2BVEA

Structure of the n-terminal of sialoadhesin in complex with 2-phenyl- prop5ac
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALOADHESIN
publication title Crystallographic and in Silico Analysis of the Sialoside-Binding Characteristics of the Siglec Sialoadhesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 25
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bveA00
1SMOA 1LP9B 1QRKA 4QOKE 5TF1L 1UYWL 2Z8SA 1T66C 5DT1L 1WWWX 4XXCC 5B21A 3ZE0F 2V9RA 4OD3L 5EBMB 2CIKB 4C4KO 1WBXB 4ZFOB 5ITFA 5HHNA 2OM5A 3ZYIA 5EC2B 1DQDL 2OP4L 4EIGB 3DO7A 1BJ8A 2BSRA 4DK6A 1IEAA 1Z0NA 3NA9L 4P4RA 1MOEA 1YMMD 4NYLA 1OM3H 5EA0H 4OLWL 3GSWA 4P5TB 5SX4H 3DSNA 5HDLA 2FRGP 3DTXB 4PS4H 4HPOH 5D9SB 2YD9A 5HDBF 5JW5B 4AEEA 4UU9A 4H25B 2A6KA 5HPOA 1OP3H 2WUCH 5GSRB 2IBBA 4O2CA 5CD3B 3ZDZE 3W5NA 4HWZB 2Z31B 1L9NA 1EFQA 5CZXD 4EEEA 1SYVB 2P5EB 5CZXC 4PYGA 1L6ZA 3TO2B 4ZPTB 1IFHH 2IQ9L 3KLHC 3CVHL 3MV7E 3MV9D 4YHML 1YN6A 2YA2A 4PR5B 4L8BA 4PJ8A 1MEXL 2W60B 3EFFB 4PFEA 3LKSB 1AR2A 3UPRA 3PHQA 2CLVB 1R3HA 1F90H 4P49A 2Y07L 5MP6H 3Q2CA 3RVWD 1IAIH 3SGDI 2QLVB 3QQ9D 4NGHH 4U33A 3QQ9C 4I3RL 5ILTH 1MJ7L 3KXFB 4YGVA 3TGXA 1T1WB 4JY5H 2E8ZA 2NY6D 5GJSH 4OV5B 2NY6C 4LPUA 1IJ9A 4NO5A 3O2VH 3O6FA 4LSVH 4WW1B 4Y5VC 3NIGF 1XCQB 4M7ZC 5B39B 5IG7A 4I2XA 3RWEB 5J11C 3C60A 1JGLH 5E6IA 2BVOA 2EDHA 2KUTA 3GI8H 4LIQE 5IB3B 1AC6A 2H9GB 4PJ9D 2IPTL 1BQSA 4PJ9C 4ZNEE 1U95A 3VFGL 1T7WA 4P2QB 2GKIA 3B4NA 1HEZB 3UTSA 3VXPB 4OI9A 1DSFH 3H9SE 1DFBL 1HZHL 4W4OC 4PPTA 1RZKL 3Q5YA 1OCWH 4NQTA 1MUJA 4MNQE 4NC2B 5BZWB 5L9DH 3G08A 4HZLA 4UT6H 4ODVH 3WNOA 2Z93A 5INDA 3GUTA 1A4KA 2MQ0A 2X4TB 3U9UA 2ZUWA 4NKIL 1KPRB 3BN9D 5DVLA 1EAJA 4I8DA 2O5XH 5ESAB 5DMKA 3BKMH 4LPCA 1RJLB 4I9WE 3VXUB 3P2TA 4UT7H 2CLZA 5EBWB 1BEYL 4FS0A 4FABH 4KJPC 1J0ZA 3LB6D 3LB6C 1VENA 1OAKH 1AGFA 1YY8A 5DUBA 1F3DJ 3TBTB 1A6VH 1W72H 4MJID 3JWOH 2GY5A 4BSVA 5F6IB 2XZAH 2FJGA 1PKQB 4LLDA 4UAOB 4XPTH 4LCYA 4LMQI 2F5AH 43C9B 5C0AA 5ALCH 4X5XA 1X44A 2R1XA 3LN9A 4YDIH 3PL6A 1IEHA 2VAAB 3J7HA 5GS1A 2AK4D 3VMOA 4NNXA 1KCSL 2Q20A 5ETUB 1XGRB 4LCCB 3CH1A 3HG1D 3OGCB 4HXAH 3Q6FA 2VDKH 4GRWH 3VRLE 2AQ3A 3R0NA 1LDSA 3PDOA 2FGWL 4MJ6A 1FVEA 2P44B 4XBEH 4DOHE 4X4YA 2P8PB 3LEXA 3SKNA 4PJFB 1AD9A 3OAZH 1NUFA 2D7OA 3FT2A 2DI8A 5LGHL 1KEMH 3SDCC 5KS9B 1IC5L 2KH2B 2C5DC 1FZMB 4M62H 3ISWA 5KSBE 3H42H 1RVFH 3UTZB 1AKJD 4RQQB 4Z9KB 1P7KB 5BRZE 1ZS8B 3MNWA 1U8MB 3OR6A 2EDOA 1BVKB 3U2SA 2KQNA 1WFUA 3EYFA 2R56L 2NY0D 2VXVH 1DVFB 4G8GE 2NY0C 1WWBX 2X4PB 4QHNB 3RWJA 3WFBH 1LE5A 4XNZB 5IT2H 5SWZB 1SEQH 2X4NB 1A14H 5L8KB 4KV5E 1LO2L 2JKXA 2JK5B 3M8OH 1MAKA 4GJTB 5DMIH 4WUUE 2C4FT 5IB2A 3CLEL 1KNOB 3EOTL 4NOBA 3EUUA 3ZHDA 3CK0H 4D9LH 4LDEB 3MUZ1 2NY1B 3QHZL 2LQRA 4HX1A 3QXAB 4C56D 3SCMD 4U0QB 3SCMC 5LWYL 1CXKA 1A5FL 3B9VA 1AO7D 4HH8A 1F6FB 1I1AB 3JV5A 1R24B 3N9GH 5DD3L 3G6JF 4WU5B 3P0VL 4Z5RB 1P9MC 3AAZA 4OF6A 43CAB 5JW3H 3ARDB 2V5YA 4OAWA 5CSZB 4TUOA 2JELH 4I18A 3VRIA 3LDBC 1C7TA 5BOZG 3WL9A 3B5GA 3RTQB 3Q5OA 1EGJH 3O9WA 4LCWD 5C08D 5CGMA 2CLRA 3FN9A 3QAZC 3FB5B 2R0WH 1QNZL 1IEBA 3DO3A 3FO1B 3ULVH 1UG9A 2D4DA 1VACA 2AEWA 1T1XB 3QFJD 2YHGA 1JK8A 4M8QA 1E27B 4WI4A 1J1XL 2Z4QB 4JFYB 2H8PB 5KZCB 2A6DB 2NW3A 3BIBX 4FZ8L 3KDMB 4XCNB 1HHJB 2ADFH 4JPKL 1I7ZB 3MNVA 4LLWA 3L1OH 3VFOA 1LD9B 3KPSD 5ISZE 2E6QA 1JUFA 5F96L 3U0TB 3GGWB 3QIBA 4ZUWA 4P59L 2FATH 5IQ7L 5I1IL 3VXRD 4S1QL 1DQJB 3WIHA 1FN4A 5D96C 2YPVH 4WFFD 5HYJB 3P30H 4GAGH 1DBMH 1DJSA 4JGUA 3HLAA 1TZHB 3D39D 2PTTA 2DQIL 5IFJB 5A2LH 4PGCA 3VXOB 4M5ZL 5D2LB 1X4XA 4YXLL 2WW8A 1X5ZA 5DC4B 5ANMB 4NQSB 4PJHA 3IT8D 3IVKB 3E3QC 2GJ6D 4P5MB 4MB5A 2XN9A 3PWPE 1B6DA 4Q97A 5IIEA 1U8KA 2JIXD 1OARL 5H94A 1CDCA 3WMSA 4P3DA 2AI0L 1H3PH 5F7DA 3U79A 1HILB 3QO1A 2DQEL 2FX7L 1EPFA 5FUOH 4JKLA 3H9HB 1H5BA 3WFHA 2AW2A 2DQGL 5GRVL 5GSVB 5DDHB 2NTSP 4FN0A 5A16B 5C09D 5IMOA 2UWEB 1NGYB 1QFPA 2BCKA 2X6MA 5E8OB 4HS6A 5ECJE 4QRRB 3BEWB 2P47B 3I3EA 3LQAC 3N1MC 1AE6L 3P11L 4CMHB 3BW9A 3LQZB 5DWUH 1CDUA 1H3WM 1A1MB 4FTVA 2BNQA 3NCJL 3U83A 3TZVA 3WLBB 3MYZA 5F7FA 4JM2D 3DSFH 4F8TA 4JM2C 3RNKA 3C08L 1TCRB 3WYRA 2F54E 4M61A 1F11B 4G6MH 3RDTD 3HAEH 4EUPB 1BPVA 3RDTC 5KSAD 5KSAC 2OL3H 3V4UL 3VG9C 3QNZB 3OB0K 3VRLF 1TZIB 5EIVA 4NN6C 4N9GB 2J5LB 4XAWL 4TSBL 2ZUSA 3GMRA 4XP4L 2BJMH 3GHEH 1JWMB 4P99A 1R5IA 1NKOA 2PO6A 1HI6B 5JUEH 3JV6A 1OPGL 2NX5D 5IHLB 1UQSB 4NRZA 3QWRA 2NY7H 3T2OA 5ESVB 4JGMA 1KCVL 1S5IH 1HH6A 4LF3B 2XTLA 2NY2C 5DHVH 4OZFB 3F7QA 3LD8B 2EDXA 5D71L 1I4FA 4KKLD 3ZZ1A 4UDTB 1CZ8L 3MLVL 5L7XH 1UENA 2JJTA 1XF1A 4S2SA 2HJLB 4XP5L 3BEVA 4KTDH 4N0UA 3GMOB 3RL2B 4XRCA 4L8DA 5J12B 2BFVH 1NC2D 3TT3L 4JDZA 1BJ1J 3NCBB 1U3HA 5A40E 1OGAD 1RZFL 4R97C 1FLRL 4PJ5E 2F15A 1FYTE 4Z7WF 5K9OA 2W59A 3LKQB 4BQ8A 3CFEA 4NQCE 4GAYA 2DLFL 1UXSA 2P43B 3ZT7A 3C8KB 3OQ3B 3VXMB 1LP9F 4ZXBC 1X5XA 2NR6D 5E9DA 4OZ4A 4Q9CA 1JNNH 3SPVB 4ELME 3PV6A 2F74B 4CMMA 1UXWA 2VAJA 1FIGL 3X3GH 2YA0A 2GUOA 1DDHA 3B9AA 4J8RA 1PG7H 3A6BL 2VZVA 1MAJA 5IK3B 3UTPD 5IV2B 4F3FA 2XNAA 4J1UB 1X5KA 5HHMD 4NKQB 4XVUC 5CAYB 1PBYA 1MVFA 4LHJB 5I0ZA 3BYYA 4FOMA 3E6HA 3Q3GA 4NC1C 1K6QH 4LQFH 5ICXB 3S88L 2OS7A 3A67H 3GBML 1J5OL 5ICYA 2AJVH 1PEZA 2XICA 3B2UD 3SQOH 1QFUH 3U0WH 4NRYB 1D5XA 4IRSC 1R5VA 4NWUH 1BZ9B 4R2GD 3FHQA 1KJ2B 4WWKC 4Y5XA 3H0TB 15C8L 1NCCL 3PABA 4KVNL 5GIRB 1G9NH 1KC5H 1TVBB 1E4XH 3CMGA 4JPIB 4JG1H 5C9KA 1Q9LA 2GITA 2VIRB 4KY1H 4HDIA 1ADQH 2H3NA 3BE1L 1LEGA 1GAFL 4AYFA 5I18H 4WJ5A 2R2EA 4N1HB 4G3YL 2DYPD 3QUZB 4ODTH 3P77B 4OJFL 2Z8WC 5LCVH 1VFBA 1NMAL 3CDGB 2EIZA 3KPRE 1F90L 4NZRH 5C0IB 3MRKB 4JFDE 1JI2A 4ONFL 2GK0A 3FQNB 1MIMH 3LZFH 4M6NH 4L4TE 1MCPH 2AJYH 2MCG1 1NCAL 1YEHH 3MGTB 4B50A 5EO0B 3GMLB 3KPTA 1MCSA 1U58B 3MRIB 5EU5A 5GRJH 2XT1B 4NJ9H 4LSUH 5AAMA 3RAJH 1AJ7L 1MCNA 4HF5L 4R4FL 1X9QA 4G9FE 1HYRC 1K4DA 3KPQA 3U4BH 4R90H 2AJSH 4O9HH 3BXNB 3S36X 1TNMA 2DN7A 1KLFA 3MRQA 1RULH 2DWEB 3GK8H 4HCRH 3GIZH 3TP4A 1T3FA 5JW4M 5DR5L 2W0FA 2R69H 2GIYA 4H8WL 4TSAL 5C3LD 4CKVX 5E2UH 5I71C 4ZFGH 5ACLA 1J12A 1A9EA 1YNKL 3DETD 5DFVD 4PUBH 3DETC 2HG5B 5DFVC 5EU6B 3R0MA 1QEWB 4DKEH 2J88L 5FF6B 1JGUL 5I8OH 3MRGA 2YRZA 1FYHB 5M94B 4XPHH 4PJXE 1LO3H 4FQXA 1QLRB 3T0EE 3QJHA 3PQYB 4KUZH 1F42A 2W91A 4HUUA 3D48R 3QDJE 3GSRB 1TLKA 2EEDA 4H88L 4ZO7A 5F71A 5TE7H 5DHXB 3VFPB 1FJ1A 1CFNA 4YPJA 5SV3A 1M7DB 3V7AG 3FT4B 2BOCA 5F9WC 3AU1A 1QSFB 2R0LH 4PJGE 5BS0A 3PGDB 4PP1D 3RWFB 1T4KB 4PP1C 2V2XB 2NLJA 2WBJA 2EYTA 4PTTB 5F8RC 5DJ8A 5GGSB 3WXVH 4A2MA 3MV8B 1A7RH 3D85A 5D93B 5IBUG 4OUOA 2ATPB 4NNPL 2EDJA 3E6FA 3VH8A 2DWDB 3LOWA 5ID1B 5ADOH 4LLQA 2HKHL 3DVNB 5IMMB 2WWMD 4Q2ZA 2WWMC 1BBJB 1QKZL 1GGCL 2O5YH 4GBXB 5HYQB 3UJTL 4OBSA 4CRPA 3CFCH 1DBKH 3SE8H 1ED3B 5H8DA 3WIIH 3BH8B 3QI9B 4JFEA 1OLZA 5MERA 4RX4A 5EULV 3GIVB 1ZT1B 4ZD3L 2NY5H 1BIHA 2A6JB 1H15A 4UZGA 1YJDC 5E08H 3B3IA 2VH5H 5DMYA 3GJEB 2F19L 4P9MH 3KR3L 2DKUA 1XF3A 4R7NA 1F3JA 3B6SA 4ZSOB 3UTQA 3WSQH 1KIUA 3V6BR 4EI6A 1MIEL 3RJDA 2LABA 4HK0B 1ROWA 3VA2C 4C55A 3WN5C 4PBWD 1NGWA 4S0TD 2PW2A 4JFZL 2YSSB 2BSTB 2X4OA 4XAKE 4IJ3C 4DW2H 4DK3A 5KG9A 4UIKL 5GGRB 3TVMA 5MEND 3CFDB 4BH7A 4ZFOA 1ZVHA 1H8SA 5F1KC 3M8OL 1MCIA 4I2XE 1B0RA 3KPPA 5IW6A 1V7MH 4Y2DB 4S1RH 1UM5L 3MLWH 4LU5H 4UB0L 4G6JL 4KPHH 3QHFL 4XPFL 2X05A 2FB4L 5HY9A 1D5IH 3WHXB 3DTXA 5D9SA 3S36H 4NN7B 5JW5A 1FCCA 4H25A 3UTSE 1JTOA 2VXUL 3P0GB 3D18B 5CBAA 1HYSD 3N9GL 5C3TA 1DUZB 2Z9TA 3G5XA 5ID0A 1OAUL 4JFPB 5GSRA 2FR4B 2Z31A 4MB4A 5CEXB 2JJSA 3B9DA 2AQ2A 3MLXL 2AEPH 4QF1B 2VLKD 3VGHA 3VFSB 5GISH 1YEFH 2W60A 3EFFA 3QT2A 2OI9C 2G2RA 3K4ZA 4P46B 4P23D 2CLVA 4P23C 2WAHA 1JZ5A 3QEHA 1IGIH 1MH5A 1QFHA 3RUGA 2EE9A 3L3HB 3QBTB 2D7QA 1SMAA 4XWOD 4R6UA 4LSDA 3BT2L 3RZCD 2Q76B 3RZCC 1FHGA 4KAQH 1PLGL 4M6OL 3U4AA 3WLWD 3MRMB 5F7EH 3WLWC 1KGCD 4WW1A 3V6ZB 5C0AE 4WI5A 4GKZB 1Z9MA 1IGMH 3NCMA 3MZTA 3Q1SL 4KK9C 3STLA 2YD7A 2YPLA 1X4ZA 3ILPA 4M93B 2EC8A 1S8DB 3QUYB 2RIKA 2BNRB 3QHTC 4GRWB 4H26A 4YNYA 3WS6A 3K81A 1KCUH 2DB8A 1HEZA 1PFCA 2IG2H 1YQVH 5I75C 1CICB 3DVIA 4K3JH 4O58H 2GJZA 4YQXH 1TJIL 4OLYH 5HYFA 1EEZA 1QLEH 1OSZB 4PJIB 3L5XL 4G8IB 3C9NB 1ES0A 1KPRA 4WEBL 2G9HB 1G7MB 4E9LA 4XTRC 4BFBD 4BFGA 3SO5A 5ESAA 3L7EA 1JI1A 4JRYB 3WUWB 2DTML 4WU7A 5EBWA 2F53D 1K8IA 3UBXI 3QQ3B 1CDIA 3OX8B 1EBAA 3IJYA 1P6AB 4OZIB 1RUMH 4U6YB 1I8IB 4R4BA 1I9EA 1ITCA 4JB9L 4L4JA 4K8RH 4F33B 1MHEB 4Z7VB 43C9A 5KN5A 4L29B 3NZHH 2W38A 1KTKE 1EAPB 1YEKL 3PWLB 3QNXA 4JJ5B 5IJVB 4KWUA 4I0PA 1CL7H 1NAML 2AEQL 4DKDC 4UTAH 4L3EB 1P7QD 1K8DA 3WHE1 3BP4B 2OTUB 4FQ2L 5F6HJ 5D72L 5J8OA 2UYLB 5IFAH 1M4KA 3ZLQC 4PJFA 4HFUL 3B8YA 2VDQL 3O11B 4BZ1H 4JVUA 3V0WH 3LEYH 1FZMA 4AIXA 3T0BA 1P4IH 3TYFA 4MXQD 2QSQA 2A77H 5FO7A 3H3PL 3ARBD 1UWGH 4JR9H 4RQQA 2VDPH 3CVHA 4LLVA 2LTQC 1VPOL 1ZHBB 1Y6NR 5JW4R 4PIRF 3QIWD 4F7MA 4XMKH 4KHXL 1RZGB 1T21A 1INEL 3Q5TA 1A6ZA 5E70A 2ZJSL 1OTSD 1NGXB 4NO2A 1DVFA 1OTSC 2VLJD 3CPLB 4JN1L 3MCLH 4XPGH 3K0WA 1YMHA 3S3JA 4S10A 2DM2A 1I9IH 4UQ2B 1YJDL 4I0CC 2CK0H 2X09A 3C5JA 5AG8A 2C7UA 2CO7B 3RVTD 3RVTC 4FQPA 5L8LB 1CGXA 5F72S 2HRPL 5E2WH 3PHOA 1R6VA 4CADB 2PETA 5HYSB 1RUQL 5HJ3A 5CSGA 2BVPB 3KLAB 3QXAA 5KBNC 1Y6MR 2EICA 4D2NA 2R4RH 1BVLA 1QQDA 2BHUA 2FD6L 4G5ZL 4WU5A 4Z5RA 5IQ9B 4JHAH 4MX7B 4HS3B 4WFHD 1A21A 5EZIH 5DSCA 4L1DA 3O2DH 3NABH 4I77H 4PJHE 3MLSL 4OCNC 4NKDB 5HPMA 3SOBL 1OP5K 1FP5A 2XN9E 5GS0H 1T1ZB 3RTQA 3DX7A 2ZKHL 4JM4L 1A9BA 3NVQA 2J7LA 3L3IB 4UIMA 3GHBH 4JKKA 3D2UB 5I8CB 3WHE0 1N6QH 3FHAA 1AXSA 1IRAY 1K6QL 3HZMB 4GW5B 4GKSA 4IRJB 4RWYH 2ZUQC 1T1XA 2EDTA 2OR7A 1BBDH 1E27A 2VABA 4EBQH 1AGDB 1OAQL 1WUNT 4L5FL 4UBDC 2B4CC 4TULH 4YO0A 3O6KH 2XRAH 5I1DB 3IS0X 4K7PL 4FTVE 2BNQE 3WIFB 3KDMA 1ULVA 1HHJA 2VZOA 1I7ZA 4QGTA 1G84A 1HQRB 1J0JA 5AEAA 4PB9H 3EYUL 4X8XA 2L7UA 3PXHA 5E8NB 3Q0HA 1JPTL 4L4VB 4Y4KD 5D7JA 5J06A 4AMKL 3BIKA 4NQVB 3WO3B 3DWTA 1S78C 5TF0A 5HYJA 5T1LD 5KOVC 2OL3B 4K23L 2PXYA 3CZFB 4QCIB 4DN4H 2JLLA 3K4AA 2OTWB 3QDGD 5IFJA 3MZGB 4A6YH 3HS0A 4NQSA 5TE4L 3IVKA 3BO8A 4L8SC 5IVZA 4G8FA 4K9EL 4YK4B 4UOW1 3V79C 2HFGL 3JV4B 5D5MB 4MCYB 3I02A 2VZSA 4Z7UB 4M1GH 4V2CB 5F88B 4QOKD 1HILA 5A2IH 1ZLUH 1UH2A 2KBGA 1XF5A 5DHVB 3GSNA 4X7DC 3CVIL 5GSVA 2ZG2A 1MHCB 5A16A 1NGYA 2VQ1B 3MLYH 2XZQL 4JRXA 3EYSH 4POYA 3JTTB 1M71B 4JDTL 4XT1C 5F7MC 4HQQL 2UY6A 4XB7A 3ZKMD 1U8IB 4PJAB 4N0UE 3ZKMC 1P2CB 1OTUD 1CI5A 1OTUC 1WT5C 2Z92A 3LQZA 5IESL 4GG6B 3TF7C 2ARWA 1A1MA 3WLBA 2IC2A 4UMGA 2MTPA 4WW2A 1B0WA 4X6FA 1CR9H 5CKAA 4LFHG 2ERJB 4WUKH 2VLLB 3T0VA 1GYAA 3TYGL 2FCBA 4H0HB 5HGHB 2G5BA 3H9ZA 4JFOA 5IVXB 1FPTL 4P2OD 5E9DE 3NFPB 3DX6B 3MV7D 4P2OC 3BGMB 4N9GA 5I1JH 3P9LB 3QDMB 1WZ1H 4OQTL 2X2YA 3UC0H 3UAJC 1HI6A 3PWVB 4OIIL 3JV0A 3MRNB 3BSZL 1QUNA 1OWWA 1I75A 1YUHA 5ESVA 1I1CA 1TJGH 4QRUB 1W0VB 2FZ3A 2R1WA 4P0DA 3O4LA 4GSDL 2MQ3A 4Y19D 4UDTA 2AXJA 4H1LH 3SDDD 1AP2A 2NW2A 3SDDC 4GMSH 2EE2A 5IHUH 5DTFA 2MHAB 4K3EH 3DV4B 1KN4L 1GL4B 4GS7C 3PHSA 2HJLA 2O5YL 5EORL 4Y16B 2E27L 5DLMH 3RL2A 1NMCC 1CLOH 3O0RH 1I9JL 4POZD 5HYEA 4X80L 4HKBB 4LVHB 5EIIA 1PSKL 2VKWA 2Z8RA 3WD5L 4ISVB 4GRLD 4TSCL 1WIUA 3EFDH 1I8KB 2BY2A 4LEXL 3LV3A 3NPSC 1TETH 4JDVA 4KKBD 4MNQD 1CE1L 4KKBC 4GAJH 2AVGA 1M7XA 3T08A 2VNCA 4NOFA 4NO3A 3VXMA 3S6CA 3RWGB 1RURH 1TVDA 3D3VB 4F2MB 5IR1A 2N7AA 5DJZB 1L9MA 1VGKB 1LDPL 5IW1B 2WWKT 4I9WD 2I5YH 1A7PL 5IEHA 3BQUB 4WV1A 3EYOB 1AXTL 5LGJA 4OUUB 2F8OA 2NY3B 1CFSB 1F58H 4U1GB 5E8DL 4RA0C 5F89A 4F9PA 4Y4HD 2PR4H 2Y5TA 4HWBH 2DDQH 1OW0A 5AYUH 1RUPH 4U1HA 3GFUA 1DCLA 5HXMA 3B5TA 3IDJA 3MGAA 1NC4A 5FK9B 1FDLH 2FL5B 35C8H 2H26A 2OR9H 4P2RA 4RFEB 5HVFB 4PREB 5C0RH 5D6DA 4ZUTA 4O51B 1YEJH 4LU5L 3IAQA 3V4PH 1MWAA 2VDOH 2Y6SD 3D25B 3P4OA 4L9LC 4X7CC 2Y6SC 3HI6H 3VI4E 3CXDH 2DQCH 1ZAGA 1KJ2A 2CR6A 4U1JA 3DV6B 2JCCB 3H0TA 5FA3B 2PN5A 4J3OC 4X9IA 5DUMH 5D70H 2XFXA 4JPIA 4U05A 3BWAB 4RMTA 5IMLA 5T1KD 3AY4A 2VIRA 5DURD 2DL9A 3LQAH 4UV4L 1TPXB 4P3CL 5HVHB 2AEPL 3D0VB 3T8XA 4OFYD 3FFCA 3IDMB 4LSRH 5D1ZA 5ADPL 4K3GA 4P5KB 2H41A 2V2TB 4K71B 4JQIL 4UILH 1OSPL 3CGTA 1DQLH 1FC2D 3L3KA 1XH3B 4LAQL 1B3JA 3MGTA 1MLBB 3OTTA 5EO0A 4NNYB 3GMLA 1EHLL 4G8GD 4WEMB 4JY4A 5BS0E 5DJYB 1U58A 4KAQL 3TV3L 1SJVA 3TO4B 1D3CA 3LS4H 1RUKL 5E00A 4EOWH 3NOIA 3BXNA 4YHZH 2GTZA 2DWEA 3WDIA 4WUUD 4QHMA 4OSUH 4UTBL 1CF8L 1AFVL 3SGEI 4YWGL 2ICWA 2IPKA 3C5ZD 3C5ZC 2KZWA 5EBGA 3FTGB 2QSCH 2NY4D 4JFEE 2NY4C 1ZMYA 1MAML 2FECI 4NM8L 4AEFA 1Q38A 1JGVH 5D1XD 3IJHA 5D1XC 2F9BT 1X5HA 2IFFL 4BKLB 1QLRA 2G60L 3MRHB 5MEPB 4HWUA 3BUYB 3EOBB 2XWBA 3MGOB 4Z7VF 1QRNB 3WJJC 2V17L 5ITBL 3GSRA 4DFIA 1DL7L 1FV1A 1J8HB 3VFPA 1J05B 5EPMB 4NBYB 2APVA 4HXBH 2B1AH 2DQTH 4RWHA 4OF0A 3AFLA 2P5ED 4Q6IB 4BELD 1CD1B 3QUKB 3PWNB 1NCWL 2VUYA 3MACH 4LLMB 2V2XA 4KTEH 4QHLB 1G6RL 3RKDD 1VFMA 4Z76A 5BVPH 5GGUB 3C5SA 3EOYG 5JA9A 3OAUH 3BGFC 3KPOA 4UUJB 1MSPA 2YMXL 4YFLI 1MCLA 1JYNA 2DWDA 5ID1A 1E4WL 3MBEC 1AGBA 1KELH 4NM4H 1NGZB 4P4KB 1HCFX 2W92A 4F58L 1U8JA 3UJIL 1HKLH 1BBJA 5JXED 3IDYC 5HYQA 2X1PA 5JXEC 3K2UL 2A1WL 3OJDA 4F15B 5ISZD 4J6RL 5CGYC 5F7YC 2YD4A 3MRPA 3T4AA 2V9QA 2VWEE 5I30H 5I8KH 1YPZB 4M7LH 4TTDD 4TTDC 1ZT1A 1KXQE 2A0LC 2VXTL 3QPXL 5ACZA 5K9KB 1HE7A 4QT5A 1F3RB 1JYVA 1H0DB 3IDGB 2AXHA 1FNGA 1MF2L 4FXKB 4YXKH 3SKJL 1KFAH 2CGRL 4MA3A 1AQDB 3RGVD 5DD5L 1HXMB 3RGVC 1GZQA 1LE9A 3UBXG 5CEZE 3G6AA 1AI1L 1ERNA 3MR9A 4ETQA 1MY7A 2SEBB 3WUZA 3ZO0A 3RUGE 2PYFB 3KPNB 4UV7L 4LIQL 1KB5L 2BSTA 1LK2B 3IJSA 1HKFA 2I9LB 1WIOA 1IGCH 1UA6H 1SVZA 4RFOL 4TVSa 3VFNA 4EI5A 5GGRA 3VGGA 1LO0H 1KENL 1I9IL 1W8NA 4PJCA 4Y4FC 5TGBB 5DJ2A 4GG8B 4MNGA 1ZTXL 2ICES 4DTGH 4O2EB 4GRMA 4RGOH 5BO1H 3WNMA 1I85C 1N26A 1IGTA 1NMBL 2J8OA 2B2XL 3DLQR 2YPLE 5B38B 3IDNB 4HIEB 4EN3A 1EXUB 1ZA6B 3MLUH 4YDLB 1UM6H 4GW4B 1FH5H 5JQ6H 1ZLSL 3ZDYF 2VLRB 1KIQB 3QEUB 2AERT 3OKDB 4RSVA 2Y36H 1CU4H 3HE6D 3HE6C 1A6PA 3T4YB 12E8H 1X5IA 2DIJA 4MVBD 1WC7A 4UDUA 4MVBC 4JZNA 5DRNB 3STBA 3MODL 5CEXA 5E5RB 4K7PX 3ESUF 1N59A 3HHRB 3EYQD 1Q94B 3VFSA 1WEJL 4WCYL 1U8NB 4ZAKC 5D1QB 3H8NA 5FYLH 5GS0L 3SE3A 3MQIA 4I3SL 3U7WH 4P46A 4G9DA 2YN5A 4ODUA 2CDGA 1MJUH 1Q9WA 3L3HA 4OQ1A 4JZOA 5CINL 5C9JA 2W9EH 5T5FL 4TNWF 3X3FH 5K59E 3O81A 2FJFA 2Q76A 1W72A 5L2KB 5CJOH 1UFUA 4F57H 1SJHB 3VD5A 2ZCHL 1T83A 3V6ZA 4IMKC 2EYSA 1RD6A 4GKZA 1D9KB 1SEBB 4JPVL 1JYXA 2X4RB 4OM1L 2R2HB 4HUXB 4TNWK 3TT1L 2D7MA 3MRJA 5CBEA 3DGGB 4MLSA 5C2UB 1BM3L 2BSED 2H32H 2FECL 2MWCA 5D7LB 4PJ5D 1FYTD 1FAIL 3K1DA 2BNRA 4DJMA 1NFIA 5D5MF 3V5DA 4NQCD 4UI2A 2Q7YA 3D0LB 1Q0YH 4PJFE 3SJVD 3GEWB 3AM8A 1ZKAA 2IANA 2JB5H 3IU3A 2BDNL 5I15L 4WO4A 5DO2D 3X14B 5DO2C 1YMMB 1MPAL 2FLBT 2HT3D 2HT3C 3V0VA 3T2QA 2AJZA 1KG0A 4PJAF 3MRRA 3UP1A 4F7CA 4OB5H 1SJEA 4GG6F 4MNHB 1IGFL 5CJXC 3O4OC 3QQ3A 3OX8A 3L5WB 4OZIA 4U6YA 2Z91B 2R0ZL 1HWHB 1LO4H 1OAZH 1UCBL 3WFCH 1ZANL 1MHEA 3LKPB 3BRDA 4IIQB 2X89A 4R7DB 3LRSB 4OZGF 1EZVX 2X9WA 3MV9B 4L29A 4BUGA 1VGEL 5IVXF 3PWLA 4BQ6A 4KJYA 4AH2A 2WIIB 3WCYA 2HWZL 2CKBL 3IFLH 2R4SL 3BP7A 4L3EA 2AAVA 3BP4A 3D9AL 1CDHA 1WV7T 4G43B 5IROA 3QFDB 2R8SL 1D5MB 4XNMA 4R96B 2NY6B 5E1AB 5DD6A 3RP1A 4G6FD 5F1OB 3PGFL 3DMMD 1SHMA 4Y5VB 1L7TL 3SY0A 3DMMC 4M7ZB 3O11A 1HHIB 3GSUA 5J11B 3QUXD 1HH9B 4R8WH 1JV5B 1ORSB 1INQA 1U93B 4IRZH 1NBYB 5EG6C 5ERWB 4JQVC 2KL6A 3KPRD 4CVXA 4JFDD 3TJEL 4CJ0A 4WHYG 4PJ9B 3KS0J 4PGEB 2ZPKL 5ABDE 5K9JL 2V7HB 1F4YL 4JFHE 1EGJA 4N1CA 5AZEH 2R2BB 1ZGLA 5MEOB 4WY7L 1OLLA 4XCYB 3CPLA 1D7FA 1I3GH 1CD8A 1QLFB 4ZO6A 5DI8B 4HLZH 3BZ4A 4KK5D 1X3DA 1DEEA 1I7TA 4DCQA 5T1DL 4P9HC 4KZDL 1LO5B 2UV3A 3C6SB 4UQ2A 1BHGA 5FA4A 3G5VA 3SGKA 1D5ZB 1Q9KB 1JN6B 2HT2D 3F6LA 2HT2C 4XBPB 5B3JE 1I1FB 2CH8A 2EECA 4ZQKA 4QTIH 1KTDA 4CADA 4QRRD 5HYSA 4MJIB 1UJTA 2BVPA 1MNUL 4M7KL 2ZSVB 1EO7A 4HHAB 3LN5B 3RWIB 4ZDHB 3KLAA 3UYPA 5BJTA 3U82B 5HYJE 1RURL 3RIFK 4GMTL 4PD4J 1EBPA 3TBWA 3MJ7B 4HS3A 2AK4B 1B0GB 4DN3L 4E42B 4A6YB 3HC3H 5DD1L 3GMNB 3T2NL 1RJCA 1KACB 4NKDA 4F9LA 1HIMH 1LEKB 3FB8B 5B8CC 5TDOB 5JIIA 1RK0B 3BDXA 2BRRL 2OQJA 3L3IA 3QEGH 5I8CA 4NP4H 4FQCL 4LASH 4TVPE 3SDCB 5I1GL 4GW5A 4CN1A 5E1HB 1ACYL 5DK0B 3FO0H 2DLEA 4JRXE 3DRQA 5GGVL 3W9DA 1NDMB 3KYKL 2GY7B 3CFKA 1TZGL 3HI5L 4CL7A 3C87A 5FB8B 1YY9C 1T03L 1AKJB 1QBML 2VC2H 5I1DA 3WIFA 4JAMB 1WCBB 5IBLD 1G7LA 2VISB 3UJJH 4BA8A 1BFOB 4Y88A 3OXRB 4R9HA 3TJHD 1NCBH 3TJHC 5EZOH 2NY0B 3PXJA 1NAMA 5AWNL 3HAEA 4HIHB 2OK0L 1HHHB 4K2UL 3FRUB 5BCAA 4NHCH 3RJQB 4DVRL 4JFFA 3DECA 4XH2B 2V6HA 5C92A 1BGXL 1UZ8A 1VKXB 4FFZH 4C59B 4U2ZA 4PJ8C 4DGYH 2ZOKB 4N5EC 4QXUH 1L7IL 1ZHNB 4YHKL 2W0PA 3HRZA 1L4IA 4RZCB 2W65A 3JV4A 2I27N 5GRUL 4U1KB 4Z7UA 4D8PA 3NCYS 3F6IA 4KI1A 1S7QA 5JHDD 4XAKD 4GQ9L 2DJ4A 5F88A 3SCMB 4C56B 1G9EA 2VDNH 1X7QB 1AO7B 3O4LE 3LKOA 1G7JA 2ILLA 2E7LA 4LNRB 3OHXA 3O6FC 4PJDF 5CMAA 4H1LB 1MHCA 4LHUD 3B9KA 3C60D 2VQ1A 2X44D 3C60C 4KRPC 4S1DD 4PRIA 4S1DC 5E6ID 5E6IC 4X6CA 1C16B 3LDBB 5E4IA 3OKMA 1WWAX 1RMFH 1U8IA 2Q6WB 5SWQB 1P2CA 1IC7H 1JF1B 4YLQT 2EDFA 5C08B 3NN8A 3SE9H 1G7HA 2PW1B 1A22B 3W2DH 1R3JA 2CXKA 5DRWB 4BK4A 4NHUB 4JJHA 3CFJB 1IAOA 3P3YA 1J86A 4TYUA 5KSVB 5IWLA 2J12B 4OKVA 3ULUL 3B8SA 3EOAA 2ORBH 5MEQB 4S0SD 3VXME 1JRHH 1JF5A 1KB9J 3VI3E 2IH1A 3HI1A 5JORB 1FO0L 2IFGA 2P5WA 1Y18B 3FO9A 2GSIB 3U36A 3CX5J 1LQSR 1VFAB 1K3ZA 3KPSB 1LWRA 1MCBA 9CGTA 2QQLH 1J1PH 4QTHB 3T3PF 4AY0A 3HFMH 5FYJE 3B83A 3O41A 2GT9A 1OTTD 2YXMA 4KROD 1QACA 1J10A 1OTTC 3VXRB 4KROC 4N0RA 5D96B 3SHSA 2C3XA 1XIWA 3NFSL 5FHAH 3IB4A 2PNDA 5C0AD 3D39B 5IOPB 4PRNB 4LMQE 4P2RE 4KI5F 2E3VA 2GQHA 1NLDL 1ZV5A 1S9VB 3QH3B 5FHBL 4WI2A 4MCZA 4RMVA 1X5LA 3QUML 2GJ6B 3K8MA 4NKOA 4PJ7B 4Y16A 3RX5A 2V7NA 4HKBA 4M7LL 5ESQB 5I1AB 3OJMB 2Z35B 4OF5A 3MBXH 1JZ2A 2YKLL 2AV1B 5EBLA 1P4BL 2XZCH 5H35B 3OKYA 1UB5B 4NWTL 3T0AA 1R5WB 1SJXA 3QCVH 5C09B 1RIVH 1KJMB 5FIEA 3VXSA 4LSPL 5I1KH 2B4CH 1RIUH 5FO8B 5B3JF 3IFNH 1VEOA 5C8JB 1UJ3A 2MQCA 1Z5LA 3FFCE 3I75B 3ROOA 4PGJA 4MD0A 5GXBB 3D3VA 1XZ0B 1TCMA 2QQNH 4OZHF 1MJJB 1GGIH 4XP9L 5FCUL 3MRLB 4UT9H 5KANI 4JM2B 1S9KC 3MA7A 1KLGA 3D1MC 4QRSB 2FWOB 5AUMA 1L0YA 4P9HL 4BSWB 3RDTB 3UBXA 3QO0A 4Z7QE 5KSAB 4RIRA 1CE6B 3DI2B 2D7PA 1ZHKA 4KKCD 2ZNXA 3VG9B 4LCUB 3MJGX 5C07D 4NN6B 3NTCH 2PTUA 2Z8VC 3E8UH 1AHWC 2BY3A 1IAKA 1GC1C 3NIDE 3P4MB 3VWJA 1QOKA 4PREA 2Q8BH 2VR4A 3EDJA 3HKFA 2AXFB 4U1SB 3E0GA 4HCRA 1F8TL 5SWSA 2NX5B 1TJHH 3BWUC 3FQRA 1TTFA 5GRYA 3D25A 2BY1A 2HFFB 3BIAX 4EXKA 4XPBH 3S4SB 1H3VA 4DVBA 4QRQA 5JLZB 3MV8D 4DAGH 3HMWH 4HC1H 5C71A 4KUCF 3VFMB 3BP5A 2VZUA 1N0LA 3IS1X 4WW2F 1A3RL 2WK2A 5I8EA 5DK3A 4PJBB 5FO9B 3IKCA 4MAYA 3WKNA 3D0VA 2BZDA 4QKXB 3IDMA 4KJQC 1J0KA 4E41A 2K7QA 2AABL 1NC2B 4P5KA 1QO3A 3ZKND 3O9WD 4PD4K 3SDAD 5L2JB 3O9WC 1ZGLP 1NCUA 7FABL 1N3NB 1XH3A 2QADD 2IGFL 4NNYA 4YX2H 1FIEA 3VFWA 5C0JA 2FHFA 4ZXBB 2XXMB 1U8LB 3P0YL 1XR8B 1WFTA 3W81A 1A6WH 5BVJB 1S7VB 3L7FA 3IDXH 3VMNA 1RV6X 3QDHA 5EN2A 3VGAB 5IMKA 5T3ZH 2P24B 3GMMA 5MI0C 3FB7A 4HW6A 3LKNB 2ZCKH 2X4SB 4TUKL 1RZJC 3FTGA 3QIBC 2KQMA 5L88L 2EE6A 3I50H 5HHMB 1I1RA 5D7KE 3MLRH 1I8LA 4HS8H 4RISL 1BAFH 3ZT6A 1SBSH 5KSUA 2A6IB 1NLBL 3O2WH 1FL6A 4HMCA 1JJUA 5GGTL 2ITCA 4J12A 4Z8FH 1YNLL 4K94H 4JG0H 3AC0A 1DBJL 5JR1H 1PZ5B 2XN9D 4IRSB 3EOBA 4LCIL 2Q8AH 2R23B 4RAUA 1HXYB 5HBBA 5DVNA 3GM0A 4JN2B 3LN4A 3LH2H 4WWKB 2P48B 4K7FA 4BH8B 1INDL 1JMXA 1MCDA 1DLHB 2HFEB 1J05A 3J8F7 5EPMA 3S96A 5B4MC 1ND0A 1BWWA 2XIDA 3L5IA 1AIFA 5HHOA 1AGEB 1IAMA 1H5BC 4Q9QL 1R3LA 1JPSH 4ZUVA 4BYHA 2NTFA 4PV8A 1EH9A 4LLMA 5D2NC 3DUSA 4QHLA 4M43L 4PRHB 4XC1L 5GGUA 3OG6B 3U6RB 1BD2A 2KPNA 4G7YH 4PJCE 4UUJA 4WNQA 4HUWB 5F1SA 2DYPB 4MNGE 4WI9A 4FTVD 2BNQD 3BZFB 4X6DB 1P53A 1YNTA 4YHLL 5I1LB 1MFEL 4GKNB 1JFQL 1YPZA 5EU4A 2M26A 3I6GA 5K9KA 4J3SA 3C09C 3MYJB 1BX2A 1CTOA 1H0DA 2H6PB 4G8EA 5IM7A 2HKFH 4M4PA 4MXVF 1EMTL 3QUYD 5F9AC 3BDYH 5GRVK 2G75B 1GVIA 2PO6D 4HJ0D 5FYKH 2PO6C 4HJ0C 2IH3A 3HMXH 4YDKH 5I71B 4X5WB 5HHQB 1YYML 25C8L 4LKCB 1CXEA 1GPOL 3QWRD 1SM3H 5TE6H 1E6OH 3ILQD 1KB9K 1DUYB 3ILQC 3JWDC 3PG2A 5AZEL 2M1KA 3BKCL 1YEIL 1QSEB 1SY6L 2B0SH 2BC4A 4JREC 2RCSL 3CX5K 4KU1A 1LK2A 5J6GA 3JTSB 1N5AB 4OCWH 1F3DH 4AG4L 3ALPA 3RY6A 2JJTC 5GGQH 3MA9H 2W0KA 5JPMA 5F3HA 2HMID 5DJXA 2HMIC 5TGBA 4GG8A 4ZUUB 1F2QA 3KLDA 3ARFD 4O2EA 3IFPA 3SEPA 2X9XA 3N06B 4C83A 4YXHH 4RGNE 1CBVL 2ZSWB 1NBZB 1U3HD 2XWJB 4HIEA 4LARL 2BVQA 1U3HC 1KXTB 4UINL 5F9WB 3ZHKA 3SDYH 1E4JA 2H32B 1EXUA 3NIDF 1KJVB 2BNRE 4OCXH 4GRWE 3O3EB 1IT9H 1MJ8H 3QEUA 1I7RA 3OKDA 5CILH 4F7EA 5J6HB 1UEYA 4J7RA 4BFIA 4ZYKA 1UZ6E 4F7PB 5LXGH 3REWA 1MHPL 4B7IA 1RZ8A 3DX8A 5FGSA 5E9DD 2RFXB 4KK8D 4KK8C 1A7NL 2IANE 3CMOH 5DRNA 3F12B 1V3KA 3TCLB 1A1NA 1DBAL 4PB0H 4YJZL 3VW3H 3IXAA 1N7MH 1XGTB 2GCYB 4MWFA 5D1QA 2OXGA 2HTLD 5HVGB 3OKKB 3UTTA 2HTLC 1NBVL 4OT1H 5HI4D 3ROLB 2FO4A 1EO8L 2VXSH 3BX7C 3IF1A 3VD4A 4CAGA 3BESR 2OJZH 4HT1H 2P45B 4OZIE 3AGVA 2BSSA 3EO1A 4NJAL 1F5WA 3X11A 4CNIB 5JO5B 2BHYA 4JVPA 1CS6A 3RU8H 4WI6A 5FGCB 4NO0D 1DLFH 1GIGH 1CVSC 3MO1A 4Z18A 4XNUL 3QEQA 1BQHB 4MD4B 4ZMAT 1BFVL 1D9KA 5J13B 1CGWA 1DQTA 4URTB 5KVFH 3OKLB 3MMEB 4OGYH 3WN5B 1PEWA 1LVEA 3DGGA 4PTUA 1ITBB 3ZKQD 4Y5XC 4XMPH 4MSWA 1C12B 5FGRA 2DJSA 1DN0B 3EZJB 1IM3B 1KBGH 5EZOL 2MNUA 5D7LA 4L3EE 3FONB 4N9OB 4OD1L 2CMRL 3S34L 3STZB 5MENB 3ECBB 1J1OL 4OGXH 3PF2A 3N85L 1KN2L 1U41A 3QPQD 5DD0L 4ZFFB 2EEAA 3TCXA 5F1IA 3QXUA 1F4XL 3CJJA 5J1TC 2OZ4H 3TNNA 1EJOL 2BXYA 1UVQB 5FOBA 1XT5A 3CLFH 3L5WA 1IM9D 5LGKA 4YAQA 4QRTA 1RZJL 5I0DA 4QRPA 1PKOA 3ULVE 4JPWL 1TNNA 2VLKB 4IIQA 3WIHL 2ATKA 2P8MA 3U4EB 4R7DA 3LRSA 1A47A 3MV9A 5TJWK 2Q86A 5JHLL 5T3XL 1U91B 3E1F1 2OI9B 4D3CL 2BNUB 3G5YA 5DJCB 4P23B 4PLJD 2FLRT 2WIIA 4PLJC 1UADC 1S9XA 5JIHA 3U7YL 4Z0XB 2W9DL 4PJCF 3DVGB 3T3ME 3BAEL 4PLKC 1CT8B 1JVKA 4FNLL 3QFDA 4MD5A 1D5MA 3RZCB 2MMXA 3S5LG 1VB9A 3A6CL 2B39A 5C0DB 1D6EB 4FQXD 5K33A 4X7TA 4FQXC 3RX8A 1KSRA 4Z7OE 4JY6B 3S3PA 1ORSA 4PV9A 3MJ9H 3MREB 2R1YA 5EUKA 5E8EA 1T89A 5ERWA 4OM0H 4PGBA 4O02H 4M48H 4L4VD 4M6ML 4YBLC 1TDQA 1S7SA 3O2DA 3GSVA 2YC1A 1RHFA 3NAAH 3EDKA 2EZ0D 3CUPB 4PGEA 5BW7A 1P4LB 3ARGA 1QBLH 5EUOF 1RZ7H 2BMKA 5BS0D 3FOLB 3WFEL 4WDIB 1G9MC 1AY1H 5CJBA 5I75B 4FQLH 1HINH 2WBJD 3N1FC 2WBJC 1NUNB 2C3VB 3OL2A 4KRMB 1MFBH 4FRWA 1CXHA 1QBAA 4FFYH 2R0KH 3KYNA 4O2FB 2EIBA 4O5LL 1CGSL 1A7BA 4NN5C 3IGAA 1Z3GH 3C6SA 1C5CH 1MHHB 4CW1A 4M9PA 4DWHA 1Q9KA 1EHXA 4N5UA 2F53B 1RFDH 3PIQB 1FL3A 1KPVB 1I1FA 4LPVA 4JKPH 1N6UA 1EVTC 3ZE1E 2YOCA 2E5EA 2HLAB 4R26H 1IKFL 1NFDF 2A73B 4MJIA 1WSST 4ZDHA 3PWUB 3TN0A 1UB6B 5E2VL 4KMTH 1RU9L 2YPKB 4JFFE 1DBBL 4PRBB 1X5FA 2F5BH 4NUGH 1S5HB 3DNKA 3V5KB 3OWEA 4WFEE 1KIPB 1Z0MA 3MJ7A 3NACL 4AJ0A 4A6YA 3HG1A 1U6AL 4Q9RL 1K5NB 1P7QB 5LBSL 3VDCA 4D9QE 4PG9B 1EERB 4Z7UE 1HOCB 5TDOA 3BVNA 5CCKH 1ONQA 3IU4L 2YD8A 5HGAA 1ZHLB 1EEQA 1FG9C 1KCRH 5KJRH 3G04B 3TVMC 3VJ6B 3BPLC 4TQEL 3QXDB 3P9MB 4OBRA 5DQJA 1JHLL 4NCDA 3EGSB 5C2BH 5HHPA 2Q8BL 2XY2A 1CFTB 1S7WB 2A9ML 2FX8L 5DK0A 3DX9B 4HGWA 1A0QL 1J0IA 2XPGA 4PRIE 4X6CE 3Q6GL 4PP2A 2ZWLT 4AQ1B 5IHZB 3ARBB 4PJBF 3FO2B 5FB8A 2DBJA 1MQKH 4AM0B 1J9CT 4WGWB 5CD5C 2O61A 1WCBA 5JOPE 1BOYA 1BJ1H 3BZEA 2R9HD 4MA8L 2CKBA 2R9HC 4U6VH 2VLJB 3O3AB 4ODSH 3OMZA 4DQOL 3VDBA 1IBGL 4NFDA 4HIHA 1TXKA 1A3LL 2Z31C 4PRDA 5BZDB 3ZL4L 5JDSB 4OF8A 3MNZB 2JJSC 1UM4L 4XH2A 3MOAL 5KANG 1QVOB 2VDRH 4BZ2L 1GSMA 1XCTB 2DI7A 1RSFA 5TQ0L 4XBGB 1IC4H 2O5ZL 3S7GA 4AENB 2P5WE 3T1FA 1P5VA 3RL1A 2HH0L 3WKML 4Z95H 4HKZA 1AQKH 5BV7C 4U1KA 1JNLH 1CFQB 2B8OT 2ARJQ 4MA1C 4DKFH 1QA9B 2ADIA 2P4AB 4LNRA 1Q0XH 1P9MA 1FC1A 5FECA 4H1LA 5F9JB 3FAWA 4ZFZA 2HT4C 4XCCH 4ZUSA 2CDEB 3DIFB 5K93A 2J8UF 2YPLD 1GGTA 2Q6WA 2FYYB 4APQA 4JZJB 5DJ6B 2OMBA 3GO1L 4LCWA 5C08A 4HIIB 3LMJL 4YIQB 5INCB 2PW1A 3F7PC 3WS6C 4Y0GA 4PJEB 4NHUA 1N4XL 3CFJA 2Y06H 1NGQH 3PV7A 2D7TH 4GAFB 2D31A 2ZUQB 1NEZB 1WLHA 2C26A 4XVSH 3QFJA 3VXSE 1I3VA 4NQEA 5MEQA 4XX1E 4GXUN 4AT6B 1Q9OB 3T3MF 4OLUH 2IMNA 5JORA 3D3VE 2P7TB 5GS2D 3FCTA 2WINB 2GSIA 1VFAA 5EOQL 1ZK9A 5F1NB 5EU3A 3AMLA 4FP8L 3G6DH 3ARPA 1H9VA 4YE4L 5TPWL 4X6DF 3VXRA 2IQAB 4NZUH 1U8QB 2NPLX 2OX5A 3HC0B 5T1LB 2Y25A 2D03L 4HWBA 5C6PB 3QDGB 3X12A 3KYMB 5J1AA 3MLTA 4PRNA 3ZYZA 2I9TB 1NFKA 4R3SA 3BISA 1FNEA 2MCPH 4KQ4H 2FJHA 1XGQA 3FN0L 4L8SB 1KPUA 5SWSE 1QYGH 3V4VL 4I0PD 4AIZB 4K07A 5C86A 4I0PC 2JIXA 5HGBA 4MB3A 1OB1A 3UPAA 1LNUA 5EOCL 5ESQA 5AAWA 1FFNA 4QOKB 4MDIA 4XCEB 3NFNA 1N64L 2VL5A 4P2YA 3RVXD 1OAXH 3KVQA 2DD8H 3RVXC 3VWKD 3V0AC 4DGIH 5FDWA 2AV1A 5H35A 1UB5A 3WE6B 1R5WA 2EH7L 3EO9L 5CIPH 1UACH 3T65B 5D7IA 4Z78B 1GRWA 2QKIB 3QCTL 4CU6A 2D0HA 3DHJA 1BF8A 1B2WH 3I75A 4OZFH 4NZJA 1XZ0A 3G6JB 3ZTJG 4E41E 3PNWB 1E6JL 1G6RB 5D7SH 1JHKH 2FWOA 1YEEL 3QQ4B 1OWRM 3U1SH 2YA1A 3WS3A 2XOTA 3LSOB 1CG9A 3M17A 3QNYB 1PDKA 4OI8A 1DVFC 4FXGB 2FX9H 1QPPA 4W70A 1K2DB 2HJFB 4LRNH 4OCSL 5DJAB 3T0WA 3MRFB 5DS8A 4JO3H 2X70B 2XTJE 4P2OB 4KTYA 2YN3A 3MV7B 5KVDH 1IGJB 5CEYA 1A6AA 1DQMH 5GRXG 3P4MA 4QY8B 2GHWB 4MA7H 5DJDA 5GZND 3QG7H 3QJFA 2WLYA 2AJXH 4WEUD 3O6LL 1XF4B 4NRXA 2NX5A 2M8XA 2GSGA 4IOFD 1WBZB 4IOFC 2HFFA 4JHWL 1JPFB 2Q1EA 4GH7B 1ZSDB 5L6YL 4XC3H 2NY1C 3LIZH 1MJ8L 1YYLH 1P7HL 5CILL 1F4HA 1W0WB 4X8JB 4EDWH 1QBBA 4Y19B 5LXGL 1RIHL 3SDDB 1FBIL 2NMSA 3BD5A 3HUJA 3VFMA 5I1EL 4E5XB 1R0AL 2HJKB 2AJUH 4GS7B 1RZKC 4UQ3B 3ZKXC 1OP5H 2ITDB 5C0GA 4NFBA 1WJ3A 1NCDL 1NMCB 4XVJH 1SYSB 4ZFOL 5E6YA 2DLTA 1EO5A 3OR7B 4ALAL 3RTQC 4CVZB 1FO0A 4KI5D 2EXWC 4KI5C 4AQOA 2UUDK 4OGAD 4EDXB 1OD7A 1OGAA 2VERN 3M45A 4ODHH 5J3HC 5C0FA 5I19H 5I1HH 4FQQA 4GRLB 4NC0B 1BZ7B 4MNQB 5HHOE 5TDPA 1NAKH 3DGCR 3DROB 3FL7A 2DQDL 4K3DL 2DQUL 2ADGB 5CHNB 3ZHLA 3RGHA 4ZS7H 3QWOA 4ZOEA 1BD2E 1XR8A 5F7UA 2R29L 2IBZX 1S7VA 4W6XB 5EC1A 3MXVL 4JO2L 4RMRA 1A2YB 3NCFB 3QIUD 1S7XA 2BK8A 2HVKA 1V7NL 3VRJB 2MFNA 4XP1H 2W07A 1MVUA 1ETZB 4GUPA 3MRBB 1C5BH 1YPZE 5D7JD 5EO9A 5D7JC 3UYRL 2BOBB 5AZ2L 1S7TA 3ZTNL 5CEZL 1T5XA 1VSCA 1U92A 2XA8L 1Q72H 1L0XA 2A6IA 5BV7L 3QXTA 2PXYD 2AV7A 2PXYC 2K7PA 5FUZH 1CXLA 4G7VL 3O8XD 1Y0LB 3H9YA 2VRAA 3N1QC 3VFTB 1FFPB 1TQBC 3UZQA 4L9LB 1PGRB 5HTSA 3ZDXF 2R23A 1XGYH 4RGMC 4J23A 1YECL 5HGGS 4NFCA 4OF3A 4DOHB 3B43A 3ES6A 4FFWD 4FFWC 1A8JH 1DLHA 2HLFD 3B2VH 4XVTL 1FVCA 2HLFC 2E6JA 4J3WA 3KNBB 5KTEL 6FABL 4M5YH 5T1KB 3IETA 5DURB 1XF2B 2B1HH 2WNGA 1KT2B 4JRXD 4XI5C 1HHGB 3JUZA 1LMKA 2RB8A 3U6RA 3CFIC 1U8OB 1QFWH 4HIXH 5D8JL 5A3ID 5A3IC 3MCKA 4KUCD 3NZ8A 4TOYH 5IB5A 5GJTL 3GMPB 4WW2C 4QYOB 1FNSH 3UZVB 4LSTL 1A4JA 4OF7A 3LEVL 2RQ8A 4G8GB 5DGQA 3WDHA 3CSGA 2OXHA 1CLZL 4ENED 1FORH 4ENEC 1T2XA 1EUUA 2UZIL 1X5AA 1WBYA 3I2CH 1CCZA 1GC1H 1GGBH 3W0WA 4N8VB 2EDWA 2H6PA 2YEZB 3GSQB 1CLCA 1Y6KR 1C8PA 1A7QL 2OMNA 4WUUB 2J5LC 3NIFF 3MX0A 2Y9RT 3W39B 1NGPL 3QSKB 4V1DD 4S1SH 3C5ZB 1PVHA 1T66D 4HJJL 4NSKB 5HHQA 3UTTE 2WQRA 2NY4B 5KVEH 1FE8H 2APFA 4MXWH 3O4LD 1IZKA 5BQ7B 3AXLA 5D1XB 1N5AA 1HSAA 1IQWL 4XPAL 4ORZC 4O4YH 4P57A 4H20L 5T33L 1I7UB 4QXGH 3QEQE 5IEKB 1U8HA 5TH2B 1F6AB 2CD0A 3MUGB 3V8OA 4WRLA 4FQHA 1S7RB 3OZ9L 5E99H 2WANA 2YRLA 2DM4A 5HHVH 5JXAL 1NBZA 1FZOA 5IKCB 1ZT4A 3S35L 4KQ3H 3RHWF 5D7LE 1KJVA 3TIEA 3KLHD 3O3EA 3HZVB 3RWHA 1HQ4A 1KCLA 3QZWG 3BGFB 4EVNB 4OTXL 1T1YB 4F7PA 5DMJB 5J1SC 1M6OB 4DKAA 3RHWK 1M05A 2YUVA 2IALA 3F12A 2ZUTA 4Y5YB 3HA0A 3NBNA 5GGTA 4PRAB 3IDYB 5IFHH 2XV6B 5ISZB 1Q1JL 3D69B 1XGTA 4DZBA 3UO1L 4WV1C 1UWEH 5JPNB 3OKKA 5FYJD 3DYOA 4JO4H 5CCKL 3GB7A 4C4KT 3I9GH 3K4DA 1G7IB 1R3KA 4HH9A 1KLUB 4WTZA 4FHBD 4AIOA 4F9PC 1OW0C 3VXTB 4IDJH 3TBYA 2ICEA 3GI9H 3VG0L 4NUJA 4P2RD 5ALBL 5JMOC 1VDGA 4QRPE 3HCVA 2APBA 5D6DC 3RGVB 3RQ3A 2N7BA 5E03A 4XCFH 3S37X 1BQHA 1RJYA 1U2CA 1FLTX 2XQBL 4HIJA 4MD4A 4LBEB 3MV9E 1MQKL 4X6EA 1ZVYA 5I66B 1QR1A 1B4JH 5E2TH 3WN5A 1K4CA 8FABB 3NGBC 4JANA 3T77A 3VGFA 4ZPVA 3FONA 3HPJB 4HBCH 2AGJL 3QDAA 4LSSL 1MREH 1FVDB 1V5JA 3AY4C 4G6KH 4LPTA 3STZA 3OXSB 1FFOA 2J6EH 3FFCD 4MDJB 4RAHA 3L9RA 3CH8A 1T04B 5BMFH 4KJPD 5D1ZD 5D1ZC 1G7QB 3VE0A 5DEGB 4LSQL 4XGZB 3LHPH 1GGYA 4YHIB 4TRPL 2AJ3B 1FRGH 2APTA 2IAMA 3VH8G 1CGUA 5TQ2L 4D0BA 4MJ5A 4U31A 5HHXH 4MAUH 6CGTA 5JOFB 1VHPA 3UROR 4ZS6C 4DKFL 3HE6B 4GXVH 2E7MA 3F62A 3PWJA 4PJEF 4LVNC 2QHRL 5CZVH 1SY6A 3SBWA 3VFUA 3ZE2F 3K46A 3SDXA 3EO0B 3SKMB 2GTWA 2WUBL 5C0BA 5IBTL 3GNML 4NKMA 2DQFB 1G7PA 3OF6D 3JWDH 1U91A 4W6WB 4ZO8A 2GAZB 5DFTA 3BKJL 2HAZA 2NNAB 4FQ1H 3HC4H 4Z0XA 3SDCD 4JFQB 4OLZH 5TFSL 1VESA 3DVGA 4KHTH 4N8CH 4AEHH 4IOIB 1S7UB 3L3OA 3OKOA 1EFXA 4MJIE 4MZ3A 3HPLA 1NKRA 1QFWM 2J4WL 4OCYL 1GJIA 2I07A 3KAAA 2OYPA 2Y7QA 5FDYA 4Z77B 5A1AA 2DQJH 2B20A 4OLUL 4HWEL 4U1IB 3R1GL 3GSNL 3C2AH 1ZA3B 3TC9A 4TVPL 3MREA 4LVOC 1E0OB 3DBXB 2YS4A 2DBLH 3HRPA 3HG1E 3ARSA 3RZWA 3X13B 2VR9A 4PJ5B 4QXTA 1FYTB 4TUJB 5FGBA 4B7LA 2YK1H 1F4WH 3FOLA 4NQCB 3MLZL 4HGKC 5DFWH 2QV2A 4Y1AA 4NZTL 3SJVB 2ICWI 2LAGB 3JVGA 4IS6B 3V52L 1ORQB 2N4IA 3HNTH 5I1CH 3L3JB 3U0PB 3EDEA 3RX7A 4O2FA 5FUCE 3TPKA 3TNMB 4HPYH 5DQ9B 4GO6B 4LKXA 2A74B 5TDNA 4I48B 1II4E 3VFVB 2CIIB 2IWGA 2UVFA 4Y8DC 2ZCLH 2F53A 3O4OB 5D7KD 1JGDB 4M7JL 4QHUA 1KPVA 1NH6A 2F8XC 3S37H 3O6MH 2A73A 3QULB 4ONHB 4G6AC 4FZEH 4YHOL 3ZDZF 3VD9A 5DUPL 1ZVSB 3VGEA 4XXDB 4PY7B 4ZTPL 5JZ7D 5JZ7C 1S5HA 2VE6A 5H37G 1NPUA 5J9PA 1QZ1A 1OHQA 4OLEA 3HNVH 4WHTB 5B39G 1AD0B 2ESVA 4YBQC 5CWSB 2OCFD 4JKMA 1N0XL 3RFZC 4RNRB 4PG9A 3GKWH 1UKTA 1RK1B 1TTGA 4HKJB 1A7OH 3U46B 3KJ6H 2E9IA 1U0QA 1RUAH 4D9RE 1NL0L 4G6FB 2VOTA 4E0RB 3DMMB 4M02A 4EI5D 5HYIA 4EI5C 1YEGH 3CNKA 5GRZA 3TIDB 3QUXB 4JLRA 3QXDA 2AK1L 3P9MA 4LEOB 2CJUL 5SX4I 1CFTA 1A1OB 3KPRB 1T20B 3DX9A 1TMCB 4JFDB 1CLYH 5EWIL 3CC5B 5JW4Q 3INUH 1N5YL 3ARBA 1RZIA 4EN3D 1NANH 4EN3C 1A6TA 3PP4H 4LCWE 5C08E 5GHWL 2ARJB 4HWNA 4H8WC 4M1DL 5C0EA 3QIWA 4HAGA 4G9FB 2DM3A 3OKEB 3N50A 3PGCA 2VLJA 1K3IA 5FYJL 1NDGB 4DZ8B 2PYEA 5BZDA 3F58H 3QFJE 4I4WB 2H1PH 5JDSA 4NQEE 1NUDA 2ED8A 2WMPA 2MPAL 4OLXL 3GRWH 1IAII 1KIRB 3SE3C 3MJ8B 3KYOB 1C1EL 5C7XL 3BPNC 3I6LD 4P46C 2L4OA 5CJQH 1MWAL 4XMLL 3TM6A 4DGVL 3CDFA 5DJ0A 1CFQA 1U3ZA 4FFVC 4YHPA 1MRDH 5DEFB 1WFOA 4ELKB 3GMQA 4U1NB 3TBSB 2GFBB 3VXRE 1KJ2L 4XP6L 1FGVL 1YC7A 1QA9A 2JB6A 1D6VH 4TPRH 4AEIH 1T83C 2KDGA 3FMGH 5EZJA 4KKNA 4N0YH 1GOHA 2QQKL 2XWTB 4RCAA 4OLVL 1YN7B 1Z2KA 1S9YA 2ENSA 4RBPK 3CSPA 3DIFA 2J2ZA 5C6TL 4ETYA 4RGNC 5B8CB 4CU7A 2PKDA 2QR0B 4KDVA 2NCMA 2FYYA 4JZJA 4YDJA 1G9MH 4UNTA 4NQXB 4OCRL 1MFDL 4KZEH 2VQUA 4FQIH 5KW9H 3TH2T 4I5BA 4JO1H 3VD3A 2FDBP 4ZTOL 3DO7B 2IAND 3AM8C 1NEZA 5D7IE 5MHSD 2WP3O 5CIPB 2I60H 1IEAB 2WZPD 4PLNC 4KXZH 1KEGH 4P4RB 4WO4C 1O7VA 3CIQA 2EE3A 4NYLB 3BYTA 5C6WH 4B5EA 3GSWB 2NY2D 3LVEA 2P7TA 4U7KA 4ERSL 2XY1A 5KSBF 3LKRA 1Z9OA 1GHFL 2D3VA 4UU9B 1NSNH 4KVCL 1ZEAH 4ONGH 3X17A 4ODWA 3IAPA 4YUEH 2COQA 4Y4KA 5HDQL 4U2YA 3QRGL 4O2CB 3MRCA 1MFAL 3MFFA 3QP3A 2CK2A 1XFPA 3MXWH 2CXGA 4GW1A 3L95A 5KVGH 3DURA 2XACC 1QHPA 3KYMA 1JWUA 1MCOH 2I9TA 1OAYH 4PJ8B 4KV5F 2IADA 3PHQB 1R3HB 2C1OA 3G5ZB 1CFVH 3ESVF 2NX5E 1CQYA 4ZXBD 1NJ9A 4MQ7B 5JHDB 4XNYH 4YGVB 5C0CD 4YFLF 1IKNA 5IROC 4KRLB 3WEXB 2ENYA 4XCEA 5E5MA 4NO5B 2VXQH 4LFHD 3O6FB 1R3IH 4CGTA 4HC1A 5IG7B 3HUJE 5I74C 5M7QA 2AXGB 1T2QH 2OSLB 4I2XB 4LHUB 4Z0BL 4Z78A 3C60B 2RBLA 4W68A 2QKIA 5E6IB 2VITB 2BVOB 2VLMD 3HNSL 4BSJA 2PCPA 3KPLB 1S3KH 3ULUE 2F58H 4XVUD 2P42B 3G6JA 3S35X 1EEYA 1KJ3H 5SX5K 3VXNA 2YD6A 4M7LT 3UTSB 3FFDB 5AD0A 1J87A 1OGAE 5E94B 5IB1A 1MRFH 4XNXH 2X7LA 3I3BA 5J57B 1OM3L 5EA0L 4HZLB 1K2DA 4IRSD 1JYWA 2Z93B 5DJAA 1LK3H 5IGXH 4PS4L 3LCYA 3ULVC 1A4KB 4HPOL 3U9UB 3TA3D 4G42A 4LLYB 3TA3C 4WWKD 4P2OA 1A6UH 1IGJA 3OPZH 2QQQA 4QY8A 4BM7A 2J8HA 1I9RH 3SGKC 2WUCL 1CXFA 4NQDA 1XF4A 2CLZB 3ARYA 1DP0A 3NH7H 1P84J 2H2PC 1AGFB 5DUBB 4LGRB 1JPFA 4PRHD 1IFHL 4KROB 4TTGA 3RA7H 4BSVB 3BKYH 1PYWB 1W0WA 4U6XA 4Q6YA 4LLDB 4X8JA 4LCYB 4Y19A 4HD9A 5C0AB 1YDPB 4X5XB 2R1XB 4E5XA 5MP6L 1HDMA 1TVHA 1IAIL 2FSEA 4MGXA 2VSCA 4NGHL 3QZWA 4NNXB 5ILTL 4F80A 1MI5D 3MTRA 4OFIA 3WNPA 3CH1B 4JY5L 3Q6FB 4XWGH 1XGPB 5GJSL 3F8UB 4NZDA 4FQJH 3O2VL 3PDOB 3OR7A 4LSVL 3S9DB 1CWVA 3I6KA 5EH1A 1AH1A 4X4YB 3SKNB 3LEXB 4YR6A 1JGLL 2ZUXA 5F9OH 4GRLA 1AD9B 2ZG3A 5DYOB 5IF0A 1DR9A 1CIUA 3RNQA 3GI8L 1FNLA 5CUSH 4RMSA 3AREA 5CHNA 1ZWIB 1DN2A 4EUPG 5DQDH 5GS2H 1ACZA 4X9HA 4HGMA 4HFWA 1DSFL 1QSED 1G6VK 1A2YA 5LQBH 5L0QC 3THMH 1OCWL 2A9NH 3MNWB 5L9DL 2EH8H 2W0LA 1BQLH 5JNYA 4UT6L 5EFIB 4ODVL 3EYFB 5CZKA 2ZZUT 4D0DA 1TQCC 3ALXA 4LLUA 3RWJB 1LE5B 2CDFA 2BOBA 5TF1H 1UYWH 4Y4HA 5CLTA 5DT1H 4KDTA 5C07B 2O5XL 3BKML 4OD3H 1KXVC 5H2BA 3SKOA 4JFFD 4X99B 1AHWB 4FABL 4UT7L 4IDLA 2BERA 3W0WE 1DQDH 2OP4H 4WFED 2HYMA 1OAKL 3FQXA 5IB2B 1A6VL 1W72L 1SQ2N 3NA9H 3VFTA 4LRIA 4F7TB 3JWOL 5D6CA 2E9BA 2XZAL 4OLWH 4D9QD 1U9KA 4X9GA 4XPTL 5D7IF 2F5AL 3IFOB 5I73B 5ALCL 5FYLE 4HX1B 1CD9B 4YDIL 3DYMA 3V6OA 2E7LC 5T1KA 4HXAL 2VDKL 4X7SH 4ZODA 3B9KD 4LDLB 3B9KC 1FZKA 4OAWB 4PRID 4YDVB 1HHGA 4DEPC 1CTNA 2Y23A 4OFYA 4TUOB 2VSDA 3E2HC 4HSQA 1U8OA 4XBEL 3VRIB 4F8QA 2IQ9H 3CVHH 5DK2B 4YHMH 3O9WB 3SDAB 3TPUA 4YH6A 1MEXH 2CLRB 4H5SA 1KEML 2Y07H 2QADB 1IEBB 5EZLA 3Q48A 4I3RH 4HUVB 1MJ7H 4M62L 1XR9A 4IMLA 3VGDA 4HBQA 5IWLC 3V95A 3H42L 1RVFL 1JK8B 4U6HB 2DQJL 4WGVB 1CYGA 4B0MM 5FXCH 4CN4A 2NW3B 4Z7WA 1MCHA 1FG2A 3HZKA 2YWYA 1OF2B 2P5WD 1UKQA 2VXVL 3W39A 4LLWB 3MNVB 4ELMF 1D5BB 1LP9A 3WFBL 3C5ZA 5MI0B 5IT2L 1HSBB 1JUFB 3HUJF 1SEQL 2IPTH 1A14L 5EBMA 2CIKA 3VFGH 1WBXA 4ZUWB 5EC2A 4TN9A 3ULUF 1FN4B 4HEME 1XIWD 5DMIL 1XIWC 1DFBH 1HZHH 1RZKH 3CK0L 4D9LL 4P5TA 5FGCE 1I7UA 4L3AA 5TH2A 2XN9B 4N90D 5F7WC 5IIEB 1F6AA 4Y16C 1U8KB 1T6VN 1V05A 5H94B 3H7LA 4LGPB 5F7DB 5CD3A 3QO1B 1BEYH 4HWZA 5AG9A 4EIZC 5JW3L 1JGEB 1G9NC 1SYVA 1H5BB 1CGYA 2JELL 2P5EA 3TO2A 1XEDA 4ZPTA 3OAYK 1NCNA 5E7FA 5D2NB 2BCKB 2OR8A 3VXSD 5J0BA 4PR5A 1EGJL 1T1YA 3LKSA 3PDDA 1UJ3C 2R0WL 1UKSA 3NCYP 1FGNH 2HTKC 4FTVB 2BNQB 1A64A 4Y5YA 3ULVL 1KCSH 4LPYA 3KXFA 4KFZC 4OFPA 1T1WA 3D69A 4M00A 4PRPD 4OFKA 4OV5A 4K9EC 2NY3C 2OZ4A 2FGWH 3KS0H 1XCQA 5B39A 3DXAD 2DF3A 1G7IA 5IHBA 3C09B 3RWEA 4KK9D 2ADFL 4PYHA 1E4KA 3L1OL 3VXTA 3EW3B 5LGHH 5IB3A 1IC5H 3VWJC 2H9GA 3SDXE 1R5IB 1GXEA 3JZ7A 2PO6B 3LPGA 5C0BE 3RGVA 5SWSD 2FATL 3BMWA 4P2QA 3VXPA 2YPVL 1E4XI 3P30L 4GAGL 5CP7B 1DBML 1C5DB 1WISA 3QXVA 5I66A 4OCMC 4CUCA 1HH6B 2YD3A 5BZWA 2YUXA 4JREB 3O3BB 3LAFA 1I4FB 3GJFK 3HPJA 2R56H 2X4TA 4Z7NE 2WSKA 4OV6F 1P84K 4XTRD 4Q0XH 4XNQB 1JPGB 4S2SB 1I8MB 1KGCE 3BEVB 4MAYC 3CDCA 1RJLA 1H3PL 4MDJA 4PJXF 3VXUA 2B7DT 1LO2H 4XRCB 2UY7A 4L8DB 3ARFB 5FUOL 3OB8A 4JDZB 3MJ9A 3TBTA 4X9FA 3CLEH 2ZUVA 4XGZA 2LV4A 3EOTH 1U3HB 4YHIA 3CXHJ 4GOSA 1PKQA 4EZMA 5K9OB 3MC0A 3QHZH 2QTEA 5JOFA 3CFEB 5DWUL 2FBOJ 1UXSB 4PJGF 5EIQA 2EDBA 2NXYD 5LWYH 4J2XA 1A5FH 2NXYC 2VAAA 2VB5A 4Y1AE 2E6PA 3DSFL 5E9DB 2XTJC 4OZ4B 1XGRA 5ETUA 4LCCA 4N0YL 5DRXB 3PV6B 3OGCA 4CMMB 4G6ML 3SO3C 1UXWB 3EO0A 3SKMA 2GUOB 1DDHB 3ZE0E 4J8RB 2OL3L 2P8PA 3SGDH 3HR5B 3IRPX 4F3FB 2LVCA 2XNAB 5I6XC 5HI5D 2NNAA 5HI5C 2F53E 1I8LC 5KS9A 2BJML 3GHEL 5GRWA 2I25N 5JUEL 2NY5C 1S7UA 3E6HB 3RIAF 3V9FA 4NO0B 5CP3H 3V2AR 2NQCA 4N0FB 2NY7L 4WHDA 4X0KB 3BMVA 3UTZA 1J1XH 1P7KA 1ZS8A 1S5IL 4Y2OA 4U1IA 1U8MA 3UMTA 1R5VB 4M6AA 4FZ8H 1BVKA 4X4XB 3RIAK 1EV2E 5DEZA 5DMGC 4Y5XB 4JPKH 3DBXA 5L7XL 2X4PA 4QHNA 2ESVE 1LEIB 5SWZA 4IOSD 2H2SC 4WHCA 5F96H 1Q9LB 2X4NA 4HEPG 4KTDL 5FM8A 5HHOD 1TIUA 4P59H 3WNLA 5IQ7H 4HDIB 5I1IH 2H3NB 2JK5A 4S1QH 1LEGB 2BFVL 3SJVA 1BD2D 1KNOA 2DQIH 3FQWB 4M5ZH 1OAYL 4YXLH 1JNHB 1VFBB 4F37F 4QNPE 2EIZB 3TNMA 3JSSA 4KRNA 2GK0B 4NQUA 3NIGE 1K85A 5EU7E 1BREA 1OARH 1I1AA 1R24A 5T3XE 2AI0H 5EU5B 1JNNL 4F37K 1G1YA 1JGDA 43CAA 2DQEH 2FX7H 5E95B 3X3GL 1IM9B 1K4DB 3ARDA 5CSZA 2VLJE 2DQGH 3MRQB 1PG7L 1T3FB 2PYEE 1ZVSA 2D2OA 4XXDA 2X1WL 1AE6H 4PY7A 3P11H 3FB5A 4EQ3A 3NCJH 1WTLA 3OGOE 3FO1A 1AD0A 3VMPA 3C08H 4LQFL 3A67L 2AJVL 2Z4QA 3SQOL 4AZ8A 1QFUL 4JFYA 3U0WL 4UBDD 2H8PA 2A6DA 1MCRA 4LPXA 2DRUA 4NWUL 3V4UH 4E0RA 2EDLA 3RY6C 1JZ8A 4FQXB 1BVZA 4XCNA 2EDYA 3QJHB 3QUXA 1G9NL 1KC5L 1LD9A 1X5GA 4EJ1C 1E4XL 3FRPG 4XAWH 4HUUB 4TSBH 3QISA 1GH7A 4JG1L 4XP4H 3U0TA 5E6ZA 3GGWA 4YBLB 1VADB 1FFQA 1FJ1B 1OPGH 1CFNB 2YZ8A 4KY1L 1ADQL 5F97E 1S78D 1DQJA 2BOCB 4A2LA 3AU1B 1NBQA 4WTXA 4PG2A 5BS0B 2ARJA 5I18L 3GKZA 3SDXF 1FNAA 1TZHA 2NLJB 5D2LA 3VXOA 4ODTL 2WBJB 5FFLA 5LCVL 5DJ8B 5D71H 4NZRL 5ANMA 1CZ8H 1MIML 3LZFL 4M6NL 2E9JA 1MCPL 4HJGB 3MLVH 4P5MA 2AJYL 1YEHL 3PDGA 2WM0A 4NN5B 4LLQB 4Q2ZB 5DXWA 4XP5H 2D9QB 3AS2A 5GRJL 4NJ9L 4LSUL 3RAJL 5D1QC 1KIRA 3UTTD 3BFOA 2Y4SA 3H9HA 3MJ8A 4YPGB 3KYOA 3U4BL 1JTTA 4R90L 3RRQA 2AJSL 4O9HL 4OCLC 3TT3H 4IEFB 2ZNWA 2Q7NA 5DDHA 1RULL 3GK8L 4HCRL 3GIZL 1RZFH 2UWEA 4CVWA 1FLRH 5E8OA 2R69L 3B3IB 4QRRA 3BEWA 1NCTA 1XF3B 1WIPA 4U1NA 3TBSA 1F3JB 2GFBA 5E2UL 4ZFGL 2DLFH 3UTQB 4EI6B 3BPOC 4K8RD 4K8RC 4PUBL 3QEQD 1L0QA 4MYWB 4DKEL 1TCRA 5I8OL 2XWTA 1F11A 1FIGH 4EUPA 3BDBA 1BLNB 4XPHL 2PW2B 4OZGB 1LO3L 3A6BH 3H6JA 4Q7DA 2X4OB 3QNZA 4YBHA 1TZIA 4NQXA 2VMFA 4KUZL 2NXZD 5KG9B 2NXZC 3TVMB 3BPLB 4BH7B 1JWMA 3UAJD 5F7HA 1VCAA 2MJWA 5TE7L 1T7ZA 2Q3ZA 4Q58C 3UXFA 1B0RB 1UQSA 3KPPB 5CIPA 5IW6B 3S88H 3GBMH 2R0LL 1J5OH 4J3UA 5IJKA 4LF3A 4Q9BA 5DZNA 5HY9B 3G6JE 4OZFA 3WXVL 1EJ6A 1A7RL 3WNNA 4KVNH 15C8H 1NCCH 4YHYC 3PJSB 5ADOL 5CBAB 3G5XB 5ID0B 5LJYH 5I9QB 3CXHK 3H7BB 4X7SL 3GMOA 3CFCL 1DBKL 4QRPD 4RMUA 3SE8L 3WIIL 3BE1H 5LAXB 5HYSG 1GAFH 4IIQC 3QRFM 2NY5L 4NPYB 1CL7I 4G3YH 2L7JA 4DFHA 3H9SD 4OJFH 4UOW0 1F97A 2G2RB 5E08L 1NMAH 2VH5L 4P9ML 4NQDE 3QEHB 3G5ZA 4ONFH 3LKQA 5BV7B 2LU3A 1MH5B 3RUGB 2FGZA 3RVWC 3WSQL 1NCAH 3C8KA 4MQ7A 1JNJA 5T3ZE 5JHDA 3FKUS 4U3XA 4MA1B 4QNPF 2Q87A 3WEXA 3SPVA 1JPST 1AJ7H 2F74A 2JJVA 4HF5H 4R4FH 4Y19E 1ZLVK 3HTLX 2AXGA 3T09A 2OSLA 4LHUA 3CX2A 2VITA 3F7YB 3STLB 1T80A 5DR5H 1T89C 4WI7A 5IK3A 3KPLA 2YPLB 5IV2A 4DW2L 3ILPB 4J1UA 4BZYA 4H8WH 4TSAH 4PJHF 5EOCJ 2X4QB 4MLIA 4H26B 5E4EC 1YNKH 4YNYB 5GS0D 5BW7C 3ARGD 5ELIA 5GS0C 3ARGC 3JBG7 4R0LC 2V2WB 3FFDA 3OV6A 5E94A 5ICXA 1EX0A 2J88H 1V7ML 3V5HB 1JGUH 5A2KH 4S1RL 2GJZB 3MLWL 4KPHL 1EEZB 1HCVA 4NRYA 2EDRA 1D5IL 5ENWB 4HK3N 1BZ9A 1ES0B 1MCWW 4LLYA 1PW3A 3S36L 4EXPX 3HAEG 3BN9C 2LFGA 1F2XK 5GIRA 1TVBA 1KUMA 1WZLA 1FQ9C 3L7EB 5FV2A 3MRDB 4BK5A 4R4ND 1OQOA 4R4NC 1WICA 4WU7B 4H88H 5E5UB 1K8IB 1FSKC 3IJYB 1OGTB 4R4BB 2B5IC 5IVNA 4ODXB 4U0RC 1PYWA 3U30B 3QUZA 5GISL 1YEFL 3P77A 3TN0D 5BRZD 3TN0C 3CDGA 1YDPA 5KN5B 5C0IA 3MRKA 5E7BA 1IGIL 3FQNA 1FGNL 4NNPH 2X41A 3WO4C 1AC0A 3QNXB 1QHOA 2HKHH 4I0PB 3MRIA 4LPWA 1QKZH 1GGCH 2CRZA 1XGPA 5FYKE 1K8DB 3UJTH 5F7EL 5C70A 1IGML 3D5OF 4ZD3H 3VWKB 2DIAA 2BVEA 3V6OE 1XAUA 5DYOA 4Z6AT 2F19H 3KR3H 4NBZB 5FUCC 1CDGA 2QL1A 1ZWIA 1YQ2A 3TYFB 5FEBA 1MIEH 2EDEA 1KCUL 2HG5A 5FO7B 5EU6A 1QEWA 2IG2L 1YQVL 4PJDB 5FF6A 4O58L 4K3JL 3CVHB 4LLVB 3ARQA 3QYCA 4FMFA 4YQXL 4K7PY 2EDNA 2VJXA 4OLYL 4F7MB 1QLEL 5EFIA 1T21B 1A6ZB 4JFZH 4NO2B 2VN7A 3EDDA 3AVEA 4Q0XL 1YMHB 3PQYA 5C07A 4UIKH 3AS0A 2C3GA 4X99A 1AHWA 2VUOA 4CJ1A 2IBGA 4Z7WE 3C5JB 1JP5A 4JQXC 1M7DA 3FT4A 5I17B 1RUML 2C7UB 3VXQB 1QSFA 3P9WB 1UM5H 4F7TA 3PGDA 3RPIB 4UB0H 4K8RL 1LP9E 3RWFA 4G6JH 1T4KA 2DI9A 3QHFH 4XPFH 2FB4H 1ZXQA 3PHOB 4PTTA 3IFOA 5HJ3B 5GGSA 3MV8A 3DPBA 3NZHL 4D9RD 2ATPA 2VXUH 3MBED 1BVLB 1QQDB 3ETBF 2Y5EA 4KMLB 4RRPA 1N2RB 3DVNA 5IMMA 1OAUH 1CL7L 1WAAA 5JQHC 4U4BA 4GBXA 4UTAL 5CGYD 3ZKXB 5DSCB 1Z9SA 1ED3A 4YDVA 3BH8A 3MLXH 3QI9A 5HPMB 2A0LD 5IFAL 3GIVA 4APQD 4EQ2A 5DK2A 4APQC 3DX7B 1A9BB 1P1ZB 2A6JA 4XX1G 3SDAA 1KYOJ 2OJEB 4NBXB 4BZ1L 3GJEA 3V0WL 3LEYL 1X4YA 4UIMB 3F5WB 3GBLA 1W8OA 4ZSOA 1P4IL 3D6GA 4HUVA 2P5EE 1AXSB 2A77L 3MUHL 3BT2H 3PWPD 4GKSB 2ADJB 1H3UA 4HK0A 1UWGL 1PLGH 1YEDB 4M6OH 4JR9L 2VDPL 4U6HA 4NQED 2VABB 2E9WA 4C57C 2FIKB 4YO0B 3WJLC 4KH2A 4XMKL 1IAIM 3Q1SH 1OF2A 3ZYOA 3GZKA 3QIUB 2YSSA 1RY7B 2EKJA 1D5BA 3KXFE 4GLRH 1RPQA 3MCLL 3DARA 4XPGL 1HSBA 1EZVY 1ZLWK 4OGZA 3P4LA 3CFDA 5D7JB 4OZHB 4Y4FD 3U7AA 3BIKB 4CU8A 2CK0L 5KAQG 3QWQB 1PG7X 5E56A 2PXYB 2LE9A 4Y2DA 1PJ9A 1TJIH 5E8PB 2F54D 3O8XB 5E2WL 2EDQA 3IAGC 1KULA 3HS0B 3WHXA 1TQBB 3OSKA 3L5XH 3BO8B 5IVZB 4G8FB 1LILA 1KTLB 4WEBH 2VDMH 4P2QE 4RGMB 2R4RL 3I02B 3F7VB 4KC3B 3D18A 4LL9A 1UCTA 1DUZA 4JCMA 2VO5A 2DTMH 2E7CA 4JFPA 3VI4F 2FR4A 4JHAL 5EZIL 4L1HA 1JGEA 1XF5B 2RGSA 4KGJA 3GSNB 3NABL 3O2DL 4I77L 1L6XA 2FHCA 4QF1A 4WI3A 1B4RA 4JB9H 4ZAKD 5D2NA 4JRXB 2O26U 2JF1A 1B6UA 3VXUE 2J6EA 2Z92B 3GHBL 5J7CC 1YEKH 3TH3T 4WW2B 1N6QL 4X6FB 3LQMA 4RWYL 1NAMH 2AEQH 5F9DC 1PKQE 3MRMA 1BBDL 3ARXA 4EBQL 1OQXA 4FQ2H 4TULL 5D72H 3O6KL 1TTUA 2XRAL 2G5BB 5KVMC 1CIDA 4JFOB 4HFUH 2VDQH 4PB9L 3RVVD 4MJ4A 3RVVC 1S8DA 3QUYA 2WBWB 4V1DB 5L8JB 4QEGA 3DUUB 3H3PH 3FRPA 5CP7A 1YUHB 1C5DA 2D0GA 1CICA 3RBSA 2XG5A 4DN4L 3W5MA 1VPOH 3EDFA 4X5LA 2FZ3B 2R1WB 3O4LB 4A6YL 3O3BA 4KHXH 5KS9E 1INEH 1OSZA 4KKLC 4PJIA 1AP2B 2NW2B 2ZJSH 4G8IA 1EIBA 3C9NA 4PLOB 3FOMB 5DTFB 2G9HA 1G7MA 4JN1H 4XNQA 1JPGA 4M1GL 2GEEA 1I8MA 3ULUD 4DUWA 4JRYA 3ULUC 3WUWA 5IBUB 2C3WA 1YJDH 3FT3B 3ARFA 3C6LD 2UUDH 3C6LC 1AR1D 5EIIB 1AR1C 1I8IA 1FAKT 2DS4A 2HRPH 3MLYL 5SWZE 3EYSL 3HE7D 3HE7C 4F33A 3LV3B 1RUQH 4JDVB 4P3WA 4YFDB 4Z7VA 2MOVA 1ZT7B 2WLZA 1JTPA