2BVEA

Structure of the n-terminal of sialoadhesin in complex with 2-phenyl- prop5ac
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALOADHESIN
publication title Crystallographic and in Silico Analysis of the Sialoside-Binding Characteristics of the Siglec Sialoadhesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 25
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bveA00
1I9JL 1X5JA 3CCHB 4K3GA 1S7RA 4OZIE 1N3NA 3HZMB 3MRRA 2IQAA 1KT2B 1LEKA 4DVRL 5KG9B 3C5ZD 4OFVA 4JO4H 5JOPD 5F7YC 1FIGH 5MHSD 1IM9D 3MV8E 3JZ7A 5IBUB 3TH4T 2W65B 1ZT7B 3UZVB 5KVFL 5DMIL 5FKAB 3HPLA 3AY4C 3QNXB 3CC5A 2W38A 4HIHA 1CD9B 4U1HB 1DSFL 2DI8A 4A2LA 1M6OB 2GEEA 1FGVL 4GQ9L 5F6IC 4UDUA 4A6YB 1LO0L 3LPGA 3GEWB 3BJ91 4D0CA 4YBQD 5MEOB 3EGSB 4JFXA 5CP7A 1F3JB 3FB8A 4DKDC 2AJXL 1XIWD 2GJ6D 1A2YA 1JHKH 5CD3B 1MCPL 2C1PA 4NBYB 4Z78A 3VH8A 5JQ6L 5FOJA 1NAML 1YEKL 4K94C 4X4XB 1CBVL 4WUUA 4KC3B 1LK2B 2LTQB 1FNGA 4PB0L 4YHLH 4MA8H 1DCLA 4OLUH 1ZXQA 3OKNA 1CLYH 4H20H 1VB9A 1JPGA 2DQHH 3RX8A 4R8WH 1D5ZB 3V7AE 1VADB 3U4BH 1G9MC 2N4IA 4IJ3C 5I1DB 1YYLH 5KSBF 3TNMB 2YOCA 1RZFL 3U36B 5E8NA 3KJ4C 1U8OB 3V6FA 4LMQE 4PJ5E 2P1YA 1F02I 4S1RH 1EFXA 4S10A 1XF4B 3P11H 3C2AH 3MLYH 3F6IA 3FQRB 2ERJC 3LS4L 5IQ9B 5ISZB 2BHUA 4LGPB 3BN9D 1Q94A 1BOGB 4Y5VA 2VZ3A 1CTNA 4XP1H 4HULB 3QSKB 2QL1A 3QQ4A 5DMJB 3KLHC 2FEDD 1JGDA 1QLRB 1RHFA 2AQ3A 4ENED 5HGHA 3F5WA 5FA3A 2E9BA 1OSZA 2EDOA 1ZT1A 5JNYB 2BXYA 4NRXB 1T5XA 4ERSL 2YHGA 5F9WB 1ZVYA 2A9NL 3CXHJ 4GSDL 4JAMA 4XX1E 5CGYC 5A43C 4LPXA 2ED7A 1AO7E 3TYFB 3VMPA 4RIRB 5K9JL 5KTEL 1GCFA 3D2UB 1A7NL 4JJHA 1MPAL 4M7LH 3HR6A 3WLWD 4PY8I 3D85D 3OR6B 4YHPA 5DFWH 4JFZL 4QRPB 2D7MA 4EXKA 2ADGB 2OMNA 5KSBE 5KANI 1I1YB 5DD0L 5IW6B 4APQA 1T21B 1T03H 1RD6A 1MAMH 4WV1C 4ELKB 3EFDL 3O8XA 4MD4A 3N1MC 2YK1L 4C55A 4FZ8L 5IB3B 1B9ZA 5HDLA 5IKCA 4LLQA 1MWAA 1YYML 3W9DB 3QUMB 5BXFB 3S88L 1LEIB 1K8DA 1E4XI 3G6AB 1C08A 1XH3B 5C8JB 1KEML 1MQKL 3BZEB 3GKWH 1BQLL 1GGIL 2DQCH 1H8NA 4TSCH 4HV8B 1HEZA 3QUXD 5IESL 3OTTA 4LKCA 5D7JC 2QADD 1B2WL 1R5VA 3L5XH 3CVHB 2QSCH 5IJVA 3VI3F 4GXVH 5FO8A 3IDJB 2A6JA 1OGTB 1CR9H 4PTUB 1EJOL 1DBAL 3OGOE 2X4OA 3V6ZB 5CP3A 5DTFB 1H8SA 1AQKH 1KCRH 3LQAC 4X5WA 4PRHD 3VE0A 1JCKA 3QHTC 3RVTC 3IXTA 4FTVB 5EH1A 3EJYC 1CE6A 4TVPD 3EOBB 1KFAL 1XGRA 1GZPB 5DHYB 2UWEE 2E7MA 2DDQL 3MGOA 2BY3A 1U8MB 4M6NH 1HXYA 1HK6A 1T1WB 2OTUB 2F5BL 4HW6A 3U46A 5D7LB 4YK4C 4PUBL 1IAKB 4ZOAA 1BWMA 3AS1A 4BH8A 5EU6D 4UILL 4KJQC 1FFNA 2FSEB 3EHBD 3GMQA 1C1EH 1BZQK 3QDGA 5BS0B 4IJ3B 4KXZI 1YECH 4JFQB 4RISH 1QHOA 2HLAA 5GISL 2Q8AH 2SEBB 3VI3E 3KJ4B 1VGKA 5BV7L 4UT6H 4UTAL 4P46D 5AWNH 1YMMD 35C8H 1UEMA 2V2WA 2ERJB 4X0KA 5FYLE 3DIFB 4TYUA 2YD1A 3RIFF 2BSTB 5L2KA 5D9SA 4XVSH 5DFVC 4DFHA 4WGVB 4PJAB 3KYMA 1U8PA 2IAMC 3AB0C 2P5WE 4LAQH 4JRWA 2R0WL 5T33L 3EOTH 4KTEL 4OLWH 1MFAH 2IFFH 3NCYS 1T2QL 3NACL 2NY6C 4M5YL 1TVBA 1RIHH 1CT8B 3G5YA 2EXYC 4RSVA 3PV6A 4HKZB 1K85A 4TPRL 1BGXH 2AW2A 3C8KB 3OPZH 4KMTL 1I7RB 1KCUL 4ODXB 1O7VA 3GSNB 1BEYH 3IDXH 5H35A 3QDHA 2Z8VC 3GIZL 4LLYA 3KR3L 1WV7T 3BP5A 5HPMB 4YGVB 3HMXL 5EOTB 5LGJA 1A9BA 2BY0A 4NUJA 4G6JL 3W0WD 5DD1H 5LQBL 3MRHB 3TNNA 1DUYB 3ZE0F 3SKNB 3O3DB 2EIZB 3QDMD 4M6OH 5HHVL 1U95B 4J3WA 3U2SA 4EUPG 4GBXC 4DQOL 5A3IC 2GTZA 3QUZD 3IDUA 1EO8L 5FAAA 4LPYA 1FVCA 1FC2D 1G7MA 5DJ2B 4MJIA 4CNIA 5HYIA 2ZUXA 1S7UA 5B38B 4FQXB 3WNPA 1FORL 5I1JH 3QBTB 1S8DB 4QRSA 4KAQL 4XCYA 5A2KH 5DJZA 1EGJH 2DYPD 4X6DE 2X42A 2ZCHH 1JWUA 5C86A 3ZYZA 1BFSA 4CU8A 5L0QC 4LCYA 5C08B 4D9LH 1SM3L 2FGWH 1WIUA 1WWBX 2X4SA 4G6AD 2MMXA 1NLBL 2R2BA 1F11A 1XR8B 3JWOL 3ARFB 1R3LA 2G5BA 1BD2D 1VKXA 3FB5A 3QUYD 3ZE0E 3RTQC 3O3EB 5ERWB 5TFSL 5HD8C 4NN5C 1BOYA 2JIXB 3BPCA 1WEJL 1QEWB 1AD0B 1ZHNB 4K3JL 5IHZB 5E5UB 1QRNA 4J12A 4HC1L 3BZDA 3ZE1F 2HJFB 4X4YA 1VSCA 2NXYB 1FRGL 4YK4B 2H2SC 1JRHI 3GMRB 3MGAA 3OZ9H 3DRTB 4JFHD 4GAGL 1PKQA 4HD9A 1PY9A 1FNAA 1CDGA 4ZXBC 3RU8L 1BX2A 4K8RL 3HB3C 1AQDB 2A0LD 3VXUE 3I84A 2C4FU 3QXAB 4DFIA 2YPLE 1S78D 4KUZL 3NZHL 5DRZA 2H3NB 1JWMB 4CU6A 1UXSA 2VLLB 1NQBA 3PNWB 5KSVB 4Y8DC 4WFFE 3U9UA 4XNUL 3VFRA 2IBGA 5BQ7B 1GH7A 4AM0B 1Q0YH 2IAMB 3AB0B 3B2VH 5FEBA 3ESUF 2XYCA 1DVFB 5SWSA 1XGTB 5CZKA 4HGWB 4XP6L 2Q3AA 1FDLH 1QBML 2HT2C 1E4XH 3TPUA 4ZD3H 5C9JA 4YZFF 3WXVL 3PDOB 5EUKB 1L7TH 3HNTL 3ZE1E 3ZKNC 4Y16C 2A6DA 4IRSD 2DWDA 4KRPB 2J8OA 5C09D 3UZEA 3G9VA 1E4WL 1VPOL 5GHWL 4HIJA 1LE9B 5T3ZD 1G9EA 2J8HA 1WICA 2R2EA 4OZHB 3P4MB 4ACPA 3EO9H 2VE6B 2W0FB 3D9AH 3G5ZB 3C9NB 4PRDB 5GRUH 4D2NA 5GPRA 1YUHB 3O3BA 2Q20A 5BRZD 3QH3A 2L4OA 1KTKE 3VCLA 1RZIB 3K4ZA 4C83B 5KVEL 4OTXL 2RCSL 2XG5A 1XZ0B 5DHVB 4GBXB 5FHBL 4AENA 4LSVH 4PP1C 1R3HA 1BHGA 1JFQH 1ZKAA 3MQIA 2V5MA 3MFFA 3F7QA 3VW3L 3ZKMD 2BNRE 2VYRE 3LQZA 3H0TA 3QUMH 5GRZA 4AMKH 3V7AG 5ITBH 3NCJH 1A6AA 4U3HA 2R8SH 1ZVSA 4WTXA 3FCTB 4YC2C 5HYJE 2XOTA 4P2QE 3QNZA 1IGYA 1HOCA 3CDYA 3QIBD 1NDGB 5MENE 4OCXL 4YFDB 1KB5B 3RGHA 3CLEH 3SJVA 1LK3H 4HJ0C 4ZNEA 2YC1A 5C0CD 4I77L 3NBNA 3GJFK 3CU1A 1JNHB 3ULSB 5GRWA 1WWWX 3WFEL 5TE6L 1PJ9A 3FO1B 2BVEA 3S5LG 4AY0A 4Y89A 2BFVH 2MHAA 2V17L 5L0QB 2V7NA 1OB1A 3SCMC 4HUKB 1KPUA 3KYAA 5F9OH 2I60L 3EW3B 3IKCA 3SE3C 3VWJD 1NGYA 1CFTA 2BJML 4UB0L 4MWFA 2ZCLL 4Z7QF 4IOSD 5DEZA 4W6XB 1YNLH 3DRQB 1EVUA 5EU5A 3JVGC 3BGMB 3RTQB 4QGTA 5LAXA 4I0PA 2OL3L 2WBJD 3DV6B 2BRRH 2IH3A 2H9GA 4XX1G 4HZAA 3RWIB 5FO7B 2XACC 4K94H 3TO2B 3ARZA 1BFOB 5A2IH 2GTWB 1KCVH 2VLJB 3L7EA 1HHGB 4R90L 5DUBA 3VDAA 3BJLA 4Y4HA 4NFCA 4FA8A 3LN5A 4YDJA 3TBTB 2NTFB 4XPBH 1J5OL 1J1OH 3E8UH 3KYOA 1P4LA 1YNKL 3QDAA 1UADC 1A1OA 1BZ9A 1CL7H 3V5DA 4S1DD 1QQDA 1H3WM 5BVPL 1YEFL 4Y19A 2EECA 3BRGC 1QFWL 4QYOB 5IJKA 1T7WA 4JCMA 3SPVB 3O6MH 5E9DE 2Q76A 3UJIL 4QHNB 4EI6B 1OAUH 2W92A 4FN0A 4YBHA 4H1LA 4DCQB 4Z7QE 3KPQB 4O2FA 4QRQB 3O3AB 3EJZC 4XI5D 4Q9QL 3AMLA 4N9OB 4WFGD 1B4JH 2J88H 5IK3B 5IVZB 1ZA3A 3PWJA 2Z92A 4NZTL 4MX7A 2PTTB 4O2EB 4MNQE 4Y16B 5EOQH 5AYUH 4ONGL 3PL6D 2HG5A 5TF1H 4D0DB 3S3SA 1KTDA 2DWEA 2X4RA 4XNMB 4PJ9A 5CD5D 4CN1A 3GSNH 3E6HA 3GMLA 1GAFL 3H6JA 3LN9A 3GSVA 3WEXB 2NY3D 2VDNL 3VXQA 3E3QC 4X5XA 4PRPB 2BOBB 1PSKL 2DLTA 4NKOB 4QRTB 5D1QD 1DBBH 3CPLA 1FV1A 3QP3A 4XC3L 4J6RH 4FFYH 2DM2A 5EA0L 4WI4A 1TTUA 4LRIA 2ZUYA 5J1SC 1NCTA 5CS7A 2XN9D 4LSPL 2VQ1A 1KLGB 2P8MA 1DQJA 4J1UA 1AP2A 1WBZA 4FABL 4QXTB 1OP3H 4AK1A 2GAZA 3DURA 3U6RA 4P57B 3FO0L 3LN4A 4H0IA 2R29H 5IW1A 1JYXA 2AS5M 3BIKA 2DMBA 1JRHH 1QBAA 3F7PC 3U83A 1U8IA 4HUWA 4JFFB 4MD5B 2D7OA 3R06A 4LCWE 1PVHA 1TNMA 4JFYB 4PRIB 1CS6A 1AFVL 1YPZE 3MO1A 5IEHB 4JFOB 2NY4D 5F3BB 1I8IA 1S9YB 4YNYB 2GJJA 2Z0BA 1BIHA 1H15A 5E2UH 4KY1H 4HUVB 1PEWA 5CBAA 4PV8B 2CR3A 3BDYH 5C0AD 4AG4H 4L8SC 1IGCH 3DX7A 5IB2B 4KUCD 4OZGA 1D5BB 1JPTL 4ZTPL 4HG4K 2JCCF 2ZNXA 3C5ZA 5HGAA 5GXBB 1NKRA 4OLXH 4WFHD 1NAKH 4G7VL 1IM9A 4P4RA 1A7PL 1Z5LB 5C6WH 4HWBL 3ULUC 5LBSL 3B2UC 4JG0H 4QWWC 5IQ7L 4GAJL 5EC1A 3ARRA 3JWDC 4GKNA 3I3DA 4X6CB 4GS7B 5EBLB 2P43B 1ORQA 1F42A 2R2HB 2JJTA 5IBLC 3VD7A 3BYYA 1MCNA 4HUNB 1WTLA 2V9TA 4LSTL 5GGQL 3RVXC 3JTTB 4M1DH 5BMFH 1UM4L 1DBJH 1CDYA 3CFCL 3REWB 1MI5D 3HPJB 1S7QA 1ZA6A 4YDKL 3IDGB 2ICEA 2I26N 3KPPB 1SYVA 3MA9H 1WBXB 4Q6IB 3NPZB 4U1JB 5HVGB 5DJCB 1MY5A 3PGCA 5GJTL 3BKCH 1IQDA 1H0DA 4AJ0A 3BSZL 4OGYH 1TJIL 2DBLL 1R5IA 3H3BC 3QEHA 1K8IA 3GMMA 4KDVA 3IFPB 3ZTJH 4LLDB 1NKOA 1NFIB 2YPKB 1S7XB 3NN8A 4LF3A 2JCCE 4LVOB 4QTHB 4APQC 3VFNA 4W6YB 3BZFB 4HFUH 1MVUA 5JW4R 3ZHKA 4NQDA 3O8XC 2HFEB 4UV7L 2MCPL 4PJGA 5ILTL 2HJLB 2FHBA 1Z3GL 4YFEA 2IG2H 4B41A 5ALBL 4GW5B 4D8PA 5H8DA 2V2TB 4EUPA 1AIFA 4OFYD 1MHHB 2BDNL 2V7HA 1S7RB 2ZCKH 1N3NB 1BF8A 2FBOJ 3MRRB 2IQAB 2HTKD 1UVQA 1I3VA 1LEKB 2E6PA 5IT2L 3EIFA 4O9HH 1P7KA 2A83A 3TCXA 5DJAA 3UX9B 1AY1L 4F37F 3T0VA 4X4MA 1F3RB 1FLRL 5JDJA 3PDDA 3HPLB 1CD1A 5DEFA 3CNKA 3U1SH 5IV2A 5E6YA 5DHVH 3KPRB 4HIHB 1G1YA 1F90L 3KJ6L 4Z76A 4F8TA 1N7MH 2Y1VA 4UDUB 5GZOD 4ZFGL 4D0CB 1G6RA 3D85A 4JFXB 5CP7B 5E8PA 3BKJH 4LSQL 1ADQH 2D7PA 1QVOA 1X5HA 2Z8RA 1DN2A 3K8LA 5JUEL 2FCBA 3MXVL 3MV9E 4YHIA 4Z78B 2C1PB 5I8CA 4ORGA 4Q0XH 3HC0A 3RZWA 4WUUB 4I0CC 1FNGB 4ODTL 2DQJL 5FYKE 3P9WB 2AEPH 1K4DA 4R96A 3BPOC 4OF5A 4X9BA 3HNVH 2UUDK 3OKNB 4JVUA 2JF1A 5I71C 1JPGB 2D03L 4HH9A 2H8PA 4GQPH 4D3CH 1KGCE 3WDJA 4M43H 5FDYA 5TPWL 2NZ9D 3MLSH 4TNWF 2VWEC 3MRPA 3V6FB 3BN3B 1QLEL 4DZBA 1DLFL 1CXIA 3IF1A 1EFXB 2EEDA 3J7HA 1IAII 2Q7YA 4FFVC 1CE1L 1S9WA 5DWUH 3MV7D 5GGTA 1Q94B 3EUUA 4JDTH 1T89A 4Q9RH 3RWFA 1ZANH 4PJHF 1A0QL 4P5TA 3TEUA 3QQ4B 5JPMA 4XNYH 2C3XA 1JGDB 3I6LE 4JFDD 5AYQA 5HGHB 2DMKA 4TVPH 3F5WB 4R3SA 5FA3B 2CLVB 4M6MH 4PRHA 2FDBP 1OSZB 1G84A 3ZL4H 3VXOA 3O2DL 4JR9L 1T5XB 4KROC 2BCKA 2NX5D 5IFHH 4JAMB 5FFLA 1BZ7A 2VLRE 2WNGA 2C4XA 1FN4A 1CFVL 1DDHA 4P5MA 1B3JA 3DO7B 1U36A 4YHPB 3X3GH 3DI2B 1ZLUH 4NBZB 2EH8H 5FHAH 1EX0A 4TRPH 4NO5A 3HC4L 4JRYB 1X5XA 5EU6A 4APQB 2A6IA 2R9HC 4JRXD 5D71H 4YXHH 1E6JL 2HVJB 2J8UE 3K3QA 4D9QE 5FA4B 1LE5A 1KJ2A 3AC0A 2YUWA 1C5BH 4CN6A 4R4FL 1CDIA 3O8XB 5GS0D 3GGWA 1DEEA 3D69A 4W81A 4P46A 2A74B 4PJHE 2AK4D 5T1DH 5IKCB 4HAFA 1MWAB 4LLQB 3T0EE 5HYQA 4OSUL 4G6KH 3ME0A 2NYYD 5EIQA 1K8DB 3RX5A 1C08B 1KC5L 4IOFC 5CKGA 3VG0H 1GC1H 4ALAL 4LKCB 4Z7VA 1GYAA 1KYOJ 1R5VB 4Z95H 5EPMA 1UM6H 5IJVB 2AJVH 3V0WL 1MJUH 4OCWL 2DN7A 5FO8B 3BYTA 1WAAE 2PN5A 5C92A 1U3HD 4N1CA 3F58L 4LHJB 3TFKC 1UB5A 2CDEA 4NIKB 1SMOA 3S5LA 4OCSH 3L5HA 4X5WB 2BMKB 1FH5H 3VE0B 4HFWA 1C16B 2DLFH 4MNGE 3O2WL 2VDKH 3S7GA 4HK3J 3C60D 5TGBA 4YDLC 3W0WA 3CK0H 3CSGA 1XGRB 5DHXB 1NMBH 3MGOB 1MQ8A 1HXYB 3FRPA 4KK8D 3GSOA 4DKFL 3BPOB 2ICCA 4ZUSA 3U46B 3PE9A 3P9LA 3QEUA 5I71B 4JPWH 4BH8B 3GIVA 1FFNB 4KVNL 3GMQB 2ZKHL 2GY5A 5AZ2H 3MOAH 3QDGB 5JW4N 2DIJA 5DD3L 2HLAB 3S34L 3G04A 3LZFH 1VGKB 1AD9A 2AJUH 4DN3L 3D87B 4QXGH 3FMGH 1QKZH 3U79A 2R4RL 4LLVA 5CILL 1SY6L 4X0KB 2MWCA 2VZUA 5C0IA 2DYPA 5L2KB 3FN9A 5D9SB 3T2QA 2WAHA 2X89A 5E2TH 1U8PB 1FG2A 3DX8A 3P73A 1L0XA 3MRQA 1TVBB 3G5YB 4KROB 3PV6B 4K7PL 4UT9H 1MAJA 4BH7A 4GRWB 3SOBH 2EEBA 4YHKH 4IRJD 3LKNA 1H5BA 5IB1A 3QULA 3MLZH 4J4PD 1OAXH 2ZPKH 4HKXA 5F72S 5ACMA 3KLDA 4UMGA 1WISA 2PTUA 3BESR 3HG1D 2L0DA 1P4IL 4KHTH 4M61A 1JGLH 5GQBA 5I1GH 4LLYB 1WFTA 4U6YA 2DQIH 3BP5B 4GG8A 1X5ZA 5LGJB 1A9BB 4NUJB 4HWEL 3SDAD 4MXQD 3ZHDA 2IQ9L 4M93C 3FQTA 4PJ7A 4GMSL 3TNNB 2CKBL 5C70A 3FHAA 3WIHH 5C2BH 4TTDD 3U2SB 2UWEA 2BNQE 4L4VA 5FYJD 1XT5A 2GTZB 4CMMB 3B9KD 3IAPA 4OZFG 1ACYH 1NFDF 3I3BA 1G7JA 4NN7C 3GZKA 1FVCB 1BJ1J 3T3MF 4LSSL 3GUTB 1G7MB 5DO2C 4YHZH 1W0WA 4MJIB 1CFBA 5DVNA 4CNIB 3HI6H 2BVYA 3UAJC 2ZUVA 1K9TA 3MLTA 2B39A 1V7ML 4FG6D 4OCRL 4U1LB 4KFZC 3B3IA 1JYWA 3A67H 5A2FA 2DTMH 4QRSB 1UH3A 1IGML 4XCYB 4XVTH 4DK3A 5DJZB 1U41A 3GJFA 4Z8FH 2JB5H 4OM1L 4JPIA 1JWUB 4ODWA 5C09A 4TVSa 4LCYB 4FQ1L 2AK1H 4M7LT 4PPTA 5FIEA 5T3XL 1G7LA 1JVKA 3WO3B 2X4SB 1IAIH 2R2BB 1CN4A 1F11B 4NZRH 3FFCE 2AGJL 2WQ8A 1EEYA 1R3LB 2G5BB 1D5MA 1VKXB 1CGUA 3FB5B 5J3HD 2XG4A 3HS0A 3SDXA 4YDLB 4YXLL 1A6ZA 5BRZA 1QRNB 2X41A 4X4YB 2NR6D 3NTCH 2IANA 2MKLC 3D6GA 3P4NA 4NZJA 5JXAL 2HH0L 3TBVA 3L3OA 2WLZA 4Y4HC 3T3ME 3UTSA 1PKQB 5JW5A 2DD8H 3EYQD 4ODVL 1BX2B 3AS3A 1OTTD 1AGCB 4ZPTA 1DQQA 4LSUL 2AKRA 1KLUA 3WL9B 3O45A 1UWEL 3HI5H 4YQXH 1MJJA 4HWUA 5HHPA 3QIBA 4JN2A 1OAKL 3PWPE 5DRZB 2J2ZA 5TDPA 3ULUH 1UWXH 3TIDB 1UXSB 3CX5K 4LGSB 2B1HH 3JWDH 2VLME 3QIWC 2H41A 4A2MA 2CGRL 3U9UB 2Z35B 1QSZA 3I50L 3QPQC 1HH9A 5SWSB 3VWJA 3SO3B 4IMLA 4U1IA 4PGBB 4XMPL 3UJTH 4UAOC 3MACH 3LEYH 1T1YA 3HE6D 3TPUB 5C9JB 4F7MA 3BMVA 3TWCH 3P9MA 3N9GL 2YD9A 3NFPA 4R26L 2A6DB 3MRJA 2DWDB 3QEQE 4M03A 1U2HA 3T65B 5EU7C 4HIJB 4XBPB 1A6UL 4X6DA 5F7MC 2CK0L 4PJ9C 4TSAL 3EYUL 2WINA 4XHJC 4HH8A 2R2EB 3BW9A 1T83A 2FIRT 1F6AA 4LIQL 3ARSA 5GGVL 2KPNA 5ALCL 2NY1B 1NDMA 1D5IH 3OSKA 3O3BB 4M93B 4PJFA 4RGNE 4MAYC 2LE9A 3QH3B 1N6UA 3LH2L 3SE9L 3S36X 3TT3L 3VCLB 4U7KA 4G8EB 4UDTA 1Q9WA 5DFTA 3BIAX 4M48H 5GGVY 2WP3O 3B5HA 4FP8H 4LRIC 4UBDC 5FK9A 4PGDA 4AENB 2XNAA 3GBNH 1R3HB 1JPSH 1UFUA 2EDDA 3MFFB 4NN7B 2P42B 1MWAH 1QSFD 3Q5TA 1UXWA 1MUJA 5ISZE 3L1OL 1YJDL 5E99L 2ORBH 4KQ3L 5I1EL 5J57B 2F53D 1JTPA 3B83A 3X17A 4KJWD 5DDHA 4WEMB 4W70A 1ZVSB 4HXAH 1E4JA 4POZC 3SBWC 2E27L 3QNZB 1IGYB 1HOCB 3GM8A 2I5YL 3F7RA 3PP4H 3SJVB 4OLZH 1N8ZA 2YC1B 2R0KH 5I1HL 3WBDA 2BY1A 5D7KD 1MLBA 3FO9A 1Y18A 4N68A 2OZ4H 4PGEB 5IR1A 2V7NB 1OB1B 3WIIL 3LY6A 5DJYA 4J3VA 1CZ8L 3IKCB 1YEGH 1HIML 4EVNA 1D7FA 3OF6A 1CFTB 4XBEH 4TUOA 2FBJH 3WFHA 4HCRL 4EJ1C 4AYFA 4JO3L 5EU5B 2Q87A 4U7SA 3UC0L 5D1QA 4I0PB 4MD0A 3U48A 1MFBH 5EUOE 3RWDA 2IH3B 1NBZA 2H9GB 5C07D 3RVVC 1YEIL 2HT3C 3MBXL 1WBYA 3O2VL 1WITA 3LHPH 1I75A 3WKNA 4XAWL 4X7DC 3EYSL 4I18A 5DUBB 1X5KA 4Y4HB 3LN5B 2JJTC 3MR9A 4YDJB 1KV3A 3ZO0A 3GSRA 4IDLA 2AQ2A 2XQBL 3KYOB 3PGFH 4HAGA 4HEPG 1KACB 4C56E 1A1OB 3V5DB 3HMWH 4NP4H 1QQDB 4OF0A 2YKLL 1A7OH 1QYGL 5I66A 4N0FB 2JLLA 3L5IA 2IGFL 4Y19B 3VGHA 3V0VA 1T0MA 3R1GH 5C0BE 2J4WL 1LO3H 2Q76B 3QIWB 4P9MH 3QDJA 3ULVC 1S9KC 1FO0A 5DQDH 1I85A 4YE4L 2DJUA 4IM8A 1AJ7L 4O2FB 4DUXA 5EBWA 3UBXI 4Z7OF 2BNRA 2YR3A 2OP4H 1SBBA 1ZA3B 2R69L 3PG2A 3C2SA 2Z92B 3T0DA 3IFNH 5HYJA 2AI0H 2DS4A 4WHYH 4P2QA 3GNMH 4HQQH 4MX7B 5JHLL 4LQFL 5MENA 3KS0H 2HG5B 2PR4H 1IC7H 4PLJD 2DWEB 2X4RB 4PJ9B 1RUKH 1UT9A 3DX6A 3JV4A 1UG9A 3E6HB 3GMLB 3BQUD 1EV2E 1AE6L 3GSVB 3QEGL 1NLDH 3CXDH 4OLYL 3VXQB 2FEDC 2H1PL 4QHUA 3K2UL 4X5XB 5KW9H 5C0JB 3QO1A 4MAYB 1QNZH 3CUPA 4ORZC 4H8WL 5BS0E 3CPLB 1FV1B 1HHIA 4Q7DA 3S36H 2BHYA 5FM5O 1G9NC 3ILPA 4X7FC 4OKDA 1T4KB 4AEEA 3QQ9D 2VQ1B 1ES0A 2P8MB 4JHZA 1P5UA 1DQJB 4TUJA 4J1UB 1AP2B 5EU4A 1I9RH 3G9AB 4EIGB 2VXUL 4Z0XA 1JF5A 2GAZB 3DURB 4LASL 4Z7OE 3NCYP 3U6RB 3NH7L 3LN4B 4MQXC 1AO7D 2VSCA 4X7SH 5IW1B 1YQVL 5FV1L 4ZAKC 4HUMB 4TNVF 1ACZA 3BIKB 5J0BA 2W9DL 1U8IB 4HUWB 4J3XA 5JXED 1XF5B 3R06B 1OP5K 3T8XA 3IB4A 4N8CL 4NQVA 3LRGA 5DT1H 5HI4C 3MO1B 4S11A 3O6LH 1W72L 1I8IB 4TULH 4WI8A 3KPSD 1VENA 1EAPA 5BO1L 1FIGL 3V4PL 4MJ6A 1H15B 4MCZA 3D18A 3QHFH 4WIQA 1JNLL 5CBAB 3ALPA 1MFCL 4C59B 1F45A 3UO1L 3DX7B 2YA2A 4DGIH 2I9TA 2HAZA 1OLZA 3RPIA 1L0YA 3NIFF 5HGAB 4XCNA 2QADC 5HI3D 1IM9B 3OAZK 3BKYL 1CDUA 4LK4A 3LEXA 4H0HB 4HBQA 5EORL 3SDYH 3AAZA 4XH2A 4MNQA 5EC1B 4GKNB 15C8H 2DQGL 1RZJC 1T89C 1ORQB 4P5TC 4ZODA 1I7ZA 4PGJA 3E6FA 3IJYA 1L9NA 2VN4A 4G43A 4UQ3B 4MA8L 4YHOL 3HNSL 4N0CD 1S7QB 1MFDL 1ZA6B 3STLA 3UPAA 4ETQB 1RU9H 2ICEB 2OJZH 4Y88A 4H20L 2QHRL 4LAJH 3ARED 4GRLD 5TH2A 1SYVB 2IPTL 4KHXH 4R8WL 4YPGA 3U4BL 2YRZA 3U0WH 1BQHG 1L7IH 3TM6A 3PGCB 4RFEA 3X3FL 1IGTA 4P59H 1H0DB 4NJAH 4AIOA 4HS3A 1R5IB 3QEHB 1K8IB 3GMMB 1ZHBA 4WFED 4MB4A 1A6PA 2FX8H 2P7TA 1ZLWH 5C08E 3NN8B 3NIFE 1NSNL 4LF3B 4Q2ZA 5I15L 3I6GA 3VFNB 2GT9A 3H42H 4JY5L 2HWZH 4EI5A 1MVUB 3ELAT 2N56A 1RZKC 4XP1L 1D9KD 4NQDB 1AC6A 4KI5D 1RV6X 4P46C 1OP9A 1YPZA 4D8PB 1RUQH 5CKAA 2XTJE 4EUPB 1AIFB 3MV7A 3CDGB 3MCLL 2V7HB 5GS2D 4CADA 2MFNA 4NN6C 4OZFA 1UVQB 2RR3A 4P9HC 3VA6A 4JFDA 4D9RE 2A83B 3FAXA 2OQJA 1PLGH 1FL5A 4OZHF 4NC2B 1V5JA 2YD5A 3Q48A 4P23D 4PTTA 4JVWA 5DUPL 5IMOA 1CD1B 5DEFB 3MLVL 1U3JA 1CICC 5KAQG 2IBBA 2C5DC 1NCWH 1TITA 4RFOL 4Z76B 5I1AA 4KMLB 4OIIH 2IFGA 5CEYA 3GHEL 3D85B 1G6RB 2VLKE 4PJEA 5E8PB 4WRLA 43CAB 4LCCA 2C7UA 3U7WH 5DZLA 5DD5H 2BC4A 1NANI 4XNXH 3R8QA 5F70A 1WCBA 3NA9H 4PJBA 2BXZA 5I8CB 4HIEA 1DZBA 3Q5OA 4ORGB 2RHEA 3HC0B 4I13B 3GKWL 3BRDA 1AXSA 2DQCL 5EU3A 4XPHH 5DK2A 1EAJA 4FFZH 1JMZA 1K4DB 1Q0XH 4R96B 1HQRB 5AG8A 5CBEB 1OGAD 4V1DA 3L5XL 2QSCL 2Y6SC 2AK4A 4CDHA 4NKMB 4LBEA 4NYLA 4HH9B 4LSDA 2H8PB 1YEHH 3U9PL 4XPFL 5I8KH 1CR9L 1G7IA 4Y5XA 5EO1A 3DMMA 3OKOA 4KKLD 3MRPB 1Z9LA 3N1PC 2QADB 3RY6A 4DZBB 3IF1B 4NC1E 1NGPL 4I3GA 1EXUB 4P2RD 2Q7YB 1S9WB 2A73A 4U3XA 1U3HA 3MLPA 5BJTA 4EN3D 5HYFA 2PYFB 4HUXA 3RWFB 3H9ZA 2FX7H 4P5TB 5EWIH 1JZ2A 1F4AA 4QT5A 1MJ8H 5JPMB 4N8VA 4LGRB 5JORA 5T3XE 2D4DA 5KSUA 2VIRA 4R3SB 2CDFA 4PRHB 3LS5L 4LU5H 1NC4A 1NUDA 3C60A 1A47A 1CWVA 4LCUA 4DKEH 1PZ5B 2BCKB 3MV8B 32C2A 1YY9D 4OQTA 3MLWL 5HGBA 3F62A 3TIEA 3VXRE 1CLCA 3RWJB 1BZ7B 2B8OT 3BT2H 1D6VH 3IRPX 1NEZG 1DDHB 3WHE0 1KIPA 3RDTD 1UM5H 1U8NA 4RMUA 4K3EH 3MRGA 2ADFL 1JWSA 4NO5B 35C8L 2A38A 3O9WD 2A6IB 5D7SH 4ZS7L 1P5VA 1QPXA 1HI6A 1T6VN 2IADA 4L3ED 2A0LC 1LE5B 1KJ2B 1OF2A 4CL7A 5KS9A 1OWRM 5IFAL 4LAQL 3GGWB 1DEEB 3D69B 1FFPA 4P46B 4HGKC 4ZOEA 4XCFH 2XFXA 2YUZA 2VDLL 2YPLD 4RX4A 5HYQB 3TBSA 4FQLL 5DMKA 3RWHA 4DKAA 4NN6B 4S1QH 1BGXL 3MODL 3TO4D 1IBGH 3BHBA 4G80A 3SEPA 2KQNA 1MEXL 4Z7VB 4AT6A 3IFLH 4JM2F 3HCVA 4WFFD 5EPMB 1A3RL 2IC2A 4MS8C 4OBRA 4KKBC 1N59A 4H26B 1FVDA 1PEZA 5DK3A 3DVGA 1XR9A 1CICB 1DP0A 3MUZ1 4PJ5B 4UIMA 4R7DA 5AZEH 1HHJA 4OGXL 1QBBA 1NCCH 1X9QA 1UB5B 5D4QA 5DD1L 4J4PA 1NGZA 1X5GA 2D4FA 3S5LB 5DK0A 2MPAH 3RJDA 4U33A 2R1XA 4JN1H 4NM8H 4HFWB 4F7PA 2XY2A 3KXFE 3O4LD 2B4CL 1P4BH 5GSRA 2P8LA 1QR1A 4ZG1A 5JW3L 2D7QA 1U6AL 4WHDA 4IMKA 4PS4H 3GSOB 5HHQB 1B4RA 1YQ2A 5F6HI 3OKEA 2EDHA 2MKWA 1S9XB 3P9LB 3QEUB 1OM3H 2KBGA 3QG6A 4HC1A 3OXRA 4XXCC 3GIVB 4NWTH 2C3HA 5T1LD 2CDGA 3IJSA 4DZ8A 3DGCR 1EGJL 1A7QH 2X4QA 4LMQI 3G04B 1VACA 4ZUUA 2B2XL 1AD9B 2BSSA 5CSGA 2FGWL 4QNPF 2DI9A 2J8UA 3E0GA 3I3EA 3WFCH 2I07A 1WWCA 1Q9OA 2VXQH 5C0IB 2DYPB 2RJMA 3KHQA 4BYHA 1B0WA 1P6FA 2R1YA 4L3CA 4NSKA 3CSPA 3T0EA 1FG2B 3MPCA 3DX8B 1ZGLA 2VKXA 4X9IA 4L29A 3P73B 5DC9B 2CRYA 2D7TH 5SV3A 4X6CF 5FCUH 2PYEA 3S3PA 1AXTL 2APWA 2HLFC 5CEZH 5JO5A 5MI0B 2H32H 3MRQB 4UUJA 3SY0B 4U7MA 4WW1A 3ECBA 2EXWD 1A1NA 2HT4D 5C0ND 3UYPA 2F9BT 4WU7A 2FB4L 3LKNB 1TDQA 1JF1A 1H5BB 2BVQA 4JFFE 5IB1B 1G6VK 3QULB 1YC7A 4MB3A 1WAAA 4HKXB 4PRIE 2PXYD 1FHGA 2AERT 3L3GA 1E6OL 4CVZA 3ULVH 1QUNA 3WUWG 4Q9CA 1FQ9C 4M61B 2FNBA 2WQRA 4U6YB 4XVJH 4FQQA 2XIDA 4GG8B 3Q1SL 1T83C 3SDCD 4IIQA 2XWJB 4RAUA 4Z7WA 4QOKD 1NPUA 1N64L 1TVHA 4PJ7B 4MNGA 2AVGA 3KDMA 1KN4H 4LEOA 2ICWA 4NDMA 4HMCA 4TUKL 1NANH 4YBLB 2UWEB 4L4VB 3HC3L 1SJHA 3ARVA 1N4XL 4M8VA 4FNLL 1G7JB 3T4YB 4GRMA 4ZD3L 2CLZA 1KXTB 1NUGA 4PJXA 1C7SA 2VDOH 4X6CE 1W0WB 3INUH 5I1KH 1J8HA 5E9DD 1ZHLA 3MLTB 1NBVH 3B3IB 4AEIL 4JREC 1LDPL 4P4KD 1PG7W 3L9RA 4BUGA 1T3FA 2DL9A 2DI7A 1WFUA 3GJFB 1TFHA 5L88H 1G9NH 4JPIB 3BOVA 1VFMA 4ODWB 5C09B 3AUVA 3DI3B 4EZMA 4WHTA 3Q6GH 4KVCH 2EICA 2AV7B 2YBRA 3VGFA 4EQ3A 5F7HA 2AEIT 4G9DA 4KPHL 5ESQA 1NGXA 1EEYB 5IGXL 5TE7L 5D7IE 2P5WB 1D5MB 1NC2D 2APTA 5E95B 4TOYH 3SDXB 1A6ZB 3K80A 1F13A 3LEVH 5SWQA 4AMKL 4FXGA 3WXWH 5B38G 5ITBL 1UYWH 1PX4A 1MY7A 4G5ZH 2OL3A 4PG2C 2IANB 1OCWH 2E7LA 3GK8H 3P4NB 2VUOA 5E8DH 1F00I 3TBVB 2ZJSH 3L3OB 5E6ID 3CLEL 3UTSB 5ENWA 5J89A 4OT1H 5JW5B 5TDNA 5MP6H 1IGIH 5I19H 4ZPTB 1T22A 1DQQB 2AKRB 1KLUB 3O45B 2BFVL 4K2UL 1CIUA 3E3QE 1ZS8A 3ARGD 1MJJB 1NCBL 5HHPB 4B50A 4FQ2L 4JN2B 1S5HA 1AGEA 1MCDA 2HKFL 5EOCL 5TDPB 3U7YL 4JZNA 3REVB 1INDH 5K9QI 1BQHA 3VXSE 43C9A 4AEFA 2KQMA 1IE5A 4LCWD 1RZJH 1W0VA 3OX8A 2OK0H 1I85C 3NZ8A 3RWEB 5I18H 3A6CL 4K7FA 1HH9B 1EBAA 7FABH 4JHBA 2C9AA 3G6JA 3NCEB 4NCC1 4U1IB 1T1YB 3GM0A 4J8RA 3LRHA 5B21A 2CK2A 3P9MB 3NFPB 2E7HA 2VDRL 3ZTNL 3MRJB 4QTIH 3E8UL 5C07A 4JE4B 4X6DB 1DL7H 4H88H 1PQZA 3VFSB 1BVLA 5IF0B 3BW9B 3Q2CA 1F6AB 2HP4A 2BVTA 3RRQA 1NDMB 4KK5C 4BSVA 4ZFOL 3CJJA 3QA3A 4HBCL 4LPTA 1RZKH 5IWLC 4IDJL 1ZLSL 4UDTB 1Q9WB 2H2PD 4BZ1H 3MTRA 2EYTA 4MLSA 5FK9B 3MJ6A 2J88L 2XNAB 2FECI 2VOTA 3HE7D 1UXWB 3F7YA 2VAAA 5AYUL 1A5FH 3QWOA 4MZ3A 2X4PA 2EDYA 2XZZA 5DDHB 4XAKD 3JWNC 4QO1A 4P9HH 3UCRA 4XP5L 4NO0A 1O7SA 4JREB 3FN0H 1N8ZB 3NIGF 3OB8A 2F74A 4PJIF 2EDKA 1GIGL 1MRCL 1MLBB 2R0LL 3UYOD 2N7AA 3FO9B 1Y18B 3PWPA 5CLTA 3TZVA 5IR1B 1CF8H 1UCBH 5DJYB 4F9PC 4EVNB 1IEAB 3WFHB 2NY3B 1CK0L 4P49A 4HIXH 3T0WA 5D1QB 4UU9A 4MD0B 3VG9C 3RIAK 3ROLB 3RWDB 2JK5A 4X80H 1NBZB 3LRSB 2NNAA 2WWMD 1N6QH 1HWHB 3ALXA 1WBYB 4ZTOH 4HWBA 2AQ1A 4JG1L 4I18B 2EE9A 3KYKH 4ZSOA 4AL8H 4ZO6A 2GSIA 3MR9B 4R6UA 1JP5A 3GSRB 1UENA 1LO4L 4H0GA 4QEGA 4OV5A 5E2UL 1U2CA 3NIGE 3BP4B 3PHOB 4G6FB 3BDYL 4P3WA 3CSYB 4CVXA 4OD3H 4PJIE 5HBBA 5FKPB 5I66B 1HXMA 2CIKA 4Z18A 3H9SD 5SX5H 2F19H 1T0MB 2V2XA 5L9DH 2NY4B 3TA3D 3QDJB 3EYFA 3M45A 3KPSA 4YDVA 2P5EE 2Y07H 3GMNA 1FO0B 2ATPB 1NEZA 2A77L 3BP7B 3FT3A 5EBWB 4JG0L 1KN2H 2BNRB 3EKCA 5FGRA 5FYKD 1EZVX 4XWOD 4KK9C 2ZUTA 4TQEH 1IKFH 5FUZH 1CGTA 4NKIL 4Y4KC 5HYJB 3NCMA 3GRWL 4EI5C 5D93C 4P2QB 2EDTA 1EO7A 2CLRA 5MENB 4F58H 4M1DL 5BMFL 4HGMA 4LSRL 5M95B 2XA8H 1RVFL 4GRWF 3DX6B 5T5FH 3JV4B 4DGYH 1K2DB 1K6QH 5JR1L 1RZ7L 4QHUB 5JMOC 1JGEA 3QO1B 3QI9C 5DURD 4FQJH 3BKCL 4IS6A 4ONHB 3CUPB 2F58L 2E7CA 2G2RA 3QDGE 5LWYL 4OGYL 3MA7A 1HHIB 1CFQA 1VEOA 4BSWA 4GO6B 4LLWA 5D1ZD 2XZCH 4LDLB 3WFBL 5EUOA 2HKHH 4S1SH 4F9LA 1ES0B 4TUJB 5EU4B 4HFUL 4OD1H 4Z0XB 5F93C 3DV4A 1HHKA 3OKLB 3VFTA 4HPOH 4JQVA 2O5XH 5C7XH 2VMFA 4X6EA 2IG2L 2VLRD 1TJGH 5TQ2H 4PD4K 3VFVA 3T8XB 3P0YH 3P30L 4CJ0A 1D9KA 2R56H 4MA7L 1U58A 3L95A 2VDQL 4DN4H 1GZQA 3X11B 4K9EL 1EAPB 3GJFH 1P7QD 4GRWE 1RJYA 4MJ6B 4QRRA 4MCZB 3D18B 1FJ1A 3W39A 5C0BA 4LRNH 5FYLH 3OG6B 3F6LA 3VFGL 3BKMH 4JO2L 2I9TB 5J8OA 3FB6B 1M7IA 4WCYH 4Y5XC 3U1SL 4GW1A 3P0VL 3RPIB 5J6GA 1HKLL 3DMMC 3V6OA 1N7ML 4R2GD 3VG9B 3E1F1 3W11D 3RY6C 3C5JA 3LEXB 4P23A 1ZV5A 4ZPVA 4Y2DC 4XH2B 4MNQB 5BV7C 2YN3A 5I30H 3Q0HA 1JPST 4JZOA 2GJZA 3WSQH 5LG1A 3K4DA 4FQHA 1WK0A 1I7ZB 4QF1A 3E6FB 1RUML 1GXEA 3IJYB 2XQYK 3L7FA 4G43B 1BLNA 2AEPL 5H37G 1YEEL 3GJEA 4M9OA 3STLB 3TVMD 3VWKD 1JV5A 1FE8H 4ZOCA 3FJTA 4MJIE 1CLOH 4D3CL 4HWNA 3QHZH 2Y5TA 4YPGB 4JKLA 2VXSH 2PCPA 3GSQA 3O2DA 3OJVC 2ZOLA 1WZ1H 4RMTA 1JF6A 4N9GA 4TNWK 4RFEB 1IGTB 1N2RA 4PFEA 1IC5H 1HKFA 4OM0H 1I1AC 3V4UH 2J7LA 4HS3B 3DPBA 4FFWD 2P45B 2HRPL 2PO6C 5GGTL 2O61A 2YD3A 1M7DB 3WUWA 5CSBA 3KWWB 2YA1A 4PJDE 4ETYA 1XF1A 2UZIL 4U1KA 4Q2ZB 4QXUL 4W4NA 4JPVH 1IQWH 3DXAD 4EI5B 5D93B 3FN3A 2FH6A 4D94A 4XNYL 1OPGH 4MCYA 1V3LA 2XWTB 4BFBD 1OTUD 4TVPL 4P2RA 1HHHA 1YPZB 4M6ML 1JGUL 5JW4Q 1I7TA 3U30C 3CFIC 3MV7B 4ESKA 4CADB 5IFHL 4OZFB 4QHKJ 1IEHA 4XCCH 3MFGB 3PABA 2PKDA 1KENL 4QLRA 3WN5A 1DQLH 5I76A 4JFDB 1ODAA 3S37X 3WNNA 2OQJB 1FL5B 3LB6D 3VA2C 3ZT5A 4PTTB 5FHAL 5IMOB 1J05A 3B5TA 4K71C 1KJ2L 1MVFA 1C12A 1EO5A 2HFGL 5CUSL 5I1AB 3GHBL 1EHNA 5F7EH 5B4MD 1QTYT 4L9LC 2NY5L 3EZJB 5DJDA 2A6KB 5CEYB 3RDTA 2Y06H 4PJEB 2DJ4A 1QBLL 4NWUH 5I8OH 3MLUL 1S9VA 2BC4B 3DSFH 3UYRH 1LO2H 1R3IL 3WD5H 4MXVF 5T1DL 1WCBB 3VXMD 4YX2L 1IGJA 4PJBB 4LDEB 1F4HA 3T1FA 2K7PA 4OD2A 4GAFB 1GGTA 4HIEB 3JWOC 1J1PH 3OKMA 5LCVH 5C0RL 5JHDD 5EU3B 1TETL 1GC1L 4GAYA 3BH9A 5DK2B 5GGRA 1EUTA 4RAVA 5F96L 4V1DB 2XPGA 2AJVL 4HX1A 4LBEB 1MJUL 4NYLB 3H3PL 3QT2A 2LV4A 2YSSA 5TJWK 3S3JA 3T2NL 1G7IB 3KPLB 4Y5XB 3W82A 2O5ZH 3FFDB 5EO1B 2BNQD 1A9EA 4I48B 4F2MA 3DMMB 2RFXA 4FQIH 4EBQH 3OKOB 1C5CH 1Q1JH 4LCIH 2I27N 4K8RC 1JTTA 5A2LH 2UYLA 3LV3A 4Y4FA 4RMSA 4Y2DB 2DLFL 1DBKH 5BV7B 2V6HA 2A73B 3VH8G 2ZUUA 1U3HB 2VXVL 3QCVL 1A6VH 1KXVC 4UTBH 4XPTH 1ZT4A 4HUXB 1SY6A 3BISA 4QT5B 1HYSC 5TE4L 3B43A 1ZWIA 3UTTE 2A9ML 4N8VB 4WENB 3T0EC 4KJPC 5JORB 5KSUB 4MXVE 3SGDI 3C6LD 4OF3A 1WSST 1F4YL 2E6JA 2VIRB 4K07A 3DVNB 3CD4A 3BZ4A 1I8KB 1NC4B 1YY8B 3C60B 4LCUB 4F33B 5D70H 4EOWH 3MOAL 5HGBB 3TIEB 2DQEH 3SJVE 1A3QA 5B22A 4ZNEE 4OBSA 1KIPB 1QFUH 1U8NB 5BOZG 3AU1A 2PO6B 4HJJH 3MRGB 3FMGL 1F4XH 1QKZL 4RWYH 1JWSB 1FO0H 1FNSL 4B53A 4M7ZC 1MCRA 3TYGH 2VLKA 4G6ML 3EDJA 1HI6B 2IADB 3OL2A 4P2OD 3N1QC 2AXJA 5FUOL 1FGNH 1TTGA 1OF2B 3QQNA 4KU1A 4ZQKA 1GPOH 4ZUVA 1PAMA 1FFPB 1RIUL 4XB8A 3CVIH 2YEZA 3IDIA 2XFXB 3MREA 1UACH 3U30B 2F54A 3RWHB 4CBPA 5DMKB 4UT9L 2L7JA 4NKQB 4NNYA 3RUGA 3BHBB 2EYRA 4G80B 4ODHH 1I9JH 5GZNC 2Q7NA 4P2CG 4AT6B 4YPJA 3SGKC 3EYOA 3OXSA 1JJUA 3HCVB 1N59B 1JIBA 1FVDB 5JIKA 3S96A 5I1GL 3S6CA 5F1NA 4OKVA 3I02A 1I4FA 1TPXC 2DQIL 3DVGB 3TN0A 1XR9B 4YHML 4I9WD 2IF7A 4UIMB 1ZVHA 4R7DB 1HHJB 2AJYH 2W59A 4DW2H 4MQTB 5KVFH 4L9LB 5DMIH 4JFEA 1NGZB 3VFPA 3A6BH 5DK0B 3TJEL 3CLFL 5CZXD 12E8L 1OWWA 1DSFH 3KLSA 1OT1A 1FGVH 4MMXC 1LO0H 3SDCA 4QOKA 3ZSTA 5D72H 4F3FA 4LOUC 2P8LB 2W1NA 1E28A 1QR1B 4HIIA 2AJXH 1Z0MA 5J12C 1JHTA 3BAEH 2H6PA 3OKEB 5ANMA 1MCPH 4M1CC 3VXRA 1OAYL 5F7WC 3QG6B 2EE3A 1Z9MA 4KKCD 4XVUC 5JQ6H 3OXRB 5E4EC 5F7LB 2E7LC 1NAMH 1YEKH 1CBVH 4YH6A 2EYSB 3NA4A 5EU7E 3FQXA 2CDGB 2DTML 3IJSB 4PB0H 4DZ8B 1PBYA 4JO1L 4KRNA 5JIIA 4Z8FL 5T3ZL 4QKXB 4XWGH 1VACB 1WIPA 4ZUUB 2BSSB 3ZZ1A 5GIRA 4OZGF 2J8UB 4YR6A 3KPOA 3DROB 1N0XL 1RZFH 1CG9A 1CLZL 1PDKA 3DHJA 4W68A 1Q9OB 2QQLH 5C0DA 2ATKA 1OAQH 2R1YB 4L3CB 3BRFA 4NSKB 3T0EB 3CFKA 4GOSA 3V5KA 1ZGLB 3LS4H 5F9JA 5DA4A 5AD0A 4L29B 2RQ8A 5CIPH 2PYEB 3NTCL 3I85A 3OAYH 5JO5B 4UUJB 5F1SA 5EDXA 4WW1B 3ECBB 3T08A 3JUZA 3D2UD 1A1NB 2DD8L 3HZYA 4WU7B 5FB8A 1R0AH 5CINL 1JF1B 2BVQB 3D39E 5DVKA 5E5MA 4X9HA 3RVUD 5E4IA 3X13A 4QRPD 4ERSH 3T77A 1MHCB 3BI9X 3L3GB 2A9NH 4U1SB 4GSDH 4CVZB 1BFVL 4BQCA 1MJ7L 5F97E 1U3ZA 1JBJA 4XTRD 2DQUL 5EZOL 5K9JH 5KTEH 1V7NL 5E6IA 3WJJC 1A7NH 2CO6B 3ULVF 4IIQB 4Z7WB 2VSDA 4RAUB 4LP5A 4X7CC 5T1KD 2B1HL 3ARBA 4OZGE 1B0RA 4JFZH 1TVHB 4MNGB 3KDMB 4G8FA 3WS6C 1J1XL 3KXFA 2ICWB 4NDMB 3DBXA 4YIQA 5DD0H 1UJ3A 5ID0A 3QRGH 4JLRA 5JOPE 3IVKA 4KTYA 5CMAA 2DQDL 5D2LA 1SJHB 5F7KC 3UJTL 5IP4A 1EZVY 4GRMB 3TBYA 3ARYA 1AHWA 2CLZB 2Q6WA 3MNVA 1IT9L 4PJGF 4JHAL 5GJSL 4FZ8H 1FC1A 4KRLB 3RGVA 1YYMH 4FZEH 1J8HB 2QQKH 4JPKL 4MSWA 4XB7A 1KEMH 3KPMA 5KOMC 2CRMA 1BQLH 1GGIH 2VQTA 3IU4L 3L9RB 1TPXB 5IESH 1T3FB 4L8BA 1B2WH 2OX5A 3EO0A 2JB6A 5SWZD 3TZVC 4NUGH 4WHTB 2NW2A 4FTVD 1ZTXL 1EJOH 2WIMA 1DBAH 2YBRB 3ULVE 2DKUA 4PGCA 4M48L 4GXUN 5JQHC 4G9DB 4I8DA 5ESQB 5ICYA 3HZVA 2Y9RT 4FP8L 4OZ4A 4GFTB 1VERA 2NLJA 4WI9A 5IEKA 4HCRA 1A21A 2F8OA 5J12B 5D7LD 5SWQB 2ORBL 3SGDH 4FXGB 3NGBC 4BSJA 2OL3B 4HXAL 3UTQA 1KFAH 2VN7A 1CU4L 4PJGE 4CW1B 3PP4L 2DM4A 5ENWB 5TDNB 2F5BH 1RULH 1T22B 3HKFA 2OZ4L 5LGHL 4UILH 1FVEA 1ZS8B 3OR7B 5KVDL 3OBAA 1S5HB 1AGEB 1B90A 5GISH 4RGNC 5EZIH 4JZNB 4P99A 4XBEL 3KLHD 1MRFL 5K9OA 1MOEA 1MF2L 3C8HA 4X4ME 4Q58C 3V8CA 5BV7H 1QO3A 1TZGL 4PJ8A 1BQHB 43C9B 1DE4B 2LABA 4X99A 1NJ9A 3BH8A 4PYGA 3RVWC 1RY7B 4G8GD 3W5MA 1W0VB 3OX8B 3ZT7A 3NZ8B 1SEQL 5FYJU 4K7FB 3VXNA 3TC9A 3G6JB 5CGYD 3LDBC 4Y5YA 4Z7NE 4ZUTB 2CO7B 4U6XA 2CXKA 3BUYA 3EFFA 4KTEH 1CDCA 5INCB 1YNTA 1MRDH 1T2QH 3WLBA 3NACH 3PGFL 4UINH 1HINH 5DZNA 4GJTB 3X14A 1S3KL 2NQCA 4TPRH 5J9PA 1PQZB 5F9WC 2BNUB 3T04D 5D96C 1BVLB 4NQCD 3P4LA 5KANG 4ZS6C 3MUGA 2DOCA 3L3KA 3OAUL 1NGQH 3WE6A 2H26B 3FFCB 3GIZH 3QA3B 3KR3H 5D7IA 5DQDL 3BX7C 3HMXH 1EERB 2G75A 1GOFA 2EYTB 2Y72A 5LQBH 4F9LC 2HRLA 1BVKA 4RQQA 1ORSA 4TTGA 5HHVH 1MLCA 2AI0L 5D7JD 3TA3A 4JHWL 3F7YB 1MIEL 5FYKH 2OR7A 2VAAB 1ETZA 5KVMC 4U0QB 4DQOH 1FZOB 3QWOB 2X4PB 2VL5A 5GRJH 2OTWA 2PR4L 5IM7A 4NO2A 2FEEL 4NO0B 2GFBA 4PRHE 4N0UA 4Z7VF 1NLDL 5C08D 5I16A 5GS1C 5KW9L 3PWPB 4XP4L 2FZ3A 1FORH 3TZVB 5EBMA 1QNZL 5HVWA 4YWGL 5E56A 3TCLA 4E0RA 1AGFA 1W72A 3RVTD 1KB9K 3EJYD 3VXSA 4B5EA 2B7DT 5GGUA 2JIXD 5E03A 5A1AA 5DA0B 1BF2A 2XZAL 5C3LD 1SM3H 2JELH 3V6OC 5E5RB 5EU6E 4CRPA 4UU9B 5BVJA 1NLBH 3JWOH 2NNAB 3EDKA 3NGBB 2I9LA 1OP3K 3MV01 2AAVA 4KJQD 4D9RD 3QEQB 4MA1C 1OW0C 1WEJH 1AGDA 3RY5A 4JDVB 4K3JH 3QYCA 2GSIB 4HC1H 4OB5L 3WDHA 2GYSA 1FRGH 1F58L 4HKBA 4PJCE 1HSAA 3QXDA 3UP1A 5ITFA 4FXKA 1Q72H 4OV5B 4GAGH 2FWOA 2ED9A 2YRLA 1IVLA 25C8L 3UPCA 1UH4A 4G3YL 1TQBB 4Z7VE 4CVXB 4K8RH 2W9LA 4RGNB 1HXMB 2CIKB 1JGVL 5DFVD 2V2XB 4YJZL 4F7EA 2IAMD 4Z9KB 3EYFB 3KPSB 4YDVB 3RHWK 1P7QA 3MYZA 1NEZB 2GI7A 2OSLB 1FSKC 2NY6D 3SHSA 2EXYD 3NFNA 3SDYL 1KJMA 5CZVH 3LDBB 15C8L 3IETA 2NY2C 3HA0A 5AUMB 1CDHA 1S5IL 4GLRH 5F8QC 3ZYOA 3ZYJA 4WNQA 4LHUD 4N5EC 2CLRB 2EZ0D 4XP6H 1GSMA 4MJ4A 3BP6A 3W0WE 4O4YL 5TDOA 3WXVH 4HHAA 1RU9L 3QDME 5D96B 3OJMB 4KHXL 4WO4C 3CFDA 4P48A 1E4WH 3BGFB 5I1CL 2DKMA 5GHWH 4KDWA 1JGEB 3WN5C 4H1LG 4IS6B 2GSGA 2G2RB 2CMRL 3AMKA 4GBXD 5DYOB 1JZ8A 5A3ID 3QWQB 3MA7B 1CFQB 2RAMA 4I0KA 4BSWB 4IOIA 4LLWB 1MCHA 5EUOB 1C5DA 1QA9A 1PFCA 4PJ7F 2C3WA 5EIIB 3UDWA 2HWZL 4IEFB 4WY7L 4OTXH 3ILQC 2RCSH 3O6FC 1P53A 3DV4B 3PWLA 4KDTA 1HHKB 5FHBH 3VFTB 2UWEF 1TJHL 2E8YA 4X6EB 3HFML 4JKMA 2CRZA 1MCCA 1RK0B 1S7TA 3VFVB 3LKPA 4FMFA 1IAIM 2VH5L 3DXAA 4C56B 1D9KB 5GS1B 1U58B 4PJIA 1OLLA 1GZQB 3D3VA 2DF3A 4QRRB 3JV0A 4MVBC 3ETBF 4FQXC 1FJ1B 4OCXH 3BEVA 3W39B 1PLGL 4I77H 5C0BB 3RX7A 1EMTL 1V3KA 2N7BA 3NCCB 2VISA 3WFEH 2P5EA 5TE6H 4L8CA 5HD8D 1M7IB 2AP2A 4PRNA 4HLZH 2V17H 4GW1B 5J6GB 2LU3A 1IM3A 1RJLA 4JFHE 2I60H 2VITA 2VLJD 1RUPH 2BJMH 2H2SD 4Y4FC 4OF7A 1CTOA 1H3TA 4P23B 4PJ7E 5DD5L 4ZPVB 3ARDA 3LIZL 3ARFC 4XNXL 3IDYC 3SDXF 4MA1B 4ZXBD 4OJFL 3HB3D 2OL3H 5GS0L 4JZOB 2GJZB 4J3TA 4L4VE 4FQHB 1T04A 2NY0C 2XTJC 4QF1B 4MQ7A 2CJUL 4Z0BL 4XPHL 3RZCA 3L7FB 1KCKA 3QFJD 3SDDA 1GGYA 5D1XA 1HZHL 2NXYC 3ARTA 3K1DA 5LGKA 4LFHD 1I8LA 3GJEB 1JV5B 5HGDA 1UB6A 5F7DA 4K3HA 4M5ZL 2Y5TB 4WEUD 5HI5C 4JKPL 1H8OA 2YD7A 4KV5F 1YNKH 4NZUL 1JZ5A 2PCPB 2ZOLB 5E2WL 1OVZA 3MJ7A 1NL0L 4N9GB 5I9QB 4Z6AT 5C71A 1N2RB 5BW7A 5BVPH 1YEFH 3NAAL 1RZ8A 2VXTH 3P4OA 3RBGA 3MBEA 1FSKB 4MZ2A 5HHOA 3VDBA 2O61B 1QFWH 5C09E 1KCSL 2QBWA 1QHPA 2DRUA 2HT2D 3WUWB 5GRVK 5F44A 3EO1B 3BEWA 3ZKND 2NY2B 4Y16D 1CXLA 4YFLF 1KG0A 3OHXB 4YEFA 2ADIB 1ZE3C 2FX7L 5CJXA 4ZDHA 4U6VL 4Q9QH 2Z8WC 1IJ9A 1DVFC 3SDXE 3KNBA 2HTLC 4P2RB 4OQTL 1HHHB 2APFA 5BRZE 1PD6A 4HG4J 1MH5A 2B0SL 1T6WA 1I7TB 4XMKL 5IROA 1KTRL 3WFDL 4PRPD 4WO4B 2IANE 3EDDA 3PABB 1KBGH 4H25A 4EDWH 4KRPC 3WN5B 2Z93B 3UTSE 4X6DF 5I76B 3C6LA 4GKSA 2RIKA 1GAFH 1CL7I 1MCOL 1UM5L 3OMZA 4S2SA 3SQOL 5JIHA 4CGTA 1GOHA 4PP1D 4KV5E 4PLNC 1PSKH 3T2PA 1JHLL 3TN0C 2X44D 3WMSA 1OSPL 4PJFF 1C12B 3IU3A 1ZLUK 4NC1C 5KSAC 2Y23A 4E41D 3O6FB 1TZHA 5EA0H 3MRKB 2G9HB 2J12B 1S9VB 3G08A 4LSPH 5IB5A 4HJ0D 3N85L 4PRID 4XCFL 4QHLA 1FCGA 2EDQA 2VR9A 1JMXA 4OD2B 4POUB 3T1FB 2AJZA 3T4AA 2DQTL 3MLXL 2APXA 1W8OA 3SCMD 4GAYB 3BH9B 5GGRB 4RAVB 2GITA 3IFLL 3ORJA 2WZPD 2Q3ZA 2XPGB 5H2BA 2HFTA 4HX1B 1AFVH 2FX9H 2K1MA 2YSSB 5KG9A 1RSFA 1EJ6A 3LD8C 3FTGA 3M8OH 3NFSL 3GBML 3T3PF 2YMXH 1A9EB 1L6ZA 2VL4A 4F2MB 2RFXB 3T0XA 4PJDA 3HLAA 5JPNA 3AM8A 1EGJA 2UYLB 3LV3B 4A6YH 4KQ4H 1B88A 2MPAL 4Y4FB 1JPTH 3NCBB 4ZTPH 4PJFE 5A40E 5BZDA 5C6TL 3IAGC 3IDYB 1AKJA 4G7VH 1ZT4B 1FIEA 1A7PH 1P4BL 4HWBH 3KLAA 3AXLA 5LBSH 1ZWIB 2NY0B 2XTJB 4PS4L 5FYJL 4GAJH 5IQ7H 4PB9L 2A1WH 4K23L 1U8HB 1ZMYA 4DAGL 1F4WL 5JA8B 1WZKA 3KVQA 2IALA 3OG4B 5FXCH 4LSTH 1LK2A 1UM4H 5FECA 4WFGE 1A7QL 5J11C 5DMGC 1P9MA 3EJZD 2YWYA 1B6UA 4OFKA 3TJHC 2ZG2A 3AU1B 3ZYIA 4HXBL 4U2YA 2KZWA 3T3PE 1EIBA 1ZLVK 2MQ3A 5GJTH 1BJ1H 3WFCL 2VLKB 3BSZH 1DUZA 4U1GC 5IHBA 3ARBC 1X6LA 3B9EA 2IPUK 3I9GL 1XF4A 4ZQKB 1WJ3A 5TF0A 4ZUVB 1UJ3C 5IQ9A 1BOGA 5FCUL 3IDIB 2CKBB 2YEZB 5C3TA 3MREB 5CEZL 3MUHL 4RBPH 2F54B 3QXWA 1CVSC 2MCPH 1AHWC 2X4NA 2VZVA 3V52H 5ILTH 3WJLA 1Z3GH 3RUGB 5ALBH 2EYRB 5CJOL 1RMFL 3RGVC 3WUZA 3EYOB 2BDNH 3OXSB 4NT6A 1YJDC 1TNNA 2JKXA 4J3OC 4JM2C 3S96B 2ZUQC 1VHPA 3KPRD 4JDZB 4OKVB 2EH7L 3I02B 4ODUA 4RIRA 5F1NB 5FGCE 3TN0B 3ZKXB 5J13B 5J6HA 5IT2H 5HHMD 1WF5A 4NJ9L 4IHOA 2HMIC 5KSAB 3GI8L 1EH9A 4WWKC 4OLEA 1AY1H 2ZUSA 4YDIH 1FLRH 4JFEB 4QRPA 3VFPB 2ADGA 1C8PA 3PQYD 5DXWA 2FGZA 4LPCA 3QDJE 3RA7L 5DF0A 3C6SA 1F90H 3UTTA 1EBPA 3DVFA 3PUCA 5F9AC 3SDCB 2Y25A 1YMHB 4WUUD 4QOKB 3D0LA 5C0AE 5C6PB 1J0IA 3BD3A 5T1KA 4F3FB 1E28B 4G9FA 4HIIB 4LSQH 3TBWA 2X9XA 3IGAA 4FQPA 1ZGLP 5I1LA 1JHTB 4MAUL 3IDMA 3N1GC 4AIZA 1BJ8A 5JUEH 3MXVH 4I2XA 2H6PB 3V8OA 3C08L 3QUMA 5ANMB 4UT7L 3MJ8B 3VXRB 2ESVD 3CVHH 2JE8A 4YO0A 1LNUA 2R23B 4W4OC 3FQXB 5HPOA 3LD8B 4NHUA 1F5WA 2APBA 3UTPD 2P49B 4HJGA 2YUVA 3ULUD 3B2UD 1EFXD 5FDWA 2D03H 2NPLX 5GRXG 4QWWD 1CGXA 5GIRB 3IFOA 2G60L 4JB9L 1YEJH 4YR6B 1U42A 5TPWH 3DVIA 4XHQA 1AR2A 2O93L 5IBLD 1CG9B 3PWUB 5DTFA 3RVXD 5C0DB 2ATKB 1QLEH 3CZFB 3FRPG 4PJ8C 4TOYL 1F2XK 1MFEH 5SWZA 1RFDL 5KVGH 3CFKB 3MJ9L 3V5KB 5F9JB 1U8KA 5AD0B 4G5ZL 4LPVA 1T20A 1BQUA 2IEPA 4WDIB 1CI5A 1A0QH 1I9EA 1ED3A 4GS7C 4RZCA 1NUNB 4YLQT 3GK8L 4XT1C 4Y5YC 5HHXH 2GQHA 4Z77A 1KIQA 4X9FA 3HZYB 5FB8B 5MP6L 1IGIL 3CFEA 3LMJL 4K7PX 1G9MH 5E5MB 3MSPA 5D7LA 3LKRB 3MLRL 1J0HA 5J11B 4M7JL 1NMAL 1FNLA 3X13B 3O2DH 3B5GA 3T77B 3K8KA 4JRYD 1SBSL 1T2XA 1FPTH 4HT1L 4APQD 2EKSA 2GK2A 1IC4H 1A7RL 4Q6IC 4OI9A 4JFQA 1I3GL 5E6IB 4XPGL 4NQED 1CFVH 3LPWA 4U1GB 3RNQA 3O8XD 4LNRA 1FYTA 3ARBB 3EOAA 1B0RB 2BK8A 3DECA 4G8FB 1UWXK 5F89A 2E6QA 3KXFB 3DBXB 2VC2L 4YIQB 4GW4A 2OK0L 1XF2A 1UJ3B 5ID0B 5I18L 2HYMA 4JLRB 4ZFOA 1QRKA 4H8WC 3U4AA 1E6JH 1V3JA 4LVOC 3IVKB 5CMAB 3UROR 3HTLX 1JN6A 4N0YL 4PJAA 3QCTL 3QIUA 2Z31A 4R4FH 3TBYB 3R4DA 1AHWB 3K7UA 3MNVB 4NBXB 1WLHA 2JJVA 1AXIB 2E8ZA 5FGSA 4G8GA 4ODSH 1YPZF 1S7VA 2R0ZL 3RGVB 1XGYL 2R15A 3BUTA 1CT8A 5DRNA 3SN6N 4KTDL 4MSWB 4JM2B 1KC5H 3KPMB 2ZUQB 4KKNA 2F5AL 4ALAH 5JA9A 4L8BB 1OTSC 1LP9A 3D25A 4WWKB 2JB6B 2D31A 2I25N 2C1OA 3V0WH 5DZOA 1HILA 1KULA 2AEQL 3O6KL 1BVZA 2NW2B 1T7YA 3ZDZF 5EOTA 1T66C 1JNJA 2NCMA 3F58H 3IXAA 4PGCB 3RBSA 4M1GL 5ICYB 4NQCA 3HZVB 3MRHA 4OZ4B 5SX4I 1XGUA 4WV1A 3A0OA 1YN7A 3I2CL 2NLJB 4PJEF 5IEKB 5ACZA 1IAMA 2PNDA 5FM4A 4RA3A 1WGOA 2ZZUT 3O2WH 3HN3A 4PJBF 4GH7B 3RNKA 3D39A 3UTQB 3QDGD 4UQ2B 1XEDA 3DJ9A 3FOLA 1II4E 1XCTA 2AABL 3FONA 1OARL 2WUBH 4DKFH 5D7JA 5DJ2A 5L8KB 2FATL 1DQTA 3MV7E 5HDQH 4FFVD 4P0DA 4N8PA 4KVNH 1FVEB 4NM4L 4JFDE 2ZOKB 3WHE1 4PLKC 4YXKL 5L2KD 4EKXA 3LQAH 3S34H 1IFHL 4O5LL 3WHXB 3L3JA 2BY2A 5K9OB 4DN3H 3WYRA 1QO3B 1BIIB 4PJ8B 1MREH 3BXNA 3ZDZE 4X99B 1NJ9B 3BH8B 3CMOL 3DYMA 2R4RH 4WI7A 5EBGA 3RWGB 1MNUL 5CILH 1SY6H 2XA3A 1H3PH 1N6QL 4KROD 3VXNB 3O3EA 3GSWA 4PJEE 1CFNA 4Y5YB 1RUAH 2Q86A 4Y5VC 5T1MA 5L6YL 5D8JH 5IHZA 4NNPL 2G5RA 5IHUL 4ONFH 3BUYB 3EFFB 4PJBE 5CHNA 1G0DA 1H3UA 4JRXE 1J0ZA 1XIWA 2DQFA 3GRWA 2OJEA 3WLBB 2BVPA 4TSBL 4K7PH 1J10A 4OQ1A 3X14B 2GJ6A 5J9PB 4KZEL 1Y0LB 2R9HD 5FUCE 4V1DE 1MCEA 2AK4E 3MUGB 2F19L 1EHAA 3L3KB 1P4IH 2YA0A 4L4TD 3WE6B 3JUYA 4MJ5A 2Y07L 5D7IB 2YS4A 3PP3H 4R4NC 3G6DH 2V9QA 2G75B 4HF5L 4HWEH 2P4AB 1XGPA 2IQ9H 4IOFD 5A2JH 3GDBA 1X4YA 4XMLL 1BVKB 4RQQB 1VFAA 1ORSB 3IYLW 3UDWC 3MCKA 2CKBH 2XRAL 2LVEA 4AM0A 4EXPX 5KS9F 4N90E 1NCAH 2LU7A 2EDFA 1ETZB 4RWHA 4KDTC 3GSXA 1J0KA 2W0LA 2VL5B 2OTWB 4WUKH 5IM7B 3CX5J 2JJUA 1IEBA 1FFOA 4LSSH 5M94B 3TFKD 2GFBB 4DGYL 4N0UB 2CIIA 3DETC 3VXPA 1K6QL 4LHUA 5I16B 1LE9A 2YN5A 1FAIL 4MXWL 2FZ3B 5EBMB 2YPVL 3TCLB 4E0RB 1AGFB 1DTUA 1W72B 2VR5A 4LVNC 1G7PA 1TQCC 3VXSB 3CX2A 4OM1H 3CC5B 5GGUB 1YUHA 4S1SL 1ITCA 2BSED 4FQ1H 5EIVA 2J6EH 4PY7A 2GW5A 1QRND 2NXZC 2FO1A 5T3XH 4JFPA 3RI5F 5BVJB 4K3DL 3FB8B 3V4VL 2AGJH 1K3IA 5CCKL 2BVUA 4G42A 4M62L 2I9LB 4JKWA 1GGCL 3ARDC 5TQ2L 4YXLH 1A2YB 3ROOA 5KS9E 3ARWA 4Y1AD 1AGDB 2QQNL 5TQ0L 2OR9L 3VH8B 3WS3A 2ICWJ 3P0YL 4RDQF 1KB5H 2CRIA 1AR1C 1RURL 4KK6D 2R56L 2WBWB 2X4UA 3RZCC 3SDDC 5EZLA 4HKBB 1HSAB 3QXDB 5D1XC 4FXKB 5JXAH 2HH0H 3LKOA 2FWOB 3THMH 1I8LC 4OCLC 1UGNA 2LAAA 4ODVH 4M7KH 3DUHA 1I3RA 1MCWM 3BKML 3FO1A 1DQMH 3HZKA 4LSUH 3PHSA 1UWEH 5E8NB 3QUXA 4F7EB 4U6TA 4WU5A 5BW7C 1P7QB 2J8UF 5SWSD 1OAKH 3BO8A 5C0EA 2QTEA 3MBEC 2X5PA 1MCSA 3NFNB 1KJMB 4OGAC 1LO5A 5E7BA 1G0YR 2CGRH 3IETB 4L9DA 4Y5VB 4JM4L 3DV6A 3BE1L 1LVEA 2VDML 1T7ZA 3I50H 5CJXC 3ZT6A 4R2GB 2VLJA 2ZG3A 1T0NA 4XGZA 3BP6B 4XMPH 1ZT1B 5TDOB 1J88A 4HHAB 3TBTA 4R26H 1A22B 4ZXBA 3RKDC 1CLOL 2FL5A 1RK1A 4HS6A 4OLVL 5E2VL 3CFDB 4WI2A 1WAAF 5IG7A 5FYJE 1A6UH 1AGBA 4YHNA 3QFJA 3EYUH 2GSGB 5ELIA 4Q74A 3V4UL 4RGOL 4MA3A 4LIQH 4Z7WF 5GGVH 5ALCH 1C5DB 1JI2A 4QHNA 1QA9B 5SX4H 2KDGA 4L5FL 3LH2H 4YUEH 3SE9H 2OTPA 3TT3H 1VEMA 5DO2D 1ZLWK 1UCTA 3UAJD 4URTB 4MD4B 3PWLB 5MEPA 4I4WA 1YMMA 5DR5L 5C2UB 5IVZA 3SJVD 1QSED 1I9IL 4CUCA 1I3UA 4ZFZA 1S7TB 1SYSA 3L1OH 4O2EA 4PJCA 1YJDH 3LKPB 3QB7C 4PJXF 5E99H 4KQ3H 5I1EH 1JUFA 2PYEE 3RJQB 3DXAB 2FYYA 4D0DA 1HEZB 2B4CC 3MV11 3CH8A 4PJIB 2E27H 1EK3A 3MOBH 3D3VB 2I24N 1YZZA 3BPNC 3SE4A 3BEVB 4LVNB 3MNZA 1TQCB 2A6JB 2VISB 2P5EB 4PRPA 2BOBA 4NKOA 4L8CB 1OL0A 4PRNB 2X4OB 1XF3A 1IM3B 1RJLB 2NXZB 5I17A 5JMRA 1CZ8H 1HIMH 4Z7WE 5FYKU 2Y06L 1IGFL 4XNQA 2B5IC 3DUUA 4HCRH 4NWUL 3QAZC 3QUKA 1CXHA 4Y4HD 3IXTB 3P77A 3ARDB 1LO2L 3UC0H 3MRBA 1CE6B 3SGEH 3T1WA 4HPYH 1KF9B 2NY7H 4JCLA 4E41A 1YEIH 1T04B 2Z91A 3MBXH 4MQ7B 3O2VH 3RZCB 2X2YA 3QDMA 3SDDB 2UZXB 4XAWH 5F71A 2P46B 3EYSH 5D1XB 4JQXA 1CGSH 5GGRY 4PJXE 4O02L 4Y19D 3QUZA 5HGDB 1UB6B 3VRLF 4HS8L 5DLMH 5F7DB 2DB8A 3C09C 1INQA 3ALWA 1J8HE 1FBIL 3QIWD 4O58L 4YNYA 4Q97A 3MJ7B 3SCMA 5LJYH 1IKNA 3QPQD 1IZJA 3DOSA 4FQIL 1P9MC 4EBQL 1INEH 2YKLH 1QYGH 1E27A 1RZ8B 3MBEB 2IGFH 4NO3A 5F9DC 2NZIA 5HHOB 2QEJA 3OB0H 2V2WB 5EC2A 2J4WH 3QPXL 1U92A 1DBKL 3BEWB 5D6CA 2ZG1A 4B0MM 1A6VL 1KG0B 2EE6A 4YE4H 1EVTC 1AJ7H 4DWHA 4ZDHB 3KYMB 3OKKA 4JGMA 4RNRA 1JZ4A 3LSOA 4PJ9D 1CCZA 3G6JF 1X5YA 3SKOA 4XRCA 4XHJD 3KNBB 3SO3C 1HNGA 5EBLA 3K0WA 4Z5RA 2VZTA 3FQUA 1MH5B 1BD2A 4NRZA 1UWGL 3QUYA 4LQFH 4X83A 5E24E 5LXGL 4MAYD 1JNNL 4H25B 1EHLL 3RPKA 3C6LB 3VFOA 3VRLE 1VA9A 1MFNA 1DJSA 4GKSB 4K7PY 1DFBL 1QFUL 1F8TL 4S2SB 5H35B 4UBDD 2WSKA 1F6FB 1BBDL 4IBLT 2R4SL 4OLYH 1F4XL 2H1PH 3K2UH 5L2JA 4MHHI 3VD3A 1U9KA 4G7YL 2Y5EA 3ZDXF 2X1QA 5B8CA 2NY1C 3IU3B 1NBQA 3MRNA 5KJRH 4H8WH 2WLYA 5F1KC 5E7FA 2BERA 1TZHB 4M3KB 1R24A 4POZD 2M1KA 3L5WA 4FQCL 5D7KE 1A02N 2XICA 1UA6L 3MGTA 4KKAC 2N1KA 5KAQF 2VXUH 5I0ZA 4LASH 1HH6A 2AJZB 3NH7H 3T4AB 5KBNC 4LPUA 3G6JE 4XP9H 1YQVH 4ELMA 3BDXA 4X98A 3BIBX 2W9DH 3QZWG 5E1HB 3BPNB 1S7UB 2X6MA 2GITB 1MHHA 5H2BB 4L1HA 4N8CH 3V5HA 1W72H 5C07E 2M26A 4WJ5A 3S37L 5ACLA 3FTGB 3V4PH 5BO1H 3QCUL 4U2ZA 4IRSA 3K4AA 1ND0A 1JNLH 2AJYL 1MFCH 4PJDB 4DW2L 3RVVD 3HLAB 2HT3D 2WUCL 4NQUA 3UO1H 5JPNB 4RRPG 4P3CH 3A6BL 2B5IB 2UVFA 5AAMA 3QAZB 3ZDXE 5BZDB 2XI9A 3KPRA 3VXTA 3GFUA 1AKJB 1OT2A 1X3DA 4XC1L 3VJ6A 1RPQA 1HDMA 5D72L 3BKYH 5CEZD 3BPCB 4I0PC 5E08L 3KLAB 3AXLB 1FZKA 5EORH 1HSBA 2AXGA 4GMTH 3BAEL 3FRUA 4MDJA 5DSCA 5ESVA 3PQYA 3BGAA 2LVCA 4MYWB 2DQGH 2IALB 2QR0A 5L8LB 5CJQL 3C09B 3S35L 3X12A 2VO5A 3ULVD 5FECB 4YHOH 3HNSH 1MHPH 2Y36H 1MFDH 1KEGL 4XWGL 2XZQL 1HYRC 2D7NA 4OFDA 1T1ZA 2QHRH 4AEHL 4L8SA 3UJJL 2IPTH 4PRBA 3SO5A 2ESVA 4E42A 5J7CC 4N1HB 5C0CA 5DQJA 6FABL 3UBXG 3X3FH 5IJKC 4LP4A 4R97C 2QQLL 1DUZB 4N8VG 4NQDD 1KELL 1T5WA 4YGAB 1OAQL 3VFRB 3HR5A 1URLA 2CPCA 5C0FA 1NSNH 3GO1L 5I15H 4RGMC 4BK5A 4JY5H 3TPKA 4L1DA 2X1WL 1BAFL 3AS0A 3QIUC 2Z31C 3STZA 1GJIA 3NABL 2X4NB 3FHQA 2WBJA 1R0AL 3GMOA 3FOMA 2CLVA 1NCUA 3UMTA 4ZSOE 2GHWB 3MCLH 1VGEH 4NT6B 1QFPA 2NW3A 1WWAX 3PXJA 2FLRT 4ODUB 3MRFA 5J6HB 3RL1A 1Y6MR 4RAHA 4IHOB 3WKML 2AJ3A 4BQ8A 3PDGA 1JZ7A 3LVEA 1MCIA 4MQXD 3DO7A 5DUPH 4DOHE 4E5XA 4ZAKD 3P40A 3MLVH 4JRYA 5EUOF 3MUY1 5IBTL 3QRGL 3MXWL 4F7TA 3KPSE 1RJCA 3C6SB 4RFOH 3UTTB 2HVJA 1OAZL 5HI4D 2VERN 1U3YA 5FA4A 4NQEA 3GB7A 3OKYA 3D0LB 1ITBB 3GHEH 1KPVA 1DEDA 4X7TA 5T1KB 4G9FB 3LQZB 4LHQB 5E00A 3H0TB 3TBWB 2EDLA 3IGAB 5HY9A 4J2XA 1F3DJ 5I1LB 1A6AB 2A74A 5JW4M 2XKNA 3IDMB 1I8MA 4AIZB 4FZEL 4I2XB 4DVBA 2QQKL 2Q8BL 2FO4A 5JZ7C 4RMQA 4YO0B 1LNUB 4LEXL 3RAJL 4HUUA 2DIBA 4NHUB 3VMOA 4KI5F 5IMLA 2MHAB 4HJGB 3PL6A 5FDWB 1TIUA 4NUGL 1KPUB 3U9PH 4LARL 1BBJA 5CP3H 3IFOB 4XPFH 4V2BA 4AZ8A 2B20A 1NGYB 2OZ4A 4MWFB 5ABDE 4P5TD 2YUXA 4BKLA 5L7XH 5F6IB 1KJ3L 3HRPA 4M3JA 1Q38A 2W9EL 3C5ZC 5LAXB 1K5NA 4RDQG 3M1BA 1NGPH 5SWZB 1T1XA 2BMKA 5INDA 1C16A 4NZDA 2VDPH 1U8KB 2PW2A 1T20B 4I3SL 3L7EB 3QQ3A 3MV8D 1PYWA 1ED3B 4RZCB 2XN9A 3FQNA 3H9HA 5IVXA 4Z77B 1KIQB 4WFEE 4X6FA 4LLUA 5IMMA 3CFEB 4JQIL 2FD6L 3K81A 2YXMA 4YBQC 3LS5H 1P4LB 1RULL 1XIWC 4JGUA 1BZ9B 5DRXA 3MLWH 1IAOA 2EKSB 2WW8A 3DTXA 4DTGL 4QRRE 4KI5E 5EZIL 4R97B 5GGSA 2MOVA 3TT1L 1BJMA 3RNQB 1WVZA 4U31A 1Z0NA 4LNRB 1FYTB 3EOAB 3VGAC 4UNUA 2ADFH 3O0RH 5F89B 4H1LB 4GW4B 5C0AA 1XF2B 3V6OE 4ZFOB 4RGMB 4ZS7H 1NEUA 1N5YH 4QHKI 3V0AC 5KZCD 3PWJB 4X8JA 3KYNA 1JN6B 5F3HA 3QIUB 2Z31B 3GMPA 2LAGB 3HUJA 5IFAH 1PZUB 4GRWH 4G8GB 1S7VB 3S4SG 1ZEAH 2VDLH 1MRDL 1KTDB 3MUJA 4PREA 3RFZC 4UINL 1HINL 4FQLH 5DRNB 3SKJL 1CICD 3QNYA 2P47B 3BN9C 4PJ5D 4X8XA 2YD2A 2XTLA 2IJ0C 3MODH 4MMZC 1RIVH 1MEXH 1ZHKA 2YD4A 1GVIA 1Y6NR 1LP9B 1UQSA 3D25B 5JLZA 3K2MC 2D31B 1A3RH 4ENEC 2C1OB 2EZ0C 1MI5A 5ADOL 1NGQL 1YN6A 1HILB 3IRZA 4XBGA 5T5NF 4K9EC 1Y6KR 3GI9L 3IXAB 4OGXH 3GBLA 4NNXA 4NQCB 1OGAE 2AJSH 1XGUB 4WV1B 1WBZB 1YN7B 1UKTA 4L4TA 5FYKL 3WLWC 5ACZB 2F8VA 2W0KA 4NFBA 2Y6SD 4AH2A 5CEXA 3LAFA 1FL6A 4CMMA 1OQOA 2B4CH 4Z7UA 1VFOA 5GRJL 4ZFFA 3RNKB 1U93A 3D39B 5JW3H 1T80A 1U6AH 3FOLB 2KH2B 1XCTB 1N5AA 4O2CA 4P2RE 3FONB 3GUTA 4ZO8A 3GSUA 5D7JB 1IZKA 4NQSA 4FXLA 3EZ8A 4JO4L 4U1LA 4FHBD 3WIFA 3ZMRA 1BQSA 1TTFA 2P24A 4OFYA 4OZGB 1OQXA 2HA1A 1L0QA 1BWWA 3L3JB 2B2XH 3G5VA 2X89D 3C5ZB 3QUXC 2JELL 4WW2A 3BXNB 1H3XA 4P4RB 4RMVA 5DQ9A 4ZO7A 5HXMA 5D2NE 1G1CA 3O3UN 3GSWB 1CFNB 1JHKL 4LNVA 2Q86B 5T1MB 3BVNA 5BZWA 4WI6A 4Q9BA 2R39A 4YHLL 1AXTH 2BVOA 3ISWA 5CHNB 4YAQA 2DQFB 1XIWB 4L3EE 2OJEB 4OLUL 2BVPB 1Q72L 3EJJX 5J4MA 4QCIA 1CLYL 2GJ6B 3FB7A 3DUSA 4NC0B 2FB4H 2DQHL 4Y1AA 3CIQA 3QXVA 1AGCA 1J8KA 1V3MA 2E9IA 3WL9A 1U91A 1YYLL 3Q3GA 4OAWA 1E6OH 1IL1A 3VGAB 1IQDB 1P84K 1JE6A 4MJ5B 4X7EC 5SX5K 4S1RL 4L4VD 3Q1SH 5HJ3A 3TIDA 4N5UA 3P11L 3C2AL 3MLYL 1XGPB 3EHBC 2C4FT 2WWKO 4GG6A 1N64H 3ARXA 5CZVL 3LKSA 3U0PA 1VFAB 2Z35A