2BVBA

The c-terminal domain from micronemal protein 1 (mic1) from toxoplasma gondii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
137
structure length
137
Chain Sequence
KTEIHGDSTKATLEEGQQLTLTFISTKLDVAVGSCHSLVANFLDGFLKFQTGSNSAFDVVEVEEPAGPAVLTIGLGHKGRLAVVLDYTRLNAALGSAAYVVEDSGCSSSEEVSFQGVGSGATLVVTTLGESPTAVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEMAL PROTEIN 1
publication title A Novel Galectin-Like Domain from Toxoplasma Gondll Micronemal Protein 1 Assists the Folding, Assembly,and Transport of a Cell-Adhesion Complex.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Adhesion
total genus 15
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11476 TgMIC1 Toxoplasma gondii micronemal protein 1 TgMIC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.710 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bvbA00
2K2SA 2BVBA
chains in the Genus database with same CATH superfamily
4QHBA 3B9CA 1JS9A 2WNVC 3I7DA 2XLFA 1R082 5FZMA 2B45X 5FK7A 2JX9A 2D43A 2WR9A 3J8F3 4YGBA 1W03A 3TBDA 3USSA 4AF9A 2JE9A 2VZUA 5JIAA 3WHUA 4RR3C 2DU0A 2GU9A 2WZPP 2DVFA 5FPAA 3WVJA 1XBFA 1DGLA 1I6XA 1WLCA 2ZMNA 3WNKA 4AYUA 1GZWA 5EJZB 1DCSA 1CQ9A 1W6OA 3IIAA 5LK7B 4IV3B 4O65A 1OH3A 3HVDA 3WF2A 2BPA2 1YQ2A 2ARBA 3N9QA 4CZSA 4DNYA 4RL7A 5F3GA 4AAXA 1D4M2 4COUA 4I02A 3WT3A 4L9BA 3R4DB 1GNYA 3FE5A 2RJLA 5IHRA 1W2NA 3WDWA 5A1LA 5F5CA 1K3IA 4XFIA 4XXPA 1Y9MA 1BVVA 4AQTA 5FZ7A 4TTGA 4GWMA 3RMXA 4LULA 4BLIA 2B9UA 3AMPA 4BIOA 3WG1A 1GBGA 2BNOA 2H0VA 1UIJA 4E8CA 4QX3A 1O59A 2A6VA 1QJY1 1BK1A 5I91A 4CCNA 4UYBA 4XJAA 2WWJA 1HB3A 5IVEA 4MXWA 2ZAHA 3KQRA 4NROA 4B3NA 4ZXKA 1QJX2 2CAVA 5JMCA 5FY0A 4N43A 5FQ0A 4BK5A 3IB3A 3GHMA 1W6PB 3VBHB 3ILRA 5JI9A 1O3SA 1A3KA 5C33A 3D0SA 3VBUB 2VW1A 5FYCA 5LW9A 1CJDA 1NZCA 1UQXA 2A3WA 1YHFA 4Y33A 2MEV1 1UZWA 1S0GA 4UWDA 4A41A 2HYKA 2DWRA 2HBTA 3OCPA 1TMF2 2OW4A 4Q0QA 3VD7A 1JUIA 3WP6A 4ZZ8A 1AL23 5CG8A 3O1RA 1HJGA 3ZFGB 2JDYA 1EP0A 3MI8A 1FAYA 1EPWA 3OY8B 5FZ9A 1MVQA 4YG3A 3GBFA 1UPSA 4P9IA 3KF3A 4LNVA 3NNGA 2XG3A 4K40A 1SCRA 3AZZA 4S2DA 2ZGOA 4Y5SA 4P08A 4PT6A 5BNQA 2UWAA 4WBBA 5LBCA 1SDDB 4IEXA 2D44A 3S7IA 3WNNA 3ZLIA 1NA1C 2R1DA 1UOGA 3ES4A 4AW7A 4BH9A 3P1IA 4CA9A 1AL21 1W2AX 2JKBA 2D3RA 1WGPA 4F8AA 5LA2A 3MGUA 2WL1A 4META 1OQEA 4PBPA 1UY0A 4Q4X3 1K5JA 5K0UB 4DQAA 2VMIA 3O0XA 1A34A 2PHXA 5T3NA 5JR2A 2DU1A 3N4MA 2YBKA 3EQEA 2WAAA 1V6LA 5ERLA 1JYCA 1ZBE1 5F3CA 1WD4A 5FV3A 1HN1A 1E5SA 4A2UA 2XJTA 4KBZA 4ITCA 4CDUC 1VBA2 1GLHA 4S2HA 3VL8A 3HJRA 1KS5A 4UFKA 4IE6A 4AI1A 1Y4WA 5ACA2 2OKXA 3ACHA 2AZ5A 1OMIA 1WA6X 3RQ0A 4Q4X1 2BV4A 1IS4A 1LR5A 1UX6A 2QQJA 4DRRA 5JLVA 3KF5A 3ZVXA 3CNAA 1OURA 4TXWA 4XFBA 5FYVA 1IKQA 2TBVA 2FMDA 2R30A 4P9GA 3WW3A 2P17A 4KQ7A 2BFUS 1YCIA 2ZKLA 3VV1A 4DFSA 3BTZA 1CESA 1Q43A 1O8PA 2UWBA 3RDIA 4AEDC 5T5OA 1NE4A 1R1A2 2QFEA 3UJOA 4QQ2A 4PDWC 5EQUA 3DGTA 4O9GA 1H8TC 2RMU2 5T50A 1O5UA 4QX7A 4QGNA 2EF6A 2GP5A 1S0EA 5EXOA 2QZ2A 3FMGA 3K2OA 2DBIA 3M7AA 4MLOA 3WY6A 3H50A 3AXEA 2QUOA 1G9CA 1FOD2 1E5HA 2OQ6A 5FZEA 1BEV1 3L2HA 5DPNA 4A3XA 5JAXA 1O7FA 3VBSB 4RQPC 3JBG2 4FQZA 2K9ZA 2XBO2 2B42B 3DPRC 5J1XA 4V2WA 3M2MA 4KWLA 4C0BA 5C70A 4QPGC 2QVSB 2BGPA 2E63A 3ALQA 2D7FA 1VLNA 1F35A 5IYYA 5JPMB 2D3PA 3SKJE 3B69A 1JYNA 4XW3A 2P2KA 1B35B 1ALYA 3NNLA 3Q8BA 2WQZC 4W6XA 5IWFA 3CDZB 2X5IA 1ZX5A 4FOWA 2X8KA 5IAVA 2WFF3 4Y20B 1X33A 5HCFA 1OLRA 5LASA 2KM2A 4L8QA 4A4AA 2BFUL 4CTEA 4HXCA 4NPLA 4Z82A 2F6BA 1NA1B 3HOBA 2ZXQA 1Y9QA 2IFWA 4MH0E 1VBE2 4HT1T 1U5ZA 5IUQA 2YU1A 5FCCA 4LO4B 1ZA7A 4AHYA 2Q8EA 4AVSA 2A6WA 1OFSA 1SACA 4RGGA 5FZDA 2WUHA 3IWZA 4M00A 3WDYA 4JDMA 3UK9A 1DU3D 3N7MA 4LHSA 3RYPA 2JB8A 4D94A 5L7OA 5L19A 4JCKA 2WFF1 4B1LA 4P9XA 2CGOA 3ZXAC 4MHUA 1F31A 2HWE2 4ZY9A 3QH6A 1LB2A 2CGPA 1S0CA 1POQA 3A7QA 3K75B 2Y6HA 4XIOA 3AYCA 1CJPA 1KFUL 2WZR2 4CDUB 1J1TA 4BJ0A 2Y33A 4ZS3A 3UGHA 5C3OA 2XVLA 1A8MA 4CCCA 1BMV1 1EV13 3OBRA 3LFIA 4A7ZA 3N9PA 5JVVA 1VBD2 1J3PA 4LEJA 4YVWC 4XQDA 3CEWA 3ZSEA 3F2ZA 3MW2A 4EWDA 1KRIA 1UY4A 1J3RA 1U5IA 3B7MA 4QPIC 4QT6A 2LALA 4IGPA 1H0BA 3SKVA 2Y6KA 2I07B 3DN7A 1RVF2 4NHYA 1ENXA 5I0SA 1V6NA 4ONUA 3DKWA 1NQDA 1TG7A 4EN9B 3OUIA 4L92A 4AEDB 4A42A 4K3UA 1G8WA 4LBLA 1EV11 4FPJA 3PJYA 3KV9A 4CSWA 5ANNA 5T5LA 5C8CC 4I3GA 5FFOC 4LUMA 2BP6A 1SBDA 1IPKA 5CKQA 3ZYFA 3BGAA 1QKQA 2CL2A 1YYNA 3I2FA 1BQPA 4Y1VA 1X36A 3OBAA 3RG0A 3ZFFC 1C1FA 1SHWB 2HKXA 1WZXA 2JDPA 3CJIB 4F7ZA 3BTYA 4YG6A 2DTYA 4UW4A 4V2VA 4XHXA 3FWEA 5CFDC 4QX1A 2BGOA 3VDDA 5C4WC 1PMIA 3DPRB 5CNAA 1J59A 2XXZA 4LHNA 2BWCA 1GKBA 3ATGA 4QPGB 1U12A 2VUJA 1SQ4A 3OTFA 1GANA 4BXSV 5C3PA 4CDXA 1F15A 3HMYA 2Y8KA 4AVBA 3AMNA 1TME3 4CEYC 5A32B 2YBPA 1UYPA 1S0IA 1XU1A 3AP6A 4N7UA 3JD73 4D6SA 4YW5A 4JGZC 1VBC3 1VMFA 2QBXA 2DVGA 3KLSA 4P9JA 3OGGA 4QKNA 2A75A 3MLLA 4HKLA 4XZPA 4BPZA 1PK6C 5C5TA 2P6CA 4QB6A 2W9XA 2ZKNA 1G9AA 4MV2A 1R093 2JDZA 4D6QA 3URFA 5FZHA 4KWJA 4QXKA 1FPN1 1LESA 1Q8SA 2GNDA 2XL7A 1MS1A 1NX9A 2H6BA 1HRI3 1WW7A 4N9IA 1TME1 4FPYA 3OYWB 2DTWA 1LHVA 4IV3A 2IUWA 4AI3A 4XBQA 1HLCA 2VBBA 3JD71 4IEYA 4YG0A 3WHTA 4ZU7A 1VBC1 2WT1A 2UY9A 5I0TA 1NOVA 1RYYA 3O7OA 5DABA 1REDA 5M0TA 4FPOB 5FK8A 5LBFA 5FPVA 4JGYC 2I74A 2YGLA 5DG2A 4QQOA 2WNUC 1R091 2B39A 3LDRA 4OYUA 4A44A 3CHXA 1RUE3 2OVUA 2Y26A 1O5LA 4LHKA 1SLCA 1DG6A 1ZZ8A 4JKMA 3PURA 4OULA 2VVEA 1HRI1 2VC9A 1V00A 2P4EA 4JTOA 1YI7A 3T2QA 1LKNA 2VMEA 2LTNA 4WZFA 3VBOC 5JSOA 2HWB3 1QHDA 4GULA 2HWC3 1H9WA 4FPFA 3T4VA 1G9FA 2AACA 5EZWA 4H14A 4KH9A 4MADA 3ACGA 3CBNA 4QU1A 4L97A 1UX7A 4B4QA 1W6PA 4LE3A 3VBHA 1GFF2 3BB6A 1PX3A 1YNAA 2BQPA 3HNYM 1MQTB 3VBUA 2PHLA 3KCYA 1RUE1 5FYYA 1JYTA 1QJY2 4YZ4A 5F6KA 1C8M3 2AC1A 2FZ1A 2JKXA 4XACA 3SHRA 1YJKA 4AR2A 3O0VA 4MGQA 4BQ3A 4NAOA 1MR5A 2PQQA 4Z07A 5FDBA 2PELA 5FY9A 1XPWA 4URTA 3T2TA 2HWB1 2RM21 2HWC1 3ZFGA 2W91A 5C8CB 5F39A 1RUOA 4DRVA 3HBKA 2A6ZA 3OY8A 4XAEA 4NAMA 3WNPA 2YPJA 4CCMA 4CCLA 3HBZA 3ZFFB 2IXHA 3BIWE 1AUYA 2JEMA 2MEV2 4MX3A 2Q5TA 2NMOA 5CFDB 3HNMA 2UWCA 3FC0A 1LHNA 1C8M1 1VRBA 2YXSA 1CWPA 3OUJA 3U14A 2VQTA 1PO13 3AK0A 4ZXEA 2ARXA 2YU2A 3RJRA 4CEYB 4YW2A 2WWSA 4LBMA 1W04A 1KITA 1LHUA 1OUXA 5BNPC 5K0UA 3VZMA 2GH8A 3WG4A 5I0UA 3POYA 1RXGA 2RDQA 2BEOA 1SLAA 1OQ1A 3LWCA 4AWDA 2GC2A 5FR3A 5IVYA 1AL22 2VH9A 4MGYE 4QM8A 2R043 4M01A 5GKAC 1ZBA1 4LKEA 4XF3A 1PO11 4L0PA 2CTVA 2DURA 1GQHA 1BKZA 5EYYA 3LEMA 5FZKA 3E5UA 3MIBA 1OPMA 5IK8A 2WDBA 4YW6A 1O3QA 1KEXA 2WQ4A 4JAAA 1N1SA 2VMHA 2MNGA 2XVKA 4A7YA 1GYKA 1ZBE2 4E2SA 1DZRA 2ZAAA 5KXBA 2XUMA 4WVMB 1A8DA 1F4HA 3GZTB 3WF1A 3SC7X 5BNNC 2BGCA 2OZJA 5GZFA 2WNUB 5FUNA 3AC0A 3POFA 1US2A 2R041 3IMMA 1L7LA 3PLQA 4XBLA 3PVOA 2X53S 4Q4X2 4AQ2A 4U36A 4JKLA 1UAIA 4Q26A 1F5FA 4GAZA 2D6NA 4LKFA 5FYSA 3WCSA 1TZOA 2EA7A 3RSJA 5GZCA 5HCAA 1S2KA 4BXFA 4MYEA 4YZ1A 1DQ0A 1IS5A 2KD7A 2WA3A 5L73A 4BQYA 1C5IA 1VMHA 3ZYJB 5BXXA 1C57A 2A3YA 3SMHA 3VBSA 4FFGA 3I97A 1W90A 1ZNPA 1LU1A 4RHV2 4LA3A 4C8DA 1QJZA 4OMDA 1YFYA 2JG8C 1POV3 3PUQA 3AZYA 3U37A 3UGFA 5DZFA 3H1WA 4C90A 1H2MA 3ORJA 5D8AC 1BEV2 3AP9A 2IXCA 1B35A 1W2UA 4E4ZA 4IESA 4XFGA 4I0AA 1QOTA 1O3RA 3AJZA 4Y20A 3ZN5A 3TB0A 5FBJA 2C4XA 4LUKA 2VZTA 1WKYA 1FNYA 2XJVA 3VZJA 3T30A 4AFMA 3VD4A 4S2FA 2TEPA 2ZJCA 1QXJA 4N53B 3W9AA 2V5YA 2BNNA 2VVFA 4FPGA 4XXAA 1POV1 2VXRA 3JCIA 1XNDA 4P00B 4BU2A 2Z42A 3IAQA 1VE0A 4NO4A 5KHKA 5LEJA 1BXHA 4PQ9A 1NT0A 1ST8A 3NMBA 2R0HA 1JI6A 1GUIA 1WLTA 1PZ8A 3VBFB 4XUOA 4BQWA 4XJUA 4LTAA 3ACFA 1DYOA 1W6QB 3B02A 3PU8A 4JZRA 4Y3OA 5GLZA 3WP4A 1V6MA 1FI2A 1IG3A 2KR2A 2YHJA 3AJYA 3LA7A 1YIPA 2SLIA 3SCGA 3ZN6B 5HV0A 5J96B 3NRUA 2XL9A 5FREA 4CDUA 1S1AA 3IDEA 4H55A 3SH4A 1YUDA 1QGLA 1OT5A 4LO7A 3GYDA 1Y43B 2OZ6A 3MLJA 2WFF2 3OEAA 1OLQA 1O4YA 4LBQD 3FLPA 4CUAA 3E6CC 4D7TA 3VD9A 4F3JA 4LOTA 3RZHA 3WDVA 5C71A 1I3HA 5FLIA 3LEGA 1RL3A 1UXXX 3ZX7A 4KG8A 3QCWA 5BNNB 5AVPA 3RFRA 2RDSA 1CX4A 1APNA 2BYVE 1GU3A 3H3UA 4ARYA 3DXUA 3VGIA 1SFNA 1BMV2 1SZBA 3H9AA 3SCFA 5IFTA 4JKKA 2QQMA 1YLLA 3NJVA 3KVBA 2XHKA 3LFMA 4UOJA 4JRLA 3Q8AA 5A6YA 4FFHA 3BU7A 3GF6A 2YC2A 5FZGA 2ZX1A 3KT4A 2C9AA 3APBA 3MIHA 2OYZA 3TNQA 1IS3A 3OB8A 4HZFA 4HPKB 2NN8A 3CJIA 3ZSJA 3NAPB 3NWKA 3T09A 1GNHA 2NQYA 3AYAA 1EV12 3VHNA 3JQXA 2VZVA 2WWUA 5FKBA 1PZ9A 4XUPA 4XURA 5IATA 3WEZA 2VW0A 5CB7A 1PM7A 1QOSA 4XJ9A 3I3DA 4NOTA 1YFWA 5I8TA 5FY4A 1UZZA 5D8AB 5FY7A 4CYDA 1JZ8A 3LIGA 5A32A 1GZCA 1F5JA 4E27A 4JX0A 5E1RA 3LSEA 4K6BA 2XWBB 1Z7S3 3I2JA 4Z2AA 2W1QA 3N7LA 1RHI1 1F2NA 3OPTA 1QIQA 2JE8A 1IQDC 1J3QA 5FP7A 5GZGA 1DQ6A 3HPNA 3M3EA 1YQ8A 4CUCA 4I30A 4FPLA 4EN8B 1HV0A 5I0RA 2A6YA 5EWSA 2V5DA 3CO2A 3MIFA 1OC1A 1NLSA 5FZ3A 5EV7A 5BNOC 1NE6A 4CU9A 1UMHA 1V6JA 5FJHA 5A7SA 5FYBA 1WCQA 1GR3A 3OYWA 4LLFA 3SITA 1ZZBA 2HWD3 1QJFA 2Q4SA 4DY3A 3MIEA 1Z7S1 4QKDA 3ZYGA 1ND3C 2ZZJA 4W6WA 2JD4A 2AEZA 2DFBA 4COVA 4TYSA 3CF6E 1SLTA 3ASIA 2O8OA 1FPN2 4U2AA 1NAEA 1GWMA 1D2QA 5FRAA 4M3CF 2BERA 3GNEA 1TME2 5EJ1B 1EAH3 1X82A 2VD7A 3RZZA 2AENA 2RVAA 5BUVA 3JD72 2VW2A 3CZUA 1ODMA 4CP9B 1ZZCA 4SBVA 4QGMA 1VBC2 3W5MA 2HWD1 1UZYA 5F8PA 3C7EA 4NR1A 5C9AC 3ZIXA 4IXLA 4TLFA 1VB2A 1AYN3 2VOXA 3B5LB 1R092 1CAXB 3T3YA 5IVVA 3ZYPA 1ULPA 4XPVA 5K4LA 5A7PA 4BIFA 1KS4A 4E2GA 1HRI2 1MQTA 4LHLA 3KSCA 4XQWA 5C8WA 3NJXA 1EAH1 3UYJA 4JVAA 5DQ0A 2Y38A 3PDQA 1MPXA 1X9TA 3VKMA 1NY71 2JE7A 4YLZA 1GQPA 2HWF3 1ND2C 3PIGA 1AYN1 3HQRA 4O9EA 2VUDA 2ZOEB 2VMGA 1RUE2 1VIWB 3ACLA 4G3YC 5F1RA 3H1MA 5EHDA 2OUHA 3B93A 1RUF3 1UZVA 1ULDA 2YY1A 4E4HA 3PJQA 4DXSA 4AGVA 5A3TA 2HWB2 5ABJB 1V6OA 2RM22 2HWC2 2SBAA 4WV8A 3DYMA 3SISA 3INAA 4CEWC 1UIKA 5GALA 1HW5A 2IVIB 4CEYA 1K5MA 3IBMA 2HWF1 3MFCA 3FJSA 3I59B 1XNBA 1CAVB 2BVVA 1C8M2 4XJWA 5A3OA 5CAZA 1F9KA 1RUF1 4TSVA 4EN0A 1LGBA 1NYWA 2ZGQA 5L9VA 4DEVA 1K45A 3VDBA 5FXVA 2ETEA 5HCBA 1R64A 3RWNA 1Y9GA 4RS5C 2J1UA 2BNMA 3W5NA 1JZ2A 4QX2A 4XF4A 2NMNA 3RWKX 1QJY3 1SEFA 4F83A 4DO0A 4IV1C 1S0DA 2OA2A 4NRPA 3UKNA 3RZGA 2WN3A 5FO7B 4A3ZA 1FYUA 1N3OA 1ND3B 1V6KA 4I0WB 3O1PA 4WVMA 4A6OA 4Q0VA 4B8EA 5KXEA 5K7PA 2VR4A 1GICA 2VM9A 2WYSA 1J1LA 1ZBA2 4RN5A 3AP5A 1PO12 5JOWA 3FUQA 2PHRA 4W8JA 2MEV3 2XLGA 2BZDA 2JG9B 3M3QA 1AR63 1WUVA 5HXMA 1W3XA 3S7EA 2QQKA 4YZ3A 5FO9B 2G19A 1AX0A 1T6BX 4M0HA 1IGOA 4AI9A 3A4UA 3K4DA 1XNTA 4XQ4A 3OG2A 2E7TA 5FZ6A 5C9AB 3BUCA 3UT0A 2ADEA 2VNGA 2WS93 1SFPA 3MEPA 2FDJA 2R042 1OUSA 2HLEA 1Z0HA 2VECA 3MIDA 3QBQA 1NCQC 1LNSA 2RHPA 4K21A 4DUWA 3ES1A 2ORZA 1AR61 4XC9A 5FXXA 4LIUA 2Y60A 4HK9A 4KL1A 2Y0OA 5CKNA 4BDVB 3MICA 3U78A 4CXYA 4PQQA 1S2EA 2RS13 3ZSKA 4HONA 1ND2B 1TNRA 3QLQA 4HOOA 5GJ6A 2RJKA 4FI9A 3SEPA 5J36A 2WS91 5E16A 4N9HA 4CDWB 1GZTA 1D2SA 3VN4A 2J1SA 1XE8A 2A7AA 2XLAA 3POGA 5CBLA 5J48A 1ZBE3 3NV2A 1ZYBA 2P5BA 5JZGA 3MYXA 4X8PA 2B46X 2KA3A 4N53A 1H1IA 2ID4A 4CCJA 3PUSA 2BVBA 2VBDA 3J7MA 4XF0A 3RYKA 1W9YA 3ZYHA 5CU1A 4CEWB 1YI9A 4N8MA 1YQ5A 4DOUA 2RS11 1RUI3 2PQSA 2WNVB 4AGRA 3AMMA 2G4IA 4X8NA 1QNYA 2WC2A 2XJQA 4FTBA 4KI5M 3VBFA 1RGSA 2WAOA 2EVXA 1W6QA 4NE9A 4UFLA 4ASKA 4LQRA 4RR3B 4XJ8A 1W9SA 2E7QA 2ZGLA 5H9RA 3AZVA 3DECA 2ZABA 3J9SA 4G9SB 4OLLA 4RHV3 4BMBA 4OI2A 1RUI1 4LBQB 4NN0A 4CDQC 1O6UA 2WO3A 3AMQA 3AP7A 1AYM3 5BY5A 4OHZA 4AQ6A 3PL0A 2O1QA 2ORXA 2QQIA 3BPSA 1H1MA 4Y4RA 4YVSA 4DEQA 4R4XA 1BEV3 3FX3A 1ONAA 1ULEA 2BW8A 4YM2A 5LK5A 2K0GA 4CU7A 4DZGA 3A21A 3KD4A 3WLUA 1R1ZA 2DUPA 5FPXA 1YXWA 2I2SA 3R4UA 3RZKA 3O5SA 2X10A 4RHV1 1MZ5A 2J1VA 4OHVA 1ACCA 1NCRC 1DIWA 1U0AA 1AYM1 1F4AA 1CAUA 1OOPC 4R9AA 5JIUA 2JDKA 1QU0A 4W6YA 4IGQA 2OUJA 4X6QB 5CFCA 1HRV3 1HQWA 1GOFA 2ZEXA 3IM0A 2VZQA 3NAPA 2BRTA 2ZA9A 3MHZA 2JDAA 3B01A 2ZS6B 4IE0A 5IK4A 3I3MA 1MZFA 3HQXA 4WM8A 1DLLA 4AXOA 3WW1A 1AR83 4MO3M 4CXWA 1PVC3 1E57A 2YG0A 3MBWA 5CISA 3H1YA 3QD6A 2NLRA 1C5HA 1F8VA 3IMNA 3WDXA 4OCTA 4CRQA 4DINB 5HCHA 5FZOB 5A70A 4AI2A 1HRV1 4HLTA 4RFRB 2DVAA 5FOBB 5HBAA 1V9U3 4M4RA 4Z8BA 4IQPA 3JUUA 4LLOA 3ZYIB 2ZPXA 4ATEA 5GLVA 3BALA 4LT5A 3VKOA 1AR81 2BWAA 4XTPA 1PVC1 4XTMA 1W8UA 3GJAA 3KHBA 3OOXA 4FOVA 3PUHA 2CV6A 1TQ5A 2B9VA 3Q8CA 2CU5A 4YWAA 4PIYA 4Q2FA 5AVAA 1UOJA 1RHI2 1GSLA 2A73B 3PU3A 1EY2A 2VL4A 1X8MA 3U11A 4NIHA 1V9U1 1VAKA 3HEIA 1T2XA 4A45A 1JYIA 3AYDA 1JOPA 3E6BA 2IC1A 2VZRA 4H7MA 2UYAA 4AFDA 1M4WA 4JHZA 3TWIA 2AUYA 3HR9A 4JRAA 3LSDA 2BUKA 3WR0A 4LO5B 2W46A 2EICA 4QX0A 1XJAA 3W58A 2AH2A 2G9ZA 2VMCA 4Y1UA 1W9WA 1Z7S2 3IAPA 4GH4C 4CUGA 3NJZA 5AFEA 2V4AA 4CP9A 3TEZA 2R1BA 5SV8A 3FBMA 5A7WB 2ES3A 1MEC3 4CDQB 2AYHA 1YQ6A 3AZXA 3EXUA 3CU7A 5DZGA 2PAMA 2QDNA 3T4HB 4CE8A 1KFXL 2ZGKA 1W06A 1YWKA 1Q5OA 4XBNA 3POEA 4IEWA 4HVQA 2KXLA 4AVCA 1DDLA 1ULOA 5T55A 1YIFA 2A6XA 1DFQA 1DYKA 3RI9A 3H8OA 1VPHA 1X9PA 2OPKA 1UU6A 4Y4YA 3WNMA 2YFZA 2HWD2 3JB8A 4PDWB 4AFCA 3WF4A 4DB5A 5FLJA 1H8TB 3HD8B 3ZMOA 4LITA 1UD1A 2RS53 2W95A 3PMEA 3SH5A 2LUWA 1NCRB 1MEC1 1SLIA 4H7LA 1OOPB 2YC0A 3TN93 4XYXA 3RYRA 4BQ5A 2WT2A 3E1F1 1NQJA 1GOHA 4YARA 4RQPB 3NL1A 4DIQA 5FPUA 1GQGA 3MFAA 4OZOA 1EAH2 3VD5A 1Q56A 2WKKA 1OQDA 4H3WA 4GMP0 4J1WA 3P3PA 5FP9A 3VZOA 1CAWB 4LOSA 4Z2WA 1G9BA 3ZR5A 5CA6A 1PMHX 1FPN3 1UW8A 2R49A 4QKBA 2VZ1A 1UOBA 4WM7C 1NY72 5ABJA 2RS51 1OSGA 1QH6A 3Q8EA 1AVBA 1SFYA 3MLKA 5JSPA 3I49A 1AYN2 4EN7B 1XRUA 2NZ9A 3OGJA 3T2PA 1SPPB 4Y1YA 1MS5A 3TN91 3V56A 3VBRC 4JV4A 4AVVA 4FOYA 2VZSA 3AFGA 3BTAA 1N1TA 1I5PA 3I59A 3PVBB 3RZJA 2R0FA 3DXTA 2PAEA 3ZN4A 4NHLA 4C1XA 4BZ4A 4UFIA 2RJ2A 1OVSA 1LOFA 3GCXA 4NJ4A 1IPSA 4XAAA 3ZXGA 2HWF2 4HMZA 1UF2C 3FHQA 2VTXA 2W08A 4D8MA 1JYXA 1C3HA 1LRHA 2FDHA 1K12A 5JCTA 3HT1A 3LEKA 3V0BB 3PMSA 4E8DA 4DXZA 2C9KA 2E51A 1PNFA 1FXZA 1RUF2 2IWGB 2LROA 2WNOA 4D7SA 1ND3A 1VALA 3SEEA 5AC93 5H9SA 1MS0A 3MW4A 4AI8A 3D3AA 1JOJA 3POSA 1K42A 4XHBA 3ZXLA 5LCWL 2J1RA 4OMCA 3K4ZA 5F2WA 3WW4A 5CADA 1Q8QA 5G05L 2JG9A 1UU4A 4ORFA 4D6RA 4COWA 1DYPA 4YVWB 5HV4A 2RM23 1UO9A 2O0OA 3KZ4C 1RUNA 2PTMA 3HT2A 3A0KA 1W8HA 3I4IA 3ZXEA 5AC91 4QPIB 3OBTA 2B4KA 3MPBA 4HN1A 3KQ4B 1W6MB 4HN0A 4CUBA 1OD3A 2ET7A 5FTTC 1O91A 4IL7A 4K8RB 4QMAA 3TAYA 4DUXA 5KR7A 3H3ZA 1PM4A 1JHJA 4QPWA 5AFBA 2YFUA 4WZCA 3WINE 2D6OX 2XKPA 5D21A 1JU4A 3HAGA 1G7YA 1WA4A 4LMFA 1ZZ7A 2W1WA 3B94A 3PUIA 2CDOA 3AYEA 4MUVA 4OUMA 4TN7A 5TSWA 2E53A 1P8JA 2ILMA 3KMHA 2QDRA 3DL3A 2J1TA 4HVRA 2WT0A 2EXJA 1RUJ3 2R063 2Q8OA 4NIIA 3SXWA 1ND2A 4MGZE 1Q8VA 2D6KA 4HETA 4JDNA 2ZGNA 3ZXJA 3I3QA 3CJXA 4CDWA 5BV6A 2IXLA 4LXLA 2WNEA 5JR7B 5C4WB 1AR62 3BOWA 4L99A 4XDOA 5JOYA 1CX1A 4UFMA 3N9MA 2WYFA 3PVNA 4R8HA 1XYPA 3CIHA 5D2AA 2XVGA 2JB4A 3WDUA 1EPZA 1ZBA3 4HBNA 4CU8A 3KCCA 4XFFA 4MGTA 5ANQA 1SLLA 4S2GA 5LBBA 2ZHKA 4FTSA 2WS92 2Q1FA 2Y6JA 4X6RB 1RUJ1 2R061 1ZZ9A 5FYUA 2WNVA 5LA1A 4UI9L 4JGZB 2JIGA 1RUH3 2VG9A 1PK6B 5IVBA 4QKFA 3ST7A 3ELNA 1W2OA 2VZOA 1GP5A 2VJXA 3NQHA 4RR3A 5FP8A 4PJYA 5IT6A 3LZZA 5H9PA 4GKYA 2VQ0A 2P1BA 5IAXA 2Z79A 2RS12 4W65A 5HPOA 1VBB3 4QD2A 2E26A 5HXVA 1VB4A 4Q8KA 3CL1A 1DLCA 1PNGA 1CN1A 2K46A 4LBQA 2BJSA 3WXPA 3N9NA 2ZTNA 4BISA 2WZ8A 3GALA 3NNFA 1RUH1 2DVDA 2ADDA 2QZ3A 4SLIA 1HJFA 2EAAA 3WUCA 2JDHA 1V70A 4JGYB 3RZMA 1NG0A 4IE7A 2WIIB 1WLWA 3U0ZA 1CR7A 5IJRA 2RV9A 2XHNA 4HKWA 4UW5A 3KVAA 1OA4A 1RUI2 1VBB1 3KGLA 1Z78A 5JOZA 2Y6FA 3OPZA 3IZOA 3VBOB 5GLTA 3BIEA 1N1VA 2WN2A 1LODA 1PZ7A 2D93A 4LBJA 4KWUA 3ZFEC 1ENRA 3LKJA 1S4CA 2BU9A 1CONA 1HB4A 4ZU5A 5JXIA 3BOPA 3OPWA 3A22A 4DUVA 4XZUG 1W9TA 3PNAA 3C7OA 3BODA 5CG9A 2IVJA 1UY3A 2ZX3A 2D97A 1WCDJ 4Y5Z0 5DZEA 1XOYA 1PX4A 4Y5TA 2H6CA 1AYM2 4D0QA 4YW3A 4FSJA 1HB2A 1GV9A 2QQPA 1XSRA 4JTNA 3SCHA 2JD9A 2J7MA 4Q29A 1GWKA 1UMIA 4K1YA 4OQ9A 5A6XA 1UYXA 5GZEA 1QDCA 1H2LA 2J22A 5FZOA 1DZTA 3GHNA 3N36A 5FYIA 5J09A 5IFPA 4INDA 2VQUA 4LE4A 2FD8A 4HANA 4N7IA 4YRDA 3EYPA 1AR73 2GC3A 4B29A 2FDIA 1URXA 4QDSA 5GLWA 3WQBA 3RGBA 1QJU3 3O1VA 1NA1A 3OGSA 1ZRDA 2QJVA 3JXSA 5DAWA 2JICA 1L3JA 1WMDA 2PMWB 3D82A 2WINB 2CYFA 3HQUA 2UURA 2J1EA 5JOXA 4RYDA 3GZEA 3PHMA 5LEKA 4B7EA 3EB7A 4HK8A 3N9LA 4JQTA 3IN9A 1HRV2 2X5IC 3NKGA 4AE2A 2GN3A 2HEWF 1C4RA 5DAXA 4CCDA 5BNPB 5K8SA 5FAXA 3K3OA 2ZGSA 3H3LA 1DBNA 5BPXA 3AKTA 2E33A 2ZHLA 2HYXA 5A33B 1AR71 4AGGA 2GC1A 3ON7A 1H2NA 3UGGA 1AR82 1QJU1 1OLME 1PVC2 1NUKA 2IXIA 2YPDA 4M4PA 4AOCA 5JSRA 2CSGA 1CPNA 2BTVC 4GA9A 5CKMA 5KC6A 4GWNA 1ULCA 4K20A 4I01A 4Q27A 1LENA 3S57A 3KT1A 4EV0A 5C3QA 4RGKA 5JI7A 3S30A 2P3YA 5L7OC 1W8FA 1CZSA 1V9U2 2EALA 4J1XA 5K9YA 3K51A 2A71A 2ZX0A 2BBVA 3B3QE 4ET7A 1ASJ3 3EHKA 5FYHA 1HIXA 3OD0A 2BOIA 4IE4A 4LPLA 4D7YA 1LEMA 2Q1ZB 4EWEA 2XJUA 2GP3A 2E7AA 2VCCA 3HN3A 4O7XA 1JYWA 4BB3A 3PVEA 1QJEA 1RINA 4L11A 5FPBA 4CPBD 4AEDA 1CPMA 5DN2A 4Q4V3 3W21A 4E9KA 2D6PA 4PDWA 2X05A 1H8TA 4OI0A 5FXWA 3ZFEB 1OOPA 3WF0A 3ZMNA 2GNTA 2VPVA 1PGSA 3NV3A 1ASJ1 4GQ7A 3C7HA 2Q30A 3OGRA 5LRRA 1AX2A 5JUVA 3PTRB 1RHI3 5F32A 3THDA 1DQ5A 4Y22B 4MHRA 4RQPA 1H9PA 3VHPA 2H0BA 5I8YA 4AEKA 1PGW1 2JIJA 4QDRA 4UXAA 4XFHA 4Y24A 4V1PA 1WLDA 3DPRA 1FMD3 4Q4V1 1CAWA 1LOCA 4HL0A 4QPGA 3ROUA 1MEC2 2QQUA 4FP2A 2JG8B 1UL9A 3AL5A 4XCBA 5LATA 5I0DA 3SLIA 2D5FA 1RMU3 1YFUA 4LBOA 4LK7A 3I2IA 4UFJA 3ZDVA 1ZREA 5DAQA 1M06G 3LOBA 4QAWA 1SMVA 1SPPA 1XYOA 2D40A 4I2OA 1H1AA 3GDBA 5FZ8A 4O61A 2ATFA 2FCVA 3AX4A 3I2DA 4K1ZA 4ZU4A 1DHKB 2WBKA 1LOBA 2JECA 3VDDC 4XILA 1AJOA 4AFAA 1FMD1 4CXXA 2RS52 4AHWA 1YQCA 5ISLA 1T6GC 2W2IA 4Q0PA 4FXGB 1ULGA 5EP9A 2K2SA 4CDXC 3AL6A 3TN92 1RMU1 2AR6A 1EUUA 1C1LA 4HG6B 3ZYRA 2PHUA 4NWWA 4WVZA 5F5AA 1ZRCA 4NHXA 3V0BA 2XR4A 2QQLA 3T1MA 2P3KA 5KHGA 2P6HA 1MS3A 2Q0AA 4PI0A 5FPZA 5A1AA 3RZLA 4IW3A 1PGL1 2IXJA 2VCBA 1OI6A 3TEXA 1XYNA 3ZXKA 1I9RA 2O8QA 4FT8A 3SNMA 5F37A 1W05A 3AKPA 4XCAA 2PLV3 3ZOIA 3T2OA 3MUZ1 3KHCA 4AG4A 4GD4A 1QMJA 4EQVA 2XMLA 4YVWA 2XWJB 4FCAA 1H6XA 1UY1A 3ACIA 3AKQA 3LE0A 1J84A 4YGDA 3ZSLA 4YFZA 2VUCA 1WBFA 4UT5A 4D3WA 5C3RA 2XB6C 4QPIA 3H8RA 2CNAA 3BKZA 3ABZA 2RDRA 2YZ4A 1W6MA 2AEYA 4YW1A 4OQ8A 4P14A 1RTVA 2UU8A 2VY0A 1DF0A 2QE3A 5FWJA 1RXFA 2PLV1 4Z1VA 2WO7A 1OD5A 1CD3G 2P3IA 2ZHMA 4C1WA 3CLPA 4CCEA 5IK5A 5IW0A 3VKLA 5GM0A 5AC92 2XJRA 4FPEA 1RJ8A 2BDRA 3DYPA 3LCPA 2YMZA 3FZ3A 5C8CA 3S0MA 1IQAA 3S5AA 4WVVA 3VBHC 3E5XA 1YJLA 1REFA 4JQRA 2WZEA 3ZFFA 1ZRFA 5T54A 1ODNA 3I2HA 5FZ4A 3VBUC 4BHPA 1LAJA 5CFDA 5C4WA 1QQP3 3H8UA 5T5PA 2WLPA 5FYMA 1LCLA 1MZ6A 3T08A 1VAMA 1XNCA 4HSJA 5J98B 5A1FA 5EIYB 3W20A 5L9RA 4QPYA 2HJIA 4NHMA 4Q8LA 1WW6A 1JU3A 1AF9A 4GWIA 2DF7A 2PA7A 3AXDA 1X50A 1N1YA 3M1HA 3N3HA 2XOMA 4PLMA 4G4FA 2R073 1PHMA 2PHWA 4JGZA 4WVWA 2RR13 1BK0A 4FBFA 3J7NA 2FZ2A 1PK6A 3ECQA 2CY6A 1QQP1 2ERFA 3ME2A 5J7MA 1W39A 3EO6A 1OHFA 3FLRA 4FP3A 1Q3EA 1I5ZA 2E31A 4URAA 1UCXA 5BNOB 1H4HA 2P37A 1W99A 2Y6LA 1RUJ2 2R062 3H8XA 1VRH3 1NXMA 3UESA 4CU6A 3POBA 4IUGA 2VULA 4IEZA 1HQLA 3WNLA 4BCUA 2R071 4LR4A 2QQOA 4C0HA 5K0UC 1NXD1 3M8LA 1VJ2A 2RR11 5FO8B 3MUY1 1MZEA 3B00A 1W0NA 2AREA 3ZIWA 3IPVB 4EE2A 2ZMLA 5SV5A 4JGYA 1WCKA 2FDKA 3K4AA 2WNUA 5LA9A 1RUG3 3WV6A 1GP4A 4FPCA 5FYTA 4QQHA 1LTEA 1UWWA 3NW4A 1UOFA 3NV1A 4Q4Y3 1VRH1 4IEQA 5EFUA 2Z69A 4UF0B 4PIXA 5T52A 4AVTA 3O1OA 3WQ1A 2ZX2A 3VBOA 1O4ZA 2GMMA 1RUH2 1JXNA 2MHFA 4EWAA 2G9FA 5FZAA 4B7KA 5A3LA 1LOAA 3U4XA 2D6MA 2YUEA 3J8F1 2NP0A 2CAUA 2P3JA 1NLRA 4EZHA 1QDOA 3TYJA 2Q8CA 2PHDA 3GGLA 1AR93 1RUG1 1VBB2 2VZ3A 3IIIA 2V4VA 2VMDA 4LBNA 3DF0A 2GAUA 3PTYA 3LQCA 4Q4Y1 1W28A 1NLQA 3BYWA 1OLMA 4DS0A 4UW3A 4AHZA 3Q9OA 1PO23 4A7KA 3PUAA 3X29B 2JWPA 3C7GA 4R9CA 1AXKA 3D5OA 1UMZA 1UKRA 1VAVA 2W87A 2ZGRA 3DUIA 3L2YA 3K46A 5FZ0A 4FOQA 3MIGA 5A3MA 3T0DA 3L9JT 2BOJA 1PVXA 3USUB 1OFNA 3P5BA 1AX1A 3VBSC 3WNOA 3NVCA 1Q8PA 5JXHA 4ES8A 1AR91 2ZZQA 1W9FA 4HKOA 5FIXA 5IK7A 2ZEZA 1HKDA 1BBT3 3OBZA 3C2UA 3WOGA 5F2SA 3GBWA 4GXLA 3DYOA 5F5IA 2W5FA 1CGPA 4ES9A 3FFZA 2WQ8A 1PO21 1YC61 1B35C 4YW7A 1IS6A 4QB1A 1NZIA 3ZKYA 2VTXJ 3H7JA 3FBYA 1QH7A 2VOWA 5BNPA 1W6NB 1D0HA 4XMIA 3NKTA 3FFQA 1WCSA 5FWEA 2XQRA 4C91A 2WSVA 2E32A 3WSOA 4RGAA 1KGYA 5A33A 5KHHA 5DMYA 1LEDA 2VO5A 1BBT1 2ZGTA 3THCA 1JODA 3WG3A 3ZN6A 4GB33 4BE3A 1Q8OA 4IE5A 4RS5B 2W1SA 5E8AA 3WUDA 1S0FA 4COZA 3IKWA 1OA3A 3I3BA 4YW4A 3P3NA 3GJBA 5LZ6A 4BLJA 3I8TA 2FDFA 4IV1B 2F4LA 3FHIB 4YPJA 3QH7A 3IDBB 4CCKA 4EYUA 3VDAA 1US3A 3VDCA 4CP0A 4NIDA 5C3SA 5JMOA 1AR72 5F6LB 4XF1A 3SH3A 2A70A 1QJU2 3AKRA 2ZGPA 1BLZA 3D8CA 1D0GA 4BK4A 5BNNA 2GALA 4GB31 3TOJA 4NRMA 1H8VA 2EAKA 4ATFA 4D69A 4OI1A 4ISQA 4UBHA 4GKXA 3DKQA 3RNSA 2V73A 3ZXDA 3CZJA 1HX6A 3IDAA 4XJZA 5LY2A 1N3QA 5FZIA 5DAVA 3ZFEA 1AJKA 5FMCA 1Y3TA 3LPGA 2VNVA 5KC5A 1JZ7A 3LGRA 4KGGA 3GBGA 1LULA 4YGCA 1JZ4A 3ZYBA 1W8WA 4KBBA 2EXKA 1O4TA 5D1IA 4HPKA 2YC4A 4CVUA 4Y22A 3M3CA 5FY8A 1J83A 2Y0IA 1NCQB 1YEWA 2ARAA 3QACA 4PCRA 1OKQA 1W2TA 5FUIA 2XH6A 2ZEWA 3MW3A 4YNIA 3WNXA 3M3OA 4LBKA 1N3PA 2CHHA 2JG8A 2VAUA 3ZO0B 4BQ4A 2DCKA 4Q0UA 1ASJ2 5D8AA 1H6YA 1W8OA 4NUBA 3P6BA 4ZPIA 2A3XA 4PF1A 3V0AB 4UAPA 1PGW2 3KB5A 2Y6GA 5FZ1A 1A6CA 3CJIC 3IT8A 4XABA 1LECA 1JHNA 3LEIA 4Q4V2 4YM3A 2OXBA 4NIGA 4KU8A 3ENRA 4NRQA 4OFGA 3C8XA 1UPIA 1RC6A 4GALA 3VL9A 3BVCA 2JXAA 2VUAA 2MPFA 5KBFA 1RUD3 3WP5A 2QQWA 4AAPA 5FKCA 1TEIA 2WABA 3NJYA 4LO6B 2BBAA 3J7HA 4M3CB 1COV3 3D0JA 3POWA 3NNMA 4OZXA 2ZEYA 4XUQA 4FFFA 1B09A 2X29A 3U10A 4XF9A 1XC6A 5LY1A 2GNBA 3ETPA 3K3NA 3UNPA 1FMD2 1WW5A 4XFCA 4BQ1A 4PBOA 1L7QA 2YV8A 1XSQA 3U07A 4DMIA 2XUEA 1TNFA 1RMU2 1JMUB 2YDEA 3IDCB 4OUEA 2W52A 5C5UA 4FXKB 5LA0A 1RUD1 3ZSMA 4AFBA 4LKSA 1C8NA 1LHOA 2VXJA 5FLHA 1COV1 2FMYA 2ZCWA 1PGL2 4YFWA 3LIHA 5JPNB 3B9IA 3I2GA 4MXVA 5KHJA 1WD3A 5DDJ3 2LRPA 5KXCA 4QQPA 1CAXA 1UXZA 4RA0A 2PXJA 3VD3A 4MG2A 2R6QA 1KQRA 2ZHNA 3BI3A 3GZUC 5A3NA 1FX5A 1E5RA 3ITQA 2LS6A 4XUNA 2XKOA 2UY8A 4AZZA 5B4NA 3N35A 4M3CE 4YZ2A 2WO2A 4EZ4A 2F4PA 1CIYA 4LK6A 5E89A 5EJ3A 1GP6A 2OT7A 3O1SA 4GMP3 2D6LX 4B4PA 1HV1A 2CWMA 2VTFA 2Z4FA 5DDJ1 1WMXA 3O12A 2IZWA 3RPQA 2W68A 3E5QA 3N7KA 2PLV2 3G6JB 3BCWA 1DGRN 3R0RA 5FZBA 2C26A 2CGNA 5FY5A 4YM0A 2C6SA 1MQTC 3H0OA 4OHXA 1DZQA 3T0AA 3OF1A 3VZKA 4LIVA 5A3PA 4RFT0 1RJ7A 3TRSB 4EROA 3QOPA 2DCYA 1X7NA 1HXS3 2YB7A 1JTZX 1AL0G 3HN1A 2C1FA 4J6GA 4KG0A 4GMP1 4JHTA 2QNKA 1FV3A 5HI0A 2JDMA 3UETA 4BQ2A 5DXDA 3MPPG 3GCWA 3A0NA 1MS4A 2WO1A 2ARCA 4BA6A 2OIIA 2W94A 1CAVA 2FHRA 4JDOA 4Q4W3 3V64A 4BM8A 2DDUA 1WBLA 4QX5A 4IEVA 3J4UH 4YSFA 1DQ1A 2LW8A 2QKDA 3K48A 5GZDA 2VZPA 3WW2A 3CMGA 5LBEA 1SBFA 2Z5WA 2XJPA 2Z2SB 3MDPA 3N7JA 2YROA 2V72A 4FFIA 5F5QA 1HXS1 3SQOA 5BNOA 4XEZA 1PIV3 3AFKA 3BPZA 3M70A 1JOBA 1K5MC 4P9WA 3LF7A 1OF4A 2JDUA 3EJKA 3MF9A 4QX8A 5E6HA 3KT7A 3WG2A 4DXRA 5F7UA 2CDPA 3MO4A 4B1MA 3JU9A 4Q4W1 4L2NA 5DUVA 1QQP2 3GXUA 4P02B 4IEOA 5C7GA 4NWVA 5IVJA 2XPJA 1D7PM 2Q1MA 2RS33 3IPVA 1SG3A 3O0WA 4ZZ5A 5KWRA 1IG0A 2VOVA 1WCUA 4XDPA 5I8SA 5FZCA 4E2QA 1W8ZA 2GH2A 3KM5A 1VR3A 4OHYA 2VMFA 1PIV1 4P5YA 2ZX4A 3FUOA 4GH4B 2R072 1YRZA 4UF0A 4OHWA 4AVAA 2RR12 4K9SA 3AVSA 3KWVA 5C6CA 3U4SA 4GWJA 5C9AA 2R7EB 1GNZA 1ULFA 1AZDA 4BYYA 3NNJA 2EXIA 2ZACA 2RS31 3AB0A 3THPA 4DY5A 3O14A 1J58A 2FBEA 3HWJA 2VE1A 3A23A 1XB9A 2N7GA 1VRH2 4YZ5A 5IVCA 4YM1A 2GC0A 1GMMA 2DCZA 4PLNA 4RD7A 4MZUA 1WMFA 1BJQA 5FZLA 3ZKUA 3ZPYA 1RUC3 3GZAA 3ILFA 3H7YA 3T1LA 2JENA 1FATA 3FN9A 1JZ6A 1MS8A 4QHZA 3J8F2 1SBEA 4N43C 3RS6A 5F9TA 2NM1A 4PLOA 3OUHA 2W0XA 1UKGA 4OVEA 1ENQA 5JDBA 1RUG2 3WF3A 1V6IA 3USUA 2QTWB 1H2KA 1LOEA 2FQPA 2ET1A 4Q4Y2 4H2AA 4QXBA 1R083 5FMBA 4MGIE 5FP4A 1XE7A 1MACA 4UW6A 3NV4A 5FP3A 1ZRRA 5JXJA 3UJQA 5LWBA 1RB8G 2OS2A 1RUC1 4WM7B 1JYVA 3UV9A 2DBNA 2D3SA 3LA3A 1AXZA 1LGNA 2DV9A 1OXCA 4CEWA 3DCQA 4GJYA 1MS9A 1CZTA 3D4KA 3VBRB 4KNCA 4KMQA 3RRDA 1AR92 2GNMA 4LORA 3WDTA 1W6NA 4KWKA 1D4M3 4NIAA 4ZHNA 1D4VB 5A80A 3R05A 3R4SA 1R081 1XE0A 3OJBA 4CP1A 3I2OA 2D5HA 2NPIA 3KV6A 5JZGC 2L9LA 4EN6B 3LDKA 4N53C 2JJ6A 2WFPA 1PO22 4RS5A 5F3EA 3ZM8A 2HH9A 4XVHA 5DUUA 3KGZA 1MVEA 2A1XA 2GMEA 5CIRA 4Y26A 3U1XA 1SDWA 5A3UA 4RSUA 1JZ5A 1BZWA 1K5MB 4IV1A 2VOTA 5DUXA 2YGMA 3AM2A 4R52A 1DP0A 3C3VA 2GDFA 4QU2A 1BBT2 1D4M1 1LJ7A 4TLGA 5CVRA 5DG1A 3VBFC 4ASLA 4DPNA 2HEYF 1QJX3 1JW6A 4P5HA 2VCMA 3E97A 4FQ4A 3MF6A 4FPKA 2G1MA 4IGOA 3BN6A 1GZWB 2W3JA 3MV11 3Q8FA 4XUTA 1W6OB 5CZKA 1FV2A 4M0NA 4CPBA 3WQ7A 3O1MA 4NMIA 1TVGA 1GOGA 3VUOA 2X09A 3OGVA 4B4RA 1TMF3 2V09A 5CYYA 1JUHA 2JDNA 2C24A 4FAGA 4I3PA 4YVSC 1FT9A 3VLBB 4GB32 1IZ3A 1G86A 3VZNA 1QJX1 2DUOA 5FUPA 3CQOA 2GZWA 2RE9A 4K7JA 2DVBA 3O1TA 1KDKA 1NCQA 1CVNA 1Y7BA 1U5YA 3POIA 4IETA 3T0BA 4AK3A 2DUQA 1BHGA 4NPRA 1GZ9A 5A7QA 3WZ1A 1S55A 3LAGA 1KD7A 1KJLA 1QXPA 1YO8A 2TUNA 3AZWA 4AEMA 5FXZA 5BYNA 1LHWA 4LO8A 4NVPA 4MXWB 3LDBA 1TMF1 4LJHA 4CCOA 4N43B 5FQ0B 5G04L 1ZM1A 4JC1A 5CFCC 3V0AA 3V65A 1QY4A 5J3UA 2GMPA 5A6ZA 4TZDA 3AKSA 3VKNA 5EPAA 3NAPC 2R16A 3I3EA 5GLUA 4TWTA 4QXHA 3TEWA 1X8EA 1UYYA 2EIDA 3POJA 1WMEA 4FVVA 1V0AA 3S5QA 4IEUA 1KJRA 2VVDA 2XDVA 3LD8A 4MSVA 2QQNA 3M3IA 4WM8C 4AL9A 1G9DA 1IPJA 1WWYA 1H30A 2F17A 2J42A 2GN7A 4PIZA 3U75A 1VBA3 4YGEA 4NHKA 5APAA 5FZFA 2E9QA 4FAHA 4R4ZA 2A5ZA 1HQNA 4ISRA 4M3CA 4AHXA 1SCSA 5ACA3 3J26N 2P34A 4R9BA 4UFHA 1FNZA 4FPHA 5B4XA 5CEHA 4CP2A 1DQ2A 2EXHA 2ZGMA 3CKHA 3E6DA 1POV0 1OF3A 2C0ZA 1LOGA 2WRAA 4QGLA 4QWNA 4FTEA 4QM9A 3JZVA 5JZGB 4GJZA 2VQAA 4ARXA 3N9OA 1DGWA 4YYOA 4KGQA 4P9LA 3EMRA 4DXTA 3KV4A 3OSDA 1CZVA 1VBA1 3K77A 2AGSA 1ZVFA 3VKFC 2EIGA 1A78A 1HN0A 3TEYA 1R1A3 1UZ0A 3OD4A 1U5XA 1SLBA 5A7WA 4CDQA 5ACA1 2W92A 1XNKA 4Q0SA 2RMU3 5L9BA 4PF5A 3RI8A 3WCRA 4MGSA 4NPMA 1ENSA 4LKDA 3M4FA 1FOD3 1QXRA 2IFRA 3LPFA 4IEPA 4IDZA 2IXKA 1RUD2 2G9GA 2VGDA 3AVRA 3RJ2X 5KHIA 3ETQA 3JBG3 2PHTA 3J7LA 4J25A 1COV2 1UYZA 2XBO3 3ILNA 3UKVA 2VU9A 1UU5A 2XONA 2W47A 1R1A1 2J1AA 1BVP1 5FJKA 1JBCA 5JWPA 2WJSA 1NCRA 3LA2A 2FCTA 2RMU1 1OBNA 3NO8A 5FMDA 4HSLA 3G7DA 4QB2A 4YVSB 5FPLA 1QWRA 5J37A 1JN2P 1S2BA 4ZKTB 4W50A 2FDGA 1JH5A 1QF3A 1FOD1 2PHFA 1EUTA 2PAKA 1OH4A 5FOJB 5FY1A 4XETA 4XMAA 1O3TA 2NYYA 2XJSA 2B8MA 3JBG1 4I09A 4KU7A 2XBO1 5FYZA 3GM8A 1OA2A 4HVOA 2W39A 4A6SA 2PYTA 1ZA4A 2YBSA 1LGCA 3C7FA 2Y64A 5DDJ2 3I54A 1VBE3 1CAUB 2ZMKA 5A7NA 3VB9A 3KCXA 4XIKA 5A7OA 2CWSA 4EJRA 1QEXA 2DFCA 1WW4A 2OX0A 2QCSB 5CFCB 2DYCA 4AI0A 3FLTA 3AMHA 4I0BA 2XGXA 4OI4A 3DV8A 2ENRA 3W59A 1HB1A 4E4DX 3UKTA 4ASMB 1RIRA 3WP3A 3H42B 3RMYA 5FMOS 3MV01 2HWE3 1UNBA 1PMJX 1TE1B 2TNFA 2ZBJA 4WM8B 5ABJC 3TNPB 4AEJA 2WZR3 3WD5A 1XXNA 1VBE1 1UN1A 3VHRA 4QHOA 1NKGA 1W3VA 1CIWA 2X5IB 3EBRA 2O14A 2Y34A 3DEMA 3KS7A 1HDKA 1ZRIA 3HIFA 2PN5A 2VBPA 4UBGA 1VBD3 4XDQA 1N47A 1XQNA 2GSYA 4W4ZA 3ZR6A 4E4SA 2LM3A 3WX5A 3BTXA 2HEVF 3VZLA 3BU0A 5L36A 1JZ3A 2HWE1 2DCJA 5H9QA 1HXS2 1LOFC 3JQWA 3HNBM 1RVF3 1XU2A 2WSUA 5LRSA 3LB9A 5DUWA 2VCAA 4QQLA 4XFAA 1W8TA 1VP6A 2WZR1 2Q8DA 1W0OA 4IV3C 1VMJA 1S0JA 1C28A 2FCUA 4Q1RA 4QDQA 4Q4W2 4GH4A 2I45A 3VHOA 3WQ0A 4BWOA 5L7OB 2EIBA 4COYA 1STMA 2B5HA 1YFXA 5A6QA 1UY2A 1VBD1 2R32A 3O1UA 2RDNA 1E5IA 3KV5A 1GWLA 2E6VA 5FBZA 4ZS2A 1BCXA 3RVHA 4P9YA 1OKOA 5FMOL 1W8NA 4MGKE 2OPWA 2VNRA 4HFSA 2C5DA 1RVF1 1OVPA 1AHSA 1PIV2 2HBUA 4Q1PA 4Z92B 2XQXA 5I93A 1H4GA 1REEA 2JG9C 3S6PA 2VNOA 5F3IA 5A3WA 5LB6A 4XE9A 3AP4A 4Y1XA 2EIEA 3ZPOA 4MOAA 5T5JA 1LU2A 2WLQA 4GZ9A 5EYXA 4BOWA 2OQ7A 1XNAA 4R9DA 1IOAA 2RS32 1KDMA 3FHAA 3OEBA 2D98A 3UL2A 3JB4C 2VOKA 5E88A 4MVTA 5DAPA 4AQSA 4ZONA 2WA4A 3PIJA 1O8SA 2UYBA 2DCTA 4N90A 2RG4A 4LA2A 3D6EA 1KXGA 1EYBA 5IVFA 1ZZ6A 4OUSA 4WM7A 4K8FA 3ZXFA 4QXCA 1BYHA 2PFWA 3ZFGC 3ZDSA 3NSTA 1IHMA 4Y1ZA 1OPOA 3FL7A 4PI2A 1G6NA 2ZGUA 3F95A 3VBRA 4BMEA 5JXGA 3THTA 2YYOA 4CDWC 1S0BA 2QQVA 1DGWX 1RITA 4FO9A 3VDDB 3MZHA 1IKPA 1RUC2 4IERA 1DGRA 5B2GB 2B7YA 2W1UA 4BQXA 3I2KA 4XOGA 4CDXB 4GIQA 1W0PA 1DQ4A 1QOOA 1AXYA 1QNWA 3LOIA 5KXDA 1I1EA 3R6SA 4Q5OA 1L7RA 4PHZA
chains in the Genus database with same CATH topology
4QHBA 3B9CA 2WNVC 3I7DA 2XLFA 1R082 2B45X 2JX9A 2D43A 3J8F3 4YGBA 3TBDA 3USSA 4AF9A 2JE9A 5JIAA 3WHUA 4RR3C 2DU0A 2GU9A 2WZPP 2DVFA 3WVJA 1DGLA 1I6XA 1WLCA 2ZMNA 4AYUA 1GZWA 3IIAA 1CQ9A 1W6OA 5LK7B 4IV3B 2BPA2 4CZSA 2ARBA 4DNYA 4RL7A 1D4M2 4COUA 4I02A 3WT3A 4L9BA 3R4DB 3FE5A 2RJLA 3WDWA 4XFIA 4XXPA 1BVVA 4AQTA 4GWMA 3RMXA 4LULA 4BLIA 2B9UA 3AMPA 4BIOA 3WG1A 1GBGA 2BNOA 2H0VA 1UIJA 2A6VA 1QJY1 1BK1A 5I91A 4XJAA 4MXWA 2ZAHA 3KQRA 4B3NA 4ZXKA 1QJX2 2CAVA 5JMCA 4N43A 5FQ0A 3GHMA 1W6PB 3VBHB 3ILRA 5JI9A 1O3SA 1A3KA 5C33A 3D0SA 3VBUB 2VW1A 1CJDA 1NZCA 2A3WA 1YHFA 2MEV1 1S0GA 2HYKA 2DWRA 3OCPA 1TMF2 2OW4A 4Q0QA 3WP6A 1JUIA 1AL23 5CG8A 3ZFGB 1EP0A 3MI8A 1FAYA 1EPWA 3OY8B 1MVQA 4YG3A 3GBFA 1UPSA 4P9IA 4LNVA 2XG3A 4K40A 1SCRA 3AZZA 4S2DA 2ZGOA 5BNQA 2UWAA 4WBBA 4IEXA 2D44A 3S7IA 1NA1C 2R1DA 3ES4A 4AW7A 4BH9A 1AL21 2JKBA 2D3RA 1WGPA 4F8AA 3MGUA 2WL1A 4META 1OQEA 4PBPA 4Q4X3 5K0UB 4DQAA 2VMIA 3O0XA 2PHXA 5T3NA 3N4MA 2DU1A 3EQEA 1V6LA 1JYCA 1ZBE1 1WD4A 4A2UA 2XJTA 4CDUC 4ITCA 1VBA2 1GLHA 4S2HA 3VL8A 4AI1A 1KS5A 5ACA2 2AZ5A 1OMIA 3RQ0A 4Q4X1 1IS4A 1LR5A 1UX6A 4DRRA 5JLVA 3ZVXA 3CNAA 4XFBA 1IKQA 2TBVA 2FMDA 2R30A 4P9GA 3WW3A 2P17A 4KQ7A 2BFUS 1YCIA 2ZKLA 3VV1A 4DFSA 1CESA 1Q43A 2UWBA 3RDIA 4AEDC 5T5OA 1NE4A 1R1A2 2QFEA 3UJOA 4QQ2A 4PDWC 3DGTA 4O9GA 1H8TC 2RMU2 5T50A 1O5UA 4QGNA 2EF6A 5EXOA 1S0EA 2QZ2A 3FMGA 3M7AA 4MLOA 3WY6A 3H50A 3AXEA 2QUOA 1G9CA 1FOD2 4A3XA 1BEV1 3L2HA 5JAXA 1O7FA 3VBSB 4RQPC 3JBG2 4FQZA 2K9ZA 2XBO2 2B42B 3DPRC 3M2MA 4KWLA 4C0BA 4QPGC 2QVSB 2E63A 3ALQA 2D7FA 1VLNA 5JPMB 2D3PA 3B69A 4XW3A 2P2KA 1B35B 1ALYA 4W6XA 3RG0A 2WQZC 2X5IA 1ZX5A 4FOWA 2X8KA 2WFF3 4Y20B 1X33A 5HCFA 1OLRA 2KM2A 4L8QA 2BFUL 4CTEA 4Z82A 2F6BA 1NA1B 1Y9QA 2IFWA 4MH0E 1VBE2 4HT1T 1U5ZA 5IUQA 5FCCA 4LO4B 4AHYA 4AVSA 2A6WA 1OFSA 1SACA 4RGGA 3WDYA 3IWZA 4M00A 4JDMA 3UK9A 1DU3D 3N7MA 3RYPA 4D94A 5L7OA 5L19A 4JCKA 2WFF1 4P9XA 2CGOA 3ZXAC 1F31A 2HWE2 3QH6A 1LB2A 2CGPA 1S0CA 4XIOA 3AYCA 1CJPA 1KFUL 2WZR2 4CDUB 1J1TA 2XVLA 1A8MA 1BMV1 1EV13 3OBRA 4A7ZA 5JVVA 1VBD2 1J3PA 4LEJA 4YVWC 4XQDA 3CEWA 3ZSEA 3MW2A 4EWDA 1KRIA 4QT6A 1J3RA 1U5IA 3B7MA 4QPIC 2LALA 1H0BA 2I07B 3DN7A 1RVF2 1ENXA 5I0SA 1V6NA 4ONUA 3DKWA 1NQDA 4EN9B 4L92A 4AEDB 4K3UA 1G8WA 4LBLA 1EV11 4FPJA 3PJYA 5T5LA 5C8CC 4I3GA 5FFOC 4LUMA 1SBDA 1IPKA 1QKQA 2CL2A 1YYNA 1BQPA 4Y1VA 1X36A 3ZFFC 1C1FA 2HKXA 3CJIB 4F7ZA 4YG6A 2DTYA 4UW4A 4XHXA 3FWEA 5CFDC 3VDDA 5C4WC 1PMIA 3DPRB 5CNAA 1J59A 4LHNA 2BWCA 1GKBA 3ATGA 4QPGB 1U12A 2VUJA 1SQ4A 3OTFA 1GANA 4CDXA 3HMYA 4AVBA 3AMNA 1TME3 4CEYC 5A32B 1S0IA 1XU1A 3AP6A 4N7UA 3JD73 4YW5A 4JGZC 1VBC3 4XZPA 2DVGA 3KLSA 4P9JA 3OGGA 2A75A 3MLLA 4HKLA 4BPZA 1PK6C 1G9AA 2ZKNA 4MV2A 1R093 2JDZA 3URFA 4KWJA 4QXKA 1FPN1 1LESA 1Q8SA 2GNDA 2XL7A 1MS1A 2H6BA 1HRI3 1WW7A 4N9IA 1TME1 4FPYA 3OYWB 2DTWA 1LHVA 4IV3A 4AI3A 4XBQA 1HLCA 3JD71 4IEYA 4YG0A 3WHTA 4ZU7A 1VBC1 2WT1A 2UY9A 5I0TA 1NOVA 3O7OA 1REDA 4FPOB 4JGYC 2I74A 2YGLA 5DG2A 4QQOA 2WNUC 1R091 2B39A 1RUE3 2OVUA 2Y26A 1O5LA 4LHKA 1SLCA 1DG6A 1ZZ8A 4OULA 2VVEA 1HRI1 1V00A 4JTOA 1YI7A 1LKNA 4WZFA 2LTNA 3VBOC 5JSOA 2HWB3 1QHDA 4GULA 2HWC3 1H9WA 4FPFA 1G9FA 5EZWA 4H14A 4KH9A 4L97A 4B4QA 1W6PA 4LE3A 3VBHA 1GFF2 3BB6A 1YNAA 2BQPA 3VBUA 1MQTB 2PHLA 3KCYA 1RUE1 1QJY2 4YZ4A 5F6KA 1C8M3 2FZ1A 3SHRA 1YJKA 3O0VA 1MR5A 2PQQA 4Z07A 2PELA 4URTA 3T2TA 2HWB1 2RM21 2HWC1 3ZFGA 5C8CB 1RUOA 4DRVA 2A6ZA 3OY8A 2YPJA 3HBZA 3ZFFB 2IXHA 3BIWE 1AUYA 2JEMA 2MEV2 4MX3A 2Q5TA 2NMOA 5CFDB 2UWCA 3FC0A 1LHNA 1C8M1 2YXSA 1PO13 3AK0A 2ARXA 3RJRA 4CEYB 4YW2A 2WWSA 4LBMA 1KITA 1LHUA 5BNPC 5K0UA 3VZMA 2GH8A 3WG4A 5I0UA 3POYA 2BEOA 1SLAA 1OQ1A 3LWCA 4AWDA 2GC2A 1AL22 2VH9A 4MGYE 4QM8A 2R043 4M01A 5GKAC 1ZBA1 4XF3A 1PO11 2CTVA 2DURA 1GQHA 1BKZA 5EYYA 3E5UA 3MIBA 1OPMA 5IK8A 2WQ4A 4JAAA 1N1SA 2VMHA 2MNGA 2XVKA 4A7YA 1GYKA 1ZBE2 4E2SA 1DZRA 2ZAAA 5KXBA 2XUMA 4WVMB 1A8DA 3GZTB 5BNNC 2BGCA 2OZJA 5GZFA 2WNUB 2R041 3PLQA 4XBLA 3PVOA 2X53S 4Q4X2 4AQ2A 4U36A 1UAIA 4Q26A 1F5FA 2D6NA 3WCSA 2EA7A 3RSJA 5GZCA 1S2KA 4MYEA 4YZ1A 1DQ0A 1IS5A 2WA3A 5L73A 1C5IA 3ZYJB 5BXXA 1C57A 2A3YA 3SMHA 3VBSA 1ZNPA 1LU1A 4RHV2 4LA3A 1QJZA 1YFYA 2JG8C 1POV3 3AZYA 5DZFA 3H1WA 4C90A 1H2MA 5D8AC 1BEV2 3AP9A 2IXCA 1B35A 1W2UA 4E4ZA 4IESA 4XFGA 4I0AA 1QOTA 1O3RA 3AJZA 4Y20A 3ZN5A 3TB0A 4LUKA 1FNYA 2XJVA 3VZJA 4AFMA 4S2FA 2TEPA 2ZJCA 1QXJA 4N53B 3W9AA 2V5YA 2BNNA 2VVFA 4FPGA 4XXAA 1POV1 2VXRA 3JCIA 1XNDA 2Z42A 4NO4A 5KHKA 5LEJA 1BXHA 4PQ9A 2R0HA 1WLTA 1PZ8A 3VBFB 4XJUA 4LTAA 3B02A 1W6QB 5GLZA 1O3QA 1V6MA 1FI2A 2YHJA 3AJYA 5J96B 3LA7A 3ZN6B 1YIPA 2SLIA 3SCGA 2XL9A 5FREA 4CDUA 1S1AA 3IDEA 4H55A 3SH4A 1YUDA 1QGLA 4LO7A 3GYDA 1Y43B 2OZ6A 3MLJA 2WFF2 1OLQA 1O4YA 4LBQD 3FLPA 3E6CC 4D7TA 4F3JA 3WDVA 1I3HA 5FLIA 1RL3A 3ZX7A 4KG8A 3QCWA 5BNNB 5AVPA 1CX4A 1APNA 2BYVE 3H3UA 3VGIA 1SFNA 1BMV2 3H9AA 3SCFA 1YLLA 2XHKA 4JRLA 3BU7A 3GF6A 2ZX1A 3KT4A 2C9AA 3APBA 3MIHA 2OYZA 3TNQA 1IS3A 4HZFA 4HPKB 2NN8A 3CJIA 3ZSJA 3NAPB 3NWKA 1GNHA 2NQYA 3AYAA 1EV12 3VHNA 3JQXA 1PZ9A 2VW0A 5CB7A 1PM7A 1QOSA 4XJ9A 4NOTA 1YFWA 5I8TA 1UZZA 5D8AB 4CYDA 5A32A 1GZCA 1F5JA 4E27A 5E1RA 3LSEA 4K6BA 2XWBB 1Z7S3 3N7LA 1RHI1 1F2NA 1J3QA 5GZGA 1DQ6A 3M3EA 4EN8B 4I30A 4FPLA 1HV0A 5I0RA 2A6YA 5EWSA 3CO2A 3MIFA 1NLSA 5EV7A 5BNOC 1NE6A 1V6JA 1GR3A 3OYWA 4LLFA 3SITA 1ZZBA 2HWD3 2Q4SA 4DY3A 3MIEA 1Z7S1 3ZYGA 1ND3C 2ZZJA 4W6WA 2JD4A 2DFBA 4COVA 4TYSA 3CF6E 1SLTA 3ASIA 2O8OA 1FPN2 4U2AA 1D2QA 5FRAA 4M3CF 3GNEA 1TME2 1EAH3 1X82A 3RZZA 2AENA 5BUVA 3JD72 2VW2A 1ZZCA 4SBVA 4QGMA 1VBC2 2HWD1 1UZYA 4NR1A 5C9AC 3ZIXA 4IXLA 4TLFA 1VB2A 1AYN3 2VOXA 3B5LB 1R092 1CAXB 3ZYPA 4XPVA 4BIFA 4E2GA 1KS4A 1HRI2 1MQTA 4LHLA 3KSCA 4XQWA 5C8WA 1EAH1 4JVAA 2Y38A 3VKMA 1NY71 2JE7A 4YLZA 2HWF3 1ND2C 4O9EA 1AYN1 2ZOEB 2VMGA 1RUE2 1VIWB 3ACLA 4G3YC 5F1RA 3H1MA 2OUHA 3B93A 1RUF3 1ULDA 2YY1A 3PJQA 4AGVA 2HWB2 5ABJB 1V6OA 2RM22 2HWC2 2SBAA 4WV8A 3SISA 3INAA 4CEWC 1UIKA 5GALA 1HW5A 4CEYA 1K5MA 3IBMA 2HWF1 3MFCA 3FJSA 3I59B 1XNBA 1CAVB 2BVVA 1C8M2 4XJWA 5CAZA 1F9KA 1RUF1 4TSVA 4EN0A 1LGBA 1NYWA 2ZGQA 2ETEA 5HCBA 3RWNA 4RS5C 2BNMA 4XF4A 2NMNA 1QJY3 1SEFA 4F83A 4IV1C 1S0DA 2OA2A 3UKNA 5FO7B 1FYUA 1N3OA 1ND3B 1V6KA 4I0WB 4WVMA 4B8EA 4Q0VA 5KXEA 5K7PA 1GICA 1J1LA 1ZBA2 5JOWA 3AP5A 1PO12 3FUQA 2PHRA 2MEV3 2XLGA 2JG9B 3M3QA 1AR63 1WUVA 3S7EA 4YZ3A 5FO9B 1AX0A 4M0HA 1IGOA 3A4UA 4XQ4A 2E7TA 5C9AB 2VNGA 2WS93 3MEPA 2R042 2VECA 1Z0HA 3QBQA 3MIDA 4K21A 1NCQC 2RHPA 3ES1A 1AR61 4HK9A 4KL1A 2Y0OA 3MICA 3ZSKA 2RS13 1ND2B 1TNRA 3QLQA 5GJ6A 2RJKA 5J36A 2WS91 5E16A 4N9HA 4CDWB 1D2SA 3VN4A 1XE8A 2A7AA 2XLAA 5CBLA 5J48A 1ZBE3 3NV2A 1ZYBA 5JZGA 3MYXA 4X8PA 2B46X 2KA3A 4N53A 1H1IA 2BVBA 4CEWB 4XF0A 3RYKA 5CU1A 1YI9A 4DOUA 2RS11 1RUI3 2WNVB 4AGRA 3AMMA 2G4IA 4X8NA 1QNYA 2WC2A 2XJQA 4FTBA 3VBFA 1RGSA 2EVXA 1W6QA 4RR3B 4XJ8A 2E7QA 2ZGLA 5H9RA 3AZVA 2ZABA 3J9SA 4G9SB 4OLLA 4RHV3 4BMBA 4OI2A 1RUI1 4LBQB 4NN0A 4CDQC 3AMQA 5BY5A 3AP7A 1AYM3 4OHZA 4AQ6A 2O1QA 1H1MA 4YVSA 4R4XA 1BEV3 3FX3A 1ONAA 1ULEA 2BW8A 4YM2A 5LK5A 2K0GA 4DZGA 3KD4A 3WLUA 1R1ZA 2DUPA 5FPXA 1YXWA 2I2SA 3R4UA 3O5SA 4RHV1 1MZ5A 4OHVA 1NCRC 4R9AA 1DIWA 1U0AA 1AYM1 1CAUA 1OOPC 5JIUA 1QU0A 4W6YA 2OUJA 4X6QB 5CFCA 1HRV3 1HQWA 3IM0A 3NAPA 2ZA9A 3B01A 2ZS6B 5IK4A 1MZFA 3HQXA 4WM8A 1DLLA 4AXOA 3WW1A 1AR83 1PVC3 1E57A 3H1YA 3QD6A 2NLRA 1C5HA 1F8VA 3IMNA 3WDXA 4CRQA 4DINB 4AI2A 1HRV1 4HLTA 2DVAA 5FOBB 5HBAA 1V9U3 4Z8BA 4IQPA 3JUUA 4LLOA 3ZYIB 2ZPXA 4ATEA 5GLVA 3BALA 4LT5A 3VKOA 1AR81 2BWAA 4XTPA 1PVC1 4XTMA 4FOVA 2CV6A 1TQ5A 4PIYA 4Q2FA 5AVAA 1RHI2 1GSLA 2A73B 1EY2A 1X8MA 3U11A 1V9U1 1VAKA 1JYIA 3AYDA 3E6BA 2IC1A 4H7MA 2UYAA 4AFDA 1M4WA 3TWIA 2AUYA 3HR9A 4JRAA 3LSDA 2BUKA 3WR0A 4LO5B 3W58A 2AH2A 4Y1UA 1Z7S2 4GH4C 3NJZA 5AFEA 2R1BA 5SV8A 3FBMA 4CDQB 2ES3A 1MEC3 2AYHA 3EXUA 3AZXA 3CU7A 5DZGA 2PAMA 2QDNA 1KFXL 2ZGKA 1YWKA 1Q5OA 4XBNA 4IEWA 4HVQA 2KXLA 4AVCA 1DDLA 5T55A 1YIFA 2A6XA 1DFQA 1DYKA 3RI9A 2OPKA 1UU6A 4Y4YA 3JB8A 2HWD2 4PDWB 4AFCA 4DB5A 5FLJA 1H8TB 3HD8B 3ZMOA 1UD1A 2RS53 3PMEA 3SH5A 2LUWA 1NCRB 1MEC1 1SLIA 4H7LA 1OOPB 2YC0A 3TN93 4XYXA 3RYRA 2WT2A 1NQJA 4YARA 4RQPB 3NL1A 1GQGA 3MFAA 1EAH2 1Q56A 2WKKA 1OQDA 4H3WA 4GMP0 4J1WA 3P3PA 3VZOA 1CAWB 4Z2WA 1G9BA 5CA6A 5ABJA 1FPN3 1UW8A 2R49A 5HCAA 4WM7C 1NY72 2RS51 1OSGA 1QH6A 1AVBA 1SFYA 3MLKA 5JSPA 1AYN2 4EN7B 1XRUA 2NZ9A 3OGJA 4Y1YA 1MS5A 3TN91 3V56A 3VBRC 4JV4A 4AVVA 4FOYA 3AFGA 3BTAA 3I59A 1N1TA 3PVBB 2R0FA 2PAEA 3ZN4A 4NHLA 4C1XA 4BZ4A 1LOFA 3ZXGA 2HWF2 4HMZA 1UF2C 2W08A 1C3HA 1LRHA 5JCTA 3HT1A 3V0BB 3PMSA 4DXZA 1PNFA 1FXZA 1RUF2 2E51A 2IWGB 5AC93 4D7SA 1ND3A 1VALA 5H9SA 1MS0A 3MW4A 4AI8A 1JOJA 3POSA 4XHBA 3ZXLA 3WW4A 5CADA 1Q8QA 2JG9A 1UU4A 4ORFA 4COWA 1DYPA 4YVWB 2RM23 2O0OA 3KZ4C 1RUNA 2PTMA 3HT2A 3A0KA 3I4IA 3ZXEA 5AC91 4QPIB 3OBTA 3MPBA 4HN1A 1W6MB 4HN0A 2ET7A 5FTTC 1O91A 4IL7A 4QMAA 3TAYA 3H3ZA 5AFBA 4WZCA 3WINE 2D6OX 2XKPA 3HAGA 1G7YA 1WA4A 1ZZ7A 3B94A 4MUVA 4OUMA 3AYEA 5TSWA 2E53A 2ILMA 3KMHA 2QDRA 3DL3A 4HVRA 2WT0A 2EXJA 1RUJ3 2R063 2Q8OA 3SXWA 1ND2A 4MGZE 1Q8VA 2D6KA 4HETA 4JDNA 2ZGNA 3ZXJA 4CDWA 3CJXA 5BV6A 2IXLA 5JR7B 2WNEA 1AR62 5C4WB 3BOWA 4L99A 5JOYA 3PVNA 4R8HA 1XYPA 2XVGA 3WDUA 1EPZA 1ZBA3 4HBNA 3KCCA 4XFFA 1SLLA 4S2GA 4FTSA 2ZHKA 2WS92 4X6RB 1RUJ1 2R061 1ZZ9A 2WNVA 4JGZB 1RUH3 2VG9A 1PK6B 3ST7A 3ELNA 4RR3A 4PJYA 5IT6A 3LZZA 5H9PA 4GKYA 2VQ0A 2Z79A 2RS12 4W65A 1VBB3 4QD2A 5HXVA 1VB4A 4Q8KA 3CL1A 1PNGA 1CN1A 4LBQA 3WXPA 2ZTNA 3GALA 1RUH1 2DVDA 2QZ3A 4SLIA 2EAAA 3WUCA 4JGYB 1V70A 1NG0A 2WIIB 1WLWA 3U0ZA 1CR7A 4HKWA 4UW5A 1OA4A 1RUI2 1VBB1 3KGLA 1Z78A 5JOZA 3OPZA 3VBOB 5GLTA 1N1VA 1LODA 1PZ7A 2D93A 4LBJA 3ZFEC 1ENRA 3LKJA 1CONA 4ZU5A 3BOPA 3PNAA 3BODA 5CG9A 2ZX3A 2D97A 1WCDJ 4Y5Z0 5DZEA 2H6CA 1AYM2 4FSJA 4YW3A 1GV9A 2QQPA 4JTNA 3SCHA 4Q29A 4K1YA 5GZEA 1QDCA 1H2LA 1DZTA 3GHNA 3N36A 5J09A 4INDA 4LE4A 4HANA 4N7IA 4YRDA 1AR73 2GC3A 4B29A 1URXA 5GLWA 1QJU3 1NA1A 1ZRDA 2QJVA 2JICA 1L3JA 1WMDA 3D82A 2WINB 2CYFA 5JOXA 2UURA 5LEKA 3PHMA 4B7EA 4HK8A 3IN9A 1HRV2 2X5IC 3NKGA 4AE2A 2GN3A 2HEWF 1C4RA 5BNPB 5K8SA 5FAXA 2ZGSA 1DBNA 5BPXA 3AKTA 2ZHLA 5A33B 1AR71 4AGGA 2GC1A 1H2NA 1AR82 1QJU1 1PVC2 5JSRA 2IXIA 1CPNA 2BTVC 4GA9A 5KC6A 4GWNA 1ULCA 4K20A 4I01A 4Q27A 1LENA 3KT1A 4EV0A 5JI7A 3S30A 5L7OC 1V9U2 2EALA 4J1XA 5K9YA 3K51A 2A71A 2ZX0A 2BBVA 3B3QE 1ASJ3 3EHKA 1HIXA 3OD0A 4D7YA 1LEMA 2Q1ZB 4EWEA 2XJUA 2E7AA 3PVEA 1RINA 4L11A 4AEDA 1CPMA 4Q4V3 4E9KA 2D6PA 4PDWA 1H8TA 4OI0A 3ZFEB 1OOPA 3ZMNA 2GNTA 2VPVA 1PGSA 3NV3A 1ASJ1 4GQ7A 2Q30A 5LRRA 1AX2A 1RHI3 1DQ5A 4Y22B 4RQPA 3VHPA 1H9PA 2H0BA 5I8YA 4AEKA 1PGW1 4XFHA 4UXAA 4Y24A 4V1PA 1WLDA 3DPRA 1FMD3 4Q4V1 1CAWA 1LOCA 4HL0A 4QPGA 3ROUA 1MEC2 4FP2A 2JG8B 1UL9A 3SLIA 2D5FA 1RMU3 1YFUA 4LBOA 1ZREA 1M06G 3LOBA 1SMVA 2D40A 1XYOA 4I2OA 1H1AA 2ATFA 3AX4A 3I2DA 4K1ZA 4ZU4A 1DHKB 1LOBA 2JECA 3VDDC 4XILA 1AJOA 4AFAA 1FMD1 2RS52 4AHWA 1T6GC 4Q0PA 4FXGB 1ULGA 2K2SA 4CDXC 3TN92 1RMU1 2AR6A 1C1LA 3ZYRA 2PHUA 4NWWA 4WVZA 1ZRCA 3V0BA 3T1MA 2P3KA 5KHGA 1PGL1 1MS3A 2Q0AA 5FPZA 2IXJA 5FDBA 1OI6A 3ZXKA 1XYNA 1I9RA 2O8QA 4FT8A 3SNMA 3AKPA 2PLV3 4AG4A 1QMJA 4YVWA 2XWJB 4FCAA 3AKQA 4YGDA 3ZSLA 4YFZA 4D3WA 1WBFA 2XB6C 4QPIA 2CNAA 2YZ4A 1W6MA 4YW1A 4P14A 1RTVA 2UU8A 2VY0A 1DF0A 2QE3A 2PLV1 4Z1VA 1OD5A 1CD3G 2P3IA 2ZHMA 4C1WA 3CLPA 5IK5A 3VKLA 5GM0A 5AC92 2XJRA 4FPEA 1RJ8A 3LCPA 2YMZA 3FZ3A 5C8CA 3S0MA 1IQAA 4WVVA 3VBHC 3E5XA 1YJLA 1REFA 4JQRA 3ZFFA 1ZRFA 5T54A 3VBUC 4BHPA 5CFDA 5C4WA 1QQP3 3H8UA 5T5PA 2WLPA 1LCLA 1MZ6A 1VAMA 1XNCA 4HSJA 5J98B 4QPYA 2HJIA 4NHMA 4Q8LA 1WW6A 1AF9A 2DF7A 2PA7A 3AXDA 1X50A 1N1YA 3M1HA 3N3HA 4PLMA 4G4FA 2R073 1PHMA 2PHWA 4JGZA 4WVWA 2RR13 4FBFA 2FZ2A 1PK6A 3ECQA 2CY6A 1QQP1 2ERFA 3ME2A 5J7MA 1W39A 3EO6A 1OHFA 3FLRA 4FP3A 1Q3EA 1I5ZA 1UCXA 5BNOB 1H4HA 2P37A 1RUJ2 2R062 1VRH3 1NXMA 2VULA 4IEZA 1HQLA 4BCUA 2R071 4LR4A 4C0HA 5K0UC 1NXD1 3M8LA 1VJ2A 2RR11 1MZEA 3B00A 2AREA 3ZIWA 3IPVB 2ZMLA 5SV5A 4JGYA 1WCKA 2WNUA 1RUG3 3WV6A 4FPCA 4QQHA 1LTEA 3NW4A 3NV1A 4Q4Y3 1VRH1 4IEQA 5EFUA 2Z69A 4AVTA 4PIXA 5T52A 3WQ1A 2ZX2A 3VBOA 1O4ZA 2GMMA 1RUH2 1JXNA 2MHFA 4EWAA 2G9FA 4B7KA 5A3LA 1LOAA 3U4XA 2D6MA 2YUEA 3J8F1 2NP0A 2CAUA 2P3JA 1NLRA 1QDOA 3TYJA 2PHDA 1AR93 1RUG1 1VBB2 4LBNA 3DF0A 2GAUA 3PTYA 4Q4Y1 4DS0A 4UW3A 4AHZA 3Q9OA 1PO23 4A7KA 3X29B 4R9CA 5FO8B 1AXKA 3D5OA 1UMZA 1UKRA 1VAVA 3DUIA 2ZGRA 3L2YA 5A3MA 4FOQA 3MIGA 3L9JT 3USUB 1PVXA 1OFNA 1AX1A 3VBSC 3NVCA 1Q8PA 4ES8A 1AR91 2ZZQA 5IK7A 4HKOA 1HKDA 1BBT3 3C2UA 3WOGA 3GBWA 4GXLA 1CGPA 4ES9A 3FFZA 1PO21 1B35C 1IS6A 3H7JA 3FBYA 1QH7A 2VOWA 5BNPA 1W6NB 1D0HA 4XMIA 3NKTA 3FFQA 1WCSA 4C91A 2WSVA 4RGAA 5A33A 5KHHA 1LEDA 1BBT1 2ZGTA 3WG3A 3ZN6A 4GB33 4BE3A 1Q8OA 4RS5B 5E8AA 3WUDA 1S0FA 4COZA 3IKWA 1OA3A 4YW4A 3P3NA 4BLJA 3I8TA 4IV1B 3FHIB 3QH7A 3IDBB 4CP0A 1AR72 5F6LB 4XF1A 3SH3A 2A70A 1QJU2 3AKRA 2ZGPA 3D8CA 1D0GA 5BNNA 2GALA 4GB31 3TOJA 1H8VA 2EAKA 4ATFA 4D69A 4OI1A 4ISQA 4UBHA 4GKXA 3RNSA 2V73A 3ZXDA 1HX6A 4XJZA 1N3QA 3ZFEA 1AJKA 1Y3TA 5KC5A 3LGRA 4KGGA 3GBGA 1LULA 4YGCA 4KBBA 2EXKA 1O4TA 5D1IA 4HPKA 4Y22A 3M3CA 2Y0IA 1NCQB 3QACA 4PCRA 1OKQA 2XH6A 3MW3A 4YNIA 3WNXA 3M3OA 4LBKA 1N3PA 2JG8A 3ZO0B 2DCKA 4Q0UA 1ASJ2 5D8AA 2A3XA 3V0AB 1PGW2 3KB5A 1A6CA 3CJIC 3IT8A 1LECA 1JHNA 4Q4V2 4YM3A 4KU8A 3ENRA 4OFGA 1UPIA 1RC6A 4GALA 3VL9A 2JXAA 2VUAA 2MPFA 5KBFA 1RUD3 3WP5A 1TEIA 4LO6B 4M3CB 1COV3 3D0JA 3POWA 4OZXA 3U10A 1B09A 2X29A 4XF9A 2GNBA 1FMD2 1WW5A 4XFCA 4BQ1A 4PBOA 2YV8A 3U07A 4DMIA 1TNFA 1RMU2 2YDEA 3IDCB 2W52A 4FXKB 1RUD1 3ZSMA 4AFBA 1C8NA 1LHOA 5FLHA 1COV1 2FMYA 2ZCWA 1PGL2 4YFWA 5JPNB 3B9IA 4MXVA 5KHJA 1WD3A 5DDJ3 5KXCA 4QQPA 1CAXA 4RA0A 2R6QA 1KQRA 2ZHNA 3GZUC 1FX5A 2XKOA 2UY8A 3N35A 4M3CE 4YZ2A 2F4PA 5E89A 5EJ3A 4GMP3 2D6LX 4B4PA 1HV1A 2CWMA 5DDJ1 3O12A 3RPQA 2IZWA 2W68A 3E5QA 3N7KA 2PLV2 3G6JB 3BCWA 1DGRN 3R0RA 2CGNA 4YM0A 4OHXA 1MQTC 3H0OA 1DZQA 3OF1A 3VZKA 4RFT0 1RJ7A 3TRSB 4EROA 3QOPA