2BVEA

Structure of the n-terminal of sialoadhesin in complex with 2-phenyl- prop5ac
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and in Silico Analysis of the Sialoside-Binding Characteristics of the Siglec Sialoadhesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords SIALOADHESIN
total genus 25
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bveA00
3NCEB 4JZJB 4E5XB 3MA9L 4Q9BA 2HWZL 2HFEA 3B5HA 1RUQH 2KQMA 3VRJB 1J8HE 4MCYA 1FNSL 4XP6L 4X80L 1MWAB 3WSQH 5DQJA 4NDMB 3W2DL 4KV5E 3F7QA 5FUOH 1IKNC 4XNQA 3K1KC 5F89A 1PEWA 4P5KA 3CH1B 5DVKA 4EQ2A 5DRZB 1TJGL 4ETQB 3F5WA 5F3BA 4M61A 4OI9A 4RAVA 2XG5A 3TT3L 3VG0L 1XF2A 4XPTH 4PGJA 3EO0B 1EBAA 4X7TB 1JZ8A 3FRUB 3HUJA 4HH9A 1D5BA 4RDQG 2I60L 3WBDA 4M4RA 3MQIA 5F3HA 1C08B 4I0PC 5E2TL 3RGVC 5D72H 5FYLH 4LIQE 4WO4C 3MTRA 4U1IB 1S7WA 4I2XA 4KK6C 4XCEB 3SDDC 3EYOB 5FYKU 4DGYL 4ZFOA 1IGYA 1G84A 2DQFB 3V6ZB 4EI5D 2O5XL 1DUZB 3HHRB 2ZUUA 3UTOA 1NC4B 4E41A 5E8PA 3LSOA 1AP2A 2FLRT 2OJZH 4Y4FA 2JK5B 3HUJE 5IM7B 3I2CL 1NAKL 3K7UA 3RBGA 4OV5B 3SDAB 1WTLA 1CCZA 1M4KA 1Z5LB 4TSBH 1BM3H 1A7PH 3S98A 1WWWX 1DSFH 3G08A 4YHOL 1FO0B 4LAQH 5EU4A 1XIWC 3CK0H 4JY5H 3RA7H 1P7KA 3GO1H 3LY6A 5JPMA 2OI9C 4Z7UA 5C0DB 1NCCL 3ZO0A 4HK3N 3BP6B 5CEYA 5JQHC 3HC4L 1KCVH 3GMLA 4HZLA 5KSBF 1F45A 2LQRA 4JE4B 4X9FA 4ZFZB 4K9EL 2CR6A 2C9AA 1MCKA 1K2DA 4IRSC 1EEQA 5HI5C 5DVLA 3MACL 5I2IB 1ZT1A 4YPJA 1NMAH 1CFSB 1BZ7B 3PDDA 5A2JH 1J18A 1AQDA 1AR1D 1DJSA 1F97A 3WLWD 3U82B 2WBJB 1HXMA 5IJKA 2X4TA 2E8ZA 4DUWA 2R4SH 1JPSH 3BP7A 1IMHC 3QNYB 4R90H 2L7JA 3QEQD 1SYVA 1FZOA 3BYYA 4JRYE 1BOGB 3V0WH 1X4ZA 1CGTA 4MMZC 3GMOB 3OJ2C 5CWSB 1RZ7L 4LCIL 4LCUB 2FECL 3PWNB 4X5LA 5ACZB 5IT2L 1AE6L 3MRJA 3W9EA 1FHGA 1Q1JH 3MRRB 1CE1H 5D1QA 4QY8B 5EIVA 2G5RA 4F7PB 4LCCA 4I3RL 1IM3B 5AYQA 5A3ID 5F88B 3DUUB 5F44A 1NGPL 1K5NA 2Q86A 1KCUL 5IBLC 1MHEA 3BZDA 4NHCL 2JIXA 3MUGA 5HYEA 4PGCA 1ZLVK 4HC1A 1AQDB 3V4VL 3N1PC 3A6BL 4CU8A 5TJWK 1HHIA 1KGCE 2OSLA 3WFBL 3LN5A 3HE6B 4M9PA 3LZFL 2VABB 3EO1A 5AZ2L 4U6VH 1YEKH 2D4FA 4I3SH 4EVNA 2OBGA 3MA9H 3PUCA 5BJTB 1HNFA 1SBSL 1KXQE 1YPZA 4W6XB 1FO0L 4MNHA 2FR4B 4D0CA 5I66B 4JCLA 4PGEA 5JNYB 4BA8A 4HX1B 3FN0H 1FSKB 4Z7UF 1ZTXL 4MDIB 2HAZA 1DL7H 2L4OA 3JTSA 1GAFL 1OTSC 4ESKA 5C7XL 3FMGL 4W6WB 5JLZA 2VH5H 4G43A 4HFUH 1A6VH 2EYTA 3ULVC 4WWID 1HXYA 5JTWA 3ZDXE 1TXKA 4OF7A 3RKPA 4LLMB 1KJ2B 4NBXB 4QHNB 1V3KA 5T3ZL 1XH3A 4PUBL 1CR9L 2VL4A 2DWEB 1KLGA 1T1XB 3PJSB 3BZEA 2GYSA 1DEEB 1HXYB 4K3HA 3H9SD 5ACZA 1YPZE 5JPNA 5JUEL 4EI5B 4I5BB 4WV1B 3VFNB 3QXAA 4ZS6D 3HE7D 5BRZE 4XMLL 5J56B 3TH3T 4PJDE 1MVUA 1ULVA 1FGNH 4P2OC 2H6PB 1P84K 1VADB 1UKTA 3WNMA 3P11L 2BJML 4V2BA 1WCBA 3THML 1S7XA 4HCRH 3QFJB 3VWJC 3WFZA 1JF5A 1NC2B 1MHCB 1P4BH 2A2QT 3D25B 2LE9A 3VRLE 4LOUC 5FCUH 1T0NA 1QBAA 2JB5H 4O9HL 4M1GL 4YHNA 2YA1A 5DRXA 5DJ0B 2R2EB 4FXKB 2YPLB 2CO6B 4I18B 3MV8A 5KVDL 5EIQA 1JZ3A 2VDOL 4IJ3B 2FJFB 3TPUB 3S37H 1YNKH 4JY6A 4CN1A 5IF0B 4GSDL 2DQCL 4NQED 2C4FT 5HJ3A 1X5JA 1SJHB 3TWCL 3O6KL 3MRNA 3TVMA 1U8LA 4N0RA 2BOCA 2JCCA 4M6ML 4XP5L 5IQ7H 2I27N 5EFIB 4DUVA 4RGMC 4ENEC 4KTEH 1G7QB 1AD9A 4PRIA 3WDIA 2FX7H 3WS3B 3V5DB 3HE6C 3TWCH 3RVXC 2EO1A 3VFTB 3ARBD 1TJHL 3IJHA 4PV9A 2ZCKL 3FB6A 3V0WL 4MAUH 1KCSL 4S1QL 4D9QE 1NFDF 4AYFA 2MPAL 3QDHA 4OF6A 5I76B 4N8CH 4C54A 1RZ7H 2VSDA 3V5HB 5C07A 1XGTA 3CNKA 2ZSWB 1UZ6F 1RIHL 4C56B 5L7XL 5E2WL 5ALBH 3T1FA 3O45A 2JELL 1PEZA 3B2UD 2MSPA 1A3QA 3X13B 5J57B 2C4FU 1JWSA 2NTSP 4KHXH 3TYFB 1JYVA 4DTGL 1EO8L 5EC2B 1BJ1H 2FCBA 3S35H 3AVEA 3HN3A 5GISL 3HE7C 3V95A 1INDL 2FBJH 5FYJE 3BKYL 4QF1A 3HFMH 2BNUA 1NPUA 4C83A 2EIDA 3OKLB 1MIMH 4F37F 2ATPB 2I07B 5E2VH 1X6LA 1ZHKA 3VDCA 5IB5A 2GKIA 3F58L 1JGDA 1EHXA 4QEGA 3QWOA 1YN6A 4AIZA 1GYAA 4EQ3A 3PWNA 5IFHH 2YD1A 1RIVL 1HDMA 2CR3A 4XNYL 3U2SB 1DVFD 1I7UA 4LPTA 2W1NA 4PJFE 4ELKA 4M43L 3OKYA 2EYSB 1CQYA 4UILL 3V4PL 4KJPC 1AH1A 3KPTA 3QNYA 4MZ2A 1E6OH 4ZOBA 1HILB 4OLZH 4TULL 3GHBL 4QTIL 1CGVA 4KPHH 5E00B 2YPKB 5DSCA 5C0BB 3HPLA 3MRLB 4FTVE 1Z0MA 5BMFL 3MXWL 3UPAA 1MFCL 2F53B 4UB0H 2V5SA 1HQRA 2IMNA 4XP9L 5CGMA 1CDCA 4LNRB 4YDIL 4OD3H 4PJDB 1TQBC 3C5JB 1BVZA 4ZFFA 5EG6C 1YNLL 4D2NA 4HGWB 4G7VL 3VXSB 4F57H 1T1WB 3VI3F 1P4BL 2AEPL 4HKXB 5CJ5A 3S3JA 1QFUL 1IGCH 2MCPL 3WE6B 1MFEL 2JTDA 3MJ8A 1YNLH 4XZUB 4L4VB 3VXNB 2JJSC 5C08A 1U2HA 4NO5B 3CPLB 1SM3L 3PGDA 4LSRL 1HIML 3GNMH 3GSUB 2QQKL 5BV7C 2ESVD 1R3KB 1HCVA 5EZIH 4B7LA 1Q9LB 2GTWA 2Y25A 5GXBB 2XKNA 3RWDA 1RJLA 1G6RH 3MPCA 3N0PB 4K94C 4WFGE 4FZ8L 4X80H 4QGTA 4RNRB 1CBVH 1AI1L 1EHNA 1QFOA 3LEXA 3KDMA 2FR4A 2G2RB 4N68A 5CUSL 1CGUA 5EOTA 3Q5YA 4QTHA 2Z92A 3F7VB 4DOHE 2Y1VA 2H26A 2BOBA 2J8HA 3IDMB 4OZHE 1FFPB 4TSCL 4Q6IA 5IB3A 3IJSB 3ARFA 1X5LA 5DT1H 5KJRH 3G5VB 1PSKL 2AJVH 1SJVA 1CLOH 1EAJA 2B4CL 3UJJL 3TYGH 4PRDA 2DWEA 3ARVA 3GMNB 1Y18B 1P53A 3L3OA 4X0KA 4FP8H 2D7PA 5GS1B 4IRJA 3VXQA 2JIXB 4YDVB 3UBXI 4D9LL 1VKXB 1YEDB 1KV3A 1CFBA 5TFSL 5IVXB 3GK8H 4O5LL 5EUKA 4WTZA 2YBRA 3W39A 5EH1A 4MCYB 3HG1A 5HGGS 4MDJA 1MCBA 3O6FB 2Y5TB 4JRXA 5F8RC 2AXGA 1MVFA 1NAMA 1MNUL 4MJIE 3QEUB 3TT1H 4TUJB 4LCWE 2PTTB 1ZKAA 4G42A 5I16B 3BZFB 3WIFA 4LAQL 3S36X 3OGCA 2GK2A 3RZCD 5CIPB 3TZVA 5D7LD 3GSRA 5E4EB 4CVZB 4FQIH 1WBYB 5B3JF 4LARL 3VFTA 5DJXB 3Q1SL 4RAHA 4Z77B 2LABA 2UVEA 4KPHL 3D18B 1I3RA 4XB7A 5FM4A 5CIPA 3AM8C 2BFVH 1CGSH 5E2UH 5C0CA 5JDSB 5GGVL 3ZYZA 1T21B 3MGAA 4L8DA 5DA4A 2CDFB 4CJ0A 4G8IB 4IDLA 2P48B 4N1CA 1YY9D 2A9ML 4AH2A 1CDGA 4XI5D 3UTPD 4GAGH 4C59B 1NAMB 4XGZA 2EE2A 3MO1B 3PL6B 3KR3H 3VI4E 2NW3B 2UZIH 3QUXB 2ZSVB 2KL6A 4MB5A 4AH2B 5ENWA 3LN9A 5KSVB 2W07A 1ZMYA 2J1KA 1K4DA 1IGJB 1U8OA 3P73A 3BAEH 1X4XA 1TZHB 1SY6A 4ZYKB 2AJYH 1UM6L 4JFZL 3C9NA 3VFRB 1GGBL 5CSBA 5EZIL 2J8UE 1VFBB 3PIQB 4Y8AA 2VLJE 1KFAH 2AABH 4CADB 4JQXA 1F3JA 2SEBB 1KIPA 4KUCD 3NFPA 3PHQA 1BIIA 4YIQA 5I1AA 3HAEB 5EWIL 2J88L 2X4NB 4HMDA 3DIFB 1MFAH 2CQVA 5DJ8B 1MH5A 2X4PB 3BEVA 4WEMB 4WTWA 3UBXA 1FL3B 5KSBA 1YNTB 1SHMA 4P5TB 3KPOB 3SDCD 4YH6A 3MCKA 4NKMA 4LLQB 4GG6E 3CVIL 3K4DA 4W6YB 1UCBH 3OAZK 3RKDD 4Y5VC 4XCFL 5C0AA 4ELKB 4OZ4B 2X7LA 3EO9H 1NDMB 1TPXB 4NZTH 5TE6L 2GT9A 4POZD 5EZJA 2NZIA 1KBGL 5CINL 4J6RH 4J1UA 4OZIF 3SE3A 4U1SB 3IFLL 4BUGA 1MCPH 3VWKD 1VCAA 1R5VB 3HS0A 1A9BA 5TE6H 3DRTA 3ARGA 4PJHB 1T0MA 3QPQC 1HHHB 4ZUUA 5IB2A 3BPOC 1T0PB 4XBGB 2HG5A 3LDBB 1JHLH 1RJCA 1AXIB 2NY2B 4QXUL 2DQUH 3G6JF 3LVEA 4OZIE 3CXHJ 5ENWB 3O41B 5J6HB 4I9WD 4KVNH 3UTZB 1NEZA 5I1EH 1BVLA 4JPVH 1N5YH 3ILPB 1I4FB 3H3PL 5IBTH 1HHJA 1RUML 2G75A 5I17B 2CLZA 3H8NA 2XQBL 2BDNL 3CU1A 3V5KB 5D7LA 1P7KB 4X8JB 1UFUA 3Q5TA 3SKNA 1Q72H 3MRBB 1YNTA 3LQAL 5IKCA 3EUUA 4YBLC 5BW7C 4QRRB 4O2CA 5DGQA 1JN6B 5L6YL 1MH5B 3OB0H 5M94B 3X3GL 2EDTA 3MRFA 2OJEB 3ABZA 5IB4B 4IS6A 4ISVB 2QKIB 5HI3D 3DV4A 1YMHB 3BWAB 5H37G 3S7GA 2M2DA 3TH2T 4IM8A 4LCCB 3HG1D 1CLZL 1FV1B 3D39D 4JDVA 5L8KB 1YECL 2Q1EA 4AT6B 2VRAA 1AKJB 1WZMA 3GSOA 4KTDH 4X6BB 2UZIL 4P23A 5KVGH 5BS0D 4MD4A 3CSBA 4ELMA 2IH1B 1ADQL 5CP3A 1VPOL 4M3KB 4PJ5A 4L9LA 4PJ7F 1SJEA 3CAFA 3TLRA 4EZMA 2AXGB 2AK4A 2JF1A 3IETA 4H5SA 3DSNA 2FGWL 2ZCHH 4JO3L 5C0GA 4G8EB 3QCVH 1IGTB 2IH1A 4NKDA 3A67H 1PZ5A 2R2HB 4BH8B 5B39A 3OHXA 1FVDA 2CIIA 5FDWA 3RDTA 1VKXA 5EUOA 1U8KB 4PJFB 1IM3A 1BQHG 4YJZL 4LSSL 1JNJA 2V5YA 2R1WB 1QSED 4BQCA 2VDQH 2Z4QA 3AROA 2A6IA 3GM8A 3U30C 3UYRL 4RZCA 2LV4A 1BJ1J 5DQ9B 1NEUA 4OZGA 4XT1C 2UYLB 1S78D 4TVPE 5JQ6H 3G6JE 2NY2D 5FGSA 3V79C 4UTBL 4GAJH 2NCMA 4PYHA 3DSFL 3WLWC 2HWZH 4L8DB 5D1XD 4OF8A 1RIUH 1W8OA 1F2QA 4ISVA 3RPIB 4LQFL 4PREB 1C7SA 4M03A 5CD5C 5JXEC 1U3HD 4U1IA 3CDYA 3QQ4A 4PRAB 1B6UA 1BFOA 2A77H 1YMMA 3NIDF 5FO8A 2WSKA 2HJKB 4HX1A 2QSQA 2E7HA 2MQ0A 5L8JB 4NM4L 5HY9A 5KVFL 4Y16B 5D8JL 4G7YH 4Z95H 1HKLH 5I19L 4K94L 4HMCA 1V3JA 1MAMH 2FBOJ 4JCMA 5IFHL 3VXQB 4UMGA 4KXZH 5DJCB 1RJZA 3BW9A 5TF1L 5BXFA 4OFVA 5GGQL 5E6YA 3TT3H 5MEQB 2I9LB 3HE6D 4L1HA 1TZGH 4PJCA 3O11A 4PJGA 4UBDD 2PF6A 4MWFA 3HZMA 2GHWB 1SEBB 2F5AL 3CX2A 4ORGA 2J6EH 3GMLB 5D7KE 2VE6B 1XF2B 4GMTL 3QJHB 1P4IH 2EDHA 4I5BA 1QBMH 4UTAL 3FB6B 2OP4H 2N1KA 3IRPX 3ZDZF 2O5ZL 3E6FA 4OF5A 1FAIH 2QHLA 3NAAH 4X9GA 4EN3A 1KIRB 1CGWA 2P8LA 1FPTL 4P2YA 3LPGA 5DJDA 1OAXH 3BXNB 1MWAA 1KC5H 3X3FH 4E9LA 3HCVA 5EZLA 4MCZA 4U1GB 4NIKB 5DGRA 3VD3A 4LOUD 3B2VH 1AQKL 1CU4H 4OUUB 2FJHB 2O5XH 2IH3A 1TCRB 3ULUE 4M5YL 4X7SH 4KQ3H 4OCSH 2E27H 5DEFB 5GZOD 3NCFB 3SN6N 4OGXL 3QNXB 5ESVA 3MMEB 2AXFA 5CKAA 1SYSB 3JWDC 3P9LB 1KPUB 3DI2B 3E6HB 4KQ4L 1ACYL 4WHYG 3T04D 1C5BL 1BREA 2NW2B 4IJ3C 4M62L 3GI8L 4QXTB 5HVWA 4CMHC 1WC7B 3MYJB 4LRNH 4P9HH 1FE8H 3IAPA 2UY7A 1RVFH 5I1KL 1MAKA 3C5JA 3DWTA 3MACH 3OKNA 2VZ1A 5I8EA 1WFUA 3I50L 4Y2DC 4GO6B 3LN4B 1B0GA 1L6ZA 1KNOA 4PJIF 5FGCE 4RAUB 4KZDL 5HSFA 1DQLH 1D5XB 5CCKH 3H3BC 2VLRE 3SPVA 2CDEA 4H1LG 2AKRA 1NMAL 1T5WB 2BMKB 3KYMA 4W4OA 3HNVH 3BGMA 1H3UA 4Y2OA 1ZXQA 4R26L 3SDAD 3SDAA 4KRMB 2DQJL 1TCMA 2CIKB 4QRRA 2X4NA 1KIRA 3D9AL 3HNVL 3CMGA 2ADIB 3OZ9H 1MWAL 2FX9H 4LSSH 2AV1A 1OSZA 1NGZB 4FQHA 1U3HC 4LCIH 3D18A 5LVEA 4MSWA 2DWDB 2PW1B 5AYUH 3MX0A 5E6ZA 1RURL 2BNUB 3QUMH 1QA9B 3TC9A 5L9DH 3SGDH 1WBZA 4KDVA 4Y19B 4MD0A 2CKBH 3ROLB 3RGVB 3MRCB 4MNQD 2R1YA 3EYSL 1ZGLB 5AYUL 4X6DF 4ZO9A 2CLRB 1WBZB 4MHHI 1R3JA 1BQHA 5DO2C 4C56D 2D3VA 4FXLA 4KJWC 3FB7B 3DMMA 1HHGB 1ERNA 3MREA 2UWEA 4JDTL 3EBAA 4D3CH 1J0HA 2VUOA 3QEHB 2YUXA 1FO0H 1NBYA 1ZSDA 4ZOAA 4NO5A 5EPMB 1U8HA 3UPCA 3RVTD 3ZE0F 2D7NA 2FHCA 4PTTA 5B4MD 1T6WA 4S2SB 1UXSA 4HG4J 1X5YA 3PWVB 2X4QB 3QNZA 3ZKQD 4A2MA 5EO9B 1HNGA 3ARFB 2XIDA 1RJYB 1XGYH 2F53A 3PQYD 4NWUH 3V8CA 2FECI 2HRLA 3O0RH 5HYSB 1J86A 2IFFH 1JZ6A 4YBQD 3CFEA 3GKWH 1K8DA 4ZFFB 1ORSA 4XVTL 3LS5L 1T3FA 1KCKA 1NLDL 3IFPB 3T3PF 2A6IB 3GSNH 5IMMB 4XNXH 4HXAH 2BSTA 4U1HB 1A6TB 3O3EA 1NGYA 4U2ZA 2XWJA 1I1FA 2YMXL 3QQ3A 2V2XA 1T3FB 1U93A 5AG9A 1IEAA 1B9ZA 3TNNA 3P40A 4HJGB 3IDYB 3MOAH 4ONFL 2C1PA 4NO3A 4LLWB 2VLLB 2EEAA 2EH7L 2WMPA 3DVGA 2X41A 1OTUC 1FLTX 4CUCA 1ZA6A 4QRPD 1OD7A 4U1JA 1QLFB 1ORQA 3FT3A 4UT6L 3HR5B 3CVHH 4P48A 1KLUB 4HPYH 3VFVB 5I8CB 4RMSA 4UINH 2QHRH 1YEFH 1OAYL 1ZA6B 1I9RL 1ZGLM 1WIOA 3FQTB 4UT7H 2YA0A 1U36A 4PJ5B 5A1AA 5K9KA 3QO0A 3S3SA 5FFLA 1W72B 3H42L 3MOQA 2FLBT 5HY9B 3MFFB 4PJ5E 4JHZA 2ED7A 5EBMB 3MBEA 4C56A 5DTFA 4B53A 4ELME 4QXGL 5I75B 1U6AH 1EHLH 5E6IA 4KJYA 4Y19D 1CFVL 1BEYL 3SBWA 1ZANH 2HVJB 3IDIA 3D85B 3EGSB 4OKVB 1BVKA 4JFFB 3RTQA 1LDPL 2HT4D 3GBMH 3QEGH 1JFQL 4I3GA 5HYSA 2W9LA 5CBEA 3BEWB 2J5LB 5L2KD 2Q76B 1FNLA 1OM3H 3ZDYE 3WNKA 2NXZD 4KZEL 4Z7OE 1T03H 4M1DH 2CKBA 3SE9H 3QBTB 4MJ6B 1BLNB 2G75B 2PO6D 4CVWA 5DMGC 5I17A 2NXYC 3QO1B 3CFJB 4PRID 1UYWL 3DETD 5CKGA 2A6DA 5BS0A 4PP1D 2BSRB 3VFOB 4HWZB 4Y19E 5FB8A 3AGVA 4DGYH 1CE1L 3TVMD 4DKFL 5INCB 3UCRA 3C5SB 2NX5B 4RGMB 4WFHE 5DJAB 4HBQA 1ZWIA 4HIJB 5BVPH 2YUZA 4I9WE 4ACPA 1KPUA 3SQOH 1IKFH 4GRMA 1T1ZB 4NN7C 3T1FB 3V6OA 3RGVD 4X8XA 1NAKH 5D2NC 1S7QB 1WCQA 1YEHL 4QXTA 4F7EA 2E9JA 1DBAL 3N85L 4OQTA 4WU7A 3RWFA 1MNUH 2JIXD 1OAZL 3LPFA 1JGVH 5FUCC 5C2UB 3FFCD 2IPUG 4JM2C 2BXYA 4R7NB 3KLAB 2ZSWA 3NVQA 4QOKD 3VXUD 3MO1A 3NACH 1NH6A 2GJ6E 3MLZH 1AFVL 2M26A 4ZAKD 4UILH 5KANI 2V6HA 1A6PA 3BUYA 1QVOB 4PJ7E 4FXGA 3F6LA 5CP7A 1I7UB 2EKSA 1KIQB 2WWMD 3V5KA 4GKZA 4M6NH 4KK5C 5C7XH 1B0RB 3C60D 3BESR 1N0XL 3T0EE 4ZS7H 5FV1L 1GOHA 3RWHA 1CFSA 2AJSL 4Q97A 2IG2H 1NEZB 1F11A 1N0LA 3MNVB 4EDXB 4MNHB 2WIIB 2EDQA 1R3JB 1P7QB 4LEOB 4KMLB 3FOLA 3KYKH 4BZ2L 2K1MA 2IBBA 5LAXA 3IFNH 4WRLA 3RZCC 1WLHA 4XP4H 1OT2A 3JWOC 2WAHA 2P46B 3M1BA 1EERB 1AE6H 1CS6A 2VUYA 1I1AC 2AQ2A 2ARWA 4MQXC 5AUMB 1T1ZA 1C1EL 1D9KC 2DBLL 4KK9C 2X1WL 3MJ9L 2OJEA 5EO1A 4KRPD 5CZXC 4PGDB 5F70A 3HI1B 3IKCA 1CD1B 1DVFC 2X9YA 3KLSA 1A6AA 3L5XH 5KS9B 1HH9A 5J13C 1N3NB 4NKQB 3BVNB 3MNWA 4FZ8H 2VR4A 3N9GL 1L9MA 2BY0A 5H94A 5C0CE 1II4E 3BT2L 3JWOH 3FQNA 5FECB 2FATH 1A7QH 1UB6A 1R0AL 4N9GA 4YX2H 3LH2L 3QDME 3UAJD 1XT5A 5BVJB 2HN7B 1Z9SA 4LLAA 2D7TH 2ICWB 4PD4J 5C09D 1NMCC 1I9JL 2AJZB 2B1HH 5SWSB 1FNSH 1REIA 3VFUB 4KI5E 3SDYL 5DDHA 2YN3A 3JUYA 3RU8L 5CBAB 1GOFA 2O5ZH 4YWGH 2X9WA 4FQPA 4L3EA 4LEOA 1ZT1B 1AGDB 4XP5H 2D0HA 1PKQB 5FKPA 3BQUC 1PLGL 3RDTD 4EDXA 3VGAB 4GXVH 4ZXBD 5KSAD 3U0WL 4J3UA 2E8YA 4N8CL 1FFQA 1CFTA 1INQB 5DJZB 5C0NC 1YEDA 1RZFL 3PV6A 1T2JA 4S1DC 1DQMH 1KYOK 2COQA 4GG8A 3B9AA 3BKMH 4L9LB 4F33A 1B4JH 3SDDB 3FCTA 4BK5A 4XZUA 5F6IB 3B9EA 1MRCH 3NBNA 1OLZA 2PN5A 5DLMH 4OFYD 4ZUWB 2DAVA 4WI2A 5EOQL 3OKDA 4FQIL 1K5NB 3BDYL 1XZ0B 5E99L 4X7SL 5JPNB 4V1DE 4GXUM 2FO1A 4N0YH 2ZUWA 4JDVB 3HI6H 4YFLI 2CK2A 3JTTA 1CL7H 3FL7A 2ITCA 4MLIA 1HQ4A 1BIHA 2A6KB 2HFEB 3X12B 3CX5K 4M62H 2VLRB 1OTSD 2Z91A 4PJXF 4RX4D 2YRZA 5B8CB 1E4WH 1XIWB 5DUPL 2XWJB 3QQ3B 3CFCH 5DJ0A 1CK0H 1IVLA 5DFWH 2ZUQC 4IRJD 3HUJB 1AGCB 5EUOE 1FORH 3S88H 4XVUC 4ZSOA 2D7QA 1TTFA 5CJQH 1UM6H 2NY6C 2CD0A 4LLDA 1QFPA 3VD5A 3K8LA 3WIFB 2P5WD 5IHUH 4MZ3A 1JYNA 1TNNA 2X89A 3MROB 5JHLH 4TULH 1LEIA 1MHPH 4MX7A 3U7WL 4P2RE 4QXWA 3F7PC 4MA3B 3BGAA 2AEWA 3O4OB 3SGEI 5CLWA 4APQC 4ZUUB 4R7NA 3G5VA 1E6JH 4HUVB 2P44B 3ETBF 4TQEH 4QHLB 4R8WL 2CGRH 3EOAA 3P4OA 4JKLA 2Z31B 2IC2A 5HBBA 4XP1L 4LPYA 4YFDB 1JPFA 3VI3E 1L7TL 1AO7B 4H20L 5CP7B 5C07B 1FBIL 2H9GB 3VDAA 1UCBL 4JRYB 3JTTB 3W11D 4XXCA 1JV5A 3ALWA 3M17B 1YEEH 1MIML 5A16A 4NQEB 4NZTL 1QPXA 4H0IA 1WBYA 1KTDB 3A0OA 4OBRA 2DM4A 3SCMD 5I2IA 4JG1L 1G9NC 5LBSH 1MJJB 4D0DA 3P0YL 4JB9H 4MMXC 5F1SA 4X8JA 3WSQL 3KPSA 3LOWA 3V52L 2Y36L 2PTTA 3UBXG 5GIRA 4WCYL 1FNHA 1ZVSA 4NHUA 5BOZG 3GSUA 4EEEA 1JCKA 3T77B 4PS4H 3HPJA 1AR2A 4FQXB 1KIPB 5D2LB 5T3ZD 4R4NC 1F11B 1FZKB 3QWQB 3AAZB 4HWZA 3D2UB 1T7ZA 4X4ME 1TJIL 4NQVB 2BP3A 5JW5A 3P77B 4JKKA 3EOBB 2R2BB 3DARA 2WIIA 1KCRL 4OM1L 3ULUH 4APQD 3MLYH 2NR6C 4JHAH 5FA4B 4N8VA 4MHHG 3ISWA 3UJJH 5I0ZA 3PABB 3QDMA 4GQ9L 4PY8J 5GJSH 12E8L 5I8EB 3MRLA 3MRGA 1XGRB 3MOBL 3KYNA 5H2BA 3KPSB 5C9JB 1LE5A 3ZE1E 2WQ8A 3GMRB 1UB6B 1FPTH 1BGXL 1D5IH 1NC4D 3L5WB 4TVPL 1RJYA 4PJIB 4RWYH 5FHAL 4Z7QE 1QR4A 25C8L 3QCUH 2NYYC 3DX6A 1HSBB 5HI5D 5T5FH 2VO5A 4YK4C 2V9RA 2Q87A 3WJLA 3GJFH 1FFRA 5C8JB 1JGUH 2CK0L 1J1OL 1MY5A 3FT2B 2QQQA 3CZFA 1T83C 3FQUA 1MCLA 1WWBX 5CMAA 1G7MB 4GRWF 2G9HA 1CBVL 4HLZG 3ZL4L 2AKRB 1GZPB 3LB6D 1Q9LA 2GTWB 2GQHA 2D9CA 2HJFB 3FO2B 3LKSA 1XIWD 2Q8BL 3PDOA 4LF3B 4EBQH 4CL7A 1IFHL 3NA9L 4YXLH 4XBPB 1I75A 3RGVA 1ZGLA 4XMPL 4ALAL 1MCWM 3DRTB 3UROR 5HPOA 2ENSA 4URTB 4FS0A 3MGOA 4PJBA 3KXFD 4P23D 4YDKH 3M1BB 3D0LB 1T80A 2IGFH 3KR3L 2Z31C 4PJXB 4JPWL 2YSSB 5FO7B 1JNNL 1F4XL 4PG2A 4J3XA 2GT9B 4PJIA 3C87A 3GSWA 4HKZA 2PUQT 1NGYB 4Y4FC 4KK6D 3BP4A 5J3HD 3HZKB 5ELIA 1X44A 1XH3B 2ARJA 2M8XA 2I26N 1IEAB 1IT9L 4DJMA 3VFNA 1L7TH 1PG7W 3V0AC 3ES6A 4G8IA 3U7WH 2JCCF 5H2BB 3V8OA 4LVNC 4FFZH 3D2UD 1H15A 1DANU 1NMBH 3DJ9A 1QBLL 3ZT7A 4JO1L 3TFKC 2FX7L 3F62A 5IGXH 4JKPL 3DV6B 2HFFA 3T2PA 3CSGA 4JFEE 4H0HB 4R4FH 3LZFH 3VFWB 2XXMB 2ZUQB 4V1DB 3MRPB 1JWMB 2EZ0D 5T3XL 4W68A 3S36H 1UJ3B 3WFBH 1U8HB 2R0KH 2MQ3A 2EDKA 4ZS6C 4JZNA 3S96B 1DN2A 4KHTL 1OP3H 1NBVH 3WL9A 2XKNB 2G9HB 5FGCB 2BVQA 3C8KA 5I1GH 1EFXA 4Y4KB 2ZP0T 3LRGA 1LP9E 4KMTL 2WINB 1WQVT 4OJFL 2CXKA 4WNQB 5KVFH 4DKEH 4BSJA 4WUKH 5DEFA 1CZ8L 4F80A 5FKPB 5GHWH 3HR5A 5DHVB 5F7MC 4IDJL 1SJEB 3RWHB 5T1MB 4PYGA 2H8PB 1E27A 1JNLH 1QO3A 4POYA 3ZTNH 2J6EL 1HZHL 1FFPA 5EOCH 3QWRA 3WS6C 1CR9H 4IRJC 3GMMA 2AK1H 3MV7D 5E95B 4AT6A 5J13B 4GAYB 1JRHI 4LSPL 5EOTB 4PP1C 3CFJA 3WKMH 2PYFA 1A02N 4M43H 4PB0H 5IEHB 5IFJA 5T1DH 2H6PA 1ZLVH 2I60H 3U4EA 3U9PL 3GJEB 1YJDL 3X14A 5E2TH 4M8QA 4X9HA 4LQ1A 2BOCB 2YD7A 1FH5H 1GXEA 5EU3B 2QJDA 3FQNB 1IC5H 2LVEA 4UAOC 2XI9A 5KVMC 1OAXL 1T7WA 3LD8C 4JPKH 2VZUA 4PJGB 4EIGB 1XF1A 3SE8H 1P7QD 2A0LC 2I9LA 4U1NB 5T1LB 1CDHA 4LSVL 5DTFB 3I02A 1QFWH 4UDTA 3QHZH 4C4KT 4P2CG 3RIAK 3GBLA 3U7YL 3U4BL 2NXYD 4TRPH 2AEIT 3P4LA 3BPNC 5CBAA 3EFFA 4WO4D 2FGZA 1G7HB 4FQXA 4PLJC 1A7PL 2V7NB 5IB1A 4LSRH 3ARPA 4NNPH 5M95B 3PL6D 4QRTA 4LDEB 4OUUA 4WFEE 4GKZB 4KKLC 4WWKB 3ARDC 4Z7UE 3WFCH 3U7AA 1WEJH 3S9DB 3LS4H 1G6VK 5HI4D 1EZVY 2FJHA 5DMIH 1HQRB 1D9KB 2DTSA 3LEVL 5KTEL 5HXMA 1U41A 1ADQH 3I84A 3Q6GH 4OCXH 2F5BL 2GJ6D 2ENYA 3F12A 4AIZB 1FC1A 4OCLC 4M48H 1HH9B 2ZJSH 5DK2A 5C09E 1PLGH 2XTJB 4Q6YA 2P8LB 3VWJA 4F33B 1A7BA 3DO7A 5D7LE 4KI1A 2CUIA 3LN4A 1T1YA 5MEOA 3PHSA 1DANT 5DC0A 1U3YA 1T03L 1JPSL 1YPZF 1S7QA 1PG7X 3MLXL 3QEQE 4R7DA 4JEGB 5FM8A 2FX8H 5HTSA 4MA1C 1MJJA 5EO1B 4NWTL 2VDQL 4NQXB 5CS7A 2DQGH 1RUKL 1M6OA 5KS9A 1ZHNB 3RWIA 2J8UF 1TETL 3K8KA 3BEVB 3UC0L 4XPBH 1TQCB 1NLBH 4K3DH 3NFNA 1KEMH 1G7MA 2OL3L 3TIDA 1DR9A 1RFDH 1NGXA 2V9TA 3NABH 2BCKA 1YQVL 4XPHH 1QSFD 5AUMA 3OKOB 4FQ1H 4LSTL 4PBVC 1FN4B 3IF1B 4K94H 3MBXH 4WGVB 2QQNL 2QKIA 3G5ZB 4YZFF 2H1PH 3WUWB 3O9WC 1JGLL 2D31B 2OR8A 5IBUB 4DCQA 3DUUA 2GTZA 3MXWH 2IFFL 4XNUH 1YJDH 3DOSA 3QIWD 3EOAB 3P4OB 5B4MC 3QUKB 1N3NA 1MAML 5FEBA 4R2GC 1JNLL 4HGMA 5MENE 1EUTA 4QRRE 1KSRA 4LCUA 4KGJA 5D1QB 4PGZA 3C2SA 3KVQA 4MA8H 5E6ID 4V1DA 1QUNA 4TUOA 5JR1L 4J23A 4DZ8A 3MNWB 4PR5A 1ND0A 4XHJD 4J4PC 1CIDA 1BAFH 3JUZA 3BP7B 5HHPA 1BECA 3RX8A 2ZKHH 5MI0C 3QIBB 5BXFB 1G7JA 3LKNA 1GGIL 2DM3A 3RWJB 1NGXB 2XQYK 3O3DB 4PJ9C 2OP4L 3MV8E 5EC2A 3HZMB 1I4FA 3CK0L 4OLVL 4NQXA 5A2FA 2VWEE 3FZUD 4TUJA 5E5RB 4G5ZL 5GGUB 1WAAF 2XWTB 2EH7H 5MHSE 5E03A 3HE6A 1X7QA 3WEXA 4K07A 1UJ3A 3ROLA 2OYPA 2DIBA 1VACA 1MI5A 4FZEH 3E8UL 5F7WC 4BELD 1N2RB 1CF8H 4ODXB 1INEL 1EFXB 4Y4KA 4OQ1A 4Y89A 4PGCB 3SDCA 4DK3A 2BY3A 4O2CB 2YBRB 3AU1A 1MI5D 4POUB 5F1IB 4OGYH 3NCJL 5BS0B 1FLRL 2EDRA 2W60B 5CJXA 1MCJA 3BWAA 4P23C 4JG1H 3MJ9H 1UM5H 5JDSA 5LBSL 4OZFG 4NUJB 4DZ8B 1PX4A 3C6SB 2Y72A 1WWCA 5T33L 4PRDB 2P43B 3CJJA 3QXAB 4KJWD 4OCXL 2Q7NA 4LEXH 3GMMB 2VN7A 4R90L 1I1RA 1PY9A 3IDIB 4RMWA 3V7AG 4L3EB 5EDXA 3RL2B 1MJUL 3WFCL 5IIEA 5CP3H 4RMQA 4F9LC 4LEXL 1NC2A 4Q0XH 4ZO6A 1NL0H 3N1MC 3GRWA 3QUXD 1J0ZA 1MI5E 4HWNA 1DE4A 4RFEB 2R0ZL 5CEZE 2ZCLH 1KNOB 1Y6NR 2OR9H 3KXFB 3W9DB 1MVUB 3QI9C 3VCLB 3BE1H 4YXKL 1G9ML 1V7NL 3O2DL 3TBSB 1IGTA 3I02B 1WCBB 4KMQA 2E6PA 2PTUA 5JIKA 4FMKA 5D71H 5E9DA 5J11C 2FX9L 4HBCH 4XC1H 2HA1A 5ANMB 5KSVA 1YMME 5JXEA 5SWSD 1KACB 4LLYA 2CUHA 3MNVA 4JPVL 1N5YL 4WEBL 3HCVB 2ADFH 1RIHH 3AXLA 3QXWA 3TCLA 3C6LC 5IWLC 3U6RA 1PAMA 3GKZA 4L8BB 4Z6AT 2C3VB 3UO1L 4CU7A 4D0DB 2DMCA 3IJHB 3IJYB 2FEDC 1LEGB 1ZHLB 4B50A 1LK2B 1MCRA 3N85H 4LMQE 1DZBA 2VDMH 3Q1SH 4R4ND 5JDJA 4GRLD 1QLFA 5IW3A 4NHUB 3L3KA 4XP6H 5DK3A 3FFDA 1G7QA 4PRIB 4KROD 4LRNL 2JJSA 3MRIB 4L5FL 3E1F1 1DSFL 4U6YA 1OQOA 3UTTB 5KZCB 1LD9A 2GSGB 1VERA 4PJEE 1AHWC 5LGHL 5CWSA 3F58H 4LSQH 3RAJH 5T3ZH 4AY0A 2ZG2A 4P0DA 3P77A 3DROB 3VFRA 4ZUTA 3O11B 3INUH 1QRKA 5I30H 5E6IB 4PTUA 5C3TA 2Z93B 5IV2B 1F4AA 4LHUB 2JJTC 3V6OE 2OL3B 5CILL 4XWOC 3OKEA 3SPVB 5DJCA 2I07A 1IAIM 5AAWA 1F58H 2W0LA 3T77A 2YMXH 3T0AA 3S88L 2ATKB 4DGVH 1EZVX 4Y16D 1N6QL 2OTUB 1C5DA 2N4IA 3MV7B 1F3DJ 4XNXL 3SO3B 5ICZB 4R7DB 1KFAL 5CHNA 1HWGB 2VLMD 4L1DA 2HFGL 3G08B 3TV3L 2RQ8A 1KB9J 3L7FA 1KIQA 2OTUA 4K3JH 1QVOA 3HZYB 5C09A 2BXZA 2X2YA 4ONFH 3WD5L 1OSZB 4MAYD 4TSBL 4OFIA 4RBPK 1FGVL 4F7EB 3NGBB 1S5IL 1QFUH 3DV4B 2H2PC 4HKJB 1INEH 3KPQA 3IXAB 3N9GH 1I8LC 2B4CC 2QADC 2UWEF 1OPGH 4HIIA 4U1MB 1LO0H 3NZ8A 4WI6A 1BZ7A 1I9RH 3BVNA 1OAKL 3SE4A 3SOBL 3IS1X 1Z9OA 5EU6E 3WIHA 1TPXC 2R2CA 1HILA 1AXSA 2MQCA 3VGFA 43CAB 3ILQD 5HDBF 1JN6A 5HI3C 3TESA 3V4VH 5DWUL 4IDJH 1DDHA 1TVHA 1HHGA 3R8QA 2HTLD 4P46D 2AK4B 3D0LA 3C08H 3BRDA 3CPLA 1AXTL 4P5TC 1WK0A 1BVLB 3QUZB 3SDYH 1JZ5A 3AREB 3IDUA 3UXFA 3VG9B 1MJUH 1R3KA 2XNAA 4ZYKA 1MF2H 3GSOB 1VACB 2APFA 5C2BH 4OM0H 1WZKA 1GGYA 1BBDL 2Z0BA 2DQHL 5JHDD 3NIFE 5F96L 1NAMH 3JSSA 2VZ3A 2JLLA 5D7IA 2ZOLB 2OR9L 4H0GA 1FO0A 4NRYA 5EU4B 3RWGA 3UJTH 5K9OB 4GKSB 2A83B 1I7TB 5IB4A 1WT5A 2IPTL 2NX5E 2APWA 4IIQA 4UDTB 1L4IA 1BF8A 4M7LT 2MCG1 4Y8DC 5FUZL 3CMOL 2PW1A 1GGTA 4R97B 3DLQR 5TFSH 3KPRA 3KAAA 4XC1L 4I1NB 2EC9U 5C09B 4Z76B 2VDLH 4NCC2 5DDHB 4L4TD 2BVUA 4OD2A 3TA3A 4AEHH 3DMMC 4RNRA 1A7RH 5E99H 4YHOH 2XOTA 1RIVH 5I15L 4QWWC 3F7YA 4Y5YB 1NFDA 2PYFB 2EZ0C 4XRCB 4CN6A 4OLWL 5EFIA 5D1ZD 1B4RA 1KJVA 3WKNA 5CJQL 1AGFA 2O5YH 4UNUA 4ORZC 3GSXA 1IAOA 2JJUA 1SQ2N 1SEBA 3EDKA 4Z7VB 3FJTA 3QEUA 4ZFOL 2Y7QA 1N59A 1TENA 2D9QB 5DUPH 1VEOA 3WN5C 3DECA 4JFDE 1MIEH 2DI9A 3HR6A 1ZHNA 2HFGH 4HT1H 2NY3D 1EEZA 4U1GC 1EV2E 3KXFA 3VMPA 2BVQB 3I6LD 4XTRC 4S10A 1T2XA 2VDKL 4WJ5A 3NZHH 5D2LE 1CG9A 1HOCB 1NFIB 4PRBA 1IKNA 2YWZA 4JG0H 4EI6B 1XIWA 4G80B 4N5ED 3PNWB 3WXVL 2PCPB 3MUHL 4E41D 2ATPA 1Q0XH 1ZHBA 1G9EA 4XI5C 4Z77A 3G9VA 4HJJH 1QBLH 4YUEH 1IQDA 1ITCA 3U6RB 1QEWB 1LE9B 4LFHD 4JFDD 2H32H 2I9TB 3A6BH 4MJ2A 1JHTA 4YE4L 3CIQA 3BDXA 5DJZA 5B38G 2DJUA 2BERA 2H3NA 5INDB 3O9WD 3MRMA 3OR6A 4R6UA 3RX7A 4KK8C 1KN2L 3BPOB 4TSCH 1W8NA 5HJ3B 3VD7A 3OKEB 3MBED 3MSPA 3S4SG 4ORGB 4ZUVB 2GITA 3RY6A 1BBJA 1SBSH 3QUXA 3WHE1 4G6ML 3U0PA 5CINH 1MCEA 3T2NL 4WHTA 3SO5A 1LK3H 3O81A 4TTDC 2WANA 5DURB 3VFGL 3K2UH 2BHUA 2Y7QB 5FGBC 2YPLD 4M7ZB 3RL1A 5CGYD 1EGJL 1F4YL 2UV3A 4LLVA 4TNVF 4LLUA 3NCCB 3RWIB 1L0QA 1XGTB 4GUPA 4IHOA 3BSZH 4NQDB 4PG9A 2BVOA 4AEIH 3KNBA 4M9OA 1GSMA 3QHFL 4WFFE 5DS8A 4KKBC 1CU4L 2DQHH 2VITA 1I8IA 3QDJB 1N5AA 2AJ3A 3NH7H 2GAZB 4XMKL 2Q76A 1DQML 1S7SB 2QTEA 3V2AR 3C2AH 1ZHBB 4KJQC 3IVKB 4M00A 1I8MB 3F65A 2CK0H 2VITB 5C0AB 3LDBC 2PCPA 1F02I 5ETUA 5I1EL 3L3KB 4DCQB 1BLNA 2DBJA 4LLQA 5HHME 5D72L 3NFPB 1JTPA 3GMRA 3OKMB 3HI5H 3C5ZB 3PHQB 5FYLL 2YKLL 4JFHE 4H88L 5GJTL 3HTLX 5I1DA 1EJOH 3NPSC 2CUMA 3NCJH 1S7WB 4I2XB 4WIQA 1H8SA 3JZ7A 3W0WD 1DQDH 4HUNB 1F4HA 2VQ1B 3CCHB 1S9XA 5MHSD 5TE4H 3SEPA 5I6XB 5KBNC 1EVTC 4GSDH 2XTJE 1F4WL 4RGNB 4FFVC 1RZJC 2EDNA 3RIFK 1FE8L 4LCCC 4FFYH 2APTA 2BNQB 2P4AB 4JJ5B 3TA3D 5SX4H 5F72S 1G0YR 1HHHA 7CGTA 1LEKB 5C71A 2LAAA 4TNWF 4TRPL 2R1YB 3AREA 4NGHH 2ZOKB 2O5YL 3KPRD 2NY0D 1PBYA 1OHQA 2KZWA 3QUZA 2VN4A 3BGFB 3GZKA 4XCCL 5IHZA 4YBLB 4AIXA 4BFBD 4GMSH 4X4YB 5SWQA 2V2TB 2V17L 2FRGP 1P4LA 2IAMD 3ZSSA 4TN9A 2Y07L 3Q48A 5FOJA 2NY5C 4X98A 3MC0A 5IHUL 4FQQA 4K71C 5CUSH 3VWKC 2OTPA 5CEXA 2O61A 1A6ZA 5TDOB 4HS6A 2ID5A 4ETQA 3MRBA 2MTPA 5FA4A 2AQ1A 1N5AB 3OZ9L 2FGWH 3B43A 2J88H 2NY6D 1G9MH 4PJ9B 4WI4A 4BH7B 1IQWL 5DS8B 1PJ9A 3FB8B 1AGEA 2XZZA 4N9OB 1MCIA 3RUGA 4ODTH 5JLZB 4PRNB 2FEEL 1A7NL 4FQCH 3S5LA 3ILPA 2B4CH 2GAZA 3TO4B 4UZGA 4FFZL 3OAYH 4MDIA 2CLVB 3QUML 5A2IH 5CJOH 4Z7VE 3NA4A 1FZOB 1OB1A 4U7KA 4QHMB 5K59E 1G1YA 4GRWB 4PRHE 5K59F 4RMRA 3ZKXC 4HKXA 3OHXB 4J6RL 4TVPD 4UV4H 4WEUD 1BZ9A 1KT2A 5MEPA 1CFNA 3PWUA 1VADA 4XNYH 2VQ1A 5SWSE 1P5VA 5F88A 5JHDB 5E9DD 3WL9B 5KS9F 1IZJA 3U79A 5HVGB 3OV6A 4KV5F 2HJFA 3LKSB 5D93B 4M7ZC 4QCIB 1U8JA 2VQUA 2FEDD 1A4KA 2W9DH 4ZUTB 4X6BA 4HKBA 2A77L 5C6TH 1A6TA 4PS4L 4KTYA 1K4DB 2FO4B 5AZEH 2DYPD 1OAQH 1HINH 4X6CB 1JRHL 2XZCL 3T0BA 4MNGE 1U2CA 4MJ6A 5DQJB 4J12A 3TNNB 3QFJD 3HZVA 4XVTH 5LG1A 5DQ9A 5I30L 4R97C 4F7TA 4FQ2H 3DGCR 5EOCJ 5FYJL 4GS7B 5T3XD 4NC2B 3LAFA 3MLZL 4NKDB 2C3GA 1Q9WB 1LO3H 1CWVA 5L0QB 3IAGC 3JWDL 1IGCL 1SJXA 5EUOB 4LSPH 1NGQL 1T4KA 1H8NA 4D9QD 4NP4H 5MEPB 2R0LL 3QDAA 3VFPA 1P9MA 2PW2B 3WHXB 1EEYB 4ODXA 2P5EB 3EFDL 1AD0A 4D0BB 2YSSA 1QSFA 4ENED 4UT7L 1E27B 2GJZA 5C0AD 1FH5L 3QXDB 1QKZH 1U95B 3ULVH 3QIWB 4OZIA 3C6LA 1U42A 4LHJB 3FCTB 4DVBB 4B0MM 1A1OB 3MUY1 5DR5H 1WBXB 4PLKC 4WU5A 1CXFA 1QBBA 1I85A 5FHAH 3IFNL 1VGEH 5EU6B 1T89A 3MLRH 4M5YH 2DD8L 3MREB 2QV2A 4R2GB 4MDJB 4U1SA 5C0BE 4LP4A 1M7XA 5T3XE 3B83A 1AQKH 3BZ4A 2DMKA 1M71A 1VPOH 2R29H 1LO0L 35C8L 2D4DA 1MHEB 3OAUL 1NCUA 3JVGA 5TQ0L 4MA7H 4PV9B 3W9DA 3T4YA 3X12A 1JF1B 4IRJB 1FCCA 4KRPC 2Y07H 4XAWH 4LU5H 4YEEA 1SY6H 1GHFL 1Q0YH 2XKSA 3KG5A 4G3YH 3QXVA 5EU3A 4KZEH 3DX6B 1QPPA 3RIFF 4Y2DB 1PVHA 4PJ8B 3WFDH 2JB5L 1FCGA 2QSCL 3B9DA 1CG9B 1HOCA 4PRBB 4CVZA 3CLFH 4BSVA 5D93C 1DUZA 1CLYL 43C9B 2NYYD 1KTLA 3QJFA 1NCTA 3FT2A 1MCSA 1H5BB 4NZDA 1FYTA 2VSCA 3M07A 5ESVB 3P4NB 5D1QD 3X17A 2F19H 5GGSB 2CO7B 4IHOB 3S37L 3AMKA 2JCCE 3LD8B 3IF1A 4WNQA 1FZJB 2VIRA 4EKXA 4WUUE 1NAML 3IU4L 3UJIL 4D9LH 3P9MA 3BO8A 1DEDA 5T1MA 4P2QD 2DQDL 4WI5A 1GPOH 1YN6B 2WV3A 3QZWB 4TPRL 2HMIC 1RULL 4YHKH 4HFWB 4XHJC 5DRZA 4HLZH 5E6IC 4N5UA 4UUJA 3A6OA 2Z8VC 4QNPF 4K23H 5EBMA 5T5NF 3MBXL 4XAKE 4K3DL 1RUAH 4X4YA 5B3JE 2R23A 1TZIA 2BNRA 4ZFGH 3NFSH 4OV5A 1XAUA 1RUMH 2P5WE 1RMFL 2ZPKL 1LVEA 1UH3A 1KG0B 1TETH 5AZEL 4PJDA 2D03L 3FQXB 1HSBA 4IMKA 3GGWA 4QHUA 4X4XA 1WFTA 3GJFB 3SCMC 3ULUD 4P5TA 5CZXD 2R1XA 5GGTA 2ICCA 4F37K 1D5ZA 1A6UL 1NUFA 4O2FB 4I77L 2VH5L 4GKSA 4EBQL 3F7RA 3MRJB 2DQTL 4NQSA 4NRXB 2WUBL 1U8OB 3P73B 1IEBB 1I1AD 5HHNB 4WUUA 3QUYA 3BH9A 4NQEA 3J7HA 3KDMB 4JY6B 2ZNWA 2Z8WC 3KPQB 3ZDYF 2HT2C 5JORA 1J9CT 3RJQB 4NQTA 4F3FB 1C8PA 4S0TD 2X4TB 3CFCL 1PGRB 4M61B 4HXAL 4PJCE 5T1KB 5C3LD 3IT8D 5ERWA 1XCQB 3NZHL 1S7UB 2OMBA 2UWEB 4YK4B 2H8PA 3G5ZA 2AJYL 3DX7B 5D6DC 4KK5D 3SKJL 1EBPA 4Y19A 1QLEH 4JN2A 1MJ7H 3UTTD 5F7EH 3P30L 2J2ZA 1IQDB 3WFEL 3KGRA 2HJKA 4JM2A 5C9KA 1JWUB 1DBML 5HYJA 1TTUA 3O2WH 4HIIB 4U1MA 1X5FA 3BKCH 1QLEL 3G6DH 4HPYL 1HN1A 1G9MC 2RAMA 3IFPA 1BMGA 3D6GA 3IKKA 3MLTA 1AKJA 4WVRA 3U4BH 4CMMB 4NZRL 4J3WA 1DBMH 4XBEL 3QDGE 5IVXF 3KYNB 1UWXH 2VC2L 5FF6A 3O3EB 4I13B 5E1HB 1NBVL 1MCOH 2Z91B 2QQLL 1R6VA 3WD5H 3FO0H 5EU7C 3LKPB 1V3LA 3L1OL 4OZGE 1A6ZB 3CC5B 5IMOA 5KN5A 1DEEA 2V5TA 3CFEB 3DTXA 2XFXA 3W2DH 3S4SB 3O6ML 4X6CA 1OP3K 1OD9A 2WWKO 3H0TB 5DD3L 1X5XA 3RDTB 5I1HH 4D8PB 2BHZA 1A3RL 4UOW0 5D7LB 1OCWH 5DC4B 3IJYA 1P1ZB 1MFDH 1BEYH 2C4XA 5F1IA 1A47A 1H9VA 4Z95L 1NGWB 3WO4C 2R0ZH 4MA3A 4RFOH 1AJ7L 4H1LH 3SDDD 3KLDA 5DD0L 4MNGA 1RSFA 4JM4L 1K6QH 1HWHB 4XRCA 4TUKH 1ED3B 1P2CA 2I5YL 5IUSA 3PV7A 4OZIB 2ZCLL 3FQTA 5CGYC 5F1KC 5GRVL 3P9LA 2VLLA 2ZZUT 1EO7A 3Q5OA 2AERT 2VKXA 3ULUL 4ELMB 3IDXL 4U1JB 1YMMB 1ZT7A 2VDML 1HE7A 3CCHA 3ARED 1WV7T 2RHEA 3KWWA 5A16B 4FTVA 2YD2A 3D3VE 4PRPD 4QY8A 1W0WA 3MV7E 2HVJA 4FQLL 4XC3H 3T0DA 4JFOA 5F1NA 2DL2A 4NM8H 3ZMRA 4MLSA 3DBXA 1B6DA 5GS2H 3D85D 4Z7VA 4CVXA 4CN4A 3MA7A 4HS6B 3QPQD 1I1CA 2C3VA 4YC2C 1NCCH 4PJFA 4JQXC 5ESQA 3HLAB 3RPKA 1U3ZA 4XPBL 1UZ8B 1UG9A 3VXSD 1NLDH 3D2UA 3NACL 4BFIB 3SDCB 4U7MA 2R1WA 5IROA 4LL9A 3LQAC 5E9DB 3F6IA 4NUGH 1IC7H 5FYKD 1AY1H 1MFBL 1L6XA 4NJ9L 3WIIH 3QDGA 1MHCA 4M6OL 1ZT4A 5LGHH 3QCVL 5C0RL 2OZ4L 2E5EA 2IQ9H 1EX0A 3FONA 4GAGL 1MUJA 1QYGH 2MJWA 3QUMA 3K1DA 3VXMB 4DAGH 3D39A 5DRXB 1A9BB 4KZDH 1MRFH 3D0VB 4BUHA 3CLEL 5DHVA 1NJ9A 5DJAA 5EO0A 3R0NA 4XWGH 4UINL 3Q3GA 2BHYA 5C0IA 4XPFH 1A0QH 1EJ6A 3R8BB 1QEWA 4HJ0C 1LE9A 3BKJL 2VXSL 5KOVC 3GJFK 5GRXG 4UQ2A 3BI9X 3HNSH 5KOMC 1MREH 4NPYB 2EYSA 1N4XH 4PJ9D 1TMCB 4LCYA 4EI5A 2AEQL 2VL5A 5D6CA 1PYWB 3O3AA 3OPZL 3SOBH 4PBWD 5IBLD 3BXNA 4M8QB 3T2OA 1SVZA 3BQUB 5DRNA 1NKOA 5A3IC 4FQXC 1MJ8H 3MLVL 3D48R 2ZNXA 1BQLH 2VL5B 1RUQL 3UTZA 3AREC 2GK0B 5GZOC 4NQSB 4NRXA 4C83B 3J8F7 2RB8A 4GBXD 3MV11 5DJ8A 1JGEB 1EO5A 4LLVB 4QLRA 5KJRL 5DWUH 2HT3D 2IQAB 4U1LA 3MGOB 4PJBB 5J6GA 4FXKA 2YA2A 3O9WB 2A74A 3REVA 3BP4B 4MGXA 3TNMB 2XTJD 5DD3H 1FAIL 4MX7B 4BQ6A 4HDIA 3L3HB 2BNRE 2VYRE 1MRDL 3OKNB 1IRAY 2I24N 3D39B 3FOLB 2XICA 4P99A 2PXYB 4WI7A 2GEEA 1A6VL 3MMEA 2Z31D 4X4ZA 3T2QA 1G1CA 2FD6L 3CSYB 4H8WC 3QUKA 1OTTC 4KH2A 3IETB 4H5SB 4GH7B 2DL9A 1NBQA 3ROOB 3ARUA 3QFJE 3BH8A 5SWZB 2B7DT 4X6EB 2AXFB 3VGAC 2WUCL 2GCYA 3SJVE 4X7FC 3SKUD 4E41B 2E27L 1I7ZA 1QKZL 2WM0A 3SJVB 4XHQA 3VJ6A 4N0CC 2OL3A 2VXQL 1J1OH 1YMMD 3ALXA 3V6FA 4DQOL 5DK2B 3EYQC 4OCYL 4LHUG 5I18H 2OXGA 3LCYA 2APVA 2BJMH 2BNRD 4M7JL 1OL0A 4AL8H 1UXWB 2E7CA 2HLFC 4H8WH 5TPWH 1A21A 3LHPH 4LCWA 4GLRH 5BZDA 1DBJH 4F7MA 5HGBA 4AMKH 5EO9A 4NQUA 1UM5L 1RJLB 4K9EH 5E08H 5IHZB 3TBYB 3HI6L 1Y0LA 3TO2B 3PXHA 3OF6A 1KCVL 4M1CD 4NQVA 3RX5A 4PRPA 3OJVC 3VW3L 1NGWA 4MXVE 4P2QA 2R8SH 1UQSA 3CLEH 3DMMB 2Y5TA 4JRXB 5BJTA 4R0LC 2EE6A 4Y16A 1M7DB 2XRAH 5D7SH 5ID1A 4PLJD 5TQ2H 6FABL 4BJLA 5DEZA 2AJXL 4YHIB 2APBA 4M6OH 5C0RH 4PFEA 3BKJH 2F54A 2OQJB 4LSQL 4Q58C 5BO1L 3RAJL 2E7LC 5F6IC 1IT9H 2DDQL 2FL5A 1C1EH 3MJ9A 4PY7A 2R4SL 2DTMH 1ORQB 3FFCA 5FYLD 3KPNB 4RISH 5M7QA 2CRMA 3PHOA 2P5EA 1J5OH 4U0RB 1OOAA 2ITCB 5IMLA 1FIGH 5GS0L 5JIHA 4FTVB 1SEQL 2R56L 3VD4A 1OAUH 2PXYD 4HF5L 2HFTA 1DUYB 1MHPL 5E8PB 3SKOB 2BC4B 3KYAA 4RRPG 3LKPA 3W0WE 3O4OC 3C5ZD 5EC1A 4Z0BL 4D0CB 3U4EB 5I66A 1ZAGA 1TQBB 5I1GL 1N4XL 1RK1B 1S3KL 4JGMA 2CKBL 5CJXC 1HHIB 1UXSB 4NBZB 4ONHB 4Q74A 1JI2A 5E0QA 5CSZA 4EN3C 1K8DB 1U3JA 3BZFA 4HUWB 4IOFD 4XP1H 3KPRE 2OZ4A 2ED8A 5IVXA 5BV7H 4W4OC 3BRGC 4GW1B 3K2UL 1QLRB 4KJPD 2PO6A 3MCLH 4O02L 4PJHE 1IKFL 5ECJE 5ADPL 2EXYC 3GI9L 4GJTB 4A6YH 3EYUH 4Z18A 2Z9TA 3NIGE 5D1XC 1WFOA 3DYOA 3WIHL 1T6VN 4WCYH 2KDGA 4AIOA 5DMKB 4OIIH 1XCTA 4LIQL 2X7LB 1Q8MA 5FK9B 5J1TC 1FV1A 1FL5A 4OZHF 2DLEA 3ARXA 3T65B 1X5HA 3U9PH 1S7VA 2A38A 4LLWA 3EOTL 3SCMB 5I19H 3W9EB 1G9NH 2LU7A 3UTTA 1JPGB 3QQ9D 5ITFB 3QI9D 3UBXB 3QI9A 2NY0C 2I9TA 1J0JA 5IEKB 3IJSA 1I1AB 3U36A 5ITBL 1ZLUK 1B90A 2FB4H 4HWBL 3CZJA 3HI5L 4NQDA 3RVUD 5GGRY 3OJDA 5F7DA 3MNZA 1FJ1A 4Z0XB 5HPMA 1RZKH 1R3HA 5L6YH 1W72A 4CAGA 5I1JL 4U3XA 3TN0A 1JZ2A 4ZDHA 3MLYL 5I71C 1DLFL 3B9KB 3HAEA 1I7RB 1M1SA 3QUYD 3EHBC 1G7HA 3ULUC 1SVCP 1CDJA 5JPMB 2W59A 5I74B 5ICZA 4PV8B 4NOBA 2VB5A 2CIKA 3UTTE 1AHWB 2X4RB 3Q0HA 1D5MA 2K3TA 3BP5B 2MFNA 2JCCB 1OGTB 1SMAA 4MS8D 4A6YB 1CICB 2FIRT 1CDIA 1CFVH 4RDQF 4PJ7B 1JGUL 2B5IB 3MUJA 3O3BA 3EJYD 3CXDL 4OLWH 1NMCB 4UIMB 3IDNA 4YXHH 3KHQA 5F1OB 4D8PA 1TNMA 2ERJB 3QDJD 2A73A 2AJXH 2ZCHL 4GG6F 4HFWA 3JV6B 2P5ED 2Q6WA 4YBHA 5F21B 4O4YL 2F58L 5LXGH 4XCCH 2DKSA 3VFOA 1QA9A 2PYEB 4RA0C 1O7VA 3VMOA 1YEIH 5BCAA 4LNRA 2AV7A 3HMXH 4MXWH 4Y5XA 4ZXBC 5HHXL 5IVXE 5KSAC 5FA3B 3TIEB 3W82A 4RISL 3E6HA 3R1GL 4GG6A 1Q38A 5T33H 4NKIL 3STLB 5L2KA 1VGKB 1UWEL 4WHYH 5TQ2L 4F8TA 6FABH 2XPGB 4TTDD 5J11B 3I50H 3MJ6A 4S2SA 5E24E 5HHXH 2B1AL 5D6DA 4OZ4A 4TUKL 1GGUA 5HYFA 4FP8L 4OF0A 1OY3B 4FG6C 4GW5A 4X9BA 5T1LD 1S7RB 4JFXB 1OARH 1IGMH 2B1HL 2WIMA 3O4LA 3PDOB 4LF3A 2YUWA 1K4CB 1W2KT 3FB8A 4WW2C 1K8IB 2P5EE 1XGRA 4NNXA 4LK4A 3P4MA 1DBKH 4WI9A 2CDGA 1A4JB 1T0MB 3RZCB 3C60C 4LSDA 5DFVC 3T08A 5GISH 3SHSA 2F9BT 3ZKMC 5CJOL 1I8LA 4FQJL 5I1CL 1XF5B 1K2DB 3DX8B 5I1IH 1W0VB 1S3KH 3S5LG 1D6EA 3TCXA 1BPVA 1F6LL 3NIDE 5DHYB 4NC0B 2IH3B 5K33A 2XQYG 1JGVL 1U58A 4JFED 1KJMA 4QHKJ 3GUTB 3D87B 3WDHA 5DF0A 4P2QB 3UTPE 1KJ3L 1QSVA 1T66C 3QNXA 2ICES 1LEKA 5JIIA 4LGRB 4P23B 4MQXD 4O58H 4TUOB 3ZKSD 4D3CL 1RMFH 1IBGL 1BD2E 5EBWA 1MLCA 3T0XA 4GRWH 3GUTA 4ODWB 1LK3L 1V3MA 3IRZA 3RY5A 4K7PH 5J12B 1CE6A 4GXUN 4WFGD 4X6DB 4L4TE 5HDOA 4KI5F 4IS6B 2NTFB 1FNEB 3MRRA 1YYMH 1Q94B 3PGCB 4DVRH 4QHLA 1A1NB 3CDFA 4NRZB 4JDZB 4HW6A 2R69L 4XP4L 5FYJH 1MSPA 4U33A 2B39A 5CSGA 4F15C 4UQ2B 1CD1A 4XH2A 1K4CA 1U8KA 5JA8B 1DBBH 4HAGA 4XVJL 4JDZA 4JFXA 1I9EA 4OZGB 2IPKA 3P11H 3VRIB 4U6HB 4OLVH 3HC3H 3GSNL 3HB3C 2MKWA 1YZZA 5GRUH 3QFJA 4DZBB 5J6HA 1MREL 4K8RH 2NY5H 3OAUH 1PKQA 5EUKB 4JM2D 3TYFA 4GUPB 4HIHA 3DV6A 5C86A 3WJJC 1KENL 1FVDB 4J8RA 5FB8B 3I2CH 4XMLH 1EAPB 2AP2A 2Q8BH 3L5XL 4HJGA 2D7OA 4HUUB 1A7QL 5B8CA 3S5LB 3I6LE 5FO8B 1H3PL 2ICWI 2LTQB 3QO1A 3X11B 4HHAA 3OXRA 2C3HA 3V0VA 5D1XB 1LQSR 1QRNE 1FNAA 3DUSA 3AFLA 3JWOL 4BFIA 1YEFL 1M05B 1WICA 2Z92B 5F6HJ 4G6FB 2PYED 2YRLA 4YLQT 5ABDE 2EDJA 4N90D 4DKDC 1NCBL 3EZJB 4O00A 3QDMB 1H3XA 3ZT6A 3L95A 3GMPB 5E8EB 4XNMA 4ELMF 5LCVH 5GRVK 1RZJH 5IOPA 2L0DA 5MEQA 1AGBA 4PTTB 2H32A 2DQCH 4MAUL 3T0ED 1IE5A 3QJHA 4YHML 2HTLC 3MV7A 1OW0C 3RKDC 2F19L 4RQQB 1RHFA 4M1DL 4NQCE 4ZDHB 2DQEL 2BMKA 4N0FA 1A2YA 4JZOA 2XWTA 2F74A 2C26A 4YHMH 4HCRA 7FABL 3MRHB 1RJZB 5CGTA 5DUML 3B9KC 1IGML 4RBPH 2XACC 5CEZH 2QADD 2P7TB 1S9KC 5TE7H 4AENA 3MV8B 5D7IE 2AGJH 4HBCL 5TGBA 1BZQK 2FX8L 4ERSL 5DA0B 1I1YB 2BX5A 3FT4A 4DGIL 1D5BB 4KROB 3UJTL 5DFVD 1MEXH 3D25A 5E2WH 4J1UB 4OQTL 1Q9OA 2P8PA 2JELH 5TH2B 2X4UA 3QULA 2H32B 3MRDA 3IDGA 4LPUA 4KHXL 5LQBL 3DO3A 4ZPVB 2XZAL 2X1XR 1BOGA 4Z7NF 4KDTA 4LCWD 5IF0A 4RWYL 4M6AA 4DFHA 1YDPB 3BPNB 1R5WA 4NM8L 4OLZL 4PJ8C 5EU6A 4I2XE 3RVWC 1M05A 1C08A 3LQZB 4Z7WB 5LQBH 1YUHB 3SDCC 1CVRA 3S8WA 4MYWB 2CDEB 5BMFH 5H94B 4NNXB 1CXLA 4LSTH 2MMXA 3STBA 5HHMB 5LJYH 2BNQE 5FYJU 1UA6L 3HRZA 5MERA 3D3VA 4YDJB 4RAVB 3FRPG 3HA0A 3WNOA 3L3GB 3PWPB 4LLUB 1CYGA 4V2CB 2DKUA 1LO3L 1IC7L 1QFWM 1EPFA 5IW1A 2VXVH 4EVNB 5HYJE 1IAIL 3B5GA 5BZDB 1QNZH 2Z8RA 1V7ML 3DX9A 2VXUL 3HKFA 4G8GE 3QEHA 2BY2A 4UOW1 1OAUL 3OGOE 3B8SA 1R3LB 4P4KB 4NJAL 4LGSB 1X9QA 1AGEB 4HS8L 5DEGB 2PETA 2OMNA 1N64L 4YFEA 5L0QC 5EZLB 2OX5A 4HXBL 1A1MA 2IALA 2EYTB 2MCPH 5C0CB 4HQQH 3P0YH 2VC2H 3UEZA 3VA2C 2NXZB 1GVIA 3U48A 1Q94A 4RIRB 4GBXA 2R29L 3OJMB 4ZO8A 5IB5B 5IKCB 1QSFB 4L3CA 1F6AB 2W0FA 2ERJC 1C16A 1C5BH 4NKOA 3WO4B 1AXTH 1JL8A 3T1WA 5CZKA 1KB5A 2WWMC 5D8JH 1TIUA 3V6ZA 3U9UB 2B5IC 3IFLH 3RWFB 1DLHB 4RFOL 2F5BH 5FO7A 2IBZX 4L3CB 4JREC 4FG6D 4J3OC 1QRNA 4ZODA 4RFNB 4UQ3B 5GGRA 1K6QL 2BZDA 5DYOA 1CT8A 3B8YA 5CJ8A 4LNVA 2QLVB 3LN5B 4I48A 2E9IA 3AS0A 4PRHD 2G5BA 1CD9B 4MD4B 5B22A 4APQA 2NW3A 4Z7OF 1TJIH 2P5WA 1M7IB 5DD0H 5F6HI 3PGDB 1ES0A 1HSAA 3IU3A 1PZ5B 2R2HA 2NY3B 5C08B 4YHNB 5E5MB 5IMKA 3ZKXB 3BD3A 4GW4A 5C0GB 3RVXD 4HZLB 3L7FB 4JKWA 3VD9A 5E9DE 5HHPB 3NAAL 3CZFB 3FQUB 5FM5O 3GSQA 2IBZY 4Z8FL 4JN2B 4K3EH 2CKBB 3R4DA 2WZPD 1YY8B 2NY0B 1QTYT 1SMOA 5CEZD 3CDGB 5T5FL 4JQIL 5F9JA 4PB0L 2QBWA 4YXKH 1LO5B 1N6UA 5T1KA 4FQLH 4LLDB 1S9WB 1LP9B 2UYLA 2UY6A 3MCKB 1YMHA 4L4TB 4TOYL 3NFSL 4QWWD 3C2AL 3EHBD 4U0QB 2RFXB 4NN5C 8FABA 2PXYC 5TQ0H 4P3DA 3BMVA 2W65B 4OFYA 2E6QA 1CLZH 3EAKA 5J9PA 4JR9H 2VNCA 3MBEB 5KVEL 3DNKA 3D1MC 3RVUC 2Q3ZA 1CDBA 1K85A 1IFHH 3GB7A 1UT9A 4X7DC 3T3ME 1U8IA 5DMYA 3L95B 2J8OA 3ARGB 3PWPE 4ZNEE 4NJ9H 3WMSA 4OV6F 4HGKC 3MV9D 2Q8AH 3MV9A 4XNQB 1WT5C 4Q9RH 3GMNA 4ONGL 3CH1A 5SX5H 2HH0L 3QIWC 4KKCC 4NBYB 4Q9CA 1AY1L 1GL4B 4HC1L 3FN9A 4NN5B 3EO1B 1CK0L 4G5ZH 4IMLB 5DJ6B 3GSQB 4FNLH 4AENB 3VRJA 3SGKC 1DTUA 4XX1E 3IU4H 3UJIH 4CVXB 5SWZD 3C5ZC 3SDXA 2WBJD 1FNFA 3A6CL 3DRQB 1ZVSB 3O2DA 1C12A 1EUUA 5JW4M 4KY1H 3CUPB 2OS7A 2X4OA 1DQTA 3WYRA 1AGDA 1O5DT 3FTGA 4YHPA 4BSWA 3S36L 4B7IA 1H3VA 1JK8A 3GM0A 1FAKT 4M8VA 4L4VD 5I16A 2CGRL 3T3PE 3VE0B 4HS3A 4XPAH 4UV7L 2VLKE 5D9SB 1H0DB 32C2A 1G0DA 3G6DL 3MRGB 1KEGH 1J0KA 3JVGC 5AD0B 3U0PB 3QDGB 3B9VA 3OAZH 5FYJD 5D5MF 5LGJA 1W72H 4RGOL 3H42H 3WN5A 4GAJL 3HC0B 5E8OB 4IRSA 1KULA 5HHVL 2Z31A 1P6AB 4KI5C 3HNTH 5HYJB 4IOSD 1HDMB 1T1WA 4U2YA 4BH8A 5B39B 3ZDXF 2NX5A 1HZHH 4NFDA 3FO1B 2YPLA 4AK1A 4XBGA 4DWHA 4M7LH 4RFNC 5IV2A 4PG9B 4KKCD 5BV7L 2NY4D 1LP9F 3BSZL 1OAKH 4WHDA 4XCYA 3GBML 3BUYB 1L7IL 4B5EA 3WFHB 1MFNA 3HPLB 3UDWC 4UTAH 5DD5L 5C8JA 4X4MA 2VMFA 1NUGA 4QRSA 4LASL 3TO4C 3GSNB 3O6FD 2R0WH 5CEYB 2YZ1A 1JWSB 1ZEAL 2NY1C 4WW2A 3BEWA 4OGAC 3MJ7B 2X89D 1TZGL 2FH8A 1TVBA 2DM7A 1DP0A 4WEBH 3ZYOA 4MQTB 2DS4A 1IC1A 1T20B 3KPSE 3IS0X 4YHLH 4Q9QH 4FQHB 1NGZA 4K3EL 2CRZA 3LEXB 4K71B 3MOBH 4PJ5D 4JKMA 1S9VB 3DIFA 4JFYB 1DQDL 3QUXC 5GGTL 2ZKHL 4PJAB 4EXKA 1HEZB 3QWOB 3OQ3B 4PY7B 1R5IB 1J10A 1OTTD 4GRLC 5HDQH 3LQZA 4Z7WA 1D9KA 2DM2A 3AUVA 3B6SB 4OCWL 4IMKC 4AG4H 3H9YA 1F3DH 4PJCB 3OKDB 3V9FA 3RNKB 2GTZB 4TSAL 3OR7B 3WN5B 1BQHB 3JV5A 5GS1A 1BX2A 2NLJB 1FORL 5FDYA 1IL1B 3I3BA 4AEHL 2VKWA 1VGEL 1D6VH 4HD9A 3GRWH 3E2HB 1A9EB 3CU7A 5I76A 5E08L 5GS3A 4HC1H 3K8MA 1W0WB 1VEPA 3DGGB 3W39B 4Q6IB 3O41A 4PJHA 3KPRB 1MHHA 3L7EA 4HH8A 3I6GA 4YXHL 3BRFA 1EDQA 3FQRA 3ORJA 4LVEA 1UZ6E 5BVJA 3DX8A 3H7LA 5J4MA 5IESH 5C70A 3H9SB 3WFHA 3SKMB 2XN9B 5FHBL 3O8XC 3UTSA 1N8ZA 4PRHA 1R24B 4D9RE 4HT1L 1G7PB 4ALAH 5TDPA 4K7PY 4HEME 4MJ5B 4NSKA 1JE6A 3I9GL 2A6KA 1JGDB 3L3DA 4PJDF 3TZVB 4NWTH 15C8H 1AGFB 2BOBB 3IDMA 1JYXA 1ADQA 2WWKT 4EDWH 2JKXA 4HF5H 3U2SA 4MCZB 5FGBA 3RNQB 5MENB 5H8DA 5DD6A 4PJXA 3EO0A 3PJSA 2NMSA 3L3DB 4RSVA 4P49A 4L8SA 2AW2A 2N56A 3WS6A 5ICYB 2O93L 3ZHKA 1E4XH 3CGTA 3IGAB 3IB4A 2Y06H 3MRDB 5JHDE 1J8HD 1A0QL 4XPGH 4M3JA 5LGKA 1TVDA 1CN4A 4JQVA 4U3CA 2QSVA 1JF6A 4R2GD 3HFML 4OGYL 3H6JA 3ARDA 4YHZH 5L88L 1T5XB 2B20A 1G7LA 2QQNH 2VR9A 4G8GB 4LKCB 3WLBB 2ORBL 4HLJA 3ALPA 2R9HD 2C1OB 1E4XI 1X7QB 5HHOE 5ISZA 4FHBD 3WEXB 1PKQE 1GZQB 3ARBA 2EYRA 4U1HA 1VDGA 4DVBA 2X5PA 3PG2A 3L3OB 5IK3A 1RUPL 4PJGF 2OSLB 5F9DC 1ND0B 3SDXB 4O02H 2GY5A 1TZHA 5KAQG 3VXOB 2VOTA 4OJFH 3VGEA 4J8RB 4MXQD 4EUPH 3EFFB 1BBDH 5F7FA 4KFZC 3MLPA 4A6YA 4G6KL 2BK8A 2EXWC 5JOFB 2D7TL 1XCTB 4N8PA 5DQDH 4N9GB 5J7CC 4FQ2L 1ZE3C 2X09A 4Q0XL 1JHTB 1NANH 2H41A 1KLUA 1BD2B 2P24B 1T04A 4QT5B 5JR1H 3VRIA 1QLRA 5BQ7B 4MNGB 4N90E 4QXUH 3BE1L 1T21A 5AWNH 2X1QA 3DXAE 3JWNC 2VZTA 4G7VH 1FGNL 4HK0B 1BQUA 2EIZB 2WLZA 3EOBA 2VTFA 2YHGA 1P1ZA 4QHKI 2ADGA 1NANI 1JZ4A 5IOPB 5KAQF 3O6FC 3L5JA 1CD8A 5T1DL 5GZNC 3SO3C 5F8QC 5ESAB 5DR5L 1ZS8A 5IFAL 1E4JA 1ZGLP 1UM4L 3ZDZE 1JHKL 4GS7C 1BM3L 2KKQA 1ZWIB 4HIJA 3L6FB 4ZAKA 4PJIE 3KXFE 1IGIL 1CF8L 5INCA 3VXUA 1IGJA 5HDBE 1KB5B 3MFGB 2HG5B 3MR9B 4JFDA 2VDPH 2V2WA 3ARZA 5MERB 3WCYA 3BJLA 5HYSG 2YKLH 2YD6A 1H5BC 1RK0B 1U9KA 3CVHL 4I18C 2XYCA 1NBYB 3MXVH 1ZSDB 5C07D 5FHBH 1T7XA 4YDKL 2AXJA 1YUHA 1BBJB 4N0CD 2V7HB 3S35X 4HUXA 5FOBA 4XBEH 1UZ8A 2FH6A 1LDPH 4KDWA 3I9GH 3GIZH 3MXVL 1NSNH 1NFDE 2EC8A 4NNPL 3TPUA 1CLOL 3INUL 3L1OH 1IM9B 1MWAH 4PLOB 3V6BR 2Y5EA 1V7NH 3QULB 1OF2A 3VXTB 4N1HB 4PD4K 1NSNL 3Q6GL 1PQZB 1ZHKB 4D94A 2J7LA 2DIJA 3FB5A 4N0UB 4BFGA 5LCVL 5BQ7A 3CFBA 3E0GA 5D7JC 3KLHD 4OZHB 3BN9D 4UDUA 5I73B 1T20A 4OI8A 1SYSA 1IGYB 4YBQC 5DHVH 4I3RH 4Z78A 2VZVA 2FIKA 5MI0B 1F90H 1IEHA 1LK2A 3W11C 2IAMA 4F2MB 1U3HB 1CQKA 1TCRA 5IVNA 4LVHB 5D7IF 3LV3A 3O3UN 3OB8A 4AQOA 4F58H 5KSUA 5I73C 1C5CH 4DKFH 4U6VL 1PKOA 4J4PA 1FGVH 1X4YA 3U1SH 5IW6B 2LFGA 1P69B 3VXMD 4PGBA 1KLGB 2APXA 4G8GD 1U0QA 4HGWA 3RZWA 2NY1B 5KS9E 1G0XA 4I77H 4JPIA 4M7KL 1MCWW 3FN0L 5H35B 5IB2B 1QP1A 4U1NA 5T1LA 1X5IA 4WFHD 1IARB 3CXHK 3MCLL 5E5MA 5IMKB 3L5HA 3QEQA 1QSFE 3WJLC 3GI9H 3UYPA 4L8CA 4ZPTB 5IVZA 3K4AA 1T83A 3UC0H 4LBEA 1ZLUH 3IDJA 4JFPB 1E4WL 4PJHF 4RZCB 2OL3H 3U0TA 5C6TL 2OXHA 1GC1C 1FZJA 2C7UA 1HK6A 2IQAA 2ZUVA 4PGEB 2C3XA 3P0VH 1SYVB 4QRTB 3H9SE 2VDNL 4OD3L 5E7FA 5C2BL 2IPUK 3VXME 2Q7YB 4YAQA 3V4PH 3HI1A 1WIPA 4F57L 4P46A 2R4RH 5TDNB 3SQBA 3OX8A 4BZ2H 3RFZC 3BISA 3RBSA 3KS0H 5JXAL 3FB5B 4N0UA 4A2LA 5CIPH 1MFEH 4UT6H 1UA6H 3SDAC 4MD5A 1YJDC 5SX5K 1MCFA 3RUGB 2CLRA 4X6EA 5JNYA 3DI3B 3K46A 1FIGL 5GS0H 3MV8D 4ZS7L 1OAYH 1KC5L 1BFVH 3LB6C 2IPKB 2BRRL 5ADOH 3K81A 2F53D 5JW3L 2X1OA 4Y4FD 4P59L 3CH8A 4P2RB 2HJLB 3VXRB 4C4KO 2Q3AA 5ID0A 1G6RL 1MELA 5JO5B 4DN3H 4XCNA 5FCUL 1RZKC 2H2SC 5I8KL 4OGXH 1A1NA 4P3WA 3AM8A 4Z5RB 5HGHA 3S34L 4KAQH 4HWUA 2EH8L 4R9HA 4GMSL 5I1HL 1IC4L 1BHGA 4V1DD 5HHNA 1R0AH 3RTQB 3QFDB 3QIUD 3E8UH 3WHXA 1YY9C 1K3ZA 4R0LA 5LWYH 4MNQA 2EEDA 2RBLA 1ZT4B 3H7BA 2ESVB 2B8OT 3QIWA 4JM2F 2YK1L 5HVHC 4XMPH 4ODHL 3W5NA 5F7LB 1RZGB 1RZ8A 4EIZC 3TFKD 4ODBD 5B21A 2BVEA 2NR6D 2PW2A 1JHLL 1Q0YL 4G3YL 1UKQA 5DD6B 3GMQA 1VENA 5D7KD 5GS2D 1L0XA 4BKLA 4QO1A 2GUOA 1XF4B 4OZFB 1PX3A 4YGVA 5E4EC 4XGZB 5ETUB 2R2EA 3RRQA 2EDYA 3GHEH 2H2SD 2MPAH 2VISB 4PLKD 4R96B 4HWBH 3V7MA 3KJ4B 4JO2L 3ZHLA 1RZFH 4O51B 5IT2H 3CD4A 1JPGA 3PV6B 2YPVH 1MRDH 3EDEA 1GPOL 1T7VA 4KI5D 4NFCA 2MWCA 1Y6MR 1QQDA 3ARWA 3MYJA 3HMWL 4WV1C 3TEUA 1UYWH 3UZQA 1KEML 1Z9MA 3B4NA 5HYQB 1LMKA 5L9DL 4F58L 1YQVH 4I0CC 4XPHL 5TGBB 4ERSH 2YXMA 3VXOA 5MEND 1HH6A 1XR8A 4RMVA 3ZLQC 4MQ7B 1FG9C 3OL2A 4NQEE 4P4RA 2Z35A 4AEFA 4XXDB 5AZ2H 2X1PA 4KKAC 5JXED 3TN0D 4OAWA 5F7UA 5I1AB 4JHBA 4RMUA 3WIIL 1UH2A 3EGSA 4OKVA 3MRNB 1F3JB 2R15A 2SEBA 3UPRA 4R0LB 4MA8L 5TF0A 2VERN 4XCEA 3F5WB 5HDLA 4HS3B 1UGNA 4FOMA 1RU9L 2YOCA 5DJ6A 4OLYL 3O0RL 3OTTA 1IBGH 3SBWC 1WZ1H 3A67L 4YQXH 3CVHA 3UZEA 2IGFL 4I4WA 2AEPH 5D5MA 4H25A 1NC2D 3OBAA 5EBLB 5BZWB 1NDMA 3TJHD 4E5XA 3ULVL 3BH8B 1KB9K 1WZ1L 1IAMA 2AK4D 4JPIB 4PUBH 2HKHH 3DHMA 4DVRL 3ZHDA 3UYRH 4YNYB 2DWDA 2V2WB 4FZEL 3UYOD 4U49A 3BPCB 3JBG7 3MLWH 4BK4A 1LHZA 3DYPA 2Z8SA 4FFWD 4P4KC 1Q0XL 2P8MB 6CGTA 3S34H 4Y4FB 4M4PA 1AIFA 1E6JL 2NNAB 4M5ZL 1KXTB 3BD4A 3VG9C 4Y4KD 2WP3T 1AI1H 5J1AA 5LWYL 3AY4C 1NEZG 2F74B 4GQPH 3ULSB 5IMMA 4YE4H 5BOPA 4I8DA 1Z9LA 4M5ZH 1CGYA 1HI6B 2K9UA 2EKSB 4FN0A 3OXSA 3CLFL 1T5WA 3KYMB 1EVUA 2RGSA 3LH2H 4JGUA 4KHTH 4AJ0A 1OP9A 4JRWA 4PJ7A 3L5IA 1XGPB 3RWDB 2Z35B 1FG2A 1OF2B 3VXTA 1RUPH 5D70H 2X40A 3G6AA 5H37H 5JORB 4KKBD 1UJTA 5CJBA 2AJ3B 2CRIA 2B0SL 2ITDB 3T8XB 5IJVA 5C0ND 3FO2A 2QQLH 2FHFA 3QH3B 4OCRH 5D2LA 1NCBH 4CGTA 4ZSOB 3FOMB 3IDGB 4JO2H 4F7CB 2CDFA 4Y88A 3LS4L 3C08L 2VXTH 2HTKD 5L2JA 1YYML 5C0BA 2OI9B 3LEVH 4RMTA 5FM5M 2E6JA 3U0WH 1HXMB 1N2RA 5F7YC 4X6CF 1EFXD 4PJGE 1I8KA 3ULUF 1EIBA 4EI5C 2V2XB 1OP5K 4MJID 4M48L 1A1OA 1JPST 3PXJA 3KLHC 1AR1C 2DQIH 5GJSL 3ZKNC 2CKNA 3DGGA 1F13A 2HKFH 3S97C 1RHHB 4L8SC 4F9PC 5IROC 1IGFH 2YEZB 3TBVB 2V5RA 2VLKD 3QYCA 3UAJC 1BD2D 3QDJE 4ZO7A 4ONOA 1EH9A 4H88H 3RI5F 3LQAH 2XV6B 5TE7L 2NX5D 4LHQB 4PP2B 3NN8B 1MHHB 2L7UA 1JPFB 2UZYB 1KCRH 3O8XB 4OM1H 3UO1H 4X5WB 2H45A 4PJ9A 3RZCA 4AMKL 2QEJA 3ULSA 1KENH 1G7LB 3TF7C 3QHZL 4NNYA 2ADJB 2XQBH 3BKYH 1GOGA 2VDPL 2D0FA 4G8FB 2W0FB 5TE4L 3E2HC 2V2TA 1ROWA 2FO4A 5DK0A 1RY7B 1BGXH 2WLYA 4KK9D