XNDA 3OGJA 1L3JA 1DQ2A 2GDFA 3A4UA 1QKQA 4L2NA 1PO21 2Y0IA 3VZOA 2VW2A 3QBQA 2GH2A 5FWEA 4NIAA 3H3UA 1Q5OA 3POBA 4AVSA 3Q8EA 2VM9A 4PDWC 4ZY9A 1Q8QA 4UBGA 5D8AC 1DGLA 1SDDB 4QAWA 2Y6JA 1A8DA 2ZCWA 3GJBA 5F32A 4IV1C 5ACA1 2JE8A 4QKFA 4ZS3A 3AZXA 4DY3A 2W87A 4FOQA 3U75A 4IERA 1VRH3 1XSQA 5EHDA 3UJQA 4ARXA 4QQ2A 5IVBA 2D5HA 2WQZC 4CCKA 1OVPA 4LKFA 5LY1A 3CL1A 4IEYA 4JAAA 1S0IA 5B4XA 3K2OA 3U37A 4AFMA 2OPWA 2GNMA 3SNMA 3VL8A 1UW8A 3OG2A 3INAA 3URFA 4CXXA 1W8OA 2QQIA 2RJLA 1CAWB 4LEJA 3BIWE 4Z1VA 1QJEA 2LRPA 4IEVA 4KU7A 3MW4A 1WMFA 2G9GA 1UMHA 3VKFC 5LEKA 1DZRA 4UI9L 2Q1MA 2GH8A 4BQ2A 3M2MA 1YRZA 4JHTA 5FZDA 1CJPA 3T08A 4OMDA 1OXCA 2QQKA 5JI9A 3SCHA 1KDKA 2VMFA 5EZWA 2WLQA 2ZHMA 2VXRA 1UY3A 5EXOA 1LR5A 4RHV2 1NZIA 4LO7A 3S30A 2YBPA 3ZFFC 1S1AA 3MLLA 1FMD1 5HI0A 2NM1A 3SCFA 3A23A 3ZVXA 5EFUA 5I8SA 5BV6A 5BPXA 1JYNA 5BNPA 1B35C 3PUHA 3LPFA 4CXYA 4XURA 1FPN1 4GH4A 1YQCA 3AZYA 2PTMA 1ZZ8A 1XNCA 2BBAA 4YGDA 3VKOA 2P6HA 4MUVA 3NNFA 4ZHNA 1AZDA 4TSVA 1OUSA 1V6MA 1D0HA 4YW5A 4WVZA 2RS31 3LOBA 3ZSEA 5FZ9A 3WNLA 3A21A 4HKWA 1BBT2 2H0BA 3O0WA 1JYXA 2UY8A 3GZTB 4ZU4A 4GQ7A 3RI8A 1VMHA 2C9KA 1N47A 1RINA 1EPZA 1PGW1 5FK7A 3N35A 2A6XA 1JZ3A 2CL2A 1E5RA 4CVUA 3PNAA 1LHWA 4XBLA 4H2AA 3NV1A 2XKPA 1RUD3 3KV5A 1XYOA 1SMVA 1O3TA 2BDRA 4JRLA 1YCIA 2ILMA 4FBFA 2O8QA 2VPVA 2XQRA 2CTVA 2W9XA 3JD73 4PQQA 1U5ZA 1N3PA 4PIXA 4AFAA 4CDQB 3NAPC 2DVGA 2QQNA 3IZOA 3OYWA 1GP5A 1DYOA 1PNFA 2C5DA 5T55A 4QX1A 1H8TB 2RV9A 3H8XA 1HLCA 1LHUA 2BOJA 5ABJA 4M3CB 3DYPA 2RE9A 2DFCA 4MVTA 2BW8A 2Y6GA 4EROA 4P5HA 3S0MA 5JLVA 1CGPA 3LFMA 4K8FA 1GZTA 4ZPIA 1AR72 3LF7A 2D40A 3HAGA 4PF1A 4KGQA 1H2NA 2JG8C 1NUKA 4LLOA 3RFRA 5DPNA 3ZPOA 2UU8A 1O59A 5C3SA 1JZ7A 1MS4A 4XYXA 2PHRA 5T5PA 1AHSA 5KWRA 5A80A 1BEV3 1W6NA 4YYOA 1SFNA 4MGZE 2QQJA 2D7FA 1UL9A 3T1MA 3DEMA 3N9NA 2VOWA 4CEWC 1W28A 1G7YA 4WM8A 3ZKYA 4RGAA 1QNYA 1YQ6A 4MZUA 4IE6A 2R041 5FOBB 1C8M1 3WOGA 5C5UA 2FDHA 3KCYA 4QU2A 3RZJA 2PAEA 5C3RA 4OZOA 5FDBA 4W50A 3A7QA 1FAYA 1E5SA 4MSVA 4Q8KA 2R0FA 5DAQA 4XFIA 4N43A 1GWLA 3C2UA 2IXHA 4XW3A 4WVVA 4IESA 1M06G 5FZCA 1IGOA 1QJX1 1A3KA 3BTXA 4TWTA 3WW2A 5C3PA 3FUQA 4MGQA 5FRAA 1RMU1 1F2NA 1E5HA 2NMOA 4MH0E 1FOD1 2ARBA 4MOAA 2WDBA 4ZXKA 4XJWA 5L7OC 1F35A 2ERFA 1UMZA 1NKGA 1UU6A 2CDOA 2QVSB 1REFA 2WWUA 4NVPA 5F3CA 1ZZ7A 4AL9A 4FPLA 3KV4A 2IFWA 4QDRA 5HCAA 1W6QA 3J4UH 5BXXA 3A22A 5FBJA 2JB8A 5FJHA 4YZ1A 5CB7A 5I0TA 3F95A 4CUGA 4NR1A 4Q8LA 2NLRA 3V0BA 1LEMA 3MPPG 2K9ZA 3VL9A 2FDFA 4NPLA 3PVNA 1POQA 5GLTA 1FPN3 1PNGA 2XH6A 3KLSA 3J7LA 3AM2A 4BQ4A 5F2SA 3B00A 4BH9A 3LB9A 5C4WC 5I0RA 3POJA 4HSLA 2W5FA 2Z5WA 1NA1C 1BBT1 4CP9A 4Q0PA 1CONA 1G6NA 4FXKB 2WQ8A 1O91A 5KC5A 3ZXFA 4Y26A 3VHRA 3KF3A 4XJAA 1REDA 3V0BB 1BMV1 1V6LA 3BTAA 3KHCA 4R9AA 1CX1A 1ZRIA 1V6NA 1OF4A 3ZXJA 4N43C 1ULPA 3RYKA 2AACA 1BBT3 3O12A 3VBHB 1NCRB 4N7UA 4CP1A 4MXVA 4D7SA 4CSWA 1HJGA 5JIUA 1L7RA 3BI3A 3JBG2 4B4PA 4QM9A 3KT4A 3H9AA 1GOGA 2IUWA 4P00B 4KNCA 1EAH1 2ZMKA 1XOYA 1KS4A 1VPHA 4H3WA 1US3A 3I3MA 4Q4Y1 4DXTA 4K20A 3JXSA 4INDA 2VMHA 2PHFA 1PZ7A 3RDIA 3VDDC 2K2SA 1SLBA 1RVF1 1NCRC 2DDUA 3WINE 4XBNA 4A7YA 5F39A 1AR91 2QZ2A 1VBC3 3DYOA 5FYUA 3RRDA 4AQ2A 5CA6A 4FCAA 2DTWA 3D0SA 2WO7A 4HPKB 2GC2A 2WIIB 5GM0A 3WDVA 4AEJA 3H7YA 4LBQD 4BWOA 1K12A 3PVBB 5BNOA 1MS1A 4DRRA 1MZFA 1RITA 1TEIA 3IDEA 1ULCA 1H1MA 4Q4W1 4YW2A 4QX5A 2E63A 3RS6A 2BWCA 1QDCA 4YM2A 4BU2A 5DAVA 2QKDA 1LHOA 4R52A 3IPVA 5JCTA 2ZKLA 4DFSA 3ZXKA 4Q4V3 3RYRA 1RJ7A 2YDEA 4HONA 1VMJA 2OPKA 1VBE1 4XJ9A 3S5AA 5F3GA 2DCTA 2GNDA 1WCSA 1Y3TA 3EB7A 4MV2A 1ENXA 2RDSA 4B4QA 5F7UA 1W6MA 2CV6A 5IK4A 1UXZA 3J7NA 1WBLA 2H6BA 5LBFA 3RMXA 3VKNA 5ERLA 3PMEA 5FPZA 5FO7B 4ASLA 1O3RA 1VJ2A 4ATFA 5FY9A 2BJSA 2GMMA 1XE0A 2V4AA 1CX4A 2ZGQA 2C6SA 4AI8A 3OPTA 1OKOA 2VL4A 3CJIC 2ZMLA 3BOPA 2I2SA 3LKJA 2Z69A 4M0NA 3FMGA 4CDQC 5I0SA 1BK1A 2GP5A 4MLOA 5DDJ3 4JTNA 1AR81 1WLDA 4XFHA 2KXLA 1WMDA 2QQWA 2MNGA 2X29A 3LSEA 4W6WA 4COWA 3Q8AA 4FOWA 3ROUA 1W6MB 1WMEA 2SLIA 1XB9A 1A8MA 2H6CA 2P4EA 2VOTA 2XBO2 5FXZA 3RPQA 1KFXL 3WT3A 2AREA 2OA2A 3VDDA 1QOTA 3NRUA 3ETPA 3R4DB 3FWEA 4ZU5A 4XUNA 1SCRA 3ETQA 2XJQA 3I3QA 1SBDA 1GFF2 1LOBA 2RMU3 2D98A 5SV5A 2ARCA 3KS7A 4K3UA 5HV4A 2GZWA 1NY72 3IAQA 5FUNA 1GMMA 5ACA2 4Z92B 3EYPA 3O1TA 5I8TA 3NV3A 5IHRA 3RZGA 1S0GA 3D4KA 2Q1ZB 1VRBA 2DF7A 4LTAA 4FPKA 1GNHA 2XJVA 3CKHA 5DG2A 1N1YA 5JVVA 1D4VB 3NKGA 1RUF2 4Q26A 1AXZA 2Q8OA 1FPN2 1WCQA 4GH4B 4LKEA 4OULA 3SH5A 5KXEA 4IV3B 1UPIA 3DECA 3WHUA 4QT6A 1K3IA 1J3RA 1RJ8A 1CIYA 1RUI2 3MEPA 4QQPA 1J84A 3V64A 4I3GA 1G9FA 2J22A 3HNBM 4Y1UA 5EQUA 1RYYA 3THPA 3P3PA 3I2JA 2VG9A 2WNUA 4CA9A 4AHZA 1VALA 2DURA 3ZN5A 5J48A 4MGYE 3ZFEC 1I5ZA 4FVVA 1PZ9A 5DDJ2 2E26A 3DV8A 3J8F3 1VBB1 1SBEA 4M3CE 5CFCB 1IS4A 3H8RA 1TNRA 2JKBA 4MG2A 2FHRA 1WA4A 2UYAA 4LORA 5A3WA 3H8OA 1SFYA 4JGYB 4IGPA 5A3OA 4UW4A 1VAVA 4QGMA 2MEV2 4CEYB 5FYCA 3T0DA 2BUKA 4BPZA 2IVIB 4HFSA 5F2WA 3D8CA 5CG9A 4IE5A 4LBQA 4E2QA 4XMIA 4CE8A 3NSTA 4J1WA 4JV4A 2WO1A 1QY4A 4H7MA 2E9QA 4QPIC 1QJY1 1PIV1 2AEYA 5A6ZA 4UFKA 3MGUA 3WF2A 3ZXLA 4Q4X2 4YZ3A 2OQ6A 1RUJ2 4JGYC 4NPMA 1W6NB 2ZEWA 1TMF2 3GNEA 3E97A 4Q0SA 3TN91 3GZUC 4LUMA 3ZFFA 2OXBA 4QPGB 1PIV3 2VOKA 3ZFGC 1BLZA 2WC2A 4XUTA 1TME2 4JTOA 1JOPA 1OD3A 1W8UA 3NMBA 2D97A 2Y6LA 2VVFA 3OCPA 4Q4V2 1AF9A 2W2IA 1O4ZA 4QXCA 1Y9QA 4Z07A 4IXLA 4QB1A 4AI3A 4FFIA 3ZFEA 1W0NA 5A7NA 2LALA 1NG0A 2GU9A 4YLZA 3CHXA 4Y4RA 3MUY1 5FLIA 1F5JA 3W58A 3AVRA 4EE2A 5L9BA
chains in the Genus database with same CATH topology
5A6XA 4UT5A 1OUXA 2JDUA 1UZVA 1W8HA 5D2AA 5A70A 2BV4A 4AOCA 5HCHA 2XR4A 5A3OA 1OVSA 1OUSA 1OXCA 5A6QA 2JDPA 2JDYA 2VUDA 2BOJA 1W8FA 2JDHA 2BOIA 2JDMA 3ZDVA 4CE8A 1OVPA 2JDNA 2JDKA 1UQXA 1GZTA 2WRAA 3DCQA 5A6YA 2BP6A 2VUCA 2WR9A 2CHHA 2VNVA 5A6ZA 1OURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A6X A;  4UT5 A;  1OUX A;  2JDU A;  1UZV A;  1W8H A;  5D2A A;  5A70 A;  2BV4 A;  4AOC A;  5HCH A;  2XR4 A;  5A3O A;  1OVS A;  1OUS A;  1OXC A;  5A6Q A;  2JDP A;  2JDY A;  2VUD A;  2BOJ A;  1W8F A;  2JDH A;  2BOI A;  2JDM A;  3ZDV A;  4CE8 A;  1OVP A;  2JDN A;  2JDK A;  1UQX A;  1GZT A;  2WRA A;  3DCQ A;  5A6Y A;  2BP6 A;  2VUC A;  2WR9 A;  2CHH A;  2VNV A;  5A6Z A;  1OUR A; 
#chains in the Genus database with same CATH topology
 1FV2 A;  5JUV A;  3RI9 A;  3OD0 A;  2W94 A;  3BVC A;  1UZV A;  2J1V A;  2R1B A;  4I09 A;  1IPJ A;  1NCQ A;  1O8S A;  4YGE A;  1AR6 2;  4AZZ A;  5FP4 A;  3UL2 A;  5CIR A;  4RHV 3;  4LE4 A;  2P37 A;  2DU1 A;  4ASM B;  3HBZ A;  3HQX A;  1NLS A;  1PGW 2;  4NHK A;  5IVC A;  2E53 A;  1FNY A;  1O4T A;  2YHJ A;  3NL1 A;  3TEZ A;  4XHB A;  1ULE A;  2F17 A;  2NPI A;  5LEJ A;  1H6X A;  4QM8 A;  3I2H A;  4BDV B;  3I2F A;  5J7M A;  1R09 1;  4M01 A;  3ZSL A;  2FQP A;  1VBE 3;  2VUL A;  4LO8 A;  5FMO S;  4Q4V 1;  4A4A A;  1JTZ X;  2HEY F;  2WNU C;  4CCC A;  2XL9 A;  3OBZ A;  3MV1 1;  4Y20 A;  1GNZ A;  2XGX A;  1HRV 1;  5DXD A;  5APA A;  1IQA A;  1S0B A;  2QQV A;  2BNM A;  3BGA A;  5DDJ 1;  4NN0 A;  2JG9 C;  1RUC 1;  3SQO A;  2A75 A;  4DIQ A;  3N4M A;  4K1Y A;  5JMO A;  1WCU A;  4CP2 A;  2VW0 A;  2G1M A;  2QFE A;  1OVS A;  1DQ6 A;  4YVW B;  4ITC A;  2EXI A;  2J1T A;  2WZE A;  3T2O A;  3U1X A;  3DKQ A;  5GLV A;  1ZBA 3;  4JGZ C;  4XVH A;  3CO2 A;  4HPK A;  3ZYP A;  5T50 A;  1H8T C;  2HWC 3;  1AX1 A;  3SEE A;  2G9F A;  1RB8 G;  3EQE A;  5KHK A;  1PK6 B;  1QXR A;  4JCK A;  4OFG A;  3DPR A;  1RXG A;  2E51 A;  1XNT A;  3AVS A;  3HNM A;  3VKL A;  3POY A;  1A6C A;  1X9T A;  2DUO A;  1ZA4 A;  3IDC B;  1XU2 A;  3FBY A;  4FPG A;  2YPD A;  3IN9 A;  3KSC A;  1J83 A;  3G6J B;  4D69 A;  4DMI A;  3AP7 A;  2A6Y A;  5FOJ B;  1RHI 1;  3BTZ A;  4EN9 B;  3PIG A;  4BK5 A;  3MDP A;  3K75 B;  4QU1 A;  3JB4 C;  3ZO0 B;  4GB3 1;  2PAM A;  3NW4 A;  2YB7 A;  2QQU A;  4GB3 2;  3R6S A;  1HIX A;  1S0C A;  3ACH A;  1UKR A;  4IEU A;  4LK6 A;  3ZXE A;  5A7O A;  2VZT A;  5A3L A;  2WFF 2;  3N9L A;  2YGM A;  3LDB A;  4EN7 B;  3NAP B;  4HK9 A;  3R0R A;  2LW8 A;  3DXT A;  3T09 A;  4QXK A;  1MVE A;  2D6P A;  4UF0 B;  1CR7 A;  1JW6 A;  1QJU 1;  3HR9 A;  4QMA A;  2VCM A;  4WZC A;  3DL3 A;  2XWJ B;  3A0N A;  3AK0 A;  4DXZ A;  3OEA A;  5A3U A;  2C0Z A;  3K3N A;  2HYX A;  2N7G A;  3UGF A;  2CYF A;  5KXB A;  5GZC A;  1OA4 A;  2TEP A;  1PM7 A;  4A3X A;  4OQ9 A;  2JEN A;  1OMI A;  5HCB A;  5GJ6 A;  2GSY A;  4XTP A;  4Q4Y 3;  4FFF A;  4PHZ A;  2BP6 A;  1UZ0 A;  2WR9 A;  1UX7 A;  1LOA A;  1TVG A;  3RJR A;  3D6E A;  4LUL A;  4IV1 A;  1OPM A;  1W8T A;  1YQ5 A;  4PJY A;  4H14 A;  1W3V A;  5C6C A;  5ANN A;  3UET A;  1K5M B;  3GXU A;  4NAO A;  3VBS C;  4FP3 A;  3JD7 2;  5L36 A;  3LDR A;  3LQC A;  3S5Q A;  5BNP C;  5GZF A;  2PYT A;  2WS9 2;  2DUP A;  4QPI B;  5LA0 A;  1R1A 1;  3FHA A;  2VBB A;  4G4F A;  3T2Q A;  1MQT A;  4FPC A;  4UBH A;  2D6K A;  4BCU A;  1R08 2;  4QGN A;  1QH6 A;  1YWK A;  4QX2 A;  4QX7 A;  4P02 B;  1IHM A;  2ZGU A;  5FQ0 B;  1XSR A;  5EPA A;  1ND2 B;  3WP3 A;  1EUT A;  2CGN A;  2TBV A;  3MW3 A;  4PDW B;  3D3A A;  1CN1 A;  5KBF A;  1AXK A;  3KD4 A;  4HAN A;  2RS5 3;  5FMD A;  2DBN A;  1JYW A;  1JZ6 A;  4FFH A;  1UNB A;  2BTV C;  4IV1 B;  4C90 A;  5CFD A;  3N9O A;  1N3O A;  1LED A;  5LAT A;  2R1D A;  3IMN A;  2VME A;  4YW1 A;  1IS5 A;  4A6O A;  1WA6 X;  1X36 A;  5FPB A;  2RM2 3;  1VB4 A;  2O1Q A;  3GDB A;  5A6Q A;  3I49 A;  3M7A A;  4M4R A;  2CAV A;  2R0H A;  3Q8F A;  2IXC A;  4UW6 A;  5CU1 A;  3TRS B;  2EXH A;  3K51 A;  4BJ0 A;  4RR3 A;  1QH7 A;  2VAU A;  1OOP C;  2R04 3;  1T6G C;  3W59 A;  3ZOI A;  4CPB D;  4I3P A;  4B8E A;  4QDS A;  2IXJ A;  3IWZ A;  2P2K A;  1LU1 A;  3HT2 A;  2PMW B;  1YJK A;  4XHX A;  4FPF A;  4OCT A;  2P1B A;  3LZZ A;  3NNL A;  5JIA A;  4N53 B;  4C0B A;  1AJK A;  5ANQ A;  1CES A;  2VMC A;  3GYD A;  3I3B A;  1BVV A;  5D21 A;  1RUD 1;  2WT2 A;  1JYI A;  1CAU B;  1V6I A;  2Z2S B;  3PUA A;  4N7I A;  2FD8 A;  4ES9 A;  2BV4 A;  1OFN A;  3M4F A;  3FFQ A;  1OOP B;  2QQP A;  5FYB A;  3OYW B;  5DUV A;  3VBU C;  5DAX A;  4XAE A;  1N3Q A;  1QIQ A;  4CDQ A;  4AAX A;  4O9G A;  4A7Z A;  1C4R A;  5AFE A;  1C8M 3;  3U11 A;  1MS8 A;  2KD7 A;  4UOJ A;  4ZON A;  2Q1F A;  1ODM A;  3OY8 A;  2B42 B;  3K48 A;  5L9R A;  2ZKN A;  1ALY A;  2YU2 A;  4AE2 A;  2PQS A;  2XUM A;  5CFC A;  2JG9 B;  1JOJ A;  2QQL A;  1NT0 A;  2VOX A;  2XON A;  3LEM A;  2RDN A;  4FPE A;  2HYK A;  1APN A;  2Q4S A;  1AR8 3;  3ZLI A;  1JZ4 A;  2CGO A;  4K6B A;  2QQO A;  3TEX A;  2YRO A;  1Q56 A;  4HN0 A;  1Y7B A;  2V5Y A;  5FYT A;  2IZW A;  1ZZB A;  2W47 A;  1NLQ A;  1TMF 1;  2ET7 A;  4QPW A;  2XR4 A;  4XCA A;  3ZXG A;  1P8J A;  2V4V A;  2VJX A;  5FZE A;  4AG4 A;  4PLN A;  4Y1X A;  5FRE A;  3P5B A;  2XLG A;  4Q2F A;  2ZGO A;  4I30 A;  2HJI A;  3JCI A;  2ATF A;  1MQT C;  1KS5 A;  2DUQ A;  3CBN A;  1PK6 C;  2ZEX A;  3ES1 A;  2E31 A;  1LTE A;  3JB8 A;  2D5F A;  4NRQ A;  2BFU S;  2WT0 A;  5T5O A;  4CCE A;  1BXH A;  3I4I A;  2ZGT A;  3K46 A;  4QHO A;  4BZ4 A;  2HWF 2;  1JYV A;  1C57 A;  3ZN4 A;  1NLR A;  1GKB A;  2X10 A;  1SEF A;  3WQB A;  2ZHL A;  2QNK A;  1EP0 A;  1YI9 A;  3H1M A;  4OLL A;  3VBU A;  4PQ9 A;  3IM0 A;  4XPV A;  1DQ5 A;  1QQP 2;  3DKW A;  3AX4 A;  2JDY A;  3MIB A;  4YM0 A;  5HXM A;  4LBJ A;  1Z78 A;  3AKS A;  3UKN A;  3B9I A;  4NO4 A;  3EJK A;  1GP4 A;  3MLK A;  5FPA A;  1NXM A;  1XE7 A;  1Q8V A;  2H0V A;  2WYF A;  2X53 S;  5FZ1 A;  1D2Q A;  2WQ4 A;  2ZMN A;  1UOG A;  4KWU A;  1GQP A;  4N8M A;  2EAL A;  2OS2 A;  1GP6 A;  2ZGK A;  1NXD 1;  5BNN B;  2AUY A;  4AVT A;  2JD9 A;  1XPW A;  3O14 A;  4KG8 A;  1H4H A;  2AYH A;  3IMM A;  3N7L A;  3H8U A;  4Y20 B;  5D2A A;  2CU5 A;  5H9S A;  2BEO A;  4COZ A;  1HQN A;  3KWV A;  1GZC A;  1TZO A;  3UV9 A;  4BOW A;  4KWK A;  2Y6H A;  1R1A 3;  2ZGM A;  4EWD A;  1H9P A;  1Z0H A;  4BHP A;  1XE8 A;  2RMU 2;  4QB6 A;  1EYB A;  1PO1 2;  2PHL A;  3AP9 A;  3PL0 A;  1MAC A;  3NO8 A;  1FX5 A;  3ACL A;  5HPO A;  5FLJ A;  3FLR A;  3B69 A;  5JZG A;  1C5I A;  5FO8 B;  2YXS A;  4BLI A;  1CPN A;  1OBN A;  1YI7 A;  4CEY A;  4EJR A;  1OQE A;  3IIA A;  1GOH A;  5A70 A;  5A7S A;  2Y38 A;  3PMS A;  2Y26 A;  4UXA A;  1FMD 2;  4FTE A;  1QXJ A;  1LOC A;  4K7J A;  3RSJ A;  4MO3 M;  2Y33 A;  2XL7 A;  1UN1 A;  1KXG A;  2CSG A;  1ZBA 1;  1D0G A;  3USS A;  4CZS A;  1W2O A;  5FBZ A;  1ONA A;  4LA3 A;  4XDO A;  3UK9 A;  4DEV A;  1RUI 3;  1V00 A;  1UD1 A;  4LIV A;  1AX0 A;  2WAA A;  3ITQ A;  5SV8 A;  3K4A A;  1S2K A;  4E27 A;  1BK0 A;  2EAA A;  1HQL A;  2JB4 A;  4UW5 A;  1LGN A;  3MFC A;  2B39 A;  4AQ6 A;  1PO1 1;  2VTX A;  4BXF A;  3PUQ A;  1M4W A;  1NA1 B;  2QDN A;  4RS5 A;  3GF6 A;  5CKQ A;  3HVD A;  1W9T A;  3I2O A;  4S2G A;  1ZA7 A;  2OQ7 A;  5FMO L;  3RZZ A;  1TQ5 A;  1KRI A;  2DTY A;  2QE3 A;  3J26 N;  4OMC A;  1O5U A;  3CDZ B;  3VBR C;  3ST7 A;  3CMG A;  3O7O A;  3KQ4 B;  3UES A;  2VW1 A;  2XDV A;  4BQ5 A;  1S55 A;  5BYN A;  1ZRE A;  4RD7 A;  5J1X A;  4CUA A;  5A7P A;  2FDI A;  1NQJ A;  3NAP A;  5IWF A;  1AX2 A;  2W52 A;  2VZ1 A;  3GCW A;  5FJK A;  3USU B;  1SDW A;  3EXU A;  3FL7 A;  5AVP A;  3ZFF B;  2ZAB A;  4C0H A;  3SC7 X;  4KI5 M;  1POV 0;  1COV 2;  2WN3 A;  2ZZQ A;  5GLW A;  5LB6 A;  4BK4 A;  1QDO A;  1JN2 P;  1PO2 2;  3S7I A;  5DN2 A;  2EXK A;  5FZB A;  3BAL A;  4AQT A;  4DUX A;  1N1T A;  3VDD B;  3V0A A;  5IK8 A;  1CIW A;  1VIW B;  2W1W A;  4U36 A;  1RUG 3;  1W2U A;  1HRI 1;  3VZM A;  3PVE A;  3KGZ A;  2QQM A;  2VZ3 A;  2X8K A;  1X7N A;  4P9J A;  1ENR A;  2PHD A;  4A42 A;  3MIC A;  5C70 A;  1PVC 2;  2GC0 A;  3B3Q E;  3LA7 A;  3N9Q A;  1UY4 A;  2BYV E;  4LKS A;  2AH2 A;  1D4M 3;  2FBE A;  4XJZ A;  1SQ4 A;  2TNF A;  4Y33 A;  4JDN A;  4Y4Y A;  4XF1 A;  1H0B A;  5CKM A;  2HWE 3;  3K4D A;  1Q8P A;  1JYT A;  1OH3 A;  5IFT A;  4PT6 A;  2ZXQ A;  3PTR B;  2DCK A;  1LOE A;  2E32 A;  4UFH A;  4XDQ A;  1HXS 2;  2HEW F;  1UX6 A;  1SLA A;  2ZOE B;  3RNS A;  4AFD A;  1GR3 A;  3CJI B;  5JXG A;  3I8T A;  2CDP A;  3ZDV A;  3OSD A;  2A3W A;  3I3E A;  5I0D A;  4XAB A;  1W6Q B;  1WW6 A;  1X8M A;  4YG0 A;  1WLT A;  2DFB A;  4AVB A;  1ZBE 2;  2VQA A;  4Y22 A;  2E7A A;  4W4Z A;  4CDX A;  5J98 B;  3DGT A;  5IVJ A;  3POF A;  2RDQ A;  4I02 A;  1GBG A;  2ARX A;  5IAV A;  1NZC A;  2GP3 A;  3Q9O A;  1UOB A;  3J8F 1;  3OGG A;  4J25 A;  4KBZ A;  1G86 A;  4MET A;  2DYC A;  4X8P A;  3VV1 A;  1ZX5 A;  4Y5Z 0;  1LRH A;  3OBT A;  3TNP B;  1W8N A;  3ZSM A;  4PBO A;  1AR6 3;  1GUI A;  5JOZ A;  3RWK X;  1SLI A;  4LMF A;  5JXH A;  3I59 B;  4JGY A;  4DO0 A;  3PUR A;  4PLO A;  4HT1 T;  2HKX A;  3WQ0 A;  5DAW A;  1UXX X;  3DUI A;  5CG8 A;  5K9Y A;  4YVS A;  3PTY A;  5EIY B;  3ELN A;  3CEW A;  4IEP A;  5LRR A;  5M0T A;  2P17 A;  2FDK A;  2UY9 A;  3CLP A;  3E6C C;  3AMM A;  3ZFG A;  3O1M A;  3AP4 A;  5G05 L;  4XUP A;  1O3Q A;  5FP7 A;  4A7K A;  1EV1 1;  4XF4 A;  4EZ4 A;  4CCO A;  3I54 A;  2AEN A;  5EYY A;  1ZZ6 A;  4UWD A;  2G9Z A;  1RUC 2;  4P9G A;  2HWB 1;  2E6V A;  3WNM A;  1WW7 A;  5A7W A;  4CRQ A;  2QZ3 A;  2WAB A;  1MS5 A;  1ND3 B;  3CQO A;  4FOY A;  5JI7 A;  4FTB A;  4M3C F;  4IEQ A;  1FAT A;  3ZMN A;  5H9P A;  1MEC 2;  3ORJ A;  2VR4 A;  4I0A A;  4N9I A;  2GNB A;  4QPG A;  3D5O A;  3POS A;  3WR0 A;  2W1U A;  4FP2 A;  2I07 B;  4IW3 A;  4CDW B;  3I59 A;  1RUN A;  5CYY A;  1AR7 1;  4CUC A;  1HB2 A;  3ACF A;  1N1V A;  3C7E A;  4QKB A;  4XZU G;  2YMZ A;  4FO9 A;  1UYX A;  1RHI 3;  1FYU A;  4K9S A;  3CZJ A;  2HWC 2;  3DCQ A;  4BIS A;  2YU1 A;  4LT5 A;  3P6B A;  2W91 A;  4K1Z A;  1U5Y A;  4LIT A;  1TNF A;  3TB0 A;  4X6R B;  5BNN A;  4COV A;  1EAH 2;  3VD7 A;  3IPV B;  4B3N A;  1X82 A;  1KIT A;  3MLJ A;  1W0O A;  2WS9 3;  1V0A A;  2P3I A;  2JDZ A;  4XUQ A;  2A1X A;  2X5I A;  1MS9 A;  1O8P A;  4RA0 A;  4FI9 A;  5EP9 A;  3RZM A;  1T2X A;  5F5I A;  3N7J A;  4AHW A;  1NCQ B;  1XXN A;  1DU3 D;  2ARA A;  3PJY A;  4OZX A;  1IKP A;  1AYN 1;  4LO5 B;  3MIE A;  4GWJ A;  4XF0 A;  2BNO A;  4YG6 A;  4YVS C;  2RR1 2;  5DZF A;  4YZ5 A;  3NWK A;  3MIG A;  3APB A;  5CNA A;  5K4L A;  5CAZ A;  3OD4 A;  2Q8C A;  2JEC A;  5BNQ A;  1H1I A;  1L7L A;  1QHD A;  2LTN A;  3MPB A;  4GB3 3;  2RHP A;  3HPN A;  5GZE A;  4GD4 A;  4K21 A;  3SH3 A;  3VBF C;  3TYJ A;  2ZPX A;  1RUC 3;  3VZL A;  5FZA A;  3W21 A;  4AGR A;  1JU4 A;  1XNK A;  5JZG B;  5FY1 A;  5FMB A;  3OUH A;  4PIZ A;  5DZG A;  1W8Z A;  1YFU A;  3IT8 A;  2I45 A;  1FV3 A;  4JHZ A;  1WCD J;  2R06 2;  4CCJ A;  3O1U A;  1SBF A;  4H55 A;  1VLN A;  1QJZ A;  4Q4W 2;  3G7D A;  2V72 A;  2X05 A;  3DPR C;  5FP8 A;  4WBB A;  1YNA A;  4QQH A;  4M00 A;  1AYM 2;  1W8F A;  2P6C A;  2JX9 A;  4FSJ A;  1EV1 2;  4YVW A;  1CQ9 A;  4LOT A;  3W20 A;  4AED C;  3WCR A;  4IV3 A;  1ND2 A;  3SH4 A;  3RZL A;  1BHG A;  3POI A;  4N53 A;  4Y1Y A;  4NPR A;  2CAU A;  5DAB A;  2YBS A;  5FZ0 A;  4AI1 A;  4CDU B;  4P08 A;  3M3C A;  3HN1 A;  3OOX A;  5J36 A;  3ZX7 A;  3LDK A;  5EV7 A;  1ULF A;  4QPY A;  3ZM8 A;  2B8M A;  1SLC A;  2VGD A;  4LBM A;  4TLF A;  4D94 A;  1VBA 3;  4NRP A;  2WFF 1;  2VTX J;  4TTG A;  1ZBE 3;  3EO6 A;  2E7Q A;  2BFU L;  2KR2 A;  1S2E A;  2V09 A;  4LKD A;  2WFP A;  5F8P A;  4D0Q A;  3EHK A;  1H8T A;  3H42 B;  5HV0 A;  2FDJ A;  2WJS A;  4CPB A;  2FMY A;  3J7H A;  5IAX A;  2ADD A;  1ZRF A;  4NHX A;  5IUQ A;  2BVV A;  2J1S A;  3NJX A;  3VBO A;  1W6P B;  4CDU C;  3B9C A;  3NKT A;  4AVC A;  1YFW A;  1Y4W A;  1SFP A;  4E4Z A;  4ZXE A;  4AGV A;  5AC9 1;  1I9R A;  3S57 A;  1NOV A;  1R08 3;  1S0J A;  2QCS B;  2QJV A;  2EAK A;  2CY6 A;  5FPX A;  5FCC A;  1Z7S 2;  1ZRR A;  3AL5 A;  4O61 A;  5FXV A;  1OH4 A;  4XUO A;  1H1A A;  2PHW A;  2WSU A;  2ORZ A;  3BOD A;  3LAG A;  4AK3 A;  5C3O A;  1PZ8 A;  2EF6 A;  2RS5 1;  2XBO 3;  3EBR A;  4Y24 A;  2JD4 A;  4MX3 A;  3TEY A;  1DQ4 A;  4XBQ A;  1DQ0 A;  4P9X A;  5DAP A;  3A0K A;  5C9A B;  1RUO A;  4AAP A;  1NE4 A;  3IBM A;  5ABJ C;  1AR9 3;  3B01 A;  1PVC 1;  2O8O A;  2Y0O A;  1LOF C;  2PQQ A;  3WG3 A;  5FMC A;  2JDM A;  5A3T A;  3GZE A;  2AGS A;  3E1F 1;  1W2N A;  2VXJ A;  3FLT A;  2WO3 A;  3KT1 A;  2HWD 1;  3B93 A;  2J1E A;  4QX0 A;  5KC6 A;  3PU3 A;  2R07 3;  5A1A A;  2RM2 1;  2A6V A;  2BPA 2;  1RUE 3;  4S2D A;  4XFB A;  4KQ7 A;  3Q8C A;  3JQW A;  3ZYI B;  3RGB A;  3WG4 A;  4CXW A;  1KFU L;  3KT7 A;  4MAD A;  2WL1 A;  2XWB B;  4W6Y A;  1RTV A;  4LXL A;  1C5H A;  5LK5 A;  4QPI A;  4YPJ A;  5FO9 B;  4IE0 A;  2R07 1;  1B09 A;  4GMP 0;  3CF6 E;  3D82 A;  1QJX 2;  3C3V A;  1MQT B;  1MS0 A;  4XMA A;  4LO6 B;  1DYP A;  3WDX A;  5TSW A;  3M3O A;  2XQX A;  5B2G B;  3R4U A;  1JUH A;  5FZO A;  4XQW A;  1LES A;  1G8W A;  3IKW A;  5CFD C;  4R9D A;  1DF0 A;  4OI1 A;  4AED A;  4WVM B;  3AJZ A;  1PVX A;  4RSU A;  3QCW A;  1LEN A;  2QBX A;  5C3Q A;  1QMJ A;  1TE1 B;  4CEY C;  1RIR A;  2PHU A;  3KCC A;  3RMY A;  3WF3 A;  4CTE A;  1Y9M A;  3J8F 2;  2A6Z A;  1IQD C;  2BGP A;  2Q0A A;  3I2D A;  4PLM A;  3T4V A;  1DZQ A;  2QTW B;  2P5B A;  4L0P A;  2HWF 3;  1LGB A;  1S4C A;  4IDZ A;  5FZ6 A;  4XAA A;  5FZI A;  4JKM A;  3WY6 A;  5F6K A;  4IEX A;  1OUX A;  3POW A;  4QXH A;  1RUF 1;  2D6N A;  1GNY A;  1H2K A;  3AYA A;  4CU8 A;  1QF3 A;  1K42 A;  3KGL A;  1VMF A;  4F8A A;  4AFC A;  2JXA A;  1IZ3 A;  4I0B A;  1O7F A;  1GQG A;  4XOG A;  4FAG A;  1IG0 A;  4LO4 B;  5K0U C;  4N90 A;  4BYY A;  3WNK A;  5DG1 A;  4M3C A;  1UQX A;  5DQ0 A;  2KA3 A;  3TN9 2;  1GZW B;  3OEB A;  1NX9 A;  3PUS A;  3ZN6 B;  4GMP 3;  4FT8 A;  5A7W B;  5FYZ A;  3RJ2 X;  2VU9 A;  4OHW A;  4ZU7 A;  3DYM A;  5JAX A;  5A6X A;  3E6B A;  3WEZ A;  1DLL A;  2YZ4 A;  5IAT A;  1PIV 2;  4JKL A;  1O3S A;  3FLP A;  1UAI A;  5JOX A;  1DZT A;  1XYN A;  5K0U B;  2QUO A;  4ASK A;  3WQ1 A;  1MS3 A;  2RS1 1;  2V5D A;  3AZW A;  3BOW A;  1VBA 2;  1NA1 A;  3WF1 A;  2WYS A;  1C1F A;  3FBM A;  3WW1 A;  1W6P A;  1YUD A;  4RFR B;  1LAJ A;  2HWD 2;  1WGP A;  1QQP 3;  5LA9 A;  3ZDS A;  4NAM A;  4HVQ A;  1BYH A;  1AL2 3;  5FLH A;  1XBF A;  1AUY A;  4PIY A;  3O1O A;  4PBP A;  3U10 A;  1I3H A;  2OUJ A;  2JG9 A;  2BQP A;  4CU9 A;  1W03 A;  3VZK A;  5KXC A;  2VBP A;  2W3J A;  3OGV A;  2G19 A;  4OUM A;  1W9S A;  1DYK A;  1POV 1;  2B45 X;  1OLM A;  2G4I A;  4UT5 A;  2ZGP A;  2HBU A;  3OUI A;  4A2U A;  5GKA C;  5H9R A;  1GIC A;  3DPR B;  5T5L A;  3WNX A;  2Z79 A;  3MUZ 1;  3OB8 A;  3VDB A;  1ZVF A;  3SCG A;  1X50 A;  3POE A;  1YO8 A;  2E7T A;  4XIK A;  2XJP A;  4DOU A;  1JS9 A;  2BNN A;  4BQX A;  2XVK A;  1YJL A;  3B94 A;  2J42 A;  1ZZ9 A;  5K0U A;  3VDC A;  2XPJ A;  4FOV A;  4AFB A;  2WSV A;  3T2T A;  3H3Z A;  2WUH A;  3AKQ A;  3GBF A;  3O1V A;  2DWR A;  4XIL A;  4Q29 A;  1PGL 1;  2DCJ A;  3FX3 A;  3ZYR A;  1R1A 2;  3LE0 A;  3AYD A;  1L7Q A;  2XVG A;  3I2K A;  5EJ1 B;  2WLP A;  5LBB A;  2Q8D A;  1CZT A;  3T3Y A;  4DS0 A;  1COV 3;  1MZ5 A;  3LOI A;  4JGZ B;  4LBQ B;  4CCL A;  2A5Z A;  4HXC A;  1YIF A;  2B7Y A;  3LA2 A;  4O7X A;  3KCX A;  1OC1 A;  3JD7 1;  4BQY A;  1F8V A;  1Q8O A;  3WF0 A;  1CAX A;  1FXZ A;  2R07 2;  5T5J A;  1LHN A;  3M1H A;  3ENR A;  3P3N A;  3KM5 A;  2B9V A;  3VD5 A;  4YGC A;  2ZTN A;  2FCT A;  5I8Y A;  1ZBA 2;  3MYX A;  4AI2 A;  1EPW A;  3BPS A;  2PLV 1;  2VCB A;  4ISR A;  1FMD 3;  1PM4 A;  1WLW A;  5GLZ A;  1OA2 A;  2W08 A;  4LBN A;  1AYN 2;  1PVC 3;  3K4Z A;  1VBD 2;  3WG1 A;  3U78 A;  4DRV A;  4MGT A;  1JBC A;  1IOA A;  2RS3 3;  2VNR A;  3JQX A;  5FIX A;  2VVE A;  3S7E A;  2WNV C;  3UJO A;  5CEH A;  4GIQ A;  3FHI B;  4IEZ A;  2VNV A;  1JOB A;  3W5N A;  1AR6 1;  3IAP A;  3WDY A;  1H30 A;  4WVW A;  1J3Q A;  4B7E A;  1GU3 A;  3VBH A;  2Q30 A;  3NNG A;  5T3N A;  1JU3 A;  3JZV A;  4DXR A;  5LW9 A;  1YEW A;  4YNI A;  3MBW A;  4Z8B A;  2FDG A;  1RUE 1;  4M0H A;  2VZP A;  3HQR A;  5DUU A;  5FPV A;  2XJR A;  3V65 A;  4AHX A;  1Z7S 1;  2VQ0 A;  4TXW A;  3HJR A;  3ILN A;  4QWN A;  1BJQ A;  1AYM 1;  4XF9 A;  4CCN A;  5A1L A;  4AI9 A;  3HN3 A;  2IXK A;  3GHN A;  4X8N A;  3WQ7 A;  1MZ6 A;  3ME2 A;  2EIC A;  1OT5 A;  2WIN B;  4QX3 A;  2JG8 A;  2VNO A;  4AI0 A;  2P3K A;  4W65 A;  5GAL A;  2BZD A;  1OSG A;  2A3X A;  4NHL A;  2W1Q A;  4CCD A;  2CNA A;  3VZJ A;  1OF3 A;  1PO2 3;  1R1Z A;  4AR2 A;  5C33 A;  3MF6 A;  2OT7 A;  1C28 A;  3M8L A;  5C8C B;  2GN3 A;  3T4H B;  4S2H A;  1XQN A;  2HWC 1;  2B5H A;  3LIH A;  4MYE A;  4RGK A;  2WO2 A;  5CAD A;  2UUR A;  1RUG 2;  3V56 A;  4DNY A;  3QH7 A;  4Q4Y 2;  2BOI A;  1LU2 A;  3UGH A;  3ZPY A;  1W8W A;  1V9U 1;  5F6L B;  1CVN A;  3F2Z A;  4XFA A;  3TEW A;  3AXE A;  1IG3 A;  4UF0 A;  1VAM A;  2DBI A;  2VBD A;  3VBR A;  2ZX2 A;  1SPP A;  2HWE 1;  4W8J A;  3NNM A;  1H4G A;  3TAY A;  3ECQ A;  3FZ3 A;  4OI4 A;  4RFT 0;  4Y22 B;  1KEX A;  4COU A;  1OOP A;  2ZJC A;  1VBB 2;  2WWS A;  3O5S A;  3R4S A;  4UW3 A;  1W05 A;  1HN1 A;  5KR7 A;  4YZ2 A;  4L97 A;  4YGB A;  1CAU A;  4BIO A;  4CCM A;  3M3E A;  1BMV 2;  2RJ2 A;  1QOS A;  4P9I A;  1GLH A;  3VHP A;  3GGL A;  1V9U 2;  3BB6 A;  5IYY A;  4Q1R A;  4WM8 B;  5A1F A;  1ACC A;  2ES3 A;  2XB6 C;  1QWR A;  1DP0 A;  3AKR A;  4YW7 A;  3N9M A;  4ISQ A;  1PHM A;  1RUG 1;  4XEZ A;  5KXD A;  3VB9 A;  1CZV A;  4BMB A;  2BU9 A;  2ZX1 A;  1CAX B;  2RS1 3;  2RS5 2;  4MHU A;  5FPU A;  4K40 A;  1QU0 A;  1SHW B;  1TG7 A;  1SLT A;  5FZ3 A;  1NYW A;  4RQP B;  1RUJ 3;  3AXD A;  4B1L A;  5LA1 A;  3LEI A;  5FYV A;  2ENR A;  3BYW A;  3VBH C;  4G9S B;  2UYB A;  3VBF B;  2ZEY A;  1JXN A;  5AVA A;  4N53 C;  3GBW A;  3L2Y A;  4GMP 1;  4CDW C;  4F83 A;  3FE5 A;  1JYC A;  2VZS A;  2GNT A;  3LEK A;  3KMH A;  2XG3 A;  4JX0 A;  3ES4 A;  1TME 3;  4QKN A;  4NII A;  4ZZ5 A;  3ZXD A;  1MPX A;  1VBC 1;  2YY1 A;  2ZX4 A;  4NRO A;  3TNQ A;  5L7O B;  2VZO A;  1XNA A;  1CJD A;  2JDK A;  1RHI 2;  4RGG A;  1QQP 1;  2DU0 A;  2VQU A;  2FZ2 A;  2GME A;  1DGW X;  1RUD 2;  4OHV A;  5FXW A;  4HKO A;  5DMY A;  2LM3 A;  2XLA A;  4LUK A;  5ISL A;  2EVX A;  2XML A;  4IE7 A;  4IQP A;  3NJY A;  2YFZ A;  4AF9 A;  1WCK A;  1H9W A;  4TYS A;  3WV6 A;  4NIH A;  1UYZ A;  2VZU A;  2ZBJ A;  4FPY A;  1SAC A;  3AMN A;  4WM7 C;  2E33 A;  4AOC A;  2C26 A;  3VLB B;  2F4L A;  3ZYH A;  1HW5 A;  2VUJ A;  4LR4 A;  1C8M 2;  2J1R A;  2XHK A;  4QDQ A;  4COY A;  1QJY 2;  1R09 3;  5B4N A;  3FHQ A;  3OJB A;  4YG3 A;  2P3Y A;  4UAP A;  1WBF A;  2RR1 3;  2W46 A;  3MV0 1;  4XQD A;  2ZEZ A;  2YBK A;  1HB4 A;  1AR7 3;  4PI0 A;  1KD7 A;  3U07 A;  1HB3 A;  1HRI 2;  4HLT A;  1GV9 A;  2WBK A;  2ZA9 A;  2B4K A;  3WW3 A;  2Z42 A;  2VC9 A;  3LIG A;  1Q8S A;  2DVB A;  5FYY A;  1YIP A;  3PVO A;  5E8A A;  1R64 A;  4EWE A;  1ZRD A;  3J9S A;  5J37 A;  4NID A;  4YM1 A;  5CBL A;  5BNO C;  1YLL A;  4NJ4 A;  5KHG A;  3FJS A;  1V6J A;  1GZW A;  3H1W A;  4CYD A;  4XJU A;  1HRV 2;  2XJU A;  4L9B A;  3WLU A;  4WZF A;  1C3H A;  1UYP A;  3PDQ A;  5DUW A;  3WZ1 A;  3AYE A;  3OY8 B;  4YSF A;  1W6O A;  3AC0 A;  1PMI A;  5E89 A;  2BBV A;  3WVJ A;  4CDX C;  2RM2 2;  4YRD A;  4OHZ A;  3SIS A;  2OVU A;  1V70 A;  4NHY A;  3TBD A;  1Z7S 3;  2W68 A;  3PHM A;  3THC A;  1B35 B;  5D1I A;  5ABJ B;  5LZ6 A;  2JDN A;  3CJX A;  2BVB A;  2C4X A;  2O0O A;  4LHN A;  1OA3 A;  4IGO A;  1CAW A;  5EJ3 A;  1IKQ A;  3ACI A;  3R05 A;  3VD4 A;  1ENS A;  5DZE A;  1LJ7 A;  4CU6 A;  1RMU 3;  1G9A A;  3KQR A;  3ZSJ A;  2CGP A;  4OI2 A;  2HWB 3;  5BUV A;  3VHN A;  1S0D A;  4MGK E;  1GOF A;  5JMC A;  3T0A A;  2R06 3;  3RZH A;  1CAV B;  3GHM A;  3QOP A;  5BNN C;  5J09 A;  1J1L A;  1G9D A;  3UNP A;  3RVH A;  4V1P A;  3AP5 A;  1C8N A;  3EMR A;  3MO4 A;  4U2A A;  4HOO A;  5DUX A;  5FTT C;  1YQ8 A;  5FV3 A;  1AYM 3;  4Q27 A;  1W9F A;  4QX8 A;  3ZYJ B;  2HBT A;  3LFI A;  1Q43 A;  5FYI A;  1UYY A;  4NWW A;  4Q0Q A;  3WUC A;  5JSO A;  1O5L A;  3HNY M;  5L73 A;  2PHX A;  5C9A C;  5KHI A;  1DG6 A;  4SBV A;  1QJX 3;  5LY2 A;  2V73 A;  3FN9 A;  3KVB A;  1DHK B;  4UFJ A;  1UKG A;  3NJV A;  4EN6 B;  2OKX A;  1ZNP A;  4E2S A;  2CWM A;  3VBF A;  2OW4 A;  2NYY A;  5CFC C;  1LHV A;  1YC6 1;  2GC1 A;  4FXG B;  1I6X A;  3MIF A;  5JSP A;  1SCS A;  4BXS V;  4GWI A;  3HT1 A;  2XHN A;  3LA3 A;  2MHF A;  1F9K A;  4O9E A;  4KL1 A;  2F6B A;  2YUE A;  4FPJ A;  1WW4 A;  2GN7 A;  2BGC A;  2MEV 1;  5I0U A;  2X5I C;  1FT9 A;  3U4X A;  1AXY A;  3Q8B A;  4NOT A;  2QDR A;  2OUH A;  5CIS A;  2UWA A;  5F3I A;  1DGR A;  1RMU 2;  4NUB A;  5A33 B;  3O1S A;  2YGL A;  5F5Q A;  1ZBE 1;  3E5X A;  1F31 A;  3AP6 A;  5A3N A;  2FZ1 A;  3BPZ A;  2VZV A;  4NHM A;  4IE4 A;  2TUN A;  2WWJ A;  1FI2 A;  3BU7 A;  2ZAA A;  3VBS A;  4MXW A;  2WNO A;  1JMU B;  2YV8 A;  1W3X A;  4BM8 A;  1HDK A;  1T6B X;  2MEV 3;  1K5J A;  3WNN A;  3FFZ A;  5CZK A;  1JZ8 A;  3B5L B;  5HCF A;  1BZW A;  2XLF A;  1AR9 2;  5F5C A;  1RVF 3;  4DUW A;  3WNP A;  1GAN A;  5JZG C;  2WZP P;  3ZR5 A;  1V6K A;  2YPJ A;  3BN6 A;  4AVA A;  2WZ8 A;  2AC1 A;  4F3J A;  3KV6 A;  1MR5 A;  4AYU A;  3W9A A;  2WRA A;  3VBR B;  4LBK A;  4H7L A;  2PXJ A;  2Y6F A;  1XNB A;  3N3H A;  1UU5 A;  3OBA A;  1KJR A;  4Q4X 3;  3VBO C;  5A32 B;  2ZAH A;  4P5Y A;  4XQ4 A;  1UZY A;  4E2G A;  1NCQ C;  4IEW A;  1DGR N;  1HV1 A;  2ADE A;  1F5F A;  2ZS6 B;  4XDP A;  5LA2 A;  3JBG 1;  3ZXA C;  3N36 A;  2HWF 1;  3JU9 A;  1AL2 2;  1ASJ 2;  5FZ4 A;  4YM3 A;  4OHX A;  1ND3 A;  2WA3 A;  2D93 A;  3MZH A;  5FR3 A;  1ST8 A;  5IFP A;  1UCX A;  5C5T A;  3SEP A;  3TOJ A;  2LS6 A;  2L9L A;  4XCB A;  2VQT A;  4UFL A;  4XJ8 A;  5D8A A;  2Y60 A;  5KHJ A;  2VE1 A;  3FUO A;  3VD3 A;  4FQ4 A;  3N7M A;  3E6D A;  4PI2 A;  2VZQ A;  5J96 B;  1D7P M;  2VOV A;  5IT6 A;  2Z4F A;  5FZ7 A;  1U5X A;  3H50 A;  5FZK A;  3U4S A;  1LOG A;  4LOS A;  1PO1 3;  1UY0 A;  1XRU A;  2CWS A;  4EZH A;  2R49 A;  2A71 A;  3M70 A;  3WSO A;  3I2I A;  4I01 A;  2YC2 A;  1PMJ X;  4P9Y A;  1QJU 2;  1W2A X;  2DVF A;  3UGG A;  3E5Q A;  4LJH A;  1EY2 A;  2HWB 2;  5FY7 A;  3HOB A;  3LEG A;  1K5M A;  1WMX A;  5LBE A;  2HWD 3;  3AZZ A;  3WDT A;  3ZYB A;  4BME A;  4X6Q B;  3MIH A;  5F3E A;  4BE3 A;  4URT A;  5L7O A;  1DBN A;  3BU0 A;  3HEI A;  3AKP A;  3ZIX A;  1WD4 A;  2PHT A;  2IXI A;  3HD8 B;  5A3M A;  5FUP A;  1GYK A;  1VE0 A;  4LHS A;  5BNO B;  3X29 B;  1UPS A;  4ONU A;  2Y8K A;  2JE9 A;  1S2B A;  3WHT A;  1FOD 3;  4M4P A;  3ZMO A;  4MGS A;  4Z2W A;  4GAL A;  3C7O A;  1OUR A;  4OUE A;  1F15 A;  4D3W A;  1Y9G A;  1IS3 A;  3ON7 A;  4YW4 A;  2PEL A;  3ZSK A;  1MZE A;  2WNV B;  1OPO A;  4A3Z A;  4XET A;  1RUF 3;  2ZX3 A;  4E4D X;  3HQU A;  1N1S A;  2OZ6 A;  4KBB A;  2VY0 A;  3O0X A;  3ZIW A;  2A73 B;  4LA2 A;  3QD6 A;  4ATE A;  2Y34 A;  2ZGL A;  3VZN A;  1VBD 3;  4LIU A;  5GZD A;  5JPN B;  3B7M A;  1IPS A;  2A6W A;  3CZU A;  1WUV A;  3HBK A;  5IVY A;  4QKD A;  5FY5 A;  1VRH 1;  2EIE A;  4JGZ A;  1G9B A;  3HWJ A;  3WP6 A;  1ZM1 A;  4LBO A;  2O14 A;  1OLM E;  2ZGN A;  4LHL A;  1X8E A;  2DVD A;  4QXB A;  1H8V A;  3C8X A;  1RC6 A;  4Y1V A;  3LCP A;  2XXZ A;  1SG3 A;  1QJF A;  4XFC A;  3U14 A;  1NCR A;  1GWK A;  4MXW B;  3KZ4 C;  5FY8 A;  4URA A;  1OD5 A;  1DGW A;  1ZZC A;  3I2G A;  5FZL A;  4A44 A;  5GZG A;  5JXI A;  4OI0 A;  5HCH A;  4LPL A;  2WZR 2;  2ZHN A;  4Q1P A;  4XXA A;  4DB5 A;  1ND3 C;  2D6M A;  2K46 A;  4GAZ A;  5CKN A;  4GUL A;  3WXP A;  1YHF A;  1UU4 A;  4HMZ A;  4LE3 A;  1QGL A;  1RXF A;  2YFU A;  1S0F A;  2VCA A;  3FC0 A;  3ZYF A;  2ZAC A;  2D43 A;  4NMI A;  1PK6 A;  1RVF 2;  4IET A;  4JQR A;  3THT A;  1YYN A;  1I5P A;  1TMF 3;  4XIO A;  4D7T A;  2YC4 A;  2XOM A;  3OTF A;  4DQA A;  1UIK A;  2ZX0 A;  3I7D A;  2B46 X;  5FZG A;  4ARY A;  1YFY A;  5C8C A;  1CD3 G;  2A70 A;  4R9C A;  4YW6 A;  4DPN A;  1V6O A;  3PJQ A;  4Q4X 1;  1DQ1 A;  3VGI A;  2JWP A;  1NE6 A;  1COV 1;  1Y43 B;  2ET1 A;  5FKC A;  1OFS A;  1QEX A;  3IDA A;  4GWN A;  4MGI E;  1F4H A;  1O4Y A;  1R08 1;  2ZGS A;  1K5M C;  2BGO A;  4IEO A;  5F5A A;  4QHB A;  3ACG A;  4RL7 A;  2JIJ A;  4QQL A;  4AXO A;  4A6S A;  4R8H A;  3C7H A;  5FZM A;  1AL2 1;  3IDB B;  1RUH 1;  1YFX A;  4BA6 A;  1URX A;  3QLQ A;  4CDW A;  3VUO A;  2RS3 2;  4WM8 C;  4W6X A;  1OLQ A;  5FAX A;  1CPM A;  4RYD A;  4L92 A;  2HEV F;  4KU8 A;  2DVA A;  2D6O X;  3AMH A;  4TLG A;  4Y1Z A;  4IGQ A;  2GMP A;  5IJR A;  1UMI A;  4DXS A;  1HB1 A;  3I3D A;  4GZ9 A;  4IV3 C;  3UT0 A;  5K7P A;  1AJO A;  3BKZ A;  1CAV A;  2WKK A;  3B02 A;  3RG0 A;  3LGR A;  4BQW A;  1DCS A;  2R7E B;  3AFK A;  4B7K A;  3WX5 A;  2R16 A;  4RS5 B;  3H1Y A;  4RN5 A;  1FNZ A;  4C8D A;  5EWS A;  5FWJ A;  5T54 A;  1NAE A;  1OQD A;  4R9B A;  3BUC A;  4KH9 A;  4QB2 A;  1ZYB A;  4JQT A;  2MPF A;  1LNS A;  1VBE 2;  3WNO A;  2W92 A;  4FQZ A;  1VAK A;  3ZFE B;  3VBO B;  5A7Q A;  3WG2 A;  4YVS B;  5IK7 A;  2RG4 A;  1DIW A;  2XJS A;  1F4A A;  4TN7 A;  4UYB A;  5FZO B;  5H9Q A;  1ZRC A;  2AR6 A;  4NRM A;  4ZZ8 A;  1VRH 2;  3KB5 A;  4AED B;  1WLC A;  2CHH A;  2KM2 A;  3ZKU A;  3AB0 A;  3LPG A;  1UZW A;  4D7Y A;  1GZ9 A;  1W0P A;  2R06 1;  3BTY A;  5FKB A;  2DV9 A;  1IPK A;  2WS9 1;  3ASI A;  3T0B A;  4YFZ A;  5JXJ A;  4RS5 C;  2B9U A;  3USU A;  5JPM B;  5IVF A;  4DZG A;  4ZS2 A;  3ZYG A;  4Q4W 3;  1UF2 C;  2WNV A;  4KMQ A;  5E6H A;  5E1R A;  4IL7 A;  4L99 A;  1HN0 A;  4AHY A;  1EV1 3;  3GJA A;  4Y3O A;  4FFG A;  1WZX A;  1V9U 3;  2OII A;  4WM7 B;  3P1I A;  4HBN A;  4B29 A;  4P14 A;  5BY5 A;  1SZB A;  4XXP A;  4D8M A;  5C4W A;  3CNA A;  4PDW A;  4EWA A;  4JDO A;  4XTM A;  4MHR A;  5L19 A;  2EIB A;  1I1E A;  2AZ5 A;  2VUC A;  4XZP A;  3UYJ A;  3MID A;  4KWJ A;  4ORF A;  5FZ8 A;  1CWP A;  4AW7 A;  4QHZ A;  4BB3 A;  1UOJ A;  3POG A;  3RYP A;  5I91 A;  4XFF A;  2BRT A;  2EID A;  4BIF A;  4DEQ A;  4HVO A;  1LOF A;  5E88 A;  4LQR A;  4YZ4 A;  1JZ2 A;  1ULD A;  1VBB 3;  2C24 A;  1J59 A;  2UWC A;  1QXP A;  1LOD A;  3III A;  2VMG A;  2SBA A;  2JKX A;  2RVA A;  2FCU A;  2NP0 A;  2XUE A;  4LBL A;  4I0W B;  4AEM A;  3GM8 A;  4DY5 A;  5JR2 A;  4CP9 B;  2HH9 A;  1NY7 1;  2WNU B;  5FZH A;  5HBA A;  1W90 A;  3MW2 A;  3OF1 A;  1W06 A;  1E5I A;  4HK8 A;  4BLJ A;  4EN8 B;  5FUI A;  4CDX B;  2VTF A;  2Y6K A;  2VMD A;  2VZR A;  1JHN A;  2LRO A;  4J6G A;  2D3P A;  1BKZ A;  3SLI A;  1Q3E A;  3U0Z A;  4A41 A;  1D4M 2;  1PMH X;  1J1T A;  4HSJ A;  5T52 A;  1VBA 1;  1ASJ 1;  3NQH A;  4OVE A;  2EIG A;  5FY4 A;  5IVE A;  1BEV 2;  4XC9 A;  2HWE 2;  2J1U A;  2A3Y A;  5LAS A;  5EJZ B;  3SKJ E;  4AVV A;  3AYC A;  5F37 A;  2JDA A;  3QAC A;  3C7G A;  3HMY A;  3NJZ A;  1CZS A;  2VMI A;  1QJY 3;  1R09 2;  1B35 A;  2ZZJ A;  5HXV A;  2K0G A;  2P34 A;  4AGG A;  3TWI A;  5C9A A;  4GJZ A;  5KHH A;  4E4H A;  1KJL A;  4B4R A;  1HQW A;  4I2O A;  3PLQ A;  1QNW A;  2C9A A;  3J7M A;  4L11 A;  1REE A;  2R32 A;  1HRI 3;  5A32 A;  4Q0U A;  2PA7 A;  5A6Y A;  4GJY A;  4E4S A;  1W2T A;  2LUW A;  2PAK A;  4N9H A;  4OUS A;  3W5M A;  2IC1 A;  4Q5O A;  1STM A;  4HKL A;  3T2P A;  1OKQ A;  2C1F A;  2JIG A;  2VCC A;  3O0V A;  4P9L A;  5IW0 A;  1UZZ A;  4G3Y C;  2JDU A;  5C7G A;  5JSR A;  5E16 A;  4EQV A;  4FPH A;  4OYU A;  1XU1 A;  3RQ0 A;  1UY2 A;  1RUJ 1;  1POV 3;  2EXJ A;  3DF0 A;  1PGL 2;  1WD3 A;  1SLL A;  4ZKT B;  1UY1 A;  2W0X A;  1OQ1 A;  4XFG A;  4LK7 A;  2ID4 A;  4PCR A;  3AFG A;  3V0A B;  4Y5S A;  3E5U A;  1DLC A;  5C8W A;  2BER A;  4ET7 A;  1AL0 G;  2FCV A;  3NNJ A;  5FXX A;  1ENQ A;  3LD8 A;  4F7Z A;  3NVC A;  5LK7 B;  2RR1 1;  1HXS 1;  1ULG A;  5FP3 A;  1JH5 A;  1PX4 A;  5EYX A;  1WKY A;  4RHV 1;  1K45 A;  2W39 A;  4WVM A;  3K77 A;  3ALQ A;  2WN2 A;  2Q5T A;  3DN7 A;  4E8D A;  3HIF A;  3JBG 3;  4TZD A;  3MI8 A;  2WFF 3;  2X5I B;  1LGC A;  4AWD A;  4CEW B;  4HZF A;  3NV4 A;  4YW3 A;  1HRV 3;  4JZR A;  2BWA A;  1XJA A;  1MEC 3;  1HKD A;  1A34 A;  5JOY A;  1XYP A;  1U12 A;  2JDP A;  2ZHK A;  3JUU A;  4OQ8 A;  1H6Y A;  5C4W B;  1RUI 1;  4ES8 A;  2IFR A;  4HN1 A;  4BQ3 A;  3K3O A;  2NQY A;  4WM7 A;  1VR3 A;  2NMN A;  3KVA A;  2NN8 A;  2VO5 A;  4CU7 A;  5F9T A;  1JHJ A;  4A45 A;  5I93 A;  2IXL A;  4JKK A;  1LKN A;  2OX0 A;  2ZGR A;  3WF4 A;  4CEW A;  4HG6 B;  4FTS A;  4OHY A;  2R30 A;  4QQO A;  2YC0 A;  3OGR A;  1EAH 3;  3ILR A;  1MEC 1;  4HET A;  2ETE A;  3ABZ A;  4N43 B;  1RUE 2;  2WZR 1;  2HLE A;  1JZ5 A;  2XVL A;  4CP0 A;  4IUG A;  2XKO A;  3SIT A;  4WV8 A;  5IVV A;  1KGY A;  3RZK A;  4C1W A;  4V2V A;  4UFM A;  3N9P A;  3UKT A;  1OI6 A;  4BQ1 A;  4D6R A;  3PIJ A;  1VB2 A;  4QPG C;  3ZFG B;  1UIJ A;  5FQ0 A;  2JDH A;  3H3L A;  1NQD A;  4HVR A;  4R4Z A;  4FAH A;  3PU8 A;  4GA9 A;  1VBC 2;  3AMQ A;  3CIH A;  1PX3 A;  1RGS A;  3OPW A;  4GKY A;  4LNV A;  4RQP C;  1VBD 1;  5FK8 A;  4KWL A;  3T30 A;  4CUB A;  2J1A A;  5A3P A;  2VUA A;  2W95 A;  4HL0 A;  4D6Q A;  4Y5T A;  3WCS A;  3WP4 A;  3VBS B;  1HX6 A;  4NE9 A;  3CU7 A;  3M3I A;  4C91 A;  3S6P A;  5LCW L;  2D3S A;  1GQH A;  1ASJ 3;  4GKX A;  5BNP B;  5JR7 B;  3KV9 A;  4O65 A;  2YYO A;  5A33 A;  2X09 A;  1MVQ A;  1AVB A;  1SPP B;  4JRA A;  1XC6 A;  2Q8E A;  1W6O B;  2VD7 A;  4KG0 A;  4R4X A;  5F1R A;  3QH6 A;  5GLU A;  3BIE A;  1LEC A;  2VUD A;  4AEK A;  4E8C A;  3MFA A;  2GC3 A;  3WDU A;  1ND2 C;  2OZJ A;  1JI6 A;  3GAL A;  1VP6 A;  2RJK A;  3VD9 A;  2VVD A;  3WDW A;  5ACA 3;  1C1L A;  1YQ2 A;  2WNE A;  3MHZ A;  4QD2 A;  5C71 A;  2R04 2;  3NV2 A;  4JDM A;  5FFO C;  1LUL A;  3C7F A;  1KQR A;  1X33 A;  3O1R A;  3WUD A;  4YWA A;  1BQP A;  3AMP A;  3TN9 3;  3ZN6 A;  1QJU 3;  4V2W A;  1JOD A;  2PN5 A;  5FPL A;  3AJY A;  1D4M 1;  1W8H A;  3VBU B;  1WWY A;  1UO9 A;  4S2F A;  1US2 A;  1U0A A;  3ZR6 A;  4B1M A;  2VEC A;  1GSL A;  3M3Q A;  3KF5 A;  1RL3 A;  5FP9 A;  2RMU 1;  3GCX A;  4KGG A;  3WW4 A;  1O6U A;  4J1X A;  4FPO B;  1LCL A;  2ORX A;  1HJF A;  3VKM A;  5FY0 A;  4XF3 A;  5G04 L;  3SKV A;  3DXU A;  4YVW C;  3WD5 A;  3UKV A;  1LB2 A;  5LRS A;  3WP5 A;  3VDA A;  1YXW A;  2J7M A;  4L8Q A;  3RWN A;  1S0E A;  2W1S A;  2R6Q A;  2DCZ A;  3KHB A;  3OGS A;  3VHO A;  4UFI A;  3OBR A;  2WA4 A;  1G9C A;  3SHR A;  2XJT A;  5CVR A;  4RR3 C;  4NIG A;  2VNG A;  2XBO 1;  3ILF A;  2Y64 A;  4JC1 A;  2EA7 A;  4DIN B;  5FZF A;  2GAL A;  1AR8 2;  2JJ6 A;  4Z82 A;  1DDL A;  1IS6 A;  1WW5 A;  1BCX A;  2F4P A;  1BVP 1;  1J3P A;  1W9W A;  3D0J A;  5JWP A;  1HXS 3;  1A78 A;  2UWB A;  1X9P A;  3MF9 A;  1RUH 3;  4Z2A A;  5FYM A;  5AC9 3;  5C8C C;  4PF5 A;  1E57 A;  3H0O A;  4CDU A;  3I97 A;  3LWC A;  2IWG B;  4RQP A;  2D6L X;  2PLV 3;  1TME 1;  4RR3 B;  2FMD A;  1U5I A;  4YFW A;  4XAC A;  1W99 A;  4P9W A;  3O1P A;  3GBG A;  5FYS A;  2AEZ A;  5AFB A;  4EYU A;  5LWB A;  2A7A A;  2JIC A;  4C1X A;  2WZR 3;  3T1L A;  5LBC A;  2DCY A;  4XE9 A;  4AQS A;  1JUI A;  4SLI A;  2JG8 B;  1OHF A;  4D6S A;  4QGL A;  3ATG A;  3CJI A;  2JE7 A;  2D44 A;  4GWM A;  3N7K A;  1J58 A;  1DFQ A;  4LLF A;  2PFW A;  4JVA A;  2P3J A;  1PGS A;  1KDM A;  3IB3 A;  3L9J T;  2RDR A;  1QOO A;  2VH9 A;  1AYN 3;  2NZ9 A;  3AKT A;  2GAU A;  3OUJ A;  1W39 A;  2D3R A;  3LSD A;  1FOD 2;  3BCW A;  2JEM A;  3AL6 A;  3THD A;  1EUU A;  3VN4 A;  1GWM A;  1BEV 1;  4GH4 C;  5FYH A;  5K8S A;  1UWW A;  3H7J A;  3OPZ A;  5IK5 A;  1ULO A;  4K8R B;  5JDB A;  2YG0 A;  2IVJ A;  1OLR A;  4DUV A;  1H2M A;  1W04 A;  3SXW A;  5CFD B;  5JOW A;  3SMH A;  3PUI A;  1ODN A;  3AZV A;  1RUH 2;  5L9V A;  2OYZ A;  5AC9 2;  5J3U A;  1HV0 A;  4LHK A;  1D2S A;  5D8A B;  3GZA A;  4E9K A;  1H2L A;  4EV0 A;  4GXL A;  2I74 A;  1UOF A;  2RS1 2;  2PLV 2;  2WAO A;  1W9Y A;  3L2H A;  4EN0 A;  4Q0V A;  4NWV A;  4YAR A;  2WT1 A;  1XND A;  3OGJ A;  1L3J A;  1DQ2 A;  2GDF A;  3A4U A;  1QKQ A;  4L2N A;  1PO2 1;  2Y0I A;  3VZO A;  2VW2 A;  3QBQ A;  2GH2 A;  5FWE A;  4NIA A;  3H3U A;  1Q5O A;  3POB A;  4AVS A;  3Q8E A;  2VM9 A;  4PDW C;  4ZY9 A;  1Q8Q A;  4UBG A;  5D8A C;  1DGL A;  1SDD B;  4QAW A;  2Y6J A;  1A8D A;  2ZCW A;  3GJB A;  5F32 A;  4IV1 C;  5ACA 1;  2JE8 A;  4QKF A;  4ZS3 A;  3AZX A;  4DY3 A;  2W87 A;  4FOQ A;  3U75 A;  4IER A;  1VRH 3;  1XSQ A;  5EHD A;  3UJQ A;  4ARX A;  4QQ2 A;  5IVB A;  2D5H A;  2WQZ C;  4CCK A;  1OVP A;  4LKF A;  5LY1 A;  3CL1 A;  4IEY A;  4JAA A;  1S0I A;  5B4X A;  3K2O A;  3U37 A;  4AFM A;  2OPW A;  2GNM A;  3SNM A;  3VL8 A;  1UW8 A;  3OG2 A;  3INA A;  3URF A;  4CXX A;  1W8O A;  2QQI A;  2RJL A;  1CAW B;  4LEJ A;  3BIW E;  4Z1V A;  1QJE A;  2LRP A;  4IEV A;  4KU7 A;  3MW4 A;  1WMF A;  2G9G A;  1UMH A;  3VKF C;  5LEK A;  1DZR A;  4UI9 L;  2Q1M A;  2GH8 A;  4BQ2 A;  3M2M A;  1YRZ A;  4JHT A;  5FZD A;  1CJP A;  3T08 A;  4OMD A;  1OXC A;  2QQK A;  5JI9 A;  3SCH A;  1KDK A;  2VMF A;  5EZW A;  2WLQ A;  2ZHM A;  2VXR A;  1UY3 A;  5EXO A;  1LR5 A;  4RHV 2;  1NZI A;  4LO7 A;  3S30 A;  2YBP A;  3ZFF C;  1S1A A;  3MLL A;  1FMD 1;  5HI0 A;  2NM1 A;  3SCF A;  3A23 A;  3ZVX A;  5EFU A;  5I8S A;  5BV6 A;  5BPX A;  1JYN A;  5BNP A;  1B35 C;  3PUH A;  3LPF A;  4CXY A;  4XUR A;  1FPN 1;  4GH4 A;  1YQC A;  3AZY A;  2PTM A;  1ZZ8 A;  1XNC A;  2BBA A;  4YGD A;  3VKO A;  2P6H A;  4MUV A;  3NNF A;  4ZHN A;  1AZD A;  4TSV A;  1OUS A;  1V6M A;  1D0H A;  4YW5 A;  4WVZ A;  2RS3 1;  3LOB A;  3ZSE A;  5FZ9 A;  3WNL A;  3A21 A;  4HKW A;  1BBT 2;  2H0B A;  3O0W A;  1JYX A;  2UY8 A;  3GZT B;  4ZU4 A;  4GQ7 A;  3RI8 A;  1VMH A;  2C9K A;  1N47 A;  1RIN A;  1EPZ A;  1PGW 1;  5FK7 A;  3N35 A;  2A6X A;  1JZ3 A;  2CL2 A;  1E5R A;  4CVU A;  3PNA A;  1LHW A;  4XBL A;  4H2A A;  3NV1 A;  2XKP A;  1RUD 3;  3KV5 A;  1XYO A;  1SMV A;  1O3T A;  2BDR A;  4JRL A;  1YCI A;  2ILM A;  4FBF A;  2O8Q A;  2VPV A;  2XQR A;  2CTV A;  2W9X A;  3JD7 3;  4PQQ A;  1U5Z A;  1N3P A;  4PIX A;  4AFA A;  4CDQ B;  3NAP C;  2DVG A;  2QQN A;  3IZO A;  3OYW A;  1GP5 A;  1DYO A;  1PNF A;  2C5D A;  5T55 A;  4QX1 A;  1H8T B;  2RV9 A;  3H8X A;  1HLC A;  1LHU A;  2BOJ A;  5ABJ A;  4M3C B;  3DYP A;  2RE9 A;  2DFC A;  4MVT A;  2BW8 A;  2Y6G A;  4ERO A;  4P5H A;  3S0M A;  5JLV A;  1CGP A;  3LFM A;  4K8F A;  1GZT A;  4ZPI A;  1AR7 2;  3LF7 A;  2D40 A;  3HAG A;  4PF1 A;  4KGQ A;  1H2N A;  2JG8 C;  1NUK A;  4LLO A;  3RFR A;  5DPN A;  3ZPO A;  2UU8 A;  1O59 A;  5C3S A;  1JZ7 A;  1MS4 A;  4XYX A;  2PHR A;  5T5P A;  1AHS A;  5KWR A;  5A80 A;  1BEV 3;  1W6N A;  4YYO A;  1SFN A;  4MGZ E;  2QQJ A;  2D7F A;  1UL9 A;  3T1M A;  3DEM A;  3N9N A;  2VOW A;  4CEW C;  1W28 A;  1G7Y A;  4WM8 A;  3ZKY A;  4RGA A;  1QNY A;  1YQ6 A;  4MZU A;  4IE6 A;  2R04 1;  5FOB B;  1C8M 1;  3WOG A;  5C5U A;  2FDH A;  3KCY A;  4QU2 A;  3RZJ A;  2PAE A;  5C3R A;  4OZO A;  5FDB A;  4W50 A;  3A7Q A;  1FAY A;  1E5S A;  4MSV A;  4Q8K A;  2R0F A;  5DAQ A;  4XFI A;  4N43 A;  1GWL A;  3C2U A;  2IXH A;  4XW3 A;  4WVV A;  4IES A;  1M06 G;  5FZC A;  1IGO A;  1QJX 1;  1A3K A;  3BTX A;  4TWT A;  3WW2 A;  5C3P A;  3FUQ A;  4MGQ A;  5FRA A;  1RMU 1;  1F2N A;  1E5H A;  2NMO A;  4MH0 E;  1FOD 1;  2ARB A;  4MOA A;  2WDB A;  4ZXK A;  4XJW A;  5L7O C;  1F35 A;  2ERF A;  1UMZ A;  1NKG A;  1UU6 A;  2CDO A;  2QVS B;  1REF A;  2WWU A;  4NVP A;  5F3C A;  1ZZ7 A;  4AL9 A;  4FPL A;  3KV4 A;  2IFW A;  4QDR A;  5HCA A;  1W6Q A;  3J4U H;  5BXX A;  3A22 A;  5FBJ A;  2JB8 A;  5FJH A;  4YZ1 A;  5CB7 A;  5I0T A;  3F95 A;  4CUG A;  4NR1 A;  4Q8L A;  2NLR A;  3V0B A;  1LEM A;  3MPP G;  2K9Z A;  3VL9 A;  2FDF A;  4NPL A;  3PVN A;  1POQ A;  5GLT A;  1FPN 3;  1PNG A;  2XH6 A;  3KLS A;  3J7L A;  3AM2 A;  4BQ4 A;  5F2S A;  3B00 A;  4BH9 A;  3LB9 A;  5C4W C;  5I0R A;  3POJ A;  4HSL A;  2W5F A;  2Z5W A;  1NA1 C;  1BBT 1;  4CP9 A;  4Q0P A;  1CON A;  1G6N A;  4FXK B;  2WQ8 A;  1O91 A;  5KC5 A;  3ZXF A;  4Y26 A;  3VHR A;  3KF3 A;  4XJA A;  1RED A;  3V0B B;  1BMV 1;  1V6L A;  3BTA A;  3KHC A;  4R9A A;  1CX1 A;  1ZRI A;  1V6N A;  1OF4 A;  3ZXJ A;  4N43 C;  1ULP A;  3RYK A;  2AAC A;  1BBT 3;  3O12 A;  3VBH B;  1NCR B;  4N7U A;  4CP1 A;  4MXV A;  4D7S A;  4CSW A;  1HJG A;  5JIU A;  1L7R A;  3BI3 A;  3JBG 2;  4B4P A;  4QM9 A;  3KT4 A;  3H9A A;  1GOG A;  2IUW A;  4P00 B;  4KNC A;  1EAH 1;  2ZMK A;  1XOY A;  1KS4 A;  1VPH A;  4H3W A;  1US3 A;  3I3M A;  4Q4Y 1;  4DXT A;  4K20 A;  3JXS A;  4IND A;  2VMH A;  2PHF A;  1PZ7 A;  3RDI A;  3VDD C;  2K2S A;  1SLB A;  1RVF 1;  1NCR C;  2DDU A;  3WIN E;  4XBN A;  4A7Y A;  5F39 A;  1AR9 1;  2QZ2 A;  1VBC 3;  3DYO A;  5FYU A;  3RRD A;  4AQ2 A;  5CA6 A;  4FCA A;  2DTW A;  3D0S A;  2WO7 A;  4HPK B;  2GC2 A;  2WII B;  5GM0 A;  3WDV A;  4AEJ A;  3H7Y A;  4LBQ D;  4BWO A;  1K12 A;  3PVB B;  5BNO A;  1MS1 A;  4DRR A;  1MZF A;  1RIT A;  1TEI A;  3IDE A;  1ULC A;  1H1M A;  4Q4W 1;  4YW2 A;  4QX5 A;  2E63 A;  3RS6 A;  2BWC A;  1QDC A;  4YM2 A;  4BU2 A;  5DAV A;  2QKD A;  1LHO A;  4R52 A;  3IPV A;  5JCT A;  2ZKL A;  4DFS A;  3ZXK A;  4Q4V 3;  3RYR A;  1RJ7 A;  2YDE A;  4HON A;  1VMJ A;  2OPK A;  1VBE 1;  4XJ9 A;  3S5A A;  5F3G A;  2DCT A;  2GND A;  1WCS A;  1Y3T A;  3EB7 A;  4MV2 A;  1ENX A;  2RDS A;  4B4Q A;  5F7U A;  1W6M A;  2CV6 A;  5IK4 A;  1UXZ A;  3J7N A;  1WBL A;  2H6B A;  5LBF A;  3RMX A;  3VKN A;  5ERL A;  3PME A;  5FPZ A;  5FO7 B;  4ASL A;  1O3R A;  1VJ2 A;  4ATF A;  5FY9 A;  2BJS A;  2GMM A;  1XE0 A;  2V4A A;  1CX4 A;  2ZGQ A;  2C6S A;  4AI8 A;  3OPT A;  1OKO A;  2VL4 A;  3CJI C;  2ZML A;  3BOP A;  2I2S A;  3LKJ A;  2Z69 A;  4M0N A;  3FMG A;  4CDQ C;  5I0S A;  1BK1 A;  2GP5 A;  4MLO A;  5DDJ 3;  4JTN A;  1AR8 1;  1WLD A;  4XFH A;  2KXL A;  1WMD A;  2QQW A;  2MNG A;  2X29 A;  3LSE A;  4W6W A;  4COW A;  3Q8A A;  4FOW A;  3ROU A;  1W6M B;  1WME A;  2SLI A;  1XB9 A;  1A8M A;  2H6C A;  2P4E A;  2VOT A;  2XBO 2;  5FXZ A;  3RPQ A;  1KFX L;  3WT3 A;  2ARE A;  2OA2 A;  3VDD A;  1QOT A;  3NRU A;  3ETP A;  3R4D B;  3FWE A;  4ZU5 A;  4XUN A;  1SCR A;  3ETQ A;  2XJQ A;  3I3Q A;  1SBD A;  1GFF 2;  1LOB A;  2RMU 3;  2D98 A;  5SV5 A;  2ARC A;  3KS7 A;  4K3U A;  5HV4 A;  2GZW A;  1NY7 2;  3IAQ A;  5FUN A;  1GMM A;  5ACA 2;  4Z92 B;  3EYP A;  3O1T A;  5I8T A;  3NV3 A;  5IHR A;  3RZG A;  1S0G A;  3D4K A;  2Q1Z B;  1VRB A;  2DF7 A;  4LTA A;  4FPK A;  1GNH A;  2XJV A;  3CKH A;  5DG2 A;  1N1Y A;  5JVV A;  1D4V B;  3NKG A;  1RUF 2;  4Q26 A;  1AXZ A;  2Q8O A;  1FPN 2;  1WCQ A;  4GH4 B;  4LKE A;  4OUL A;  3SH5 A;  5KXE A;  4IV3 B;  1UPI A;  3DEC A;  3WHU A;  4QT6 A;  1K3I A;  1J3R A;  1RJ8 A;  1CIY A;  1RUI 2;  3MEP A;  4QQP A;  1J84 A;  3V64 A;  4I3G A;  1G9F A;  2J22 A;  3HNB M;  4Y1U A;  5EQU A;  1RYY A;  3THP A;  3P3P A;  3I2J A;  2VG9 A;  2WNU A;  4CA9 A;  4AHZ A;  1VAL A;  2DUR A;  3ZN5 A;  5J48 A;  4MGY E;  3ZFE C;  1I5Z A;  4FVV A;  1PZ9 A;  5DDJ 2;  2E26 A;  3DV8 A;  3J8F 3;  1VBB 1;  1SBE A;  4M3C E;  5CFC B;  1IS4 A;  3H8R A;  1TNR A;  2JKB A;  4MG2 A;  2FHR A;  1WA4 A;  2UYA A;  4LOR A;  5A3W A;  3H8O A;  1SFY A;  4JGY B;  4IGP A;  5A3O A;  4UW4 A;  1VAV A;  4QGM A;  2MEV 2;  4CEY B;  5FYC A;  3T0D A;  2BUK A;  4BPZ A;  2IVI B;  4HFS A;  5F2W A;  3D8C A;  5CG9 A;  4IE5 A;  4LBQ A;  4E2Q A;  4XMI A;  4CE8 A;  3NST A;  4J1W A;  4JV4 A;  2WO1 A;  1QY4 A;  4H7M A;  2E9Q A;  4QPI C;  1QJY 1;  1PIV 1;  2AEY A;  5A6Z A;  4UFK A;  3MGU A;  3WF2 A;  3ZXL A;  4Q4X 2;  4YZ3 A;  2OQ6 A;  1RUJ 2;  4JGY C;  4NPM A;  1W6N B;  2ZEW A;  1TMF 2;  3GNE A;  3E97 A;  4Q0S A;  3TN9 1;  3GZU C;  4LUM A;  3ZFF A;  2OXB A;  4QPG B;  1PIV 3;  2VOK A;  3ZFG C;  1BLZ A;  2WC2 A;  4XUT A;  1TME 2;  4JTO A;  1JOP A;  1OD3 A;  1W8U A;  3NMB A;  2D97 A;  2Y6L A;  2VVF A;  3OCP A;  4Q4V 2;  1AF9 A;  2W2I A;  1O4Z A;  4QXC A;  1Y9Q A;  4Z07 A;  4IXL A;  4QB1 A;  4AI3 A;  4FFI A;  3ZFE A;  1W0N A;  5A7N A;  2LAL A;  1NG0 A;  2GU9 A;  4YLZ A;  3CHX A;  4Y4R A;  3MUY 1;  5FLI A;  1F5J A;  3W58 A;  3AVR A;  4EE2 A;  5L9B A; 
#chains in the Genus database with same CATH homology
 5A6X A;  4UT5 A;  1OUX A;  2JDU A;  1UZV A;  1W8H A;  5D2A A;  5A70 A;  2BV4 A;  4AOC A;  5HCH A;  2XR4 A;  5A3O A;  1OVS A;  1OUS A;  1OXC A;  5A6Q A;  2JDP A;  2JDY A;  2VUD A;  2BOJ A;  1W8F A;  2JDH A;  2BOI A;  2JDM A;  3ZDV A;  4CE8 A;  1OVP A;  2JDN A;  2JDK A;  1UQX A;  1GZT A;  2WRA A;  3DCQ A;  5A6Y A;  2BP6 A;  2VUC A;  2WR9 A;  2CHH A;  2VNV A;  5A6Z A;  1OUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...