2BV4A

1.0a structure of chromobacterium violaceum lectin in complex with alpha-methyl-mannoside
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSGNVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual Entropy Driven Affinity of Chromobacterium Violaceum Lectin Cv-Iil Towards Fucose and Mannose
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Lectin
molecule keywords LECTIN CV-IIL
total genus 25
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bv4A00
2VUDA 2BOIA 2JDPA 1OVPA 2JDMA 5A6YA 2JDUA 2XR4A 4CE8A 5A6QA 1UZVA 2VUCA 1W8FA 1GZTA 2VNVA 5D2AA 1UQXA 2JDKA 5A70A 1OURA 1OXCA 1W8HA 5HCHA 2WR9A 2BP6A 5A6XA 2CHHA 3DCQA 3ZDVA 2BOJA 1OUSA 5A6ZA 2JDYA 2BV4A 2JDHA 5A3OA 1OVSA 4AOCA 2JDNA 2WRAA 4UT5A 1OUXA
chains in the Genus database with same CATH superfamily
5JIUA 4RHV3 5K0UB 4W6XA 1NA1B 1PIV2 2QUOA 2X8KA 3LPFA 4Q4W3 5C8CA 3OG2A 1L7QA 4MGKE 4RQPB 4YFWA 5DZFA 4AEDA 4UBHA 3CDZB 4LE4A 5FFOC 1NA1C 4LEJA 1UZWA 5JXGA 3R4SA 1JU4A 1UOFA 4IV3B 4N9HA 3PNAA 2K46A 1Z7S1 3TWIA 2VH9A 2RS53 5DPNA 3KGZA 3K3OA 5CIRA 2PHFA 5C5TA 2IXKA 1ONAA 4JRAA 1UPSA 2YBKA 3THCA 3KV6A 4Y4RA 1IZ3A 4HBNA 3OOXA 4IEWA 3NJZA 3O0VA 2BU9A 4XAEA 2ZS6B 1MZ5A 1A34A 1YYNA 3ACIA 1HJFA 1VBB3 5EXOA 3J9SA 5JLVA 1UW8A 3PTYA 2RG4A 5FZBA 2CGPA 4JVAA 5IVYA 1F5JA 5CFCA 2GNBA 2J22A 4RSUA 4D7TA 3POEA 2IVJA 1G6NA 4Y5Z0 1AR93 2HJIA 4AI0A 3J8F2 3BTYA 1UZYA 3CIHA 5GZGA 1F4AA 4NRQA 5F6KA 1GQGA 2VAUA 1Y43B 5CG9A 3IDCB 2TUNA 1FPN1 5FZ9A 3EHKA 5LEJA 4HL0A 1IS4A 3IT8A 1OKQA 1KQRA 2BWCA 2JG8C 2DFCA 3K2OA 4META 4RD7A 5KXEA 1N1VA 2WWSA 4IDZA 3ABZA 1H8TC 1W6OA 1AJOA 2ZAAA 4PDWA 3NV3A 3ZN4A 4AW7A 4BQ2A 3AC0A 3ZXDA 3MV01 3HBKA 3WSOA 3BTZA 2A3WA 4LK7A 4NVPA 4UFJA 1CONA 2VOTA 4AAPA 5F37A 5A6QA 2A6XA 2YHJA 2YU2A 1PGSA 3AKPA 1CR7A 5LBBA 3OPZA 4PDWC 4ASMB 1QHDA 3VV1A 3ZPOA 1GV9A 4MGTA 2VZTA 4EQVA 3RWKX 1JOPA 4I0WB 3ENRA 4IV1C 3AP9A 1OPOA 3EO6A 3H42B 5KBFA 3JCIA 2HWF3 3LDRA 4XTPA 4P9YA 3EMRA 4L92A 3ZYHA 1H9PA 1W0NA 5KHHA 4DXSA 1ENXA 1AL22 2P6CA 2VMGA 3P5BA 3S6PA 2PLV1 1NE6A 2YFZA 1MEC2 1TE1B 1V70A 3FX3A 1ZZ6A 4A6SA 2TBVA 2O8QA 5CA6A 5C33A 3H1YA 2J1RA 3GBGA 1Y9QA 4CVUA 3RGBA 3NNMA 3MPBA 1AYN3 1GP4A 4Y5SA 2Y60A 4QM9A 3SCHA 5A3TA 2EVXA 5GZFA 1MEC1 5CISA 1ZVFA 2XG3A 2WABA 1IGOA 1XSRA 2WWJA 1Z7S3 1ENSA 3JQXA 1OLQA 4C90A 2GAUA 3KF3A 4ATFA 3NJVA 5F32A 1LRHA 5FXVA 5IAXA 3N9NA 1DQ4A 5GLTA 5FMOL 2RS12 4RA0A 2VY0A 1MQTB 4F83A 5DDJ3 5F5CA 5I0RA 1D4VB 3ZXAC 2QZ3A 3NRUA 3OBTA 4GMP3 4NWWA 4GWNA 5HV0A 1FOD3 3AZXA 1ZBE2 3WNXA 3BIWE 1H2NA 1ZZBA 1LHUA 1W05A 2CY6A 2F4LA 2F4PA 1W9YA 2RS51 3MHZA 5FMBA 5FYBA 2YUEA 2E53A 3CL1A 5FZ4A 2BNNA 1VBE2 1QOOA 1WW4A 2GZWA 5T54A 2JIJA 1NOVA 3SCGA 4ISRA 4CUCA 2ZGSA 2Y0OA 2ZZQA 5FIXA 4OCTA 4QHOA 4ARYA 2YC0A 3HQUA 4JGYB 3DGTA 4JKLA 5FPZA 2GSYA 4XBNA 4CEWA 1AVBA 2HWE2 2Y0IA 4OHXA 1CAWA 1STMA 2WKKA 4E2SA 2R49A 2ZGMA 2YBPA 5FLJA 4RFRB 4RR3C 4CPBD 5KR7A 4UXAA 2Y38A 3GBWA 4E2QA 3PUQA 5A7WB 2ZAHA 4YZ5A 2GP5A 3ZYPA 3NNGA 5CU1A 5C71A 3T4HB 1C5IA 3T4VA 4RS5A 1GMMA 1QH7A 4WVZA 5HCBA 4TZDA 5F1RA 5JPNB 2DCKA 2PMWB 3MEPA 4CZSA 3TAYA 4GWJA 3G6JB 1OA4A 1ZRFA 3J7LA 3RWNA 3T0DA 1W8TA 4BQ1A 2IFRA 2ZMKA 4NAOA 3NAPC 2XXZA 2ZX3A 3NKTA 3NWKA 5F39A 4EN7B 4TLGA 1WCDJ 4P00B 1EPWA 2OUJA 2PLV3 3E1F1 1DYKA 5FZDA 4NRPA 4HN1A 4AVVA 1S4CA 4YGCA 1URXA 1WCKA 3WZ1A 2ZHLA 3NSTA 2WUHA 3AP7A 1DYPA 4QDSA 5JCTA 5KXBA 1M4WA 1CD3G 2W92A 4BYYA 4KQ7A 4OZXA 1REEA 3OD0A 4YM2A 2GALA 1NKGA 2W1WA 3EYPA 3CLPA 4AGRA 3WDUA 3HNYM 4UBGA 2B9VA 2C9AA 5FYIA 2JX9A 2V4AA 3KCXA 2HWF2 3AVSA 4JV4A 1V9U1 1S2KA 3M3OA 5BV6A 5JVVA 2P34A 1J1LA 3K48A 4XCAA 4QKNA 2WNVA 1OUXA 5GJ6A 1HN1A 1JYXA 4J1XA 3ZM8A 3M3QA 1HV1A 3OYWB 4JAAA 5EYYA 5J09A 1JYIA 2VUCA 2QQJA 3VBRA 2C6SA 3MI8A 3AMQA 2BPA2 2VBBA 1DQ6A 5L19A 1JBCA 3OEAA 3A4UA 3EQEA 1H6XA 2JDKA 3U37A 3MBWA 3BB6A 4YVSC 2ZX2A 4MXVA 3JXSA 3A7QA 3JB8A 5FR3A 5FY0A 1XNTA 3PVNA 3RZKA 5CFDB 5LA0A 1DZQA 4W6WA 4OUSA 2WQ4A 1YI9A 1ZBA1 4R9CA 1S2BA 2BOIA 5FWJA 3AZWA 3R05A 1QWRA 5FZMA 5FREA 1OQDA 4AR2A 4CDQB 1UN1A 3WF1A 3U07A 2PA7A 4RGGA 2G19A 4XIOA 2AYHA 5IFPA 4OHYA 4Z2WA 4EWEA 1FOD1 1VBA2 5LA1A 2RM21 1WKYA 4XJ8A 1UY0A 3MIHA 3RZGA 4NIIA 4GB32 3WEZA 2C26A 4DFSA 3GJAA 4QPGA 2WN3A 4AFDA 3IWZA 3IMNA 3NNJA 1CQ9A 1UYPA 2IXLA 5L7OB 1JZ3A 1VAVA 5C6CA 1QDOA 3ALQA 3MIEA 3OPWA 3N36A 4KGGA 3ZFFB 4DXTA 2L9LA 4Q4Y2 4EN0A 5J1XA 3OBAA 5LB6A 1KFUL 1DZRA 1CGPA 3ZYJB 2WT2A 2VZPA 2D93A 4GB31 4M3CF 1JZ6A 1X50A 4H3WA 4LO5B 1BKZA 5E8AA 4FFHA 2OYZA 3GCXA 4XZUG 5FPLA 3S30A 3SH3A 3KQRA 3TB0A 5DAXA 3PIGA 2VW0A 1WW5A 3J26N 3WLUA 3BTXA 2O1QA 1AYN1 1WA6X 4LO7A 1SBDA 2WNVC 2JG9C 1KJLA 1O59A 1W0OA 3AP4A 3WF3A 3M3IA 3WW1A 5A1FA 4CP1A 3FUQA 5DUVA 3JU9A 4AK3A 4XDOA 4FFFA 3IMMA 4UFKA 3D5OA 4UF0B 4YZ1A 1GNHA 4YG0A 2YXSA 2YG0A 3O7OA 4OHZA 5FO9B 3K3NA 2JD9A 4MOAA 4MSVA 3U11A 4EZ4A 5C4WB 4URTA 4CTEA 1U5XA 1UYZA 1D0HA 1V9U3 2VJXA 3ZOIA 2KD7A 3MLJA 1PVC2 1VMJA 2Y6GA 1CIYA 1IHMA 5DDJ1 1XNKA 1GOHA 3VBHA 1COV1 5FBZA 4HPKA 2PHUA 5FY5A 5L9BA 2FMYA 3R4UA 3SNMA 3WVJA 1C8M2 2XLAA 2WLPA 4KMQA 3OTFA 3LEIA 3POIA 3VBSB 1ZRCA 1WMFA 3GXUA 2D40A 4CCDA 1C1LA 1X8MA 2D6KA 1SQ4A 4XACA 4XE9A 5BNOC 2WO2A 1GZCA 2XLFA 2CNAA 3NJXA 3B7MA 4M4RA 1G9FA 1YO8A 2JEMA 2VNGA 4IUGA 2JECA 1JYVA 5A7WA 2EICA 3N9PA 4OULA 4KBZA 3DYOA 4P9GA 5A3PA 4LBQD 1OSGA 4KI5M 4MH0E 5GLZA 2A7AA 4X8PA 4BIOA 1UMIA 1W2TA 1K5JA 1ZBA3 2Y34A 3LKJA 2DYCA 3TBDA 3GJBA 1EP0A 3MF9A 4YZ3A 3RDIA 3PMSA 5D8AA 3VBFC 3ZVXA 4LOTA 5I0SA 4Y22B 4KWKA 4BQ3A 2V4VA 3MIDA 1O3RA 1GSLA 4DUXA 5J7MA 5KC6A 2RMU3 2Y33A 4A3ZA 1ZA7A 2VZOA 3E5UA 1YWKA 2WNVB 1ULEA 5JMCA 1ND2C 4JGZC 3KT7A 2VE1A 5LK7B 3VBRC 3I59A 2JE8A 1S0IA 1P8JA 3J4UH 3ZFFC 4N43A 4ONUA 1V00A 3POFA 4KNCA 3T1LA 4LA3A 4Y4YA 4MGYE 2VMCA 1K5MC 5APAA 1TMF3 2WQZC 2D3RA 3WQ7A 1ULPA 2GH8A 3AFKA 3J7HA 2R32A 1WLDA 2ZGQA 5J98B 2VZ3A 4P9WA 4Q0PA 2IC1A 4A4AA 5K4LA 4FFIA 2VCBA 4LUMA 3IB3A 5FXXA 2RDNA 4HKLA 1CAXA 4Q8LA 2QBXA 5DG1A 5AC93 4XUTA 1LAJA 3JUUA 1UQXA 4JX0A 3ZN5A 2H0BA 3IBMA 1OLRA 1NXMA 3HAGA 4GA9A 3TEXA 4MGIE 2GP3A 4PHZA 1LESA 1REFA 1VBD1 3LDKA 5JXHA 1UKRA 4Y3OA 1KS5A 1W9SA 3LWCA 3HIFA 4BWOA 4CDXC 1XQNA 5JSOA 1SLLA 3MICA 3HT2A 4ZU5A 4YPJA 4PJYA 2YPDA 5ABJB 2WO3A 1IPKA 5KHKA 3O1SA 1GNZA 2WZPP 4BQWA 4CEYC 5F3EA 1LOFC 2VNOA 4AG4A 4P14A 1S0GA 4O7XA 2QFEA 3EJKA 1O5LA 5K8SA 1AR73 4C0BA 3IDEA 2X5IA 5FZAA 1MPXA 4EWDA 2DV9A 2XBO1 2RJKA 3BU7A 3RZMA 1I3HA 5FJHA 3I2HA 4JDMA 1NZCA 2A70A 2WZR1 4N8MA 3FHQA 2E7TA 2JWPA 5IATA 1YQ6A 2Q8OA 1SZBA 1QU0A 2XJPA 1AYM1 1ND3B 2MEV2 4QT6A 3VKOA 3V65A 1COV3 1AXKA 1PIV3 4Q4W2 3K4DA 2D5HA 4BB3A 2ES3A 4QXKA 5ACA1 5FPXA 1BLZA 4NAMA 1QJFA 2W47A 3HT1A 5LCWL 1Y9MA 1R082 4E8CA 2ZGKA 1BXHA 5BNNB 1SDDB 4UOJA 2F6BA 2K9ZA 5A6YA 4L9BA 3JD73 4E8DA 5LWBA 2VECA 1IKQA 1H1MA 1Q8QA 2Q1MA 4S2HA 3WQ0A 4AGVA 3BOPA 2W9XA 2VNRA 4IE7A 4TYSA 2FBEA 4PF1A 4QU2A 3HOBA 4CP9B 1KDKA 3D0JA 1C28A 5GLUA 2Q8CA 4CYDA 5FZEA 3UNPA 2QE3A 2P4EA 4LBJA 1CZVA 5IK7A 1CAUA 5FQ0B 1PM7A 3HNBM 1D4M2 1DQ0A 3RG0A 3TN91 4OHVA 1NLQA 3W21A 2XONA 4Z1VA 1LOCA 1SPPA 1SCSA 1X9TA 3T3YA 1W2OA 4BM8A 1LULA 3AJYA 4H7LA 4GQ7A 3SHRA 1LHOA 4NUBA 1JN2P 4DXRA 4WM7B 1OOPB 2VOWA 2YGMA 3MFAA 4R52A 1YLLA 3DL3A 3GZAA 4FXKB 4JRLA 1PO23 4LKFA 5FZ3A 1XB9A 2JJ6A 4HONA 1XNAA 2WYSA 1WZXA 3UK9A 4K1YA 1JI6A 5FZGA 4MVTA 3MW2A 2I07B 2WO7A 3I2DA 5T5OA 5EJ1B 3Q8CA 1RJ7A 1DU3D 3P1IA 1DQ1A 5D1IA 5A33A 2CU5A 4AXOA 1NLRA 4YSFA 1JOBA 4GIQA 5A3OA 1I5ZA 4CUGA 3U4SA 2VGDA 4LBLA 3AMNA 2VBDA 3DPRC 3K4AA 2JDPA 1VBD2 2D6LX 3Q9OA 4N43B 1RUJ1 1UU5A 1PO22 4IV1A 1Y4WA 4DUVA 4LHKA 1DF0A 4P08A 1HQLA 2E7QA 3CF6E 3ST7A 4OHWA 3P3PA 1DGWA 4HETA 2RS32 2A6WA 4UFMA 1MR5A 1QJZA 2WQ8A 4S2GA 5D8AB 2DCYA 1ENQA 3THTA 1KS4A 1AL23 2E6VA 4B7EA 1OT5A 3TOJA 4B1LA 2OPKA 2VU9A 2VQUA 2WT0A 1CAXB 4LBQA 5EWSA 3GDBA 5BNOB 1AR62 4DY3A 2PLV2 2V73A 5GLVA 5EV7A 1W6OB 4I30A 4BISA 1PK6B 3WR0A 3LE0A 5KHIA 1W8WA 2N7GA 2VVFA 3MLLA 5C3QA 4CE8A 4KU8A 2WJSA 4XW3A 4U36A 1LEMA 5IUQA 5BPXA 4Y5TA 4WVVA 2BERA 5T50A 5I8YA 2WZR3 1DYOA 1JZ2A 2A1XA 2WZ8A 3HD8B 1CVNA 3CZJA 1B09A 2QNKA 4CDWC 1K5MB 5A3LA 2BP6A 2DTWA 1GZWB 1H8TB 2NLRA 1Y3TA 3MV11 5FY8A 2DVFA 1BZWA 5LATA 2J1EA 1AL21 4LK6A 3ROUA 2VL4A 1K45A 2PYTA 4D69A 1ULCA 2FZ2A 2FCTA 4K8FA 2ARXA 4CA9A 3IPVB 4MGSA 1EAH3 1PIV1 3WT3A 3IAPA 1G9CA 4GKXA 2ZACA 4QM8A 3VHNA 3WNNA 2NMNA 1GWLA 5IT6A 2GNMA 4OQ9A 3ZXEA 1FMD3 5ABJA 3AMPA 5T52A 5EQUA 4QWNA 3S0MA 3X29B 3OGGA 4HOOA 1DGLA 3BU0A 4NIHA 1GU3A 5ISLA 1E5HA 2R062 1NQDA 4AEDC 2EAAA 3OD4A 1X7NA 3TN93 4E4SA 3UKTA 3VGIA 1MZ6A 1UAIA 2VUJA 3D8CA 4QU1A 4Y24A 3DN7A 3MW3A 4XF9A 5FTTC 3AJZA 4E4ZA 3RI9A 2RS11 4K40A 4ZS2A 2K2SA 2XJSA 4XVHA 4D8MA 1O3SA 1WLWA 2W2IA 2WIIB 1RVF2 4OYUA 4KBBA 4Q4X1 3RYRA 4QMAA 5EYXA 2EXJA 1BK0A 3E6DA 3O1TA 1CJDA 1QJY1 5FPAA 1GWKA 2PFWA 1RIRA 2XVGA 1RL3A 4DINB 1V6IA 3VHPA 1HDKA 3RPQA 3D0SA 1RITA 1RUE3 2WAAA 4KH9A 4K6BA 5E6HA 3UYJA 3BPZA 1W28A 1UF2C 3IN9A 1U5YA 2D43A 3H3LA 4GMP0 4BOWA 3VBFA 2OPWA 3UJOA 2ZHKA 5FP8A 3V0BA 1PO21 5F9TA 4CEYB 1POV1 2F17A 1RUH2 3KM5A 3PL0A 3M3CA 1S0FA 4Q4V2 2A6VA 1VIWB 2VMDA 4B4PA 5CEHA 3I8TA 4COWA 5JPMB 5IK5A 3I3QA 3WNOA 3ZO0B 4XAAA 4IGOA 2HWE1 2W0XA 4GZ9A 5ACA3 4MG2A 1UOBA 4M01A 1C57A 4R4ZA 2VZUA 4NN0A 3WG4A 2WNUA 1ND3C 3WNMA 3GNEA 3RZZA 4C8DA 3HJRA 5FUNA 1BMV1 1YRZA 3LDBA 1NLSA 1PMJX 3NVCA 1FV2A 2AACA 3H7YA 2ZXQA 3CJIC 3ACHA 4Q1PA 5ANNA 4DOUA 1Q8OA 1I9RA 4MXWB 4SBVA 2YC4A 4NRMA 3ZFGC 2OS2A 1WMDA 1OH4A 1AUYA 4QDQA 1XE8A 2ARCA 2E33A 2XKPA 3NJYA 4B8EA 1WBLA 4ZPIA 2AEYA 5FLIA 5L36A 3O1UA 1JYCA 2JG8A 3WNLA 4BA6A 4PI0A 4F8AA 3I2OA 1QEXA 4OLLA 3RZHA 1IG0A 2ORXA 1F5FA 3T2TA 3ZFGB 2ZBJA 5FJKA 1T6GC 4A6OA 3LPGA 2XDVA 4QX3A 1W8OA 2FCUA 2VVDA 4QPIC 2BZDA 2RS52 3LFMA 4LQRA 1VBE1 3U0ZA 1EPZA 1RUI2 1WCSA 1ZM1A 2R071 4IV1B 1UXXX 1JZ8A 1EUTA 3POSA 2YV8A 5AFEA 2JG9B 5FDBA 1X33A 1QJU1 4FPKA 1PVXA 2YDEA 2HKXA 2BW8A 4DS0A 2JDYA 5FXZA 3N7MA 4GWMA 2VR4A 4DQAA 4FOWA 3VZMA 3RQ0A 4I02A 2NN8A 4YM3A 3TEZA 1O8PA 4YW6A 1FMD1 1GZWA 1QJU2 5F5IA 1ZBE1 2R1DA 3C8XA 1UZVA 2B8MA 2CGOA 5FUPA 4A45A 4D94A 1A8DA 2D3PA 2ZGNA 4XMIA 1UOJA 5GLWA 2JXAA 1AJKA 2VULA 4YW3A 2JICA 3HQRA 1YCIA 2D6MA 1IOAA 1ZZ9A 4LTAA 3VDDA 4XJAA 4D0QA 4XJUA 1X36A 4ET7A 5FKCA 3RZLA 3LD8A 2ET7A 4KWLA 4WM8B 4AEMA 4FOYA 2P5BA 2XOMA 1TMF2 4WV8A 5LBFA 4D7YA 1US3A 1TZOA 1QJY3 2QTWB 3SKJE 4XEZA 3WNKA 4DO0A 3VHRA 3VDCA 1ZRIA 1SG3A 1WCUA 4P9XA 5CFDA 4W4ZA 5JXJA 1IQAA 1IG3A 4UW6A 4AI9A 2RS13 4IGPA 4COUA 5J37A 1DBNA 5FZLA 2VVEA 1XYNA 2UYBA 5FCCA 2WA3A 3WNPA 1AYN2 1QJX3 2WNEA 3PVEA 3ILRA 3OGSA 1ZBE3 1V6KA 4HFSA 3DECA 5M0TA 1UY1A 4DY5A 4BHPA 2FZ1A 1CJPA 1R1A1 2GN7A 2ID4A 2ILMA 2W68A 4GH4B 2PHTA 4GULA 1NUKA 3N3HA 2XJRA 4PBPA 1SEFA 2O8OA 3LEGA 3IKWA 3O14A 4RGAA 5FKBA 3N4MA 2LRPA 2XB6C 2ZX4A 4UFLA 1WWYA 2VZQA 2SBAA 5DDJ2 2VUDA 4IEOA 1Q56A 1R1A2 4X6QB 1Q5OA 3NV1A 3P3NA 3S7EA 3ZR6A 3PLQA 1LHVA 1RUD2 4YGEA 3M7AA 4FQZA 4CEYA 4CDWB 3D6EA 3TEYA 1CESA 2YBSA 2OZ6A 4LBMA 5HBAA 2XPJA 1GZTA 5EPAA 2VOKA 4CU7A 4XDQA 3BALA 4JHTA 5T5JA 5IVVA 1HV0A 4W6YA 4K8RB 5JOZA 1YQCA 3KZ4C 3FE5A 3WQ1A 3SCFA 4CP9A 3U78A 4Y1UA 4FPOB 4JDNA 3KMHA 1OLME 5BNPC 1LB2A 3CMGA 4LT5A 2ZGOA 2RHPA 5K9YA 4X6RB 3LA3A 1R1A3 3O1MA 3PTRB 2WYFA 2J42A 1KDMA 1ZREA 1YJKA 1Z78A 1QGLA 1YQ2A 3GF6A 1FV3A 1QDCA 3NAPA 4FPLA 2VW1A 5KHGA 2OXBA 4XTMA 4RQPA 3FL7A 4AEDB 2E31A 4HPKB 5FZCA 4AFBA 1H4HA 4K20A 3AB0A 5GZEA 3ZXLA 1H9WA 2CSGA 3AMHA 2BFUS 2IZWA 3OJBA 1FT9A 1W6QB 2XKOA 1CAVB 1S55A 5A7NA 2XL7A 4D3WA 5FPVA 2HWC2 3USUB 2EAKA 5JDBA 1RMU2 2LTNA 2DVDA 2WSUA 2WSVA 1UCXA 2XWBB 1DQ5A 1KXGA 4XXAA 1YFWA 1VRH3 2WRAA 5FMCA 3POYA 4Y1XA 4QGMA 4BXSV 4AGGA 2EIDA 5FZ6A 1QF3A 2NYYA 1RUC3 1BVVA 5FYTA 1H8VA 1RUE1 2FCVA 4AQTA 4XZPA 3LA2A 4C1XA 4CU9A 3N35A 3R4DB 1CX4A 4QQOA 2RM22 1D7PM 4ARXA 2R1BA 4Y22A 1D2QA 3B00A 3N7KA 4PIXA 1OD5A 2ADDA 2Z42A 5DZEA 3RRDA 3WP4A 3WF4A 4DRRA 2NP0A 3BCWA 4MO3M 2DVAA 4IESA 5LY2A 5J3UA 3FUOA 1SLAA 3RMXA 1A6CA 4IEUA 2CGNA 1W9WA 2RR12 5F5QA 1S0BA 4QGNA 2OVUA 4G4FA 5JOWA 1SLTA 5JR2A 5KXDA 5F2WA 4W8JA 3KQ4B 1J1TA 2QQNA 2Z4FA 4Q0QA 4BMBA 3HN1A 1CZSA 1JOJA 1PO13 5BNOA 2JG9A 4ES8A 1IS6A 3OYWA 2GC3A 2VMHA 4LA2A 3ELNA 3T09A 4QB6A 3C7HA 4U2AA 2W5FA 3L2HA 2YPJA 1SACA 4CCEA 1OVPA 4E9KA 1F8VA 3SH5A 3HWJA 2Y6JA 2ZEXA 4G3YC 1OLMA 4S2DA 2VZVA 1SLIA 2H6BA 2J1SA 2VZSA 5CKMA 4R4XA 1MS4A 2YY1A 1C4RA 3BYWA 3OBZA 3VKLA 2RS33 4ZS3A 3WY6A 4CXXA 1K3IA 3DYMA 2RDRA 4RR3B 3H3UA 3LOBA 3GZUC 5F3GA 4I09A 1G9AA 4XYXA 2MEV1 3WD5A 2ZGLA 1UY4A 4XQDA 3ZXFA 2CWSA 5BNQA 2ATFA 2UY9A 3OGRA 3CJXA 4OI4A 1ND2B 4JGZB 4O9EA 1IPJA 2EXIA 1ZZ8A 2BYVE 2R6QA 3HR9A 3NL1A 3WINE 5J36A 2B42B 1GANA 1GQHA 2VOXA 3BOWA 5G05L 2D3SA 5JSPA 3FFQA 5E88A 1MZFA 3AK0A 2WT1A 2MNGA 5ERLA 1XU2A 3SQOA 1F31A 3KHBA 3UKNA 1XE0A 4Q2FA 5F8PA 1ULFA 3A21A 1WBFA 2KR2A 1NCRA 1LR5A 2EIBA 2PAEA 4YVSA 2XUEA 4NHKA 5T5LA 3WCSA 3PIJA 1ODNA 3DCQA 1HRI3 3K46A 4LORA 4MGQA 4R8HA 2VPVA 1UZZA 1RUD3 3BVCA 5EZWA 1XU1A 1UU4A 1WCQA 2TNFA 5JI9A 3ZSJA 4FAGA 1FX5A 1AF9A 1TQ5A 5E16A 5AFBA 4QKDA 2ZCWA 2X53S 5C8WA 3H1MA 4EN8B 5JR7B 1E5RA 1C8M3 4CP0A 4UF0A 5CZKA 4GALA 2R7EB 3AKQA 3LA7A 5I8SA 2DWRA 4GH4C 2DU0A 4IXLA 4XJWA 1RVF3 1W6PA 4IL7A 3P6BA 2D6NA 3MPPG 1NCQC 4LO8A 1AL0G 1R64A 2W3JA 4B4QA 2VCCA 4Y1YA 5IW0A 3O0WA 1OUSA 2BV4A 1W8UA 2DBIA 2Q0AA 4FPCA 1O4TA 3APBA 4S2FA 3UV9A 3CHXA 4UFHA 1CN1A 1PO11 5HPOA 1XNDA 1VBB2 2GDFA 2YGLA 5FYSA 2AH2A 3KV9A 2X10A 2VCAA 3ETQA 3Q8FA 4ZU4A 5I91A 3AXDA 4R9BA 4YARA 5AVAA 5A32A 3JBG1 4QPIB 2CYFA 1RUH3 3QD6A 3NAPB 1Q8PA 2QZ2A 3QBQA 1AX2A 1H0BA 3ITQA 3AYDA 4N7IA 2OQ6A 4E4HA 2ET1A 3H8XA 2Q4SA 2CTVA 2GH2A 3AYEA 3BN6A 1MVEA 4FOVA 4FPFA 5FXWA 2ORZA 1AX0A 1YIPA 1B35A 4XBQA 4YGDA 2G1MA 1W39A 2Q30A 4V2WA 2VZRA 3VZJA 5KC5A 2PHXA 4XF4A 4XDPA 3O1OA 1YI7A 1N3OA 5GM0A 1SLCA 4HZFA 2QQUA 1CAVA 2VXRA 1PZ7A 2XWJB 5IYYA 2A3XA 3VD7A 1OC1A 2WDBA 4GJZA 4LJHA 4HANA 2WFF2 1ODMA 5DUUA 2GNDA 3S7IA 4JQRA 2OX0A 4XIKA 1ZX5A 4BPZA 4YLZA 1WGPA 4JHZA 4LO6B 4WBBA 1KD7A 1E57A 2J7MA 2QQVA 4GJYA 1GQPA 3WV6A 3KT4A 3AKSA 1MEC3 3PURA 4K9SA 4BQXA 3PJQA 4Z8BA 2O0OA 4K7JA 3WG1A 5DN2A 2BQPA 4IEZA 5GALA 1XJAA 1R1ZA 4GMP1 2BDRA 4AOCA 4XUPA 1PZ9A 2HYKA 2LUWA 2UWBA 2IVIB 4NO4A 2P3YA 5H9SA 1LOBA 1QQP1 4XBLA 4RR3A 4LLFA 4CCOA 4ZHNA 1MS8A 2OT7A 2X29A 1E5IA 4QGLA 5EJZB 2R063 3I2KA 3WCRA 1DLCA 5DZGA 2WAOA 2LROA 4KWUA 4YZ2A 1U5IA 4CP2A 4DEVA 1NYWA 5J96B 1EYBA 1OH3A 1V6LA 2JIGA 2WR9A 4QX2A 4ASLA 3I49A 1OA3A 1QJU3 4CDQA 3VBOB 5CKQA 5JXIA 1JYTA 1V6OA 3ES1A 4AHZA 1XSQA 3J8F1 1W99A 5LRSA 1WLTA 2P2KA 1REDA 4JQTA 4N53C 4SLIA 3ZFEC 1Z7S2 1XC6A 2C9KA 1DFQA 1VBC3 2BNOA 2D7FA 1QJY2 1BBT3 1RJ8A 1DG6A 3LFIA 3R0RA 5L7OC 5LW9A 4PIYA 1MVQA 2A75A 5FK8A 3SLIA 5JMOA 5AC91 2CL2A 1OQEA 5TSWA 3UESA 4UW4A 1XOYA 2HWB1 3FLPA 3H8OA 2OIIA 2EXKA 3DUIA 3FLTA 3THDA 2RS31 4BCUA 1UYXA 5L7OA 3T1MA 2QCSB 5BNPB 4I0AA 1RHI1 3FMGA 5A6XA 3W5MA 4YWAA 4Q5OA 2BOJA 2FDJA 4XFCA 1O4YA 1VBC2 1J83A 4AHYA 3H9AA 4AFMA 1C1FA 1JU3A 2HWB2 4UAPA 5HXMA 1MS5A 2YU1A 4OUMA 4Q4X2 4QX7A 5DUXA 1DCSA 4AEKA 1LGCA 4TXWA 3WP6A 1W9FA 2D5FA 2ZZJA 3I4IA 3NO8A 1V6MA 1XE7A 2E7AA 1T2XA 3F95A 3N9LA 1ST8A 1LENA 4GWIA 1PX3A 3ECQA 4W50A 4ISQA 1W3VA 3W20A 3LEMA 4BLJA 3DKQA 1PK6C 3E5QA 1V6NA 1W8HA 1XXNA 2HH9A 4UWDA 3VBHB 5C9AB 4LKDA 2HWB3 4QX5A 1APNA 2PTMA 5JOYA 3U4XA 4KGQA 1L3JA 2ZABA 1OFSA 2YYOA 3VB9A 2JDHA 1W8ZA 4D6SA 5IFTA 4Y20B 2GMEA 5FY7A 1VMHA 2Q1FA 2ERFA 5B4NA 2GNTA 5FZIA 5BUVA 3IIAA 3KLSA 2KA3A 3WG2A 1BYHA 3MYXA 2B5HA 4HSJA 5FZFA 1UMZA 3TEWA 2OUHA 1J3PA 1LU1A 4YZ4A 1WMEA 1XRUA 2BBAA 4FPYA 1RYYA 1AR81 2R073 5IVCA 1RUG2 1O4ZA 4LIVA 1U12A 4LO4B 3OEBA 1LGNA 4AVCA 4OMCA 3BODA 3CO2A 2X5IC 3H8RA 3WW2A 4RHV1 3T30A 3RJ2X 4Q8KA 4FTBA 1QQP3 4A2UA 2E26A 4P5YA 3OCPA 3VBUB 3WF2A 4CUAA 4YM0A 1HKDA 4N90A 3ZSKA 4OMDA 4M3CB 1UXZA 2JDMA 4FI9A 2JD4A 4TSVA 4A7KA 4IE4A 3H7JA 5T3NA 2C24A 4WM7C 4M3CE 3HVDA 3KD4A 4E4DX 3JB4C 3RFRA 1BJQA 5L9VA 1QMJA 1FI2A 4LHNA 2R061 1ZBA2 4A3XA 3SC7X 4YG6A 1JTZX 1GLHA 3MIBA 1C8NA 1OMIA 3C7GA 3B69A 5G04L 5KHJA 1PGW1 2D44A 2Z79A 2D97A 2E9QA 2XJUA 3DKWA 3ZMOA 4M0HA 1AR63 4EWAA 2PHLA 2A3YA 2WL1A 2XHNA 2P3KA 2Z5WA 2XVLA 4N9IA 3H0OA 5FP7A 4M4PA 1AR91 1OOPC 3LEKA 4COYA 5A3UA 4QKFA 1J58A 5C5UA 5C8CC 3O1PA 1RB8G 3AZVA 4YVWC 1QY4A 4JKKA 2XJQA 1VBC1 1VAKA 4LE3A 1LCLA 4E27A 3VD9A 1K5MA 1HN0A 1EV11 1DGRN 1HLCA 5BNNC 4YW2A 5C3OA 4MLOA 5CG8A 2P17A 1LOFA 5A3WA 3CBNA 2Q8DA 1G86A 4V2VA 1VE0A 5FYHA 1CPMA 4MGZE 4Q4V1 1W3XA 4JGYC 5IJRA 1TMF1 3PUSA 3AZYA 4A7ZA 1AX1A 2CAUA 4UW3A 3WDVA 1D2SA 4CXWA 5LRRA 4Q0VA 4QQLA 3DXUA 3I97A 2W1SA 2ADEA 2CDPA 2RE9A 3AM2A 5BNPA 3GHMA 5IVEA 2UU8A 1VR3A 5A3NA 4Q4Y3 4EN9B 4NHMA 3DV8A 2ZX0A 3LCPA 5CNAA 2VMFA 3N9MA 5I0UA 4Z92B 3AVRA 1RC6A 5LA9A 2Y6KA 1W9TA 4G9SB 1LODA 1RGSA 1TNFA 1W6MB 2Z69A 4IE0A 1AR83 2ZHMA 2G4IA 2XJVA 1PVC3 2AC1A 2ZHNA 1JS9A 3ORJA 3RZJA 4YVSB 1DQ2A 1OD3A 1QNWA 3WDXA 2EIGA 2XJTA 3BGAA 4GH4A 5A80A 1DGWX 3NW4A 1LHWA 2ZMNA 3T2QA 5SV5A 3H50A 4FPHA 5LK5A 4FPJA 1BEV2 1RUG1 1YHFA 2VMIA 5LA2A 3ZXJA 3I2JA 1A78A 5FY9A 5CB7A 1FMD2 1AHSA 5JZGB 4LUKA 4QPYA 4YGBA 4Z82A 3E6CC 1VPHA 4MX3A 3UKVA 2DURA 1LJ7A 2VTXA 4FO9A 2AENA 4IV3A 2R043 5IVJA 1QNYA 2W1QA 1RUI1 2R072 1C3HA 2ZA9A 3UGFA 4YW7A 5C7GA 5DUWA 2B45X 2Y8KA 1NZIA 1JW6A 2RMU1 4UYBA 1JZ5A 4IEPA 4PQQA 4M0NA 3FN9A 2ZOEB 3NMBA 4PI2A 2NM1A 5EP9A 1HRI2 4NOTA 2DBNA 3Q8EA 2LS6A 1BVP1 2ZEZA 2VC9A 1KRIA 3WF0A 4PQ9A 1OVSA 3VBSA 5HXVA 4YFZA 4XHBA 5FP3A 1F9KA 3GZTB 3PUAA 4UI9L 3KCCA 4CCKA 2R042 1OQ1A 3KS7A 3SKVA 1RUE2 1PGW2 4HXCA 4LPLA 5A32B 3WW3A 2DCJA 4AQ6A 4PLNA 3OY8B 4CCNA 2HWD2 4MXWA 1EUUA 4I0BA 4IE5A 3FLRA 3MO4A 1ZA4A 3MUY1 4GKYA 1H2MA 2YC2A 2KXLA 2QQKA 2RJLA 4BXFA 2DCZA 1UYYA 4NE9A 4L97A 3ZX7A 1AR92 1O8SA 3MGUA 4EROA 5K0UC 2V09A 4QPGC 1N3QA 2UWAA 4J6GA 3FC0A 3GCWA 2BNMA 2JG8B 1F15A 3GZEA 3B5LB 3MIFA 3POWA 4LOSA 4QB2A 3USUA 4UT5A 4EYUA 1K42A 2WFPA 3KVAA 3KWVA 3O0XA 4LKSA 4XFHA 2X05A 2IXIA 2QJVA 3SITA 4FBFA 4XUNA 2W87A 3AFGA 1Y7BA 4V1PA 2YROA 4LITA 5JI7A 3N9QA 1GICA 1HXS2 5FBJA 1IS5A 2AREA 4Q4Y1 3TNPB 5A3MA 4FT8A 3VBSC 5C3RA 2P6HA 2AEZA 3ASIA 3JZVA 4NWVA 4GXLA 5FYMA 5IK8A 3M70A 1PHMA 2QQWA 2WFF3 1MACA 2C0ZA 3FWEA 2FDGA 3HPNA 3HN3A 4NJ4A 1R091 4IERA 1GNYA 1F35A 4WM8C 2QQIA 1DHKB 5DG2A 3M8LA 3DXTA 1J59A 3SISA 3OUHA 4LBQB 4A41A 3VHOA 4IV3C 2AR6A 3ACGA 3A22A 1ZZCA 3ON7A 4BK5A 2VG9A 1SLBA 2BGPA 2ZX1A 2PAMA 4H55A 4XF0A 4P9LA 3V0AA 3AL5A 1ZNPA 2WZR2 1ZZ7A 4ZXKA 2B7YA 1OBNA 2BWAA 2XGXA 1GYKA 3SH4A 1VB2A 3PU8A 3MW4A 4J1WA 5F6LB 1R081 3WUDA 3IPVA 4DUWA 2SLIA 1QH6A 1OI6A 4L99A 5FAXA 2VCMA 2WS91 2WWUA 5DQ0A 3VL9A 4QD2A 4Y1ZA 1EAH2 3LOIA 1W03A 1YQ5A 3PMEA 5F3IA 1XPWA 1N3PA 1IQDC 2UYAA 1AXZA 4O9GA 1BEV3 1MQTA 1UZ0A 5JAXA 2D98A 4JCKA 3AYCA 4N43C 1W2AX 3ZFFA 4AQSA 4NPLA 5FWEA 3FHAA 4RQPC 3M4FA 3B3QE 2VOVA 4LHSA 1ZYBA 3JD72 2JE9A 1V6JA 2EXHA 3TN92 2QDRA 2C1FA 5H9RA 1YIFA 4BK4A 1NY71 4ZKTB 4P9IA 1AXYA 4AE2A 2W39A 4NPRA 3BIEA 2R041 4MUVA 5DAPA 1A3KA 1RMU1 5BNNA 2VW2A 2Q8EA 3RYPA 1VP6A 4IW3A 1VBA1 1HQWA 5FMDA 4MHUA 3ZDSA 2FHRA 1RUOA 3UJQA 3M1HA 4A44A 2GU9A 3U14A 4LLOA 4ORFA 4QB1A 1VBB1 4RYDA 3MZHA 1CAWB 1D0GA 1ACCA 1K12A 2H0VA 2IXCA 3TYJA 3VBFB 2RVAA 1QIQA 2P1BA 3GGLA 1GBGA 3HBZA 1PMIA 1W90A 3K77A 1N1YA 1C5HA 1HB4A 2DUPA 2ZTNA 2GC2A 4INDA 2E51A 1GP6A 3ACFA 2P3IA 5FYZA 4JKMA 2CWMA 3ETPA 5JZGA 3WDWA 5C3PA 1AYM3 3KV5A 5I0DA 3EB7A 3N7LA 1V0AA 2YB7A 1S0CA 2DVGA 3B9IA 3ES4A 2G9GA 1HQNA 2W1UA 1EY2A 3QLQA 3ZDVA 1W6PB 2OQ7A 4RS5B 3R6SA 4CDUB 4QXHA 3HEIA 3D3AA 1UY2A 4WM7A 5EHDA 1TME1 3L2YA 1H4GA 3ZYBA 2RDSA 1WW6A 2CV6A 2PELA 4HKWA 1R092 2VXJA 3NNLA 1PNGA 2D6OX 4AI8A 1LU2A 4CCCA 3WP5A 1GUIA 3Q8BA 4MHRA 1JYNA 2WFF1 1I5PA 2V72A 2WINB 2XHKA 4FPGA 4XF3A 2O14A 1G8WA 1YFYA 1IPSA 2R30A 1AYM2 1QJEA 4TN7A 4YYOA 1PVC1 1UNBA 1Y9GA 3U1XA 2VQTA 4AL9A 2OZJA 3I54A 4I3PA 3VKMA 5JOXA 2BRTA 4WVMB 4Y26A 4XFIA 4HSLA 2A73B 2YFUA 3ZXKA 1OHFA 3VDBA 4OVEA 4AZZA 1VB4A 3FHIB 3J7NA 1PX4A 2WLQA 2W08A 2WS93 3F2ZA 1B35B 2VTXJ 4QPWA 2PAKA 3WW4A 4CCLA 5FLHA 1UWWA 4NROA 5E89A 1TEIA 3RI8A 1Q3EA 1I6XA 1LOEA 5C4WC 5J48A 3OUIA 3LAGA 3GBFA 2DDUA 2DTYA 3KCYA 4XILA 1ZRDA 2Q5TA 4AF9A 1YXWA 5FYUA 4L0PA 1EAH1 1D4M1 3QACA 5FYCA 1YFXA 4RFT0 3MF6A 4HVRA 2I45A 2UWCA 1LNSA 1LEDA 5GZCA 4Q0UA 1O3TA 3UETA 4HK8A 1SDWA 2Y6FA 3FJSA 3N9OA 4MADA 4EN6B 3VDDC 5LZ6A 1VALA 2IUWA 2ARAA 5FRAA 4TTGA 3AYAA 2E32A 1PK6A 3KF5A 4CU6A 1NAEA 2VTFA 3BI3A 3S5AA 1GOFA 3S5QA 5FZ1A 3KGLA 3VD5A 4WVWA 3IDBB 1NY72 5FZ0A 2DVBA 5A1LA 1PO12 4FVVA 4LR4A 2JB4A 4GB33 4EV0A 3IIIA 2QVSB 2BJSA 2HYXA 3OUJA 3V0BB 3CEWA 1RTVA 1UIKA 3KB5A 5I0TA 2RM23 3VDDB 4ZU7A 3VDAA 2R0FA 4LKEA 3UL2A 3IDAA 5FZ7A 4AFCA 3Q8AA 3ZYGA 3K4ZA 4J25A 4QXCA 1RXFA 4NIAA 5AC92 1DP0A 1O6UA 2MHFA 1H8TA 1PNFA 2VQAA 2ZGPA 3D4KA 5CYYA 3ZN6B 1HX6A 4XURA 3GM8A 1VBA3 3CZUA 2NPIA 3ZXGA 4LBOA 3W5NA 1L7RA 4I3GA 1NQJA 1UU6A 4FQ4A 4NIGA 4XOGA 4H14A 5I93A 2BUKA 2IXHA 3WHUA 1POV3 2K0GA 4XETA 4ATEA 3OF1A 4KG0A 4YNIA 1ZRRA 1CPNA 3OPTA 1HW5A 2Y6LA 5T55A 2JE7A 3LQCA 3VKFC 3B01A 1HB1A 4F7ZA 1VRBA 4HKOA 1W8FA 4X8NA 2GC0A 4N53A 2ETEA 3ZFEA 4KG8A 3UGHA 5KWRA 2DF7A 4AEJA 4CCMA 4B7KA 3E97A 3VZNA 3WG3A 1S1AA 1XYOA 5JIAA 3L9JT 5FZHA 1R083 1MS3A 4LMFA 1NCQB 1RUJ2 3WP3A 1WMXA 5FK7A 1BMV2 3ME2A 2ZGUA 5C4WA 3DF0A 4Q4V3 3UGGA 3CJIA 1VAMA 4HLTA 2MEV3 4CXYA 3D82A 3O1RA 4Y33A 4H2AA 2HWE3 1NA1A 1G9BA 1AZDA 1ULDA 1TG7A 4JGYA 1FNYA 1GFF2 2A6ZA 4LBKA 3I3DA 3WUCA 3NKGA 3ZPYA 1CAUB 5FQ0A 4R9AA 4EJRA 3M2MA 5FOBB 3WDYA 3WOGA 3RVHA 3ZMNA 1VBE3 1F4HA 3UT0A 1QXPA 5FYYA 1LHNA 3ZIWA 4QQPA 1RUJ3 2PXJA 3LSDA 1SPPB 1LTEA 1UD1A 2Y64A 1H30A 1SFPA 1H2LA 3E5XA 3A23A 1AR71 1IS3A 3I2GA 4XFFA 3W58A 4Q26A 4XUOA 2D6PA 1OOPA 5FP4A 5FZOA 3BPSA 2CDOA 5IWFA 4OI2A 4C91A 4ZZ8A 5FO8B 1SFNA 2LALA 1X8EA 2BTVC 3CKHA 1JODA 3IM0A 3VZKA 1KEXA 4NIDA 4D7SA 5FY1A 5CFCB 4Q29A 3ILFA 1XNBA 2BEOA 1HB2A 4AFAA 1RUG3 2I2SA 2JKXA 3NQHA 4HK9A 1D4M3 2PN5A 3T0AA 3PU3A 5JSRA 1WD4A 2FDIA 1BK1A 1S0EA 5A1AA 3T2PA 4AQ2A 3RNSA 1POQA 4FP2A 4AWDA 2B39A 1Q8VA 3GHNA 4XJ9A 4NR1A 1RUI3 1RVF1 5IAVA 2FQPA 4K1ZA 3I59B 5A7OA 4BU2A 4WZFA 4QDRA 3SEPA 1JZ4A 3DPRA 3PDQA 5FPBA 5FZ8A 5H9QA 3LZZA 4CRQA 5C3SA 3LSEA 1QKQA 4Q0SA 1DLLA 4K3UA 4A7YA 3H3ZA 3WQBA 1LECA 3B02A 3QH6A 1RUNA 2QQOA 1QXJA 3C7EA 1FYUA 1NE4A 2DUQA 4FAHA 2HWC3 3JBG3 3KT1A 1RUH1 2RDQA 4M3CA 5FV3A 3PVOA 2W94A 4QQHA 2WA4A 4HVOA 3WXPA 1RUC1 1M06G 2OA2A 4E2GA 3LGRA 1VBD3 1YNAA 3OBRA 4COZA 4MYEA 4OUEA 1W6NB 1FPN3 4ES9A 2P3JA 3H8UA 4BIFA 1W2NA 2QQLA 4PIZA 1QOSA 5GKAC 3S57A 2VUAA 4XJZA 5JWPA 2LW8A 2DU1A 2LM3A 4R9DA 4YRDA 4AI2A 2JDNA 1WLCA 3VKNA 3K75B 3M3EA 3ZKUA 1LOAA 1J3RA 1F2NA 4BZ4A 5AVPA 1RUF3 1B35C 3THPA 1J84A 4MZUA 5FPUA 2VMEA 2PHRA 4TWTA 3LIGA 5DAQA 2NMOA 1S0JA 4JDOA 4BE3A 1TNRA 2XH6A 2I74A 5D21A 4FTEA 2XLGA 2VM9A 2Y6HA 5EJ3A 3I3BA 2XL9A 1UX7A 1XYPA 3OB8A 4OI0A 1ASJ3 4AAXA 4BMEA 3VBHC 2HWF1 4IGQA 3ZSLA 1MS9A 2PHDA 2A5ZA 2PHWA 3C7FA 4AVTA 2E63A 5FZKA 4UW5A 1XBFA 3KHCA 3AP6A 3AP5A 1QOTA 5T5PA 1ULGA 3MFCA 4YVWB 1NCQA 4P02B 3HQXA 1PMHX 2VBPA 3O5SA 5IHRA 2R16A 1UO9A 5F3CA 4ASKA 1OPMA 1RINA 4QAWA 1CWPA 4OI1A 1ENRA 4PT6A 2AUYA 2XVKA 3DYPA 5CFCC 1JHNA 4CEWB 1US2A 3EXUA 1V9U2 4BQ5A 4P5HA 4QHBA 1VLNA 4RHV2 3LB9A 5E1RA 4Q27A 4BQ4A 1O7FA 4NHLA 4D6RA 1NXD1 5F7UA 4CDQC 4Q4X3 3G7DA 2WO1A 4LBNA 3CJIB 1VRH1 5CKNA 3VLBB 5B2GB 5BY5A 3VZLA 5L9RA 4BH9A 4AHXA 1FOD2 2W91A 1YJLA 4AI1A 1SHWB 5C9AA 1MS1A 2P37A 5I8TA 4YM1A 4PCRA 1EV12 3T2OA 1JHJA 4QX8A 3MUZ1 1O91A 2ZGTA 2RMU2 4YG3A 1VRH2 5FYVA 3SEEA 3VBOC 5BYNA 1O3QA 2FD8A 5FO7B 1X82A 3B94A 3ACLA 2ENRA 4CPBA 1RMU3 1NX9A 5A33B 3QCWA 1RUC2 4CDUA 4CSWA 3MLKA 1RXGA 4URAA 5LASA 2ZMLA 1L7LA 5FZOB 4L2NA 4Z2AA 4XPVA 2YMZA 2IWGB 1GP5A 1SMVA 2J1UA 5EIYB 1HRV1 3J7MA 3AL6A 1W6QA 2ARBA 3DPRB 1UKGA 3LF7A 3NV4A 3PUIA 4XQWA 3CQOA 5GZDA 5HI0A 1UX6A 1G7YA 2EA7A 3OGVA 4LHLA 3VL8A 4HN0A 3OSDA 2HWD1 2V5DA 3JQWA 2WC2A 1T6BX 1WW7A 1POV0 3O12A 3CNAA 3HMYA 1H2KA 2XQRA 3I3EA 3PVBB 2FDFA 4L11A 4DIQA 1DGRA 4WVMA 4M00A 5DABA 2X09A 1R093 2JDZA 4B3NA 5JUVA 2AGSA 1QXRA 1UMHA 4DB5A 4B4RA 5CVRA 4AVSA 5JZGC 3IAQA 5ANQA 3FBMA 5A6ZA 1PZ8A 5HCFA 1UL9A 2GC1A 5BXXA 2B46X 2QDNA 3RSJA 2BGCA 2DUOA 2IXJA 2KM2A 5F2SA 2RR13 4FCAA 3ATGA 4HMZA 3ZYIB 4B29A 1CZTA 3VUOA 3K51A 1RUF1 3KVBA 3POGA 4IQPA 3POJA 3B93A 2H6CA 4CDXA 1UPIA 3TRSB 1H1IA 4FXGB 4KU7A 2ZJCA 1YC61 3W59A 1RUD1 1VJ2A 4XCBA 1W8NA 1YEWA 2Z2SB 2WS92 4BLIA 1RUF2 4AHWA 1Q43A 4QKBA 3VD3A 1W04A 4RN5A 2G9FA 1GR3A 1S2EA 1BEV1 4XXPA 2JDAA 1COV2 1PGL1 4WM8A 1BHGA 4JTNA 2IFWA 3U75A 1C8M1 1G9DA 2JB8A 1DDLA 1E5SA 2HWC1 4ITCA 4PLMA 3ZYFA 3ZIXA 3V0AB 3JD71 1W0PA 2XUMA 1DZTA 3BKZA 4IEXA 4FSJA 3OGJA 2TEPA 1N1TA 1U0AA 3ZN6A 1O5UA 5FUIA 2RJ2A 4YVWA 1PGL2 4MV2A 2HEVF 1GZ9A 2A71A 2BVBA 2X5IB 5DAWA 5DAVA 3U10A 3VBOA 1HRI1 1ND2A 1GKBA 2OW4A 4JGZA 4LULA 2UY8A 3TNQA 3VBUC 4AVAA 3ZYRA 1BBT2 4XFAA 1GOGA 2Q1ZB 2PQQA 5D8AC 2C5DA 4NPMA 5SV8A 2C4XA 4C1WA 3H1WA 1NCRC 4O65A 3A0NA 1CX1A 3QOPA 3LIHA 3VD4A 2EALA 5DXDA 4DPNA 4I2OA 2QQPA 4N7UA 4NHXA 1MQTC 1NCRB 4L8QA 3RYKA 2VNVA 2HBUA 1BBT1 5CAZA 2W52A 3INAA 4QQ2A 1EV13 3IZOA 1LKNA 3I2IA 3ZKYA 3GALA 1HRV2 4XUQA 4P9JA 4AVBA 1QJX2 3ZSEA 3POBA 2VQ0A 2FDKA 1Z0HA 4YW5A 4KWJA 5C70A 5C9AC 2FDHA 3NV2A 3I7DA 2GMPA 2ZGRA 1TME3 1JXNA 1MS0A 4JZRA 2HEWF 3ZSMA 3WHTA 2JKBA 2B4KA 5LBEA 4O61A 4CU8A 1HXS1 4NMIA 1TVGA 3WDTA 1I1EA 2HBTA 4CUBA 3ZR5A 1HRV3 5LY1A 2NQYA 4IEYA 2B9UA 4DMIA 5A7PA 1ALYA 2GMMA 4I01A 1OF4A 4Y20A 4CCJA 1VMFA 2XBO3 2VZ1A 2J1AA 2BGOA 2HWD3 3PJYA 4IEVA 5LBCA 2WNUB 3GYDA 4ZZ5A 4YW4A 5K0UA 1HIXA 3RS6A 1GWMA 5C8CB 2VO5A 5FOJB 3T0BA 1WD3A 3AMMA 3FFZA 3E6BA 1XNCA 3AKRA 5B4XA 1HB3A 3N7JA 4QPIA 4CDUC 4D6QA 4FOQA 3AKTA 3WX5A 4XMAA 2ZPXA 4JC1A 1NG0A 3VN4A 1BCXA 4RGKA 1OA2A 1W06A 3OY8A 3I3MA 2WNUC 1A8MA 2JDUA 3A0KA 3FZ3A 5K7PA 2XMLA 3SXWA 3PHMA 2BVVA 5A7QA 5A7SA 2VD7A 4BQYA 4LXLA 1S0DA 4HVQA 2W95A 3VZOA 4EE2A 1HXS3 2WZEA 2MPFA 2G9ZA 1KGYA 2DFBA 1JYWA 1OURA 2NZ9A 1H1AA 4PDWB 4XFGA 1QQP2 3PUHA 3J8F3 3ZFGA 1KITA 1BQPA 4Q1RA 3KV4A 2CHHA 4LNVA 4UFIA 4EZHA 2YZ4A 2DCTA 2V5YA 1WA4A 4QX1A 1JMUB 1OKOA 4FFGA 4WZCA 2R0HA 4XF1A 3VBUA 3W9AA 1N47A 4FPEA 5LEKA 1U5ZA 4GD4A 1N1SA 2ZKNA 3QH7A 3RJRA 4JTOA 3EBRA 5IVBA 2BFUL 2XR4A 3T08A 2AZ5A 3VBRB 1LOGA 1PM4A 5H9PA 5KXCA 4QXBA 3C3VA 1LGBA 2J1VA 4QHZA 2XQXA 2WN2A 4RL7A 4ZONA 4IEQA 4FP3A 1JH5A 4RS5C 1JUHA 1RHI3 1UIJA 4PF5A 4YW1A 1OFNA 1KJRA 1W6NA 1OXCA 2FMDA 3AXEA 2CAVA 3ZLIA 4C0HA 1SBEA 1SCRA 5L73A 4XC9A 4H7MA 3DEMA 4CDXB 3JBG2 4DXZA 4DRVA 2GN3A 2J1TA 4PBOA 3V56A 4COVA 5ABJC 1HJGA 2WNOA 3V64A 1FATA 1FPN2 1YUDA 1QJX1 2HLEA 2ZEWA 1RHI2 3BUCA 2RR11 4KL1A 1Q8SA 4B1MA 2EF6A 4OZOA 4Z07A 1YQ8A 3MIGA 2HEYF 4OFGA 4F3JA 3HNMA 1SFYA 5HCAA 2BBVA 2Y26A 4IE6A 5EFUA 2RV9A 2ZKLA 1YFUA 4QPGB 4BDVB 3SMHA 4TLFA 3C2UA 1OF3A 4XFBA 1JUIA 1ND3A 3AX4A 3AZZA 4HT1T 5FMOS 4PLOA 1IKPA 4XQ4A 4LIUA 3ILNA 5HV4A 1FNZA 3MDPA 5CADA 3O1VA 3KSCA 1UOGA 4QX0A 4W65A 4Q4W1 4ZXEA 5DMYA 1J3QA 1TME2 1AR61 4HG6B 2QKDA 2OKXA 4A42A 4XHXA 1FXZA 5IVFA 4DEQA 1H6YA 4XABA 1DIWA 1CIWA 1ULOA 3C7OA 1SBFA 4IETA 5FP9A 4DNYA 1KFXL 1X9PA 2EIEA 1ASJ2 3BTAA 3FBYA 4ZY9A 4K21A 4AI3A 4BJ0A 2WBKA 5D2AA 1W6MA 3CU7A 2QQMA 4AYUA 4CEWC 5IK4A 4FTSA 4DZGA 2XBO2 1JZ7A 2A6YA 3I2FA 3NNFA 4N53B 1NT0A 3RMYA 4Y1VA 3ZFEB 5A70A 1AR72 1WUVA 2UURA 1MZEA 5HCHA 4GAZA 4CDWA 3USSA 4NHYA 5FY4A 1ASJ1 2JENA 5CBLA 5CFDC 4OQ8A 1W2UA 2W46A 2PQSA 1FAYA 5F5AA 1UY3A 2ZEYA 3URFA 5ACA2 3B9CA 1AR82
chains in the Genus database with same CATH topology
2VUDA 2BOIA 2JDPA 1OVPA 2JDMA 5A6YA 2JDUA 2XR4A 4CE8A 5A6QA 1UZVA 2VUCA 1W8FA 1GZTA 2VNVA 5D2AA 1UQXA 2JDKA 5A70A 1OURA 1OXCA 1W8HA 5HCHA 2WR9A 2BP6A 5A6XA 2CHHA 3DCQA 3ZDVA 2BOJA 1OUSA 5A6ZA 2JDYA 2BV4A 2JDHA 5A3OA 1OVSA 4AOCA 2JDNA 2WRAA 4UT5A 1OUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  2BOI A;  2JDP A;  1OVP A;  2JDM A;  5A6Y A;  2JDU A;  2XR4 A;  4CE8 A;  5A6Q A;  1UZV A;  2VUC A;  1W8F A;  1GZT A;  2VNV A;  5D2A A;  1UQX A;  2JDK A;  5A70 A;  1OUR A;  1OXC A;  1W8H A;  5HCH A;  2WR9 A;  2BP6 A;  5A6X A;  2CHH A;  3DCQ A;  3ZDV A;  2BOJ A;  1OUS A;  5A6Z A;  2JDY A;  2BV4 A;  2JDH A;  5A3O A;  1OVS A;  4AOC A;  2JDN A;  2WRA A;  4UT5 A;  1OUX A; 
#chains in the Genus database with same CATH topology
 5JIU A;  4RHV 3;  5K0U B;  4W6X A;  1NA1 B;  1PIV 2;  2QUO A;  2X8K A;  3LPF A;  4Q4W 3;  5C8C A;  3OG2 A;  1L7Q A;  4MGK E;  4RQP B;  4YFW A;  5DZF A;  4AED A;  4UBH A;  3CDZ B;  4LE4 A;  5FFO C;  1NA1 C;  4LEJ A;  1UZW A;  5JXG A;  3R4S A;  1JU4 A;  1UOF A;  4IV3 B;  4N9H A;  3PNA A;  2K46 A;  1Z7S 1;  3TWI A;  2VH9 A;  2RS5 3;  5DPN A;  3KGZ A;  3K3O A;  5CIR A;  2PHF A;  5C5T A;  2IXK A;  1ONA A;  4JRA A;  1UPS A;  2YBK A;  3THC A;  3KV6 A;  4Y4R A;  1IZ3 A;  4HBN A;  3OOX A;  4IEW A;  3NJZ A;  3O0V A;  2BU9 A;  4XAE A;  2ZS6 B;  1MZ5 A;  1A34 A;  1YYN A;  3ACI A;  1HJF A;  1VBB 3;  5EXO A;  3J9S A;  5JLV A;  1UW8 A;  3PTY A;  2RG4 A;  5FZB A;  2CGP A;  4JVA A;  5IVY A;  1F5J A;  5CFC A;  2GNB A;  2J22 A;  4RSU A;  4D7T A;  3POE A;  2IVJ A;  1G6N A;  4Y5Z 0;  1AR9 3;  2HJI A;  4AI0 A;  3J8F 2;  3BTY A;  1UZY A;  3CIH A;  5GZG A;  1F4A A;  4NRQ A;  5F6K A;  1GQG A;  2VAU A;  1Y43 B;  5CG9 A;  3IDC B;  2TUN A;  1FPN 1;  5FZ9 A;  3EHK A;  5LEJ A;  4HL0 A;  1IS4 A;  3IT8 A;  1OKQ A;  1KQR A;  2BWC A;  2JG8 C;  2DFC A;  3K2O A;  4MET A;  4RD7 A;  5KXE A;  1N1V A;  2WWS A;  4IDZ A;  3ABZ A;  1H8T C;  1W6O A;  1AJO A;  2ZAA A;  4PDW A;  3NV3 A;  3ZN4 A;  4AW7 A;  4BQ2 A;  3AC0 A;  3ZXD A;  3MV0 1;  3HBK A;  3WSO A;  3BTZ A;  2A3W A;  4LK7 A;  4NVP A;  4UFJ A;  1CON A;  2VOT A;  4AAP A;  5F37 A;  5A6Q A;  2A6X A;  2YHJ A;  2YU2 A;  1PGS A;  3AKP A;  1CR7 A;  5LBB A;  3OPZ A;  4PDW C;  4ASM B;  1QHD A;  3VV1 A;  3ZPO A;  1GV9 A;  4MGT A;  2VZT A;  4EQV A;  3RWK X;  1JOP A;  4I0W B;  3ENR A;  4IV1 C;  3AP9 A;  1OPO A;  3EO6 A;  3H42 B;  5KBF A;  3JCI A;  2HWF 3;  3LDR A;  4XTP A;  4P9Y A;  3EMR A;  4L92 A;  3ZYH A;  1H9P A;  1W0N A;  5KHH A;  4DXS A;  1ENX A;  1AL2 2;  2P6C A;  2VMG A;  3P5B A;  3S6P A;  2PLV 1;  1NE6 A;  2YFZ A;  1MEC 2;  1TE1 B;  1V70 A;  3FX3 A;  1ZZ6 A;  4A6S A;  2TBV A;  2O8Q A;  5CA6 A;  5C33 A;  3H1Y A;  2J1R A;  3GBG A;  1Y9Q A;  4CVU A;  3RGB A;  3NNM A;  3MPB A;  1AYN 3;  1GP4 A;  4Y5S A;  2Y60 A;  4QM9 A;  3SCH A;  5A3T A;  2EVX A;  5GZF A;  1MEC 1;  5CIS A;  1ZVF A;  2XG3 A;  2WAB A;  1IGO A;  1XSR A;  2WWJ A;  1Z7S 3;  1ENS A;  3JQX A;  1OLQ A;  4C90 A;  2GAU A;  3KF3 A;  4ATF A;  3NJV A;  5F32 A;  1LRH A;  5FXV A;  5IAX A;  3N9N A;  1DQ4 A;  5GLT A;  5FMO L;  2RS1 2;  4RA0 A;  2VY0 A;  1MQT B;  4F83 A;  5DDJ 3;  5F5C A;  5I0R A;  1D4V B;  3ZXA C;  2QZ3 A;  3NRU A;  3OBT A;  4GMP 3;  4NWW A;  4GWN A;  5HV0 A;  1FOD 3;  3AZX A;  1ZBE 2;  3WNX A;  3BIW E;  1H2N A;  1ZZB A;  1LHU A;  1W05 A;  2CY6 A;  2F4L A;  2F4P A;  1W9Y A;  2RS5 1;  3MHZ A;  5FMB A;  5FYB A;  2YUE A;  2E53 A;  3CL1 A;  5FZ4 A;  2BNN A;  1VBE 2;  1QOO A;  1WW4 A;  2GZW A;  5T54 A;  2JIJ A;  1NOV A;  3SCG A;  4ISR A;  4CUC A;  2ZGS A;  2Y0O A;  2ZZQ A;  5FIX A;  4OCT A;  4QHO A;  4ARY A;  2YC0 A;  3HQU A;  4JGY B;  3DGT A;  4JKL A;  5FPZ A;  2GSY A;  4XBN A;  4CEW A;  1AVB A;  2HWE 2;  2Y0I A;  4OHX A;  1CAW A;  1STM A;  2WKK A;  4E2S A;  2R49 A;  2ZGM A;  2YBP A;  5FLJ A;  4RFR B;  4RR3 C;  4CPB D;  5KR7 A;  4UXA A;  2Y38 A;  3GBW A;  4E2Q A;  3PUQ A;  5A7W B;  2ZAH A;  4YZ5 A;  2GP5 A;  3ZYP A;  3NNG A;  5CU1 A;  5C71 A;  3T4H B;  1C5I A;  3T4V A;  4RS5 A;  1GMM A;  1QH7 A;  4WVZ A;  5HCB A;  4TZD A;  5F1R A;  5JPN B;  2DCK A;  2PMW B;  3MEP A;  4CZS A;  3TAY A;  4GWJ A;  3G6J B;  1OA4 A;  1ZRF A;  3J7L A;  3RWN A;  3T0D A;  1W8T A;  4BQ1 A;  2IFR A;  2ZMK A;  4NAO A;  3NAP C;  2XXZ A;  2ZX3 A;  3NKT A;  3NWK A;  5F39 A;  4EN7 B;  4TLG A;  1WCD J;  4P00 B;  1EPW A;  2OUJ A;  2PLV 3;  3E1F 1;  1DYK A;  5FZD A;  4NRP A;  4HN1 A;  4AVV A;  1S4C A;  4YGC A;  1URX A;  1WCK A;  3WZ1 A;  2ZHL A;  3NST A;  2WUH A;  3AP7 A;  1DYP A;  4QDS A;  5JCT A;  5KXB A;  1M4W A;  1CD3 G;  2W92 A;  4BYY A;  4KQ7 A;  4OZX A;  1REE A;  3OD0 A;  4YM2 A;  2GAL A;  1NKG A;  2W1W A;  3EYP A;  3CLP A;  4AGR A;  3WDU A;  3HNY M;  4UBG A;  2B9V A;  2C9A A;  5FYI A;  2JX9 A;  2V4A A;  3KCX A;  2HWF 2;  3AVS A;  4JV4 A;  1V9U 1;  1S2K A;  3M3O A;  5BV6 A;  5JVV A;  2P34 A;  1J1L A;  3K48 A;  4XCA A;  4QKN A;  2WNV A;  1OUX A;  5GJ6 A;  1HN1 A;  1JYX A;  4J1X A;  3ZM8 A;  3M3Q A;  1HV1 A;  3OYW B;  4JAA A;  5EYY A;  5J09 A;  1JYI A;  2VUC A;  2QQJ A;  3VBR A;  2C6S A;  3MI8 A;  3AMQ A;  2BPA 2;  2VBB A;  1DQ6 A;  5L19 A;  1JBC A;  3OEA A;  3A4U A;  3EQE A;  1H6X A;  2JDK A;  3U37 A;  3MBW A;  3BB6 A;  4YVS C;  2ZX2 A;  4MXV A;  3JXS A;  3A7Q A;  3JB8 A;  5FR3 A;  5FY0 A;  1XNT A;  3PVN A;  3RZK A;  5CFD B;  5LA0 A;  1DZQ A;  4W6W A;  4OUS A;  2WQ4 A;  1YI9 A;  1ZBA 1;  4R9C A;  1S2B A;  2BOI A;  5FWJ A;  3AZW A;  3R05 A;  1QWR A;  5FZM A;  5FRE A;  1OQD A;  4AR2 A;  4CDQ B;  1UN1 A;  3WF1 A;  3U07 A;  2PA7 A;  4RGG A;  2G19 A;  4XIO A;  2AYH A;  5IFP A;  4OHY A;  4Z2W A;  4EWE A;  1FOD 1;  1VBA 2;  5LA1 A;  2RM2 1;  1WKY A;  4XJ8 A;  1UY0 A;  3MIH A;  3RZG A;  4NII A;  4GB3 2;  3WEZ A;  2C26 A;  4DFS A;  3GJA A;  4QPG A;  2WN3 A;  4AFD A;  3IWZ A;  3IMN A;  3NNJ A;  1CQ9 A;  1UYP A;  2IXL A;  5L7O B;  1JZ3 A;  1VAV A;  5C6C A;  1QDO A;  3ALQ A;  3MIE A;  3OPW A;  3N36 A;  4KGG A;  3ZFF B;  4DXT A;  2L9L A;  4Q4Y 2;  4EN0 A;  5J1X A;  3OBA A;  5LB6 A;  1KFU L;  1DZR A;  1CGP A;  3ZYJ B;  2WT2 A;  2VZP A;  2D93 A;  4GB3 1;  4M3C F;  1JZ6 A;  1X50 A;  4H3W A;  4LO5 B;  1BKZ A;  5E8A A;  4FFH A;  2OYZ A;  3GCX A;  4XZU G;  5FPL A;  3S30 A;  3SH3 A;  3KQR A;  3TB0 A;  5DAX A;  3PIG A;  2VW0 A;  1WW5 A;  3J26 N;  3WLU A;  3BTX A;  2O1Q A;  1AYN 1;  1WA6 X;  4LO7 A;  1SBD A;  2WNV C;  2JG9 C;  1KJL A;  1O59 A;  1W0O A;  3AP4 A;  3WF3 A;  3M3I A;  3WW1 A;  5A1F A;  4CP1 A;  3FUQ A;  5DUV A;  3JU9 A;  4AK3 A;  4XDO A;  4FFF A;  3IMM A;  4UFK A;  3D5O A;  4UF0 B;  4YZ1 A;  1GNH A;  4YG0 A;  2YXS A;  2YG0 A;  3O7O A;  4OHZ A;  5FO9 B;  3K3N A;  2JD9 A;  4MOA A;  4MSV A;  3U11 A;  4EZ4 A;  5C4W B;  4URT A;  4CTE A;  1U5X A;  1UYZ A;  1D0H A;  1V9U 3;  2VJX A;  3ZOI A;  2KD7 A;  3MLJ A;  1PVC 2;  1VMJ A;  2Y6G A;  1CIY A;  1IHM A;  5DDJ 1;  1XNK A;  1GOH A;  3VBH A;  1COV 1;  5FBZ A;  4HPK A;  2PHU A;  5FY5 A;  5L9B A;  2FMY A;  3R4U A;  3SNM A;  3WVJ A;  1C8M 2;  2XLA A;  2WLP A;  4KMQ A;  3OTF A;  3LEI A;  3POI A;  3VBS B;  1ZRC A;  1WMF A;  3GXU A;  2D40 A;  4CCD A;  1C1L A;  1X8M A;  2D6K A;  1SQ4 A;  4XAC A;  4XE9 A;  5BNO C;  2WO2 A;  1GZC A;  2XLF A;  2CNA A;  3NJX A;  3B7M A;  4M4R A;  1G9F A;  1YO8 A;  2JEM A;  2VNG A;  4IUG A;  2JEC A;  1JYV A;  5A7W A;  2EIC A;  3N9P A;  4OUL A;  4KBZ A;  3DYO A;  4P9G A;  5A3P A;  4LBQ D;  1OSG A;  4KI5 M;  4MH0 E;  5GLZ A;  2A7A A;  4X8P A;  4BIO A;  1UMI A;  1W2T A;  1K5J A;  1ZBA 3;  2Y34 A;  3LKJ A;  2DYC A;  3TBD A;  3GJB A;  1EP0 A;  3MF9 A;  4YZ3 A;  3RDI A;  3PMS A;  5D8A A;  3VBF C;  3ZVX A;  4LOT A;  5I0S A;  4Y22 B;  4KWK A;  4BQ3 A;  2V4V A;  3MID A;  1O3R A;  1GSL A;  4DUX A;  5J7M A;  5KC6 A;  2RMU 3;  2Y33 A;  4A3Z A;  1ZA7 A;  2VZO A;  3E5U A;  1YWK A;  2WNV B;  1ULE A;  5JMC A;  1ND2 C;  4JGZ C;  3KT7 A;  2VE1 A;  5LK7 B;  3VBR C;  3I59 A;  2JE8 A;  1S0I A;  1P8J A;  3J4U H;  3ZFF C;  4N43 A;  4ONU A;  1V00 A;  3POF A;  4KNC A;  3T1L A;  4LA3 A;  4Y4Y A;  4MGY E;  2VMC A;  1K5M C;  5APA A;  1TMF 3;  2WQZ C;  2D3R A;  3WQ7 A;  1ULP A;  2GH8 A;  3AFK A;  3J7H A;  2R32 A;  1WLD A;  2ZGQ A;  5J98 B;  2VZ3 A;  4P9W A;  4Q0P A;  2IC1 A;  4A4A A;  5K4L A;  4FFI A;  2VCB A;  4LUM A;  3IB3 A;  5FXX A;  2RDN A;  4HKL A;  1CAX A;  4Q8L A;  2QBX A;  5DG1 A;  5AC9 3;  4XUT A;  1LAJ A;  3JUU A;  1UQX A;  4JX0 A;  3ZN5 A;  2H0B A;  3IBM A;  1OLR A;  1NXM A;  3HAG A;  4GA9 A;  3TEX A;  4MGI E;  2GP3 A;  4PHZ A;  1LES A;  1REF A;  1VBD 1;  3LDK A;  5JXH A;  1UKR A;  4Y3O A;  1KS5 A;  1W9S A;  3LWC A;  3HIF A;  4BWO A;  4CDX C;  1XQN A;  5JSO A;  1SLL A;  3MIC A;  3HT2 A;  4ZU5 A;  4YPJ A;  4PJY A;  2YPD A;  5ABJ B;  2WO3 A;  1IPK A;  5KHK A;  3O1S A;  1GNZ A;  2WZP P;  4BQW A;  4CEY C;  5F3E A;  1LOF C;  2VNO A;  4AG4 A;  4P14 A;  1S0G A;  4O7X A;  2QFE A;  3EJK A;  1O5L A;  5K8S A;  1AR7 3;  4C0B A;  3IDE A;  2X5I A;  5FZA A;  1MPX A;  4EWD A;  2DV9 A;  2XBO 1;  2RJK A;  3BU7 A;  3RZM A;  1I3H A;  5FJH A;  3I2H A;  4JDM A;  1NZC A;  2A70 A;  2WZR 1;  4N8M A;  3FHQ A;  2E7T A;  2JWP A;  5IAT A;  1YQ6 A;  2Q8O A;  1SZB A;  1QU0 A;  2XJP A;  1AYM 1;  1ND3 B;  2MEV 2;  4QT6 A;  3VKO A;  3V65 A;  1COV 3;  1AXK A;  1PIV 3;  4Q4W 2;  3K4D A;  2D5H A;  4BB3 A;  2ES3 A;  4QXK A;  5ACA 1;  5FPX A;  1BLZ A;  4NAM A;  1QJF A;  2W47 A;  3HT1 A;  5LCW L;  1Y9M A;  1R08 2;  4E8C A;  2ZGK A;  1BXH A;  5BNN B;  1SDD B;  4UOJ A;  2F6B A;  2K9Z A;  5A6Y A;  4L9B A;  3JD7 3;  4E8D A;  5LWB A;  2VEC A;  1IKQ A;  1H1M A;  1Q8Q A;  2Q1M A;  4S2H A;  3WQ0 A;  4AGV A;  3BOP A;  2W9X A;  2VNR A;  4IE7 A;  4TYS A;  2FBE A;  4PF1 A;  4QU2 A;  3HOB A;  4CP9 B;  1KDK A;  3D0J A;  1C28 A;  5GLU A;  2Q8C A;  4CYD A;  5FZE A;  3UNP A;  2QE3 A;  2P4E A;  4LBJ A;  1CZV A;  5IK7 A;  1CAU A;  5FQ0 B;  1PM7 A;  3HNB M;  1D4M 2;  1DQ0 A;  3RG0 A;  3TN9 1;  4OHV A;  1NLQ A;  3W21 A;  2XON A;  4Z1V A;  1LOC A;  1SPP A;  1SCS A;  1X9T A;  3T3Y A;  1W2O A;  4BM8 A;  1LUL A;  3AJY A;  4H7L A;  4GQ7 A;  3SHR A;  1LHO A;  4NUB A;  1JN2 P;  4DXR A;  4WM7 B;  1OOP B;  2VOW A;  2YGM A;  3MFA A;  4R52 A;  1YLL A;  3DL3 A;  3GZA A;  4FXK B;  4JRL A;  1PO2 3;  4LKF A;  5FZ3 A;  1XB9 A;  2JJ6 A;  4HON A;  1XNA A;  2WYS A;  1WZX A;  3UK9 A;  4K1Y A;  1JI6 A;  5FZG A;  4MVT A;  3MW2 A;  2I07 B;  2WO7 A;  3I2D A;  5T5O A;  5EJ1 B;  3Q8C A;  1RJ7 A;  1DU3 D;  3P1I A;  1DQ1 A;  5D1I A;  5A33 A;  2CU5 A;  4AXO A;  1NLR A;  4YSF A;  1JOB A;  4GIQ A;  5A3O A;  1I5Z A;  4CUG A;  3U4S A;  2VGD A;  4LBL A;  3AMN A;  2VBD A;  3DPR C;  3K4A A;  2JDP A;  1VBD 2;  2D6L X;  3Q9O A;  4N43 B;  1RUJ 1;  1UU5 A;  1PO2 2;  4IV1 A;  1Y4W A;  4DUV A;  4LHK A;  1DF0 A;  4P08 A;  1HQL A;  2E7Q A;  3CF6 E;  3ST7 A;  4OHW A;  3P3P A;  1DGW A;  4HET A;  2RS3 2;  2A6W A;  4UFM A;  1MR5 A;  1QJZ A;  2WQ8 A;  4S2G A;  5D8A B;  2DCY A;  1ENQ A;  3THT A;  1KS4 A;  1AL2 3;  2E6V A;  4B7E A;  1OT5 A;  3TOJ A;  4B1L A;  2OPK A;  2VU9 A;  2VQU A;  2WT0 A;  1CAX B;  4LBQ A;  5EWS A;  3GDB A;  5BNO B;  1AR6 2;  4DY3 A;  2PLV 2;  2V73 A;  5GLV A;  5EV7 A;  1W6O B;  4I30 A;  4BIS A;  1PK6 B;  3WR0 A;  3LE0 A;  5KHI A;  1W8W A;  2N7G A;  2VVF A;  3MLL A;  5C3Q A;  4CE8 A;  4KU8 A;  2WJS A;  4XW3 A;  4U36 A;  1LEM A;  5IUQ A;  5BPX A;  4Y5T A;  4WVV A;  2BER A;  5T50 A;  5I8Y A;  2WZR 3;  1DYO A;  1JZ2 A;  2A1X A;  2WZ8 A;  3HD8 B;  1CVN A;  3CZJ A;  1B09 A;  2QNK A;  4CDW C;  1K5M B;  5A3L A;  2BP6 A;  2DTW A;  1GZW B;  1H8T B;  2NLR A;  1Y3T A;  3MV1 1;  5FY8 A;  2DVF A;  1BZW A;  5LAT A;  2J1E A;  1AL2 1;  4LK6 A;  3ROU A;  2VL4 A;  1K45 A;  2PYT A;  4D69 A;  1ULC A;  2FZ2 A;  2FCT A;  4K8F A;  2ARX A;  4CA9 A;  3IPV B;  4MGS A;  1EAH 3;  1PIV 1;  3WT3 A;  3IAP A;  1G9C A;  4GKX A;  2ZAC A;  4QM8 A;  3VHN A;  3WNN A;  2NMN A;  1GWL A;  5IT6 A;  2GNM A;  4OQ9 A;  3ZXE A;  1FMD 3;  5ABJ A;  3AMP A;  5T52 A;  5EQU A;  4QWN A;  3S0M A;  3X29 B;  3OGG A;  4HOO A;  1DGL A;  3BU0 A;  4NIH A;  1GU3 A;  5ISL A;  1E5H A;  2R06 2;  1NQD A;  4AED C;  2EAA A;  3OD4 A;  1X7N A;  3TN9 3;  4E4S A;  3UKT A;  3VGI A;  1MZ6 A;  1UAI A;  2VUJ A;  3D8C A;  4QU1 A;  4Y24 A;  3DN7 A;  3MW3 A;  4XF9 A;  5FTT C;  3AJZ A;  4E4Z A;  3RI9 A;  2RS1 1;  4K40 A;  4ZS2 A;  2K2S A;  2XJS A;  4XVH A;  4D8M A;  1O3S A;  1WLW A;  2W2I A;  2WII B;  1RVF 2;  4OYU A;  4KBB A;  4Q4X 1;  3RYR A;  4QMA A;  5EYX A;  2EXJ A;  1BK0 A;  3E6D A;  3O1T A;  1CJD A;  1QJY 1;  5FPA A;  1GWK A;  2PFW A;  1RIR A;  2XVG A;  1RL3 A;  4DIN B;  1V6I A;  3VHP A;  1HDK A;  3RPQ A;  3D0S A;  1RIT A;  1RUE 3;  2WAA A;  4KH9 A;  4K6B A;  5E6H A;  3UYJ A;  3BPZ A;  1W28 A;  1UF2 C;  3IN9 A;  1U5Y A;  2D43 A;  3H3L A;  4GMP 0;  4BOW A;  3VBF A;  2OPW A;  3UJO A;  2ZHK A;  5FP8 A;  3V0B A;  1PO2 1;  5F9T A;  4CEY B;  1POV 1;  2F17 A;  1RUH 2;  3KM5 A;  3PL0 A;  3M3C A;  1S0F A;  4Q4V 2;  2A6V A;  1VIW B;  2VMD A;  4B4P A;  5CEH A;  3I8T A;  4COW A;  5JPM B;  5IK5 A;  3I3Q A;  3WNO A;  3ZO0 B;  4XAA A;  4IGO A;  2HWE 1;  2W0X A;  4GZ9 A;  5ACA 3;  4MG2 A;  1UOB A;  4M01 A;  1C57 A;  4R4Z A;  2VZU A;  4NN0 A;  3WG4 A;  2WNU A;  1ND3 C;  3WNM A;  3GNE A;  3RZZ A;  4C8D A;  3HJR A;  5FUN A;  1BMV 1;  1YRZ A;  3LDB A;  1NLS A;  1PMJ X;  3NVC A;  1FV2 A;  2AAC A;  3H7Y A;  2ZXQ A;  3CJI C;  3ACH A;  4Q1P A;  5ANN A;  4DOU A;  1Q8O A;  1I9R A;  4MXW B;  4SBV A;  2YC4 A;  4NRM A;  3ZFG C;  2OS2 A;  1WMD A;  1OH4 A;  1AUY A;  4QDQ A;  1XE8 A;  2ARC A;  2E33 A;  2XKP A;  3NJY A;  4B8E A;  1WBL A;  4ZPI A;  2AEY A;  5FLI A;  5L36 A;  3O1U A;  1JYC A;  2JG8 A;  3WNL A;  4BA6 A;  4PI0 A;  4F8A A;  3I2O A;  1QEX A;  4OLL A;  3RZH A;  1IG0 A;  2ORX A;  1F5F A;  3T2T A;  3ZFG B;  2ZBJ A;  5FJK A;  1T6G C;  4A6O A;  3LPG A;  2XDV A;  4QX3 A;  1W8O A;  2FCU A;  2VVD A;  4QPI C;  2BZD A;  2RS5 2;  3LFM A;  4LQR A;  1VBE 1;  3U0Z A;  1EPZ A;  1RUI 2;  1WCS A;  1ZM1 A;  2R07 1;  4IV1 B;  1UXX X;  1JZ8 A;  1EUT A;  3POS A;  2YV8 A;  5AFE A;  2JG9 B;  5FDB A;  1X33 A;  1QJU 1;  4FPK A;  1PVX A;  2YDE A;  2HKX A;  2BW8 A;  4DS0 A;  2JDY A;  5FXZ A;  3N7M A;  4GWM A;  2VR4 A;  4DQA A;  4FOW A;  3VZM A;  3RQ0 A;  4I02 A;  2NN8 A;  4YM3 A;  3TEZ A;  1O8P A;  4YW6 A;  1FMD 1;  1GZW A;  1QJU 2;  5F5I A;  1ZBE 1;  2R1D A;  3C8X A;  1UZV A;  2B8M A;  2CGO A;  5FUP A;  4A45 A;  4D94 A;  1A8D A;  2D3P A;  2ZGN A;  4XMI A;  1UOJ A;  5GLW A;  2JXA A;  1AJK A;  2VUL A;  4YW3 A;  2JIC A;  3HQR A;  1YCI A;  2D6M A;  1IOA A;  1ZZ9 A;  4LTA A;  3VDD A;  4XJA A;  4D0Q A;  4XJU A;  1X36 A;  4ET7 A;  5FKC A;  3RZL A;  3LD8 A;  2ET7 A;  4KWL A;  4WM8 B;  4AEM A;  4FOY A;  2P5B A;  2XOM A;  1TMF 2;  4WV8 A;  5LBF A;  4D7Y A;  1US3 A;  1TZO A;  1QJY 3;  2QTW B;  3SKJ E;  4XEZ A;  3WNK A;  4DO0 A;  3VHR A;  3VDC A;  1ZRI A;  1SG3 A;  1WCU A;  4P9X A;  5CFD A;  4W4Z A;  5JXJ A;  1IQA A;  1IG3 A;  4UW6 A;  4AI9 A;  2RS1 3;  4IGP A;  4COU A;  5J37 A;  1DBN A;  5FZL A;  2VVE A;  1XYN A;  2UYB A;  5FCC A;  2WA3 A;  3WNP A;  1AYN 2;  1QJX 3;  2WNE A;  3PVE A;  3ILR A;  3OGS A;  1ZBE 3;  1V6K A;  4HFS A;  3DEC A;  5M0T A;  1UY1 A;  4DY5 A;  4BHP A;  2FZ1 A;  1CJP A;  1R1A 1;  2GN7 A;  2ID4 A;  2ILM A;  2W68 A;  4GH4 B;  2PHT A;  4GUL A;  1NUK A;  3N3H A;  2XJR A;  4PBP A;  1SEF A;  2O8O A;  3LEG A;  3IKW A;  3O14 A;  4RGA A;  5FKB A;  3N4M A;  2LRP A;  2XB6 C;  2ZX4 A;  4UFL A;  1WWY A;  2VZQ A;  2SBA A;  5DDJ 2;  2VUD A;  4IEO A;  1Q56 A;  1R1A 2;  4X6Q B;  1Q5O A;  3NV1 A;  3P3N A;  3S7E A;  3ZR6 A;  3PLQ A;  1LHV A;  1RUD 2;  4YGE A;  3M7A A;  4FQZ A;  4CEY A;  4CDW B;  3D6E A;  3TEY A;  1CES A;  2YBS A;  2OZ6 A;  4LBM A;  5HBA A;  2XPJ A;  1GZT A;  5EPA A;  2VOK A;  4CU7 A;  4XDQ A;  3BAL A;  4JHT A;  5T5J A;  5IVV A;  1HV0 A;  4W6Y A;  4K8R B;  5JOZ A;  1YQC A;  3KZ4 C;  3FE5 A;  3WQ1 A;  3SCF A;  4CP9 A;  3U78 A;  4Y1U A;  4FPO B;  4JDN A;  3KMH A;  1OLM E;  5BNP C;  1LB2 A;  3CMG A;  4LT5 A;  2ZGO A;  2RHP A;  5K9Y A;  4X6R B;  3LA3 A;  1R1A 3;  3O1M A;  3PTR B;  2WYF A;  2J42 A;  1KDM A;  1ZRE A;  1YJK A;  1Z78 A;  1QGL A;  1YQ2 A;  3GF6 A;  1FV3 A;  1QDC A;  3NAP A;  4FPL A;  2VW1 A;  5KHG A;  2OXB A;  4XTM A;  4RQP A;  3FL7 A;  4AED B;  2E31 A;  4HPK B;  5FZC A;  4AFB A;  1H4H A;  4K20 A;  3AB0 A;  5GZE A;  3ZXL A;  1H9W A;  2CSG A;  3AMH A;  2BFU S;  2IZW A;  3OJB A;  1FT9 A;  1W6Q B;  2XKO A;  1CAV B;  1S55 A;  5A7N A;  2XL7 A;  4D3W A;  5FPV A;  2HWC 2;  3USU B;  2EAK A;  5JDB A;  1RMU 2;  2LTN A;  2DVD A;  2WSU A;  2WSV A;  1UCX A;  2XWB B;  1DQ5 A;  1KXG A;  4XXA A;  1YFW A;  1VRH 3;  2WRA A;  5FMC A;  3POY A;  4Y1X A;  4QGM A;  4BXS V;  4AGG A;  2EID A;  5FZ6 A;  1QF3 A;  2NYY A;  1RUC 3;  1BVV A;  5FYT A;  1H8V A;  1RUE 1;  2FCV A;  4AQT A;  4XZP A;  3LA2 A;  4C1X A;  4CU9 A;  3N35 A;  3R4D B;  1CX4 A;  4QQO A;  2RM2 2;  1D7P M;  4ARX A;  2R1B A;  4Y22 A;  1D2Q A;  3B00 A;  3N7K A;  4PIX A;  1OD5 A;  2ADD A;  2Z42 A;  5DZE A;  3RRD A;  3WP4 A;  3WF4 A;  4DRR A;  2NP0 A;  3BCW A;  4MO3 M;  2DVA A;  4IES A;  5LY2 A;  5J3U A;  3FUO A;  1SLA A;  3RMX A;  1A6C A;  4IEU A;  2CGN A;  1W9W A;  2RR1 2;  5F5Q A;  1S0B A;  4QGN A;  2OVU A;  4G4F A;  5JOW A;  1SLT A;  5JR2 A;  5KXD A;  5F2W A;  4W8J A;  3KQ4 B;  1J1T A;  2QQN A;  2Z4F A;  4Q0Q A;  4BMB A;  3HN1 A;  1CZS A;  1JOJ A;  1PO1 3;  5BNO A;  2JG9 A;  4ES8 A;  1IS6 A;  3OYW A;  2GC3 A;  2VMH A;  4LA2 A;  3ELN A;  3T09 A;  4QB6 A;  3C7H A;  4U2A A;  2W5F A;  3L2H A;  2YPJ A;  1SAC A;  4CCE A;  1OVP A;  4E9K A;  1F8V A;  3SH5 A;  3HWJ A;  2Y6J A;  2ZEX A;  4G3Y C;  1OLM A;  4S2D A;  2VZV A;  1SLI A;  2H6B A;  2J1S A;  2VZS A;  5CKM A;  4R4X A;  1MS4 A;  2YY1 A;  1C4R A;  3BYW A;  3OBZ A;  3VKL A;  2RS3 3;  4ZS3 A;  3WY6 A;  4CXX A;  1K3I A;  3DYM A;  2RDR A;  4RR3 B;  3H3U A;  3LOB A;  3GZU C;  5F3G A;  4I09 A;  1G9A A;  4XYX A;  2MEV 1;  3WD5 A;  2ZGL A;  1UY4 A;  4XQD A;  3ZXF A;  2CWS A;  5BNQ A;  2ATF A;  2UY9 A;  3OGR A;  3CJX A;  4OI4 A;  1ND2 B;  4JGZ B;  4O9E A;  1IPJ A;  2EXI A;  1ZZ8 A;  2BYV E;  2R6Q A;  3HR9 A;  3NL1 A;  3WIN E;  5J36 A;  2B42 B;  1GAN A;  1GQH A;  2VOX A;  3BOW A;  5G05 L;  2D3S A;  5JSP A;  3FFQ A;  5E88 A;  1MZF A;  3AK0 A;  2WT1 A;  2MNG A;  5ERL A;  1XU2 A;  3SQO A;  1F31 A;  3KHB A;  3UKN A;  1XE0 A;  4Q2F A;  5F8P A;  1ULF A;  3A21 A;  1WBF A;  2KR2 A;  1NCR A;  1LR5 A;  2EIB A;  2PAE A;  4YVS A;  2XUE A;  4NHK A;  5T5L A;  3WCS A;  3PIJ A;  1ODN A;  3DCQ A;  1HRI 3;  3K46 A;  4LOR A;  4MGQ A;  4R8H A;  2VPV A;  1UZZ A;  1RUD 3;  3BVC A;  5EZW A;  1XU1 A;  1UU4 A;  1WCQ A;  2TNF A;  5JI9 A;  3ZSJ A;  4FAG A;  1FX5 A;  1AF9 A;  1TQ5 A;  5E16 A;  5AFB A;  4QKD A;  2ZCW A;  2X53 S;  5C8W A;  3H1M A;  4EN8 B;  5JR7 B;  1E5R A;  1C8M 3;  4CP0 A;  4UF0 A;  5CZK A;  4GAL A;  2R7E B;  3AKQ A;  3LA7 A;  5I8S A;  2DWR A;  4GH4 C;  2DU0 A;  4IXL A;  4XJW A;  1RVF 3;  1W6P A;  4IL7 A;  3P6B A;  2D6N A;  3MPP G;  1NCQ C;  4LO8 A;  1AL0 G;  1R64 A;  2W3J A;  4B4Q A;  2VCC A;  4Y1Y A;  5IW0 A;  3O0W A;  1OUS A;  2BV4 A;  1W8U A;  2DBI A;  2Q0A A;  4FPC A;  1O4T A;  3APB A;  4S2F A;  3UV9 A;  3CHX A;  4UFH A;  1CN1 A;  1PO1 1;  5HPO A;  1XND A;  1VBB 2;  2GDF A;  2YGL A;  5FYS A;  2AH2 A;  3KV9 A;  2X10 A;  2VCA A;  3ETQ A;  3Q8F A;  4ZU4 A;  5I91 A;  3AXD A;  4R9B A;  4YAR A;  5AVA A;  5A32 A;  3JBG 1;  4QPI B;  2CYF A;  1RUH 3;  3QD6 A;  3NAP B;  1Q8P A;  2QZ2 A;  3QBQ A;  1AX2 A;  1H0B A;  3ITQ A;  3AYD A;  4N7I A;  2OQ6 A;  4E4H A;  2ET1 A;  3H8X A;  2Q4S A;  2CTV A;  2GH2 A;  3AYE A;  3BN6 A;  1MVE A;  4FOV A;  4FPF A;  5FXW A;  2ORZ A;  1AX0 A;  1YIP A;  1B35 A;  4XBQ A;  4YGD A;  2G1M A;  1W39 A;  2Q30 A;  4V2W A;  2VZR A;  3VZJ A;  5KC5 A;  2PHX A;  4XF4 A;  4XDP A;  3O1O A;  1YI7 A;  1N3O A;  5GM0 A;  1SLC A;  4HZF A;  2QQU A;  1CAV A;  2VXR A;  1PZ7 A;  2XWJ B;  5IYY A;  2A3X A;  3VD7 A;  1OC1 A;  2WDB A;  4GJZ A;  4LJH A;  4HAN A;  2WFF 2;  1ODM A;  5DUU A;  2GND A;  3S7I A;  4JQR A;  2OX0 A;  4XIK A;  1ZX5 A;  4BPZ A;  4YLZ A;  1WGP A;  4JHZ A;  4LO6 B;  4WBB A;  1KD7 A;  1E57 A;  2J7M A;  2QQV A;  4GJY A;  1GQP A;  3WV6 A;  3KT4 A;  3AKS A;  1MEC 3;  3PUR A;  4K9S A;  4BQX A;  3PJQ A;  4Z8B A;  2O0O A;  4K7J A;  3WG1 A;  5DN2 A;  2BQP A;  4IEZ A;  5GAL A;  1XJA A;  1R1Z A;  4GMP 1;  2BDR A;  4AOC A;  4XUP A;  1PZ9 A;  2HYK A;  2LUW A;  2UWB A;  2IVI B;  4NO4 A;  2P3Y A;  5H9S A;  1LOB A;  1QQP 1;  4XBL A;  4RR3 A;  4LLF A;  4CCO A;  4ZHN A;  1MS8 A;  2OT7 A;  2X29 A;  1E5I A;  4QGL A;  5EJZ B;  2R06 3;  3I2K A;  3WCR A;  1DLC A;  5DZG A;  2WAO A;  2LRO A;  4KWU A;  4YZ2 A;  1U5I A;  4CP2 A;  4DEV A;  1NYW A;  5J96 B;  1EYB A;  1OH3 A;  1V6L A;  2JIG A;  2WR9 A;  4QX2 A;  4ASL A;  3I49 A;  1OA3 A;  1QJU 3;  4CDQ A;  3VBO B;  5CKQ A;  5JXI A;  1JYT A;  1V6O A;  3ES1 A;  4AHZ A;  1XSQ A;  3J8F 1;  1W99 A;  5LRS A;  1WLT A;  2P2K A;  1RED A;  4JQT A;  4N53 C;  4SLI A;  3ZFE C;  1Z7S 2;  1XC6 A;  2C9K A;  1DFQ A;  1VBC 3;  2BNO A;  2D7F A;  1QJY 2;  1BBT 3;  1RJ8 A;  1DG6 A;  3LFI A;  3R0R A;  5L7O C;  5LW9 A;  4PIY A;  1MVQ A;  2A75 A;  5FK8 A;  3SLI A;  5JMO A;  5AC9 1;  2CL2 A;  1OQE A;  5TSW A;  3UES A;  4UW4 A;  1XOY A;  2HWB 1;  3FLP A;  3H8O A;  2OII A;  2EXK A;  3DUI A;  3FLT A;  3THD A;  2RS3 1;  4BCU A;  1UYX A;  5L7O A;  3T1M A;  2QCS B;  5BNP B;  4I0A A;  1RHI 1;  3FMG A;  5A6X A;  3W5M A;  4YWA A;  4Q5O A;  2BOJ A;  2FDJ A;  4XFC A;  1O4Y A;  1VBC 2;  1J83 A;  4AHY A;  3H9A A;  4AFM A;  1C1F A;  1JU3 A;  2HWB 2;  4UAP A;  5HXM A;  1MS5 A;  2YU1 A;  4OUM A;  4Q4X 2;  4QX7 A;  5DUX A;  1DCS A;  4AEK A;  1LGC A;  4TXW A;  3WP6 A;  1W9F A;  2D5F A;  2ZZJ A;  3I4I A;  3NO8 A;  1V6M A;  1XE7 A;  2E7A A;  1T2X A;  3F95 A;  3N9L A;  1ST8 A;  1LEN A;  4GWI A;  1PX3 A;  3ECQ A;  4W50 A;  4ISQ A;  1W3V A;  3W20 A;  3LEM A;  4BLJ A;  3DKQ A;  1PK6 C;  3E5Q A;  1V6N A;  1W8H A;  1XXN A;  2HH9 A;  4UWD A;  3VBH B;  5C9A B;  4LKD A;  2HWB 3;  4QX5 A;  1APN A;  2PTM A;  5JOY A;  3U4X A;  4KGQ A;  1L3J A;  2ZAB A;  1OFS A;  2YYO A;  3VB9 A;  2JDH A;  1W8Z A;  4D6S A;  5IFT A;  4Y20 B;  2GME A;  5FY7 A;  1VMH A;  2Q1F A;  2ERF A;  5B4N A;  2GNT A;  5FZI A;  5BUV A;  3IIA A;  3KLS A;  2KA3 A;  3WG2 A;  1BYH A;  3MYX A;  2B5H A;  4HSJ A;  5FZF A;  1UMZ A;  3TEW A;  2OUH A;  1J3P A;  1LU1 A;  4YZ4 A;  1WME A;  1XRU A;  2BBA A;  4FPY A;  1RYY A;  1AR8 1;  2R07 3;  5IVC A;  1RUG 2;  1O4Z A;  4LIV A;  1U12 A;  4LO4 B;  3OEB A;  1LGN A;  4AVC A;  4OMC A;  3BOD A;  3CO2 A;  2X5I C;  3H8R A;  3WW2 A;  4RHV 1;  3T30 A;  3RJ2 X;  4Q8K A;  4FTB A;  1QQP 3;  4A2U A;  2E26 A;  4P5Y A;  3OCP A;  3VBU B;  3WF2 A;  4CUA A;  4YM0 A;  1HKD A;  4N90 A;  3ZSK A;  4OMD A;  4M3C B;  1UXZ A;  2JDM A;  4FI9 A;  2JD4 A;  4TSV A;  4A7K A;  4IE4 A;  3H7J A;  5T3N A;  2C24 A;  4WM7 C;  4M3C E;  3HVD A;  3KD4 A;  4E4D X;  3JB4 C;  3RFR A;  1BJQ A;  5L9V A;  1QMJ A;  1FI2 A;  4LHN A;  2R06 1;  1ZBA 2;  4A3X A;  3SC7 X;  4YG6 A;  1JTZ X;  1GLH A;  3MIB A;  1C8N A;  1OMI A;  3C7G A;  3B69 A;  5G04 L;  5KHJ A;  1PGW 1;  2D44 A;  2Z79 A;  2D97 A;  2E9Q A;  2XJU A;  3DKW A;  3ZMO A;  4M0H A;  1AR6 3;  4EWA A;  2PHL A;  2A3Y A;  2WL1 A;  2XHN A;  2P3K A;  2Z5W A;  2XVL A;  4N9I A;  3H0O A;  5FP7 A;  4M4P A;  1AR9 1;  1OOP C;  3LEK A;  4COY A;  5A3U A;  4QKF A;  1J58 A;  5C5U A;  5C8C C;  3O1P A;  1RB8 G;  3AZV A;  4YVW C;  1QY4 A;  4JKK A;  2XJQ A;  1VBC 1;  1VAK A;  4LE3 A;  1LCL A;  4E27 A;  3VD9 A;  1K5M A;  1HN0 A;  1EV1 1;  1DGR N;  1HLC A;  5BNN C;  4YW2 A;  5C3O A;  4MLO A;  5CG8 A;  2P17 A;  1LOF A;  5A3W A;  3CBN A;  2Q8D A;  1G86 A;  4V2V A;  1VE0 A;  5FYH A;  1CPM A;  4MGZ E;  4Q4V 1;  1W3X A;  4JGY C;  5IJR A;  1TMF 1;  3PUS A;  3AZY A;  4A7Z A;  1AX1 A;  2CAU A;  4UW3 A;  3WDV A;  1D2S A;  4CXW A;  5LRR A;  4Q0V A;  4QQL A;  3DXU A;  3I97 A;  2W1S A;  2ADE A;  2CDP A;  2RE9 A;  3AM2 A;  5BNP A;  3GHM A;  5IVE A;  2UU8 A;  1VR3 A;  5A3N A;  4Q4Y 3;  4EN9 B;  4NHM A;  3DV8 A;  2ZX0 A;  3LCP A;  5CNA A;  2VMF A;  3N9M A;  5I0U A;  4Z92 B;  3AVR A;  1RC6 A;  5LA9 A;  2Y6K A;  1W9T A;  4G9S B;  1LOD A;  1RGS A;  1TNF A;  1W6M B;  2Z69 A;  4IE0 A;  1AR8 3;  2ZHM A;  2G4I A;  2XJV A;  1PVC 3;  2AC1 A;  2ZHN A;  1JS9 A;  3ORJ A;  3RZJ A;  4YVS B;  1DQ2 A;  1OD3 A;  1QNW A;  3WDX A;  2EIG A;  2XJT A;  3BGA A;  4GH4 A;  5A80 A;  1DGW X;  3NW4 A;  1LHW A;  2ZMN A;  3T2Q A;  5SV5 A;  3H50 A;  4FPH A;  5LK5 A;  4FPJ A;  1BEV 2;  1RUG 1;  1YHF A;  2VMI A;  5LA2 A;  3ZXJ A;  3I2J A;  1A78 A;  5FY9 A;  5CB7 A;  1FMD 2;  1AHS A;  5JZG B;  4LUK A;  4QPY A;  4YGB A;  4Z82 A;  3E6C C;  1VPH A;  4MX3 A;  3UKV A;  2DUR A;  1LJ7 A;  2VTX A;  4FO9 A;  2AEN A;  4IV3 A;  2R04 3;  5IVJ A;  1QNY A;  2W1Q A;  1RUI 1;  2R07 2;  1C3H A;  2ZA9 A;  3UGF A;  4YW7 A;  5C7G A;  5DUW A;  2B45 X;  2Y8K A;  1NZI A;  1JW6 A;  2RMU 1;  4UYB A;  1JZ5 A;  4IEP A;  4PQQ A;  4M0N A;  3FN9 A;  2ZOE B;  3NMB A;  4PI2 A;  2NM1 A;  5EP9 A;  1HRI 2;  4NOT A;  2DBN A;  3Q8E A;  2LS6 A;  1BVP 1;  2ZEZ A;  2VC9 A;  1KRI A;  3WF0 A;  4PQ9 A;  1OVS A;  3VBS A;  5HXV A;  4YFZ A;  4XHB A;  5FP3 A;  1F9K A;  3GZT B;  3PUA A;  4UI9 L;  3KCC A;  4CCK A;  2R04 2;  1OQ1 A;  3KS7 A;  3SKV A;  1RUE 2;  1PGW 2;  4HXC A;  4LPL A;  5A32 B;  3WW3 A;  2DCJ A;  4AQ6 A;  4PLN A;  3OY8 B;  4CCN A;  2HWD 2;  4MXW A;  1EUU A;  4I0B A;  4IE5 A;  3FLR A;  3MO4 A;  1ZA4 A;  3MUY 1;  4GKY A;  1H2M A;  2YC2 A;  2KXL A;  2QQK A;  2RJL A;  4BXF A;  2DCZ A;  1UYY A;  4NE9 A;  4L97 A;  3ZX7 A;  1AR9 2;  1O8S A;  3MGU A;  4ERO A;  5K0U C;  2V09 A;  4QPG C;  1N3Q A;  2UWA A;  4J6G A;  3FC0 A;  3GCW A;  2BNM A;  2JG8 B;  1F15 A;  3GZE A;  3B5L B;  3MIF A;  3POW A;  4LOS A;  4QB2 A;  3USU A;  4UT5 A;  4EYU A;  1K42 A;  2WFP A;  3KVA A;  3KWV A;  3O0X A;  4LKS A;  4XFH A;  2X05 A;  2IXI A;  2QJV A;  3SIT A;  4FBF A;  4XUN A;  2W87 A;  3AFG A;  1Y7B A;  4V1P A;  2YRO A;  4LIT A;  5JI7 A;  3N9Q A;  1GIC A;  1HXS 2;  5FBJ A;  1IS5 A;  2ARE A;  4Q4Y 1;  3TNP B;  5A3M A;  4FT8 A;  3VBS C;  5C3R A;  2P6H A;  2AEZ A;  3ASI A;  3JZV A;  4NWV A;  4GXL A;  5FYM A;  5IK8 A;  3M70 A;  1PHM A;  2QQW A;  2WFF 3;  1MAC A;  2C0Z A;  3FWE A;  2FDG A;  3HPN A;  3HN3 A;  4NJ4 A;  1R09 1;  4IER A;  1GNY A;  1F35 A;  4WM8 C;  2QQI A;  1DHK B;  5DG2 A;  3M8L A;  3DXT A;  1J59 A;  3SIS A;  3OUH A;  4LBQ B;  4A41 A;  3VHO A;  4IV3 C;  2AR6 A;  3ACG A;  3A22 A;  1ZZC A;  3ON7 A;  4BK5 A;  2VG9 A;  1SLB A;  2BGP A;  2ZX1 A;  2PAM A;  4H55 A;  4XF0 A;  4P9L A;  3V0A A;  3AL5 A;  1ZNP A;  2WZR 2;  1ZZ7 A;  4ZXK A;  2B7Y A;  1OBN A;  2BWA A;  2XGX A;  1GYK A;  3SH4 A;  1VB2 A;  3PU8 A;  3MW4 A;  4J1W A;  5F6L B;  1R08 1;  3WUD A;  3IPV A;  4DUW A;  2SLI A;  1QH6 A;  1OI6 A;  4L99 A;  5FAX A;  2VCM A;  2WS9 1;  2WWU A;  5DQ0 A;  3VL9 A;  4QD2 A;  4Y1Z A;  1EAH 2;  3LOI A;  1W03 A;  1YQ5 A;  3PME A;  5F3I A;  1XPW A;  1N3P A;  1IQD C;  2UYA A;  1AXZ A;  4O9G A;  1BEV 3;  1MQT A;  1UZ0 A;  5JAX A;  2D98 A;  4JCK A;  3AYC A;  4N43 C;  1W2A X;  3ZFF A;  4AQS A;  4NPL A;  5FWE A;  3FHA A;  4RQP C;  3M4F A;  3B3Q E;  2VOV A;  4LHS A;  1ZYB A;  3JD7 2;  2JE9 A;  1V6J A;  2EXH A;  3TN9 2;  2QDR A;  2C1F A;  5H9R A;  1YIF A;  4BK4 A;  1NY7 1;  4ZKT B;  4P9I A;  1AXY A;  4AE2 A;  2W39 A;  4NPR A;  3BIE A;  2R04 1;  4MUV A;  5DAP A;  1A3K A;  1RMU 1;  5BNN A;  2VW2 A;  2Q8E A;  3RYP A;  1VP6 A;  4IW3 A;  1VBA 1;  1HQW A;  5FMD A;  4MHU A;  3ZDS A;  2FHR A;  1RUO A;  3UJQ A;  3M1H A;  4A44 A;  2GU9 A;  3U14 A;  4LLO A;  4ORF A;  4QB1 A;  1VBB 1;  4RYD A;  3MZH A;  1CAW B;  1D0G A;  1ACC A;  1K12 A;  2H0V A;  2IXC A;  3TYJ A;  3VBF B;  2RVA A;  1QIQ A;  2P1B A;  3GGL A;  1GBG A;  3HBZ A;  1PMI A;  1W90 A;  3K77 A;  1N1Y A;  1C5H A;  1HB4 A;  2DUP A;  2ZTN A;  2GC2 A;  4IND A;  2E51 A;  1GP6 A;  3ACF A;  2P3I A;  5FYZ A;  4JKM A;  2CWM A;  3ETP A;  5JZG A;  3WDW A;  5C3P A;  1AYM 3;  3KV5 A;  5I0D A;  3EB7 A;  3N7L A;  1V0A A;  2YB7 A;  1S0C A;  2DVG A;  3B9I A;  3ES4 A;  2G9G A;  1HQN A;  2W1U A;  1EY2 A;  3QLQ A;  3ZDV A;  1W6P B;  2OQ7 A;  4RS5 B;  3R6S A;  4CDU B;  4QXH A;  3HEI A;  3D3A A;  1UY2 A;  4WM7 A;  5EHD A;  1TME 1;  3L2Y A;  1H4G A;  3ZYB A;  2RDS A;  1WW6 A;  2CV6 A;  2PEL A;  4HKW A;  1R09 2;  2VXJ A;  3NNL A;  1PNG A;  2D6O X;  4AI8 A;  1LU2 A;  4CCC A;  3WP5 A;  1GUI A;  3Q8B A;  4MHR A;  1JYN A;  2WFF 1;  1I5P A;  2V72 A;  2WIN B;  2XHK A;  4FPG A;  4XF3 A;  2O14 A;  1G8W A;  1YFY A;  1IPS A;  2R30 A;  1AYM 2;  1QJE A;  4TN7 A;  4YYO A;  1PVC 1;  1UNB A;  1Y9G A;  3U1X A;  2VQT A;  4AL9 A;  2OZJ A;  3I54 A;  4I3P A;  3VKM A;  5JOX A;  2BRT A;  4WVM B;  4Y26 A;  4XFI A;  4HSL A;  2A73 B;  2YFU A;  3ZXK A;  1OHF A;  3VDB A;  4OVE A;  4AZZ A;  1VB4 A;  3FHI B;  3J7N A;  1PX4 A;  2WLQ A;  2W08 A;  2WS9 3;  3F2Z A;  1B35 B;  2VTX J;  4QPW A;  2PAK A;  3WW4 A;  4CCL A;  5FLH A;  1UWW A;  4NRO A;  5E89 A;  1TEI A;  3RI8 A;  1Q3E A;  1I6X A;  1LOE A;  5C4W C;  5J48 A;  3OUI A;  3LAG A;  3GBF A;  2DDU A;  2DTY A;  3KCY A;  4XIL A;  1ZRD A;  2Q5T A;  4AF9 A;  1YXW A;  5FYU A;  4L0P A;  1EAH 1;  1D4M 1;  3QAC A;  5FYC A;  1YFX A;  4RFT 0;  3MF6 A;  4HVR A;  2I45 A;  2UWC A;  1LNS A;  1LED A;  5GZC A;  4Q0U A;  1O3T A;  3UET A;  4HK8 A;  1SDW A;  2Y6F A;  3FJS A;  3N9O A;  4MAD A;  4EN6 B;  3VDD C;  5LZ6 A;  1VAL A;  2IUW A;  2ARA A;  5FRA A;  4TTG A;  3AYA A;  2E32 A;  1PK6 A;  3KF5 A;  4CU6 A;  1NAE A;  2VTF A;  3BI3 A;  3S5A A;  1GOF A;  3S5Q A;  5FZ1 A;  3KGL A;  3VD5 A;  4WVW A;  3IDB B;  1NY7 2;  5FZ0 A;  2DVB A;  5A1L A;  1PO1 2;  4FVV A;  4LR4 A;  2JB4 A;  4GB3 3;  4EV0 A;  3III A;  2QVS B;  2BJS A;  2HYX A;  3OUJ A;  3V0B B;  3CEW A;  1RTV A;  1UIK A;  3KB5 A;  5I0T A;  2RM2 3;  3VDD B;  4ZU7 A;  3VDA A;  2R0F A;  4LKE A;  3UL2 A;  3IDA A;  5FZ7 A;  4AFC A;  3Q8A A;  3ZYG A;  3K4Z A;  4J25 A;  4QXC A;  1RXF A;  4NIA A;  5AC9 2;  1DP0 A;  1O6U A;  2MHF A;  1H8T A;  1PNF A;  2VQA A;  2ZGP A;  3D4K A;  5CYY A;  3ZN6 B;  1HX6 A;  4XUR A;  3GM8 A;  1VBA 3;  3CZU A;  2NPI A;  3ZXG A;  4LBO A;  3W5N A;  1L7R A;  4I3G A;  1NQJ A;  1UU6 A;  4FQ4 A;  4NIG A;  4XOG A;  4H14 A;  5I93 A;  2BUK A;  2IXH A;  3WHU A;  1POV 3;  2K0G A;  4XET A;  4ATE A;  3OF1 A;  4KG0 A;  4YNI A;  1ZRR A;  1CPN A;  3OPT A;  1HW5 A;  2Y6L A;  5T55 A;  2JE7 A;  3LQC A;  3VKF C;  3B01 A;  1HB1 A;  4F7Z A;  1VRB A;  4HKO A;  1W8F A;  4X8N A;  2GC0 A;  4N53 A;  2ETE A;  3ZFE A;  4KG8 A;  3UGH A;  5KWR A;  2DF7 A;  4AEJ A;  4CCM A;  4B7K A;  3E97 A;  3VZN A;  3WG3 A;  1S1A A;  1XYO A;  5JIA A;  3L9J T;  5FZH A;  1R08 3;  1MS3 A;  4LMF A;  1NCQ B;  1RUJ 2;  3WP3 A;  1WMX A;  5FK7 A;  1BMV 2;  3ME2 A;  2ZGU A;  5C4W A;  3DF0 A;  4Q4V 3;  3UGG A;  3CJI A;  1VAM A;  4HLT A;  2MEV 3;  4CXY A;  3D82 A;  3O1R A;  4Y33 A;  4H2A A;  2HWE 3;  1NA1 A;  1G9B A;  1AZD A;  1ULD A;  1TG7 A;  4JGY A;  1FNY A;  1GFF 2;  2A6Z A;  4LBK A;  3I3D A;  3WUC A;  3NKG A;  3ZPY A;  1CAU B;  5FQ0 A;  4R9A A;  4EJR A;  3M2M A;  5FOB B;  3WDY A;  3WOG A;  3RVH A;  3ZMN A;  1VBE 3;  1F4H A;  3UT0 A;  1QXP A;  5FYY A;  1LHN A;  3ZIW A;  4QQP A;  1RUJ 3;  2PXJ A;  3LSD A;  1SPP B;  1LTE A;  1UD1 A;  2Y64 A;  1H30 A;  1SFP A;  1H2L A;  3E5X A;  3A23 A;  1AR7 1;  1IS3 A;  3I2G A;  4XFF A;  3W58 A;  4Q26 A;  4XUO A;  2D6P A;  1OOP A;  5FP4 A;  5FZO A;  3BPS A;  2CDO A;  5IWF A;  4OI2 A;  4C91 A;  4ZZ8 A;  5FO8 B;  1SFN A;  2LAL A;  1X8E A;  2BTV C;  3CKH A;  1JOD A;  3IM0 A;  3VZK A;  1KEX A;  4NID A;  4D7S A;  5FY1 A;  5CFC B;  4Q29 A;  3ILF A;  1XNB A;  2BEO A;  1HB2 A;  4AFA A;  1RUG 3;  2I2S A;  2JKX A;  3NQH A;  4HK9 A;  1D4M 3;  2PN5 A;  3T0A A;  3PU3 A;  5JSR A;  1WD4 A;  2FDI A;  1BK1 A;  1S0E A;  5A1A A;  3T2P A;  4AQ2 A;  3RNS A;  1POQ A;  4FP2 A;  4AWD A;  2B39 A;  1Q8V A;  3GHN A;  4XJ9 A;  4NR1 A;  1RUI 3;  1RVF 1;  5IAV A;  2FQP A;  4K1Z A;  3I59 B;  5A7O A;  4BU2 A;  4WZF A;  4QDR A;  3SEP A;  1JZ4 A;  3DPR A;  3PDQ A;  5FPB A;  5FZ8 A;  5H9Q A;  3LZZ A;  4CRQ A;  5C3S A;  3LSE A;  1QKQ A;  4Q0S A;  1DLL A;  4K3U A;  4A7Y A;  3H3Z A;  3WQB A;  1LEC A;  3B02 A;  3QH6 A;  1RUN A;  2QQO A;  1QXJ A;  3C7E A;  1FYU A;  1NE4 A;  2DUQ A;  4FAH A;  2HWC 3;  3JBG 3;  3KT1 A;  1RUH 1;  2RDQ A;  4M3C A;  5FV3 A;  3PVO A;  2W94 A;  4QQH A;  2WA4 A;  4HVO A;  3WXP A;  1RUC 1;  1M06 G;  2OA2 A;  4E2G A;  3LGR A;  1VBD 3;  1YNA A;  3OBR A;  4COZ A;  4MYE A;  4OUE A;  1W6N B;  1FPN 3;  4ES9 A;  2P3J A;  3H8U A;  4BIF A;  1W2N A;  2QQL A;  4PIZ A;  1QOS A;  5GKA C;  3S57 A;  2VUA A;  4XJZ A;  5JWP A;  2LW8 A;  2DU1 A;  2LM3 A;  4R9D A;  4YRD A;  4AI2 A;  2JDN A;  1WLC A;  3VKN A;  3K75 B;  3M3E A;  3ZKU A;  1LOA A;  1J3R A;  1F2N A;  4BZ4 A;  5AVP A;  1RUF 3;  1B35 C;  3THP A;  1J84 A;  4MZU A;  5FPU A;  2VME A;  2PHR A;  4TWT A;  3LIG A;  5DAQ A;  2NMO A;  1S0J A;  4JDO A;  4BE3 A;  1TNR A;  2XH6 A;  2I74 A;  5D21 A;  4FTE A;  2XLG A;  2VM9 A;  2Y6H A;  5EJ3 A;  3I3B A;  2XL9 A;  1UX7 A;  1XYP A;  3OB8 A;  4OI0 A;  1ASJ 3;  4AAX A;  4BME A;  3VBH C;  2HWF 1;  4IGQ A;  3ZSL A;  1MS9 A;  2PHD A;  2A5Z A;  2PHW A;  3C7F A;  4AVT A;  2E63 A;  5FZK A;  4UW5 A;  1XBF A;  3KHC A;  3AP6 A;  3AP5 A;  1QOT A;  5T5P A;  1ULG A;  3MFC A;  4YVW B;  1NCQ A;  4P02 B;  3HQX A;  1PMH X;  2VBP A;  3O5S A;  5IHR A;  2R16 A;  1UO9 A;  5F3C A;  4ASK A;  1OPM A;  1RIN A;  4QAW A;  1CWP A;  4OI1 A;  1ENR A;  4PT6 A;  2AUY A;  2XVK A;  3DYP A;  5CFC C;  1JHN A;  4CEW B;  1US2 A;  3EXU A;  1V9U 2;  4BQ5 A;  4P5H A;  4QHB A;  1VLN A;  4RHV 2;  3LB9 A;  5E1R A;  4Q27 A;  4BQ4 A;  1O7F A;  4NHL A;  4D6R A;  1NXD 1;  5F7U A;  4CDQ C;  4Q4X 3;  3G7D A;  2WO1 A;  4LBN A;  3CJI B;  1VRH 1;  5CKN A;  3VLB B;  5B2G B;  5BY5 A;  3VZL A;  5L9R A;  4BH9 A;  4AHX A;  1FOD 2;  2W91 A;  1YJL A;  4AI1 A;  1SHW B;  5C9A A;  1MS1 A;  2P37 A;  5I8T A;  4YM1 A;  4PCR A;  1EV1 2;  3T2O A;  1JHJ A;  4QX8 A;  3MUZ 1;  1O91 A;  2ZGT A;  2RMU 2;  4YG3 A;  1VRH 2;  5FYV A;  3SEE A;  3VBO C;  5BYN A;  1O3Q A;  2FD8 A;  5FO7 B;  1X82 A;  3B94 A;  3ACL A;  2ENR A;  4CPB A;  1RMU 3;  1NX9 A;  5A33 B;  3QCW A;  1RUC 2;  4CDU A;  4CSW A;  3MLK A;  1RXG A;  4URA A;  5LAS A;  2ZML A;  1L7L A;  5FZO B;  4L2N A;  4Z2A A;  4XPV A;  2YMZ A;  2IWG B;  1GP5 A;  1SMV A;  2J1U A;  5EIY B;  1HRV 1;  3J7M A;  3AL6 A;  1W6Q A;  2ARB A;  3DPR B;  1UKG A;  3LF7 A;  3NV4 A;  3PUI A;  4XQW A;  3CQO A;  5GZD A;  5HI0 A;  1UX6 A;  1G7Y A;  2EA7 A;  3OGV A;  4LHL A;  3VL8 A;  4HN0 A;  3OSD A;  2HWD 1;  2V5D A;  3JQW A;  2WC2 A;  1T6B X;  1WW7 A;  1POV 0;  3O12 A;  3CNA A;  3HMY A;  1H2K A;  2XQR A;  3I3E A;  3PVB B;  2FDF A;  4L11 A;  4DIQ A;  1DGR A;  4WVM A;  4M00 A;  5DAB A;  2X09 A;  1R09 3;  2JDZ A;  4B3N A;  5JUV A;  2AGS A;  1QXR A;  1UMH A;  4DB5 A;  4B4R A;  5CVR A;  4AVS A;  5JZG C;  3IAQ A;  5ANQ A;  3FBM A;  5A6Z A;  1PZ8 A;  5HCF A;  1UL9 A;  2GC1 A;  5BXX A;  2B46 X;  2QDN A;  3RSJ A;  2BGC A;  2DUO A;  2IXJ A;  2KM2 A;  5F2S A;  2RR1 3;  4FCA A;  3ATG A;  4HMZ A;  3ZYI B;  4B29 A;  1CZT A;  3VUO A;  3K51 A;  1RUF 1;  3KVB A;  3POG A;  4IQP A;  3POJ A;  3B93 A;  2H6C A;  4CDX A;  1UPI A;  3TRS B;  1H1I A;  4FXG B;  4KU7 A;  2ZJC A;  1YC6 1;  3W59 A;  1RUD 1;  1VJ2 A;  4XCB A;  1W8N A;  1YEW A;  2Z2S B;  2WS9 2;  4BLI A;  1RUF 2;  4AHW A;  1Q43 A;  4QKB A;  3VD3 A;  1W04 A;  4RN5 A;  2G9F A;  1GR3 A;  1S2E A;  1BEV 1;  4XXP A;  2JDA A;  1COV 2;  1PGL 1;  4WM8 A;  1BHG A;  4JTN A;  2IFW A;  3U75 A;  1C8M 1;  1G9D A;  2JB8 A;  1DDL A;  1E5S A;  2HWC 1;  4ITC A;  4PLM A;  3ZYF A;  3ZIX A;  3V0A B;  3JD7 1;  1W0P A;  2XUM A;  1DZT A;  3BKZ A;  4IEX A;  4FSJ A;  3OGJ A;  2TEP A;  1N1T A;  1U0A A;  3ZN6 A;  1O5U A;  5FUI A;  2RJ2 A;  4YVW A;  1PGL 2;  4MV2 A;  2HEV F;  1GZ9 A;  2A71 A;  2BVB A;  2X5I B;  5DAW A;  5DAV A;  3U10 A;  3VBO A;  1HRI 1;  1ND2 A;  1GKB A;  2OW4 A;  4JGZ A;  4LUL A;  2UY8 A;  3TNQ A;  3VBU C;  4AVA A;  3ZYR A;  1BBT 2;  4XFA A;  1GOG A;  2Q1Z B;  2PQQ A;  5D8A C;  2C5D A;  4NPM A;  5SV8 A;  2C4X A;  4C1W A;  3H1W A;  1NCR C;  4O65 A;  3A0N A;  1CX1 A;  3QOP A;  3LIH A;  3VD4 A;  2EAL A;  5DXD A;  4DPN A;  4I2O A;  2QQP A;  4N7U A;  4NHX A;  1MQT C;  1NCR B;  4L8Q A;  3RYK A;  2VNV A;  2HBU A;  1BBT 1;  5CAZ A;  2W52 A;  3INA A;  4QQ2 A;  1EV1 3;  3IZO A;  1LKN A;  3I2I A;  3ZKY A;  3GAL A;  1HRV 2;  4XUQ A;  4P9J A;  4AVB A;  1QJX 2;  3ZSE A;  3POB A;  2VQ0 A;  2FDK A;  1Z0H A;  4YW5 A;  4KWJ A;  5C70 A;  5C9A C;  2FDH A;  3NV2 A;  3I7D A;  2GMP A;  2ZGR A;  1TME 3;  1JXN A;  1MS0 A;  4JZR A;  2HEW F;  3ZSM A;  3WHT A;  2JKB A;  2B4K A;  5LBE A;  4O61 A;  4CU8 A;  1HXS 1;  4NMI A;  1TVG A;  3WDT A;  1I1E A;  2HBT A;  4CUB A;  3ZR5 A;  1HRV 3;  5LY1 A;  2NQY A;  4IEY A;  2B9U A;  4DMI A;  5A7P A;  1ALY A;  2GMM A;  4I01 A;  1OF4 A;  4Y20 A;  4CCJ A;  1VMF A;  2XBO 3;  2VZ1 A;  2J1A A;  2BGO A;  2HWD 3;  3PJY A;  4IEV A;  5LBC A;  2WNU B;  3GYD A;  4ZZ5 A;  4YW4 A;  5K0U A;  1HIX A;  3RS6 A;  1GWM A;  5C8C B;  2VO5 A;  5FOJ B;  3T0B A;  1WD3 A;  3AMM A;  3FFZ A;  3E6B A;  1XNC A;  3AKR A;  5B4X A;  1HB3 A;  3N7J A;  4QPI A;  4CDU C;  4D6Q A;  4FOQ A;  3AKT A;  3WX5 A;  4XMA A;  2ZPX A;  4JC1 A;  1NG0 A;  3VN4 A;  1BCX A;  4RGK A;  1OA2 A;  1W06 A;  3OY8 A;  3I3M A;  2WNU C;  1A8M A;  2JDU A;  3A0K A;  3FZ3 A;  5K7P A;  2XML A;  3SXW A;  3PHM A;  2BVV A;  5A7Q A;  5A7S A;  2VD7 A;  4BQY A;  4LXL A;  1S0D A;  4HVQ A;  2W95 A;  3VZO A;  4EE2 A;  1HXS 3;  2WZE A;  2MPF A;  2G9Z A;  1KGY A;  2DFB A;  1JYW A;  1OUR A;  2NZ9 A;  1H1A A;  4PDW B;  4XFG A;  1QQP 2;  3PUH A;  3J8F 3;  3ZFG A;  1KIT A;  1BQP A;  4Q1R A;  3KV4 A;  2CHH A;  4LNV A;  4UFI A;  4EZH A;  2YZ4 A;  2DCT A;  2V5Y A;  1WA4 A;  4QX1 A;  1JMU B;  1OKO A;  4FFG A;  4WZC A;  2R0H A;  4XF1 A;  3VBU A;  3W9A A;  1N47 A;  4FPE A;  5LEK A;  1U5Z A;  4GD4 A;  1N1S A;  2ZKN A;  3QH7 A;  3RJR A;  4JTO A;  3EBR A;  5IVB A;  2BFU L;  2XR4 A;  3T08 A;  2AZ5 A;  3VBR B;  1LOG A;  1PM4 A;  5H9P A;  5KXC A;  4QXB A;  3C3V A;  1LGB A;  2J1V A;  4QHZ A;  2XQX A;  2WN2 A;  4RL7 A;  4ZON A;  4IEQ A;  4FP3 A;  1JH5 A;  4RS5 C;  1JUH A;  1RHI 3;  1UIJ A;  4PF5 A;  4YW1 A;  1OFN A;  1KJR A;  1W6N A;  1OXC A;  2FMD A;  3AXE A;  2CAV A;  3ZLI A;  4C0H A;  1SBE A;  1SCR A;  5L73 A;  4XC9 A;  4H7M A;  3DEM A;  4CDX B;  3JBG 2;  4DXZ A;  4DRV A;  2GN3 A;  2J1T A;  4PBO A;  3V56 A;  4COV A;  5ABJ C;  1HJG A;  2WNO A;  3V64 A;  1FAT A;  1FPN 2;  1YUD A;  1QJX 1;  2HLE A;  2ZEW A;  1RHI 2;  3BUC A;  2RR1 1;  4KL1 A;  1Q8S A;  4B1M A;  2EF6 A;  4OZO A;  4Z07 A;  1YQ8 A;  3MIG A;  2HEY F;  4OFG A;  4F3J A;  3HNM A;  1SFY A;  5HCA A;  2BBV A;  2Y26 A;  4IE6 A;  5EFU A;  2RV9 A;  2ZKL A;  1YFU A;  4QPG B;  4BDV B;  3SMH A;  4TLF A;  3C2U A;  1OF3 A;  4XFB A;  1JUI A;  1ND3 A;  3AX4 A;  3AZZ A;  4HT1 T;  5FMO S;  4PLO A;  1IKP A;  4XQ4 A;  4LIU A;  3ILN A;  5HV4 A;  1FNZ A;  3MDP A;  5CAD A;  3O1V A;  3KSC A;  1UOG A;  4QX0 A;  4W65 A;  4Q4W 1;  4ZXE A;  5DMY A;  1J3Q A;  1TME 2;  1AR6 1;  4HG6 B;  2QKD A;  2OKX A;  4A42 A;  4XHX A;  1FXZ A;  5IVF A;  4DEQ A;  1H6Y A;  4XAB A;  1DIW A;  1CIW A;  1ULO A;  3C7O A;  1SBF A;  4IET A;  5FP9 A;  4DNY A;  1KFX L;  1X9P A;  2EIE A;  1ASJ 2;  3BTA A;  3FBY A;  4ZY9 A;  4K21 A;  4AI3 A;  4BJ0 A;  2WBK A;  5D2A A;  1W6M A;  3CU7 A;  2QQM A;  4AYU A;  4CEW C;  5IK4 A;  4FTS A;  4DZG A;  2XBO 2;  1JZ7 A;  2A6Y A;  3I2F A;  3NNF A;  4N53 B;  1NT0 A;  3RMY A;  4Y1V A;  3ZFE B;  5A70 A;  1AR7 2;  1WUV A;  2UUR A;  1MZE A;  5HCH A;  4GAZ A;  4CDW A;  3USS A;  4NHY A;  5FY4 A;  1ASJ 1;  2JEN A;  5CBL A;  5CFD C;  4OQ8 A;  1W2U A;  2W46 A;  2PQS A;  1FAY A;  5F5A A;  1UY3 A;  2ZEY A;  3URF A;  5ACA 2;  3B9C A;  1AR8 2; 
#chains in the Genus database with same CATH homology
 2VUD A;  2BOI A;  2JDP A;  1OVP A;  2JDM A;  5A6Y A;  2JDU A;  2XR4 A;  4CE8 A;  5A6Q A;  1UZV A;  2VUC A;  1W8F A;  1GZT A;  2VNV A;  5D2A A;  1UQX A;  2JDK A;  5A70 A;  1OUR A;  1OXC A;  1W8H A;  5HCH A;  2WR9 A;  2BP6 A;  5A6X A;  2CHH A;  3DCQ A;  3ZDV A;  2BOJ A;  1OUS A;  5A6Z A;  2JDY A;  2BV4 A;  2JDH A;  5A3O A;  1OVS A;  4AOC A;  2JDN A;  2WRA A;  4UT5 A;  1OUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...