2BVPA

Structures of three hiv-1 hla-b5703-peptide complexes and identification of related hlas potentially associated with long-term non-progression
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
publication title Structures of Three HIV-1 Hla-B5703-Peptide Complexes and Identification of Related Hlas Potentially Associated with Long-Term Nonprogression.
pubmed rcsb
source organism Homo sapiens
molecule tags Glycoprotein/peptide
total genus 76
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bvpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2bvpA01
1IL1B 3LAFA 1N5AA 4L8SC 1G6RL 5IGXL 1RD6A 5E94A 3AS0A 3KPPA 4OZ4A 3I2CH 4KMTL 4X5LA 4JG0H 4NRYB 4U1IA 4NKOA 3OAZK 3TN0C 2CD0A 3MFGB 5DJAB 2Y72A 4Z78A 4PJEB 3QUXC 4P3CH 4AT6B 3SCMB 3L7FB 3S37H 4XVTH 1C5DB 2MPAH 4J1UB 2DWEB 2DQTH 4FTVE 3MUY1 4XP5H 3CSYA 1CD9B 3CFKB 1KG0B 1NC2B 4G3YL 1KEML 3QUYD 2F8XC 1KCRL 4YPGB 1AE6L 2P5EE 1N2RB 2LQRA 3SDDD 4N90E 5C08A 3WS6C 1TJIL 4NJAL 1XGTA 2J3SA 4Z7VE 5C0GB 1TIUA 5F1SA 4YGAB 1KYOK 5I9QC 3W0WD 2R23A 4U7SA 3BWAA 3X14B 1G6RA 4ZSOA 5ABDE 1NLBL 4OGAC 2ERJC 4HT1H 4NNPH 4N9GA 1ZV5A 3G5YB 2MOVA 5E1AB 3GBMH 3ZLQC 2CKBB 3CSBA 4NHUA 3WN5B 5EU7C 2ITDA 4HJ0D 5JZ7C 4KK8D 4ZOEA 5AZEH 2WUBH 4EUPB 2LU3A 4Y16B 3LRSA 2QR0A 1MCIA 4EN3B 1RZIA 2OZ4L 3SGJA 1GGCH 4RMTA 5DVMA 1BOGB 1QBLH 4HWUA 1ZLVH 1MJUL 5DC0A 4UV4L 3MV11 2CMRH 2H8PA 4R97C 4WU7B 5KAQF 5IMOA 1XIWB 1GOGA 1Q9KB 2CK0H 4I4WB 1DQJB 1NKRA 5L2KB 5CUSH 3QI9B 1A7PL 4ZUUB 1T66C 1P4LA 5BS0A 1M05B 3VXQB 5E8OA 2XFXB 4LU5L 5B3JE 5BRZB 4NBYB 5HY9B 3IVKA 1TJGH 1RMFL 2NW3B 1GVIA 3HC3H 1TMCA 4YR6A 3RTQB 1BGXL 4JJ5B 3DURA 4HUXA 2GK0A 4WWID 3VXUB 1RULH 3G5ZB 4LCIL 2H9GA 4NZTH 2WWKT 4JE4B 3H9YA 3ARQA 4XNMB 1H15B 3OJ2C 4HGMA 5BVPH 1ND0A 1EIBA 2NY3C 2BERA 4XP9L 1RV6X 3JWDH 1GCFA 3GSWA 1JHKL 2OZ4A 2OJEB 5HDQL 4PJFF 1UVQB 4QOKD 3JZ7A 4NNXB 5ADOL 5GRWA 5KVGH 3RRQA 1J18A 4OQ1A 4UUJB 4WVRA 4K07A 4L4VA 2CIIA 3MUHL 3C60A 3CU1A 2R8SH 2PO6D 1OTUC 5EU4B 3HC0B 4HWNA 3MPCA 1OCWH 2Q20A 2X4UA 2P8MA 4YDIL 3VDAA 4OJFL 2AS5M 3HNSL 3OXSA 5CGMA 3CFJA 4S0UC 4HCRH 1D5XA 3LKPB 1UG9A 5DJ8B 5HGDB 2Y07H 4IRZH 2PW2B 3L3DA 4OLYL 2JB6B 2ZJSH 5DUBB 3O4LB 3S4SG 5C9JA 1MJ7L 4OUUA 3BDXA 4EVNB 4LVOB 3LVEA 4MB5A 3HG1D 2BX5A 5HYSG 3QH3A 3QFJE 5D6DC 4V1DE 1RY7B 1MCWM 1Z9LA 2ICWJ 3OXRA 4CVWA 1AQDB 2X4NA 2YPLB 3WJLA 1P4IL 3IRZA 3R1GH 4GKZA 4MD4A 3SDCD 3H3KA 2V5TA 1QFOA 4R26L 2VZ1A 4XP1H 4NP4L 3T65A 3LPWA 3D0LB 3BGMB 1HINH 3NCJL 3BZ4A 5DSCB 4CVZB 4EDXB 1D6EA 4P2RA 2JB5H 3MR9A 4PJXA 3MRFB 4G59A 3L3IA 4GW4A 5BZWA 3RGVA 1TLKA 4JRXE 2NW2A 3TN0D 2FLRT 3MGTA 4GRWH 5J13B 3QUXD 3F62A 2HMID 3QDAA 5KW9H 2WBKA 3OKDB 1F4AA 4N68A 3M1BB 2H32H 3PL6C 3RWEB 5BCAA 3JV5A 3HN3A 4NDMA 2PYED 2YK1L 3QQNA 1UYWL 1HSAB 4XCYA 4G8EB 4O58H 1JE6A 1EHLH 3KPSD 4XVUC 2ORBL 2DQUH 1N64H 1N5AB 3DECA 3H7BA 3A6BH 5KTEH 1A7BA 1DSFL 4M3KB 3U83A 4OGAD 5E94B 5EBWA 5KSBF 3O3DA 3KPPB 4H88H 3G04A 4JGJA 4NKIH 4OZ4B 5DHYA 4G8FB 4U1IB 4NKOB 4UNVA 4JM2C 3CMOH 4FTVA 3SKOA 5FO7A 5T1LD 2DJSA 3ETBF 4Z78B 5JZ7D 4LK4A 1KSRA 5TQ0L 3VXRD 1NEZA 2P5EA 1FO0H 1J88A 1R3HA 3BPNB 3ZDYE 3BPOC 3IKKA 3HCVA 1MPAH 4WTZA 4X83A 3INUL 4GRLB 3CSYB 4XX1E 5JW4M 3DO7B 4QXUL 5D1ZC 4JFDE 2QEJA 5KZCB 1KPRA 4Z7VA 3MBEC 5B4MD 5D93C 3DROA 4NQSA 5C08B 4JZNA 3WNLA 2F9BT 1BF2A 1XGTB 2JIXD 1T66D 1O7SA 3UJTL 4KQ3H 3KPNA 3BWAB 4NWUL 3ABZA 3GMNA 1G6RB 4ZSOB 3VDCA 3BGAA 3RHWF 1RAMA 5CKAA 2EDQA 4N9GB 1WZLA 1B2WL 3H9HA 3QISA 2WV3A 3FQNA 1TITA 4FQXD 1U2HA 4NHUB 2ITDB 3CH8A 3GJEA 4EOWL 4WO4A 3WIHL 3LRSB 2QR0B 4CDGC 2NY3D 2PXYA 5I1EL 1BM3L 4RAHA 1RZIB 4WWKA 1U3ZA 5I75C 4WFFE 1UWGL 3WMSA 2H8PB 3H9SD 2GT9A 4QGTA 5IMOB 3ULVC 3GMQA 5TH2A 3TYGL 3BPLC 1EFXA 3FN3A 3KG5A 3F65A 4YFLI 1TQBC 1P4LB 3MXWH 3RJQB 5BS0B 1F11A 5E8OB 1NCTA 5HPMA 5I74B 1EHNA 5IJKA 3VW3H 3IVKB 5IQ9A 4DVRH 5A16A 4WI6A 4LF3A 1A7NH 3BT2L 1TMCB 4YR6B 1OSPL 3RVUC 5L8JB 1QFUH 3DURB 4HUXB 4PJFE 2GK0B 3RDTD 3KPLA 4R4BA 3J8F7 2BK8A 3MLVL 1LEKA 4Q6YA 2H9GB 3P4MA 1V8HA 3WIHA 5SX5H 1ND0B 4DVBA 2FATL 4KGJA 3M17A 1NCAH 3T4YA 3GSWB 5GS0L 5F7NC 4DKFL 4F37K 4OFPA 2XWTA 1LE5A 1SM3H 4XNZB 4TSBL 1XZ0A 3WL9A 1F4YH 4L4VB 2CIIB 3C60B 5J0BA 4U1HA 2VXVL 1KELH 4JFEE 2X41A 4YXKL 2CSPA 1KCVL 1IGCH 5H94A 3NIGF 2X4UB 1G84A 3MROA 1P7QA 3B5GA 4NQEB 5C71A 5J11B 1S7QA 3RP1A 3OXSB 4OUOA 3CFJB 1AD0A 3ARWA 4RNRA 1D5XB 2HA1A 4TUKL 3RBGA 3L9RA 2VXSH 3FHQA 1KB5H 4MWFA 1G7QA 4UINH 5CD5C 3L3DB 3V5KA 3QFJA 1F42A 4EEEA 5C9JB 4V1DA 4OUUB 4M1GL 2VLMD 2VLLA 4M00A 2R4RH 3HPLA 3TV3H 5GQBA 1SQ2N 5GHWH 3QH3B 2EDLA 4XNXL 3PL6D 1RK1A 2H2PC 3OXRB 4XHQA 3TBSA 2X4NB 3QXDA 4GKZB 1JF1A 1AO7E 4MD4B 2ZSVB 1RSFA 4O5LL 3T65B 2QQNH 4P99A 4X4ME 3BZ4B 3BP6A 4EBQH 4LASH 3ZKNC 4XGZA 1D6EB 2IANE 1QNZL 2J5LC 2QHLA 3MR9B 4P2RB 1PG7X 4PJXB 3VG0H 1N0XL 2G75A 3L5JA 3LB6C 4XC1L 4NZUL 3L3IB 4GW4B 5BZWB 3RGVB 2NW2B 4FQLL 2BHYA 1UGNA 2BMKA 4U6VL 3MGTB 3CSPA 1UM6H 3D0VA 4XZUA 2PR4L 5GGQL 1BIIA 4UT7L 1WZMA 3BDYL 4HXBL 4NRXA 2OQJA 4RQQA 2CLVA 5E9DE 1PFCA 5D1ZD 3T08A 1B4JL 1MHPH 4I2XE 5KSBE 5CD3A 3GUTA 4NDMB 4FFYH 1C1EH 3MLWH 2O5ZH 4NZJA 3RFZC 5IFAH 1P9MA 3OGCA 1B0GA 4EUPG 1PSKH 3EDFA 3H7BB 1U6AL 4HZLA 4MS8A 5EBWB 3BUTA 4HUNB 4A2MA 3O3DB 3G04B 5DHYB 4M4RA 4PBVC 2B8OT 4JO4H 5D7LA 2DDQH 4C56A 2J8UF 3TT3L 3SKOB 5FO7B 2HJFA 1FAKT 4XCNA 1NBYA 1NEZB 2P5EB 4JFDA 4M7LT 1R3HB 4QYOA 3HCVB 4HWEL 3EBAA 4TTGA 3BRDA 4F9PC 4YHLL 4HAFA 4PJ8C 3CAFA 1KPRB 4Z7VB 3DROB 4NQSB 5HYJE 3QJFA 2EDHA 4JZNB 3WNPA 2NY6B 3IDUA 1FNGA 1T03L 1WAAA 4RRPG 1MFBH 4JPWH 1QBAA 4DOHB 5BOPA 5F7EL 2BJML 1FV1A 3KPNB 1L7TL 4OCYL 4EKXA 1GGBH 1JGDA 3GMNB 4TVPD 3JTTA 2VDLL 1OT2A 2BNRE 1MWAL 1DEDA 3PGDA 2WNGA 4LARL 3FQNB 3RY6A 4CN1A 4OBRA 3SKUD 5I0DA 3GJEB 2Q7YA 4WO4B 2E7LE 2EXWC 1JGVL 2X4OA 2PXYB 4MA7L 1ZT4A 3QIBA 4WWKB 2J6EH 3BP4A 4IRSC 1WLHA 3UXFA 2GT9B 3EFDL 3LDBC 4RCAA 3GMQB 5TH2B 3KHQA 4KUZH 1OP5K 3SO3C 3FFCD 3IB4A 1EFXB 4NO5A 5JXAH 4HGKC 2DQIL 3DI3B 1F11B 4MMZC 5HPMB 1F4WH 1P53A 5IQ9B 2A6KA 4L1DA 3T0EB 5A16B 4LF3B 5GGUA 3MJ7B 4ZFZA 3I50H 1MWAA 3BZFA 1YMMA 3A6CH 2QQKH 3KPLB 4R4BB 1YYML 1LEKB 5IB1A 4BFEA 4RMUA 3IT8D 3WFDL 3QDGE 4OZGF 2EDJA 4WGVB 1AFVL 5F9WB 4DVBB 3CVIL 2A1WH 4K8RD 3M17B 3T4YB 2DB8A 1IZJA 2XWTB 2OJZH 1LE5B 1YEEL 4HXAH 4OZHF 4XP4H 4JFEA 1XZ0B 3F5WB 3TVMA 3D85A 4D9QD 4WV1A 1F58H 5FHAH 1H5BA 2H2PD 1X5IA 2D0FA 2H6PA 1WZKA 3S97C 5D1QC 4NGHL 4U1HB 3JTSA 3EYVA 4XPBL 4YHYB 2E27H 1LO4H 2NTFA 4KQ4L 5I6XC 1NBVH 4XT1C 2CRZA 5H94B 1QSEE 3MROB 1P7QB 1QLEL 3VD4A 1S7QB 4FQJH 3PDOA 1JK8A 1AD0B 3LB6D 4RNRB 3HI6H 2HYMA 3L3GA 1DP0A 4J7RA 4E0RA 4MWFB 1G7QB 4RBPK 4R8WH 3HR6A 4JDTH 3QFJB 1A3RH 4V1DB 5TE4L 4NZDA 2VLLB 1F6LL 3HPLB 1AO7A 3NCEB 4JFZL 2DL2A 1J05A 1RK1B 4YK4B 3TBSB 5CILH 5DD0L 4UIKL 2VH5H 3G5VA 4LGSB 1DQLL 1A6TA 5I17A 3QXDB 4NQTA 1JF1B 5FA4A 3GGWA 3QG6A 2IANA 4HV8A 3V4UL 5E99L 1NCNA 5D70H 4JFHE 3BP6B 4MNGE 5MEOA 1AXTH 4XGZB 4NFBA 4BZ2H 2C4XA 2G75B 5LKNA 4PRBA 5MHSD 2QSCH 3LKQA 3MSPA 2Y5EA 4M1CC 4WU5A 1FRGH 2BMKB 3QB7C 4WIQA 3D0VB 4NN7C 5E8DL 3LH2L 4XZUB 3WFCH 3AMKA 1N26A 5GGRB 1L4IA 4PYHA 2WBJC 1BIIB 4UDTA 4I2XA 2WY3A 4NRXB 1RJYA 3JV0A 5LQBL 2OQJB 2DBJA 2CLVB 4RQQB 4W4OC 3JVGC 1YC8A 4EQ3A 2FSEA 4HLZG 5CLWA 3GBNL 5CEXA 4YUEH 4FZ8L 2CGRH 3GUTB 5T3XH 5I15L 5DMJB 5FB8A 2ATPA 1EEZB 4PRID 5I1JL 3RPKA 3OGCB 4G6AC 3JBG7 1CLZH 2HVJA 4HZLB 3MLYL 4MVBD 4CU8A 2BSRA 5L8LB 3C2AH 5BO1L 5D7LB 5IMMA 1OTTD 4C56B 3ZKXB 4YHMH 1MJ8L 2HJFB 4P2OA 4XCNB 1NBYB 3PWJA 4JFDB 4XXCA 2NTSP 2EXWD 4QYOB 4HEPG 2AV7A 3EFFA 1RUKL 4M1DH 4IRSD 2EIEA 1DBML 4KDTA 1CXLA 3QJFB 3HZYA 2GK2A 1FNGB 4PJ7E 4V3EB 3MYZA 4N0UA 5GGVH 3SDXE 4K7PX 3VD5A 1TETH 2ESVE 1FV1B 1JGDB 2RQ8A 3GZKA 3JTTB 4LSDA 4UT6L 1QPPA 3WKMH 2F19L 3O3UN 3MMEA 3PGDB 4XNYL 3UTSD 2OBGA 2CRMA 1XEDA 2BNUA 5IVXF 5FECA 4IBLT 1ZLSL 4N1EA 2Q7YB 3MRQA 1YN7A 3FHAA 3GO1L 4P23C 2X4OB 4MAYC 1CR9L 5BJTA 1CI5A 4B53A 1ZT4B 3VI3E 3QIBB 1CFVH 1VFUA 1MCLA 1XF5A 2EIDA 3BP4B 3B4NA 2AJVH 4P2QD 5EU6E 4P46A 2Y9RT 3O3EA 1X3DA 2J88H 1K3IA 5D1QD 2WANA 1RZKC 4NO5B 1GGUA 2YXMA 4Y7MA 4Q9CA 2N7BA 5GS1A 3B2UD 1HKLH 2A6KB 5DWUH 1I8LC 2GTZA 3C8DA 4ISVA 5CEZD 5GGUB 4ZFZB 1MWAB 3BZFB 1YMMB 3QDGA 3UDWC 2O5XH 2D0HA 3BGFC 4TOYH 4OCWH 4APQD 5IB1B 2XPGA 3V0WL 4I1NB 2EYTA 2VDOH 1IQDA 4CGTA 2Q8AL 3TFKA 4HMEA 4LSRH 1H3TA 2APVA 4PP2A 3OAYK 5DGRA 1IKFH 2VDKH 1E6JL 4JFEB 1QR4A 4OGXL 1VACA 1P6AB 3D85B 4WV1B 3TT1L 1UJ3C 2I5YL 1U92A 3HMXH 3F7YA 4IIQC 2H6PB 4E5XA 1MCWW 3RIFF 1QSEA 3EYVB 3BZEA 3AS2A 2VISA 2NTFB 4PRHD 4PGZA 4F8QA 2Y06H 5IUSA 1KC5H 1J1OH 1T2XA 3OGOE 1YEGL 3SGEI 4AMKH 5JPNA 1EA9C 3PDOB 1JK8B 2YEZA 1DE4A 2VR5A 3HNVH 3L3GB 4DW2H 4M8VA 3UBXI 3ZYZA 4E0RB 3I02A 2IPTL 4RAVA 3OB0K 4ODXA 2AK4D 2WBJD 3FT4A 1MCSA 4XPGL 4L9LA 4PBWD 1J8KA 2R4SL 1JYWA 1LO3L 4OFYD 1AO7B 5LBSL 3FO1A 1J05B 2NY2C 1JNJA 1YZZA 5MERA 1SMAA 3EDDA 3G5VB 3TA3C 5I17B 1A6TB 3KLHD 3S9DB 5FA4B 3GGWB 3QG6B 4LIQE 4RMQA 5B8CA 2IANB 1VGEL 4RZCB 1AH1A 2HLFC 4G6AD 2IBGA 1FC2D 2GFBA 5MEOB 1N4XH 4V3DB 4YHOL 4PRBB 4R7NA 1MFCL 1X6LA 2CJUL 3LKQB 4WU5B 2Z31C 7FABH 3QSKB 5HI5D 1FPTL 5ALBH 3U36A 4XC3H 4UDTB 5KOMC 1DBBL 4I2XB 4GG8A 4N0RA 1RJYB 2QJDA 3QIUC 4ZUWA 3T2OA 2IBZY 2QQQA 5DJ0A 5C86A 3EYFA 4TNVF 5HDBE 3MLXL 4DEPC 2FSEB 1CXEA 1T1ZA 5CEXB 2C1OA 4B50A 5HI4D 1BBDL 4DQOH 5FB8B 2EZ0C 2ATPB 1T2QL 4G7VH 5EZOH 2G5RA 4XTRC 4OD2A 1IC7H 4IOFC 4WDIA 3RZWA 4OB5L 1UC6A 1RVFH 2HVJB 4QF1A 3VG9C 3WDHA 3T77A 3OKMA 2BSRB 3WFEH 1I8KA 1GC1C 1FZKB 5IMMB 1JTOA 3IDMA 4D9LH 5DVLA 5J57B 3FN9A 4P2OB 5I2IA 4PR5A 3PWJB 2XQBL 4M62L 4BUHA 4P23D 1RIVL 4MAYD 4GKSA 2AV7B 4MD5A 3ARFC 3EFFB 4IM8A 3T0AA 3WSQH 4OIIH 1YEHL 4PJ7A 5K59F 4OCLC 3SDXA 4BSWA 2ESVA 1QRNE 3HZYB 1EAJA 4LSUH 1ZA3A 4G9FD 1NAKL 4N0UB 3PGFH 4LCCC 5EO0A 3O9WC 3ZE2E 5KS9B 3MMEB 3BRGC 2CLRA 2YD3A 2OTWA 2BNUB 3W5NA 1VEOA 5FECB 1TZGH 2W9EH 2WW8A 4KKBC 3MRQB 1YN7B 1G9NL 2KDGA 3LEXA 5E5MA 4F57L 1I7UA 3E6FA 4I77L 4PY8J 5BJTB 3IU3A 1KJ3H 4ZDHA 5ITBL 1XF5B 2ZUWA 2W9LA 5DT1H 4ZNEE 3N1PC 1CF8H 2JJVA 3O81A 1YY9C 5IIEA 4P46B 4O2CA 3O3EB 4NYLA 4YHKH 5DFVD 3WJJC 1A7QL 1JZ8A 2YUVA 5EOQH 5GS1B 3N85H 5SWZA 2O93L 5HYEA 4R0LA 2OX5A 2GTZB 4ISVB 3C08L 1MI5E 4AG4L 3D39D 1K6QH 1CYGA 1LO0H 3QDGB 3L3HA 3B3IA 2SEBA 5EZIL 1ZHBA 3OF6A 5D1XA 2XTJB 2EYTB 4HC1L 3QIWD 1IQDB 1OAKH 1LWRA 5CZXD 1LP9F 4PP2B 3UJJH 4LHUD 4MNHA 5KSUA 3CXHJ 2ZUUA 2FBJL 4D3CH 2NY2D 4ZTPL 1U92B 4ZO7A 1KFAH 3F7YB 4XPAL 4E5XB 5HVFB 1DJSA 4YDLB 5DLML 1QSEB 3AREC 4RGNB 3BZEB 1CE6A 5EOCL 2Z4QA 3IFNH 4Y2DA 3UO1H 2VISB 3WFBH 1UWEH 1KULA 3G08A 4L3AA 1CZ8H 1XGYL 3FQWA 5JPNB 5E6YA 4PLOB 1A3QA 5I71C 2R2CA 2WIIA 2YEZB 3RWFA 1DE4B 1WEJH 2YA2A 3I02B 2Z31D 3DXAD 4RAVB 3U7YL 1G7JA 5HD8C 4AEIH 5IWLA 4HC1A 4ODXB 1Z9OA 4NCC2 3FT4B 3C5SA 3QIUD 4UTBH 1OQXA 4L9LB 1A4JA 1D6VL 4G8GD 5GJSH 4MXVE 4BK4A 3B9AA 3FO1B 3IFLH 5DHVA 5MERB 1NCUA 5JW4Q 1H9VA 2EE6A 1G7IA 1QYGH 2BCKA 3ILQD 5J56B 5AG9A 5C09E 5B8CB 4XWGL 3QUZA 5D96B 1NANH 4OM0H 3U46A 2X9WA 3GSVA 4IOFD 4KI5C 4XP6L 2V5SA 3CLFH 1FGNH 2VLKD 4O4YH 2GFBB 1DLFH 5D72H 2JELH 2LABA 1INEH 1PKOA 3GSRA 4PRDA 4R7NB 4XXDA 2AK1H 2XWJA 3UBXA 3BP7A 4P5TA 1YNKL 4N0FA 4GH7B 3U36B 1ZANH 3KPRE 4GG8B 2WUCL 1IQWH 2DQEL 4FZEL 4JRYD 1WUNT 1EUUA 5DJ0B 3EYFB 4ZFGL 4OF3A 2E8ZA 4MZ2A 4Y5XC 1BHGA 4CN6A 1G1CA 1T1ZB 2VXTH 2C1OB 5CCKH 1A64A 5JUEH 1X5AA 3ARRA 1JYXA 3BKCH 3RVWD 1X5GA 4AZ8A 3GIZH 1K2DA 4ODTL 4OD2B 4WDIB 3NOIA 5DMKA 3NFSH 4QF1B 2OI9B 3T77B 3OKMB 1MH5A 1I8KB 4YBLB 2IGFH 5E1HB 5BXFA 2HRPH 3G6DL 3H7LA 3IDMB 5K59E 3KYOA 1B6UA 4ZUVA 3LS5L 2ZPKH 5I2IB 4PR5B 4KKBD 1ADQL 1U8NA 4GKSB 4MD5B 1J86A 3PWPE 5J13C 1QRNA 4LLYA 3SCMD 4PTUA 4P9HL 4D0BA 4PJ7B 1NSNL 4ONOA 1A6UH 4KZEH 3SDXB 1F8TH 2FD6L 3CFCH 4BSWB 2ESVB 1NC2D 3UAJD 5T3ZD 4MXWH 3VCLB 4S1SH 1ZA3B 3LD8B 1OTSC 1IVLA 4Z0XA 4LRIA 4TNWF 5IT2H 1P84K 4U3CA 4EXKA 4X6BA 5EO0B 2AEPH 4HDIA 3LY6A 3QAZB 3K80A 5TPWH 3LEYL 4OZIE 2F54A 5D2NC 2CLRB 2OTWB 6FABL 4M7JL 3MV9E 3I2CL 1II4E 4JG0L 1MQKH 2YUZA 3GSNH 4CL7A 2HLAB 3UC0L 3QULA 1ADQA 3O6KH 3LEXB 5E5MB 3BWUC 1I7UB 3E6FB 1NDGA 4AYFA 2VLJA 4MAUL 3IU3B 2LU4A 4I18A 2MPAL 2X1XR 5SX4H 4ZDHB 4P49A 4XP5L 5DRWA 5HHMA 2APBA 4EN3D 2OR8A 4ONGH 2R0KH 5IIEB 4K3GA 1YJDH 4O2CB 2AGJL 3D48R 2P5WD 4NYLB 1YECH 5DUPH 3THMH 3HFMH 3ZMRA 1UJTA 1A0QL 1MI5A 1EMTH 3K81A 5F3HA 5SWZB 3BH8A 2V5MA 1CLOH 4RX4D 4R0LB 2Q87A 3TO4C 3QI9D 1LP9E 1RFDL 1CVRA 4HT1L 4AEHH 1GIGH 3L3HB 1RJCA 3B3IB 2SEBB 1X44A 3MOAH 3GBML 1ZHBB 4PYGA 3RTQD 5D1XB 3AXLA 2AI0L 3H0TA 3P9MA 5E8NA 3U9UA 4MNHB 2B20A 3S36X 4URTB 5KSUB 3O4OB 3QO0A 3VXMA 1OAYH 5JW4R 1GGCL 3LS4H 5LJYH 1QBLL 2W38A 4J6RL 1ZLWH 4XCFL 3TPUE 4X9IA 4M7LL 3D69B 4MDIB 2GITA 1CE6B 2Z4QB 2Y36L 4Y2DB 5CUSL 2HFGH 5DD3H 4Z7UA 4KI5D 3G08B 4BQ9A 2FGZA 3VXOA 3VGEA 3FQWB 2WIIB 3VXTA 4GW1A 1OM3L 1V3MA 3RWFB 5HPOA 4H8WC 4WHYG 1MCJA 1FCGA 3QRGH 1G7JB 5I1GH 4LVHB 1EBPA 5CINH 5BVPL 3R8BB 4LL9A 2JF1A 2VKXA 3VWKC 1KGCE 3C5SB 1QACA 4RA3A 4HLJA 1A4JB 3E8UH 3QUKA 2BNQA 3OG6B 3IDXL 1QEWA 1JHLL 1TFHA 3TH3T 5DHVB 3QG7H 1A7RL 1A7OH 2H3NA 4KPHH 2AJXL 3WO4C 1G7IB 4GMTH 2W59A 4UTAH 3CNKA 4RA0C 2ZCHH 2LTQC 5E8PA 3QUZB 5JA8B 3U46B 2R8SL 2YPLD 4M3JA 4FQ2L 5AZ2H 3FQUA 3GSVB 3QCUL 4ZODA 2H26A 5H37G 5JOFA 5KVDH 3REVA 4JY5H 4WRLA 2ARJA 1BFTA 1KCUH 3GSRB 4W6YB 2EH7H 1PBYA 1IGIH 5DUML 2WIMA 2XWJB 2DMKA 4HCRL 5D7JC 3UBXB 4OQTH 5JORA 3BP7B 2Z92A 5E5UB 32C2A 3DMMA 4DKEH 2RFXA 4P5TB 3K4AA 1YEKH 4N0FB 3RU8H 1G7LA 4Z7NE 1DQDH 3UX9B 2RGSA 3WHXA 2I60L 1I75A 2IMMA 2VZVA 3ESUF 1TZIA 1F3DH 1T7XA 5DRXA 1IZKA 1I7RA 2HT3C 2XICA 4QTIH 3SN6N 1BEYL 3V52L 3QZWA 1X9QA 1A21A 5T33H 2VSCA 1IEAA 4PG9A 1F90L 4U7KA 1U0QA 2AKRA 2EDNA 3HZKA 5CAYB 1CBVL 1K2DB 4KHTH 3WJLC 3HR5A 4LPWA 4PJIF 3ZE1E 1T0MA 1W0WA 4PJAF 5DMKB 1CIDA 3MXVL 3B8YA 4M9PA 3O0RH 2ADGA 4KJWC 5IFJA 1S7WA 1EEYA 4Y1AE 1MH5B 2JB5L 4FS0A 5BXFB 1JIBA 4XPFH 4KKNA 1I8IA 1WITA 3FO9A 4HCRA 3ZL4H 3KYOB 4ZUVB 3NZ8A 3PWPA 1UCBL 1AY1L 1U8NB 4MJ5A 4LGPB 3VGGA 3MRBA 5ECJE 4K94L 5IBTL 1QRNB 4LLYB 4PTUB 3V0VB 2VZTA 5F7YC 3O6FC 5FUCC 4D0BB 5KW9L 2O61A 4MJ4A 3DTXB 1O0VA 1NLDH 1XR8A 1ACYL 5D71L 3LEVH 2DBLL 5KZCD 5DD1L 3DIFA 5A2IH 2FB4H 4Z0XB 3VXRE 4OZIA 5C08D 4M9OA 4KJYA 2BXYA 4X6BB 1W72L 2P8PA 4HDIB 1GL4B 4G6JH 4Y5YA 5H2BA 1BLNA 5JIIA 2F54B 1KB9J 3CIQA 5IHZA 3DUSA 4NKIL 3SE9L 3T3MF 1VCAA 4L8CA 3NFNA 2JTDA 2YD5A 1EERB 4UILL 1J0JA 1RURH 2UWEE 1K85A 5CIPH 4M5YL 1NDGB 2VLJB 3K2UH 2JJTC 4I18B 1AR1C 4EI5A 3LKNA 1UM4H 2EYRA 5DRWB 5HHMB 3BPCA 3BO8A 4PDCE 2ZKHH 1OF2A 1J8HA 1SYSA 4GSDH 2R56H 1CDGA 3NIFE 5ACLA 1PYWA 1AJ7H 2EDWA 4W6WB 2WK2A 3JWDC 3GJFH 4P9MH 1MI5B 5F3HB 4I0PA 4MMXC 3BH8B 2HFEA 3IDJA 1OVZA 1W72A 3KLSA 5BS0D 4QT5A 5IW6A 5ANMA 2XZAL 5L88H 2GEEA 4R4FH 3DLQR 3TNMA 4C83A 1IC5H 3DSFH 1IKNA 5INDA 5GRJH 1YPZF 1V7ML 3AXLB 3H0TB 3HS0A 1YYLL 3P9MB 5E8NB 3U9UB 1J87A 4JZJC 4Q74A 4Y4HA 4JFYA 2XRAH 3TPUA 3NIDF 4XAWH 2X89A 3QO0B 3VXMB 1RZ7L 4KRPC 5GGTH 4U1GB 1N6QL 3QXTA 1Z5LA 3MNZA 3NCFB 2Y25A 1MNUL 3NTCL 2GITB 4Y88A 5HI3C 2X5PA 4M6NL 4YC2B 4YPJA 1NGQH 4NRZA 4MA1C 1I1FA 3C60D 2G5BA 4Z7UB 4YX2L 2VDQH 4QHNA 3QHTC 3VW3L 3ULUE 4JREC 2EDBA 2HKHH 4DVRL 2VAAA 4GW1B 1ZA6A 3G6JF 3X3FH 2MKWA 3KPTA 5IVOA 3K4DA 2AJ3A 2X4RA 3CX5K 4NQDA 3MV8E 3NCBB 3T0DA 1OL0A 4S1QL 3GI8H 1I3VA 3B6SA 1UB5A 3FTGB 2Z8RA 2EE2A 3QUKB 2BNQB 2XACC 1QEWB 3NZHH 2Y4SA 1A14H 4U0QB 3ZTJH 2H3NB 3V7MA 1RU9H 2B0SH 3QCVH 4PJBF 2V9RA 5E8PB 4S0SD 2EXYC 1KELL 3MRLA 2LFGA 2H26B 5JOFB 3REVB 4YHYC 2M1KA 2R69L 2ARJB 4GAGH 4WFGE 3UTTE 5E2TH 4KJWD 4ZOAA 5DQDL 4WENB 4OLVL 3KNBA 1BD2E 4M6OH 2E7HA 3M8OH 1CQYA 5JORB 4DN4H 4P2RD 2Z92B 32C2B 4PJ5E 2RFXB 4IRJC 1NMCB 5ITFA 4HUKB 3LQAL 3ARTA 1G7LB 3RGVD 3WHXB 1WZ1H 1KCSH 4WGWB 3B9DA 4YQXH 1TZIB 3DX9A 1AKJA 3HNTL 4HLZH 4HPOL 5DRXB 3TV3L 3O6FD 3WEXA 1I7RB 4F7CA 1QFWI 5GS0C 3QZWB 3FN0H 4H26B 4HS8L 1IEAB 1KJVA 4PG9B 1WJ3A 1Q72L 2AKRB 2VKWA 3HZKB 4Y1AA 3HR5B 3BQUA 5GS3A 1T0MB 1MY5A 1W0WB 3ARGA 2QQNL 4PS4H 1DFBL 1QQDA 5IKCA 2ADGB 4GAJL 4LASL 4PBXA 5IFJB 1S7WB 1EEYB 4HK3N 2FGWL 4ALAL 5IW3A 3VG0L 4ZMAT 1I8IB 3FO9B 4AL8H 1YN6A 1T89C 3NZ8B 3ME0A 3SDAC 4Q9RH 4UNTA 1UFUA 4ODSL 4X4XA 4MJ5B 3MRBB 3Q5OA 4FTVD 5ALCL 1NQBA 1AR1D 3HE7C 4OLUL 2P5ED 4XWOC 4MJIE 3SJVE 4K3JL 3FO0L 4MGXA 4EI6A 2O61B 4JHWH 5FHBH 4N90D 1XR8B 4ZYKA 3DIFB 1C1EL 3T3ME 1X5ZA 5HYQA 4OZIB 1XF2A 4KJYB 1MCCA 4KY1L 1IE5A 2P8PB 1HSBA 4OLXL 1P9MC 5C07E 4Y5YB 5H2BB 4FABH 1SVCP 3DUSB 4YAQA 1QVOA 5DVKA 4POYA 4GG6E 2H1PH 1D5BA 4L8CB 1I4FA 3NFNB 2XZZA 1C5BH 2EDFA 5IROA 3EOTL 2O5YH 2Q8BH 4L3EE 1NCWH 4EI5B 1UH3A 3LKNB 2EYRB 5MENA 5F1NA 3BPCB 4FMKA 1KENL 1DL7H 3P0VL 3BO8B 5GGRY 5IQ7H 5DMIH 4KRPD 1OF2B 4OLWL 1J8HB 1SYSB 4B0MM 5CZVL 1PYWB 2YZ1A 2PTUA 3ULUL 4LEXL 5I8EB 4NPYB 5AUMA 4MJ6A 5E00A 4I0PB 4PTTA 4U1KA 2HFEB 3IDJB 1W72B 4IS6A 4HULB 4WUKH 4R2GB 1AGCA 4QT5B 5IW6B 5ANMB 5HVHC 1L0XA 4JO3H 3TNMB 4C83B 4QHLA 4FNLL 1WFOA 5INDB 3GRWL 3IU4H 3H8NA 4F9LA 3UYRH 3HS0B 4PB9H 4M4PA 1RIHH 2FCBA 4Y4HB 5AWNH 5IB5A 4JFYB 3PQYE 3TPUB 3X17A 1JI2A 1FH5H 4RISH 1OOAA 4LKXA 2QHRH 1G7PA 2B1HH 4L8DA 1J9CT 1MCFA 3TNNA 2BDNL 1Z5LB 3MNZB 1ZLVK 2DQFA 4U33A 4KUZL 3G6JE 1FP5A 2EXYD 4NRZB 4UOW0 3HC4H 3VXSE 3NVQA 4CNIA 2G5BB 5DGQA 4JPKL 4QHNB 3DHMA 1QSFE 2VAAB 4TVPH 5TDNA 1VFAA 1KJMA 3W81A 2DQCH 4WW2A 1ZA6B 3E0GA 4KTEH 1P7QD 4N0CC 4HIHA 3DOSA 3GRWA 3C6LA 4UB0H 2MCG1 2AJ3B 2X4RB 4NQDB 4IRJD 5DD5H 5D7SH 5KG9A 1HNFA 4N5EA 3B6SB 1KLUA 1UB5B 5DFTA 2C4FT 2A83A 4LQ1A 4BQ8A 3QFJD 2OJZL 4V1DD 4HXAL 5GS0D 2FX7H 1YEJL 4KJPD 3SGKA 1EO8L 1HIMH 4F2MA 5FO8A 2VWEC 4PJCF 1CL7H 2YD1A 3TVMC 1NCCL 1H5BC 3UTTA 1VGKA 1U91A 3MRLB 2E27L 1BD2A 2YWYA 1TZHA 2CLZA 1T5XA 4D9RE 1S9XA 4PJ5A 1KPUA 4Z7WF 4FQJL 3O2DH 1FBIH 4WW1A 2XN9E 4JRXD 1WGOA 3HI6L 2GY5A 3UPAA 3AB0C 2R9HD 1JRHI 5ITFB 3RAJL 2NXZB 4OBSA 3E2HC 4Y19E 1HEZA 4R8WL 4OFKA 4JDTL 2QL1A 3ECBA 4LLUA 3S5LG 4Y5VC 2JCCE 4K8RH 5E24E 5I1AA 1N7ML 3DX9B 1AKJB 3FQRA 3HE7D 3MLZL 2AABH 3WEXB 3TZVA 1PG7H 4F7CB 3CCHA 4O9HL 1ZTXH 1RUAH 5MHSE 3CD4A 4FFZH 3IS0X 3KHOA 1DQML 4ONFL 5CILL 5HXMA 1KJVB 3CDGA 4LLWA 4WI5A 2EDRA 4FQ1H 5F7DA 1GSMA 4R7DA 2C9AA 4Y1AB 3BQUB 3FQXA 3ARGB 3V7AE 3WO3B 3REWA 1QQDB 1VEPA 5FCUL 5IKCB 1JI1A 1XF3A 1HNGA 1AXTL 5TGBA 5E2VL 3FT3A 3VH8A 4BZ2L 4OCSL 4R4NC 5F9OH 1XAUA 1YN6B 5A2LH 5TE6L 1KN4H 4PD4K 4H1LH 2IQ9L 1FRGL 1U8PA 4AIXA 5K9JL 4X4XB 4BKLA 3U30C 2YOCA 1CE1H 3DJ9A 3EUUA 5JR1H 3QPXH 1JN6A 5HDOA 1MQ8A 4WEBL 5E6IA 4JFDD 4TUJA 2FHCA 3QJHA 4PRNA 4QRTA 4EI6B 4AM0A 1BFVL 1NUDA 4XB7A 2R2EA 4HBCH 3MLUL 4ZYKB 1SY6L 2R1WA 5T3XL 2B2XH 5BW7C 3G5XA 5GS2D 5HYQB 5C07A 4I3RL 3FL7A 1XF2B 1LEGA 1ONQA 1JFQL 4ENEC 2I24N 2IFGA 1D5IH 1HSBB 2HFTA 2YD8A 1I1AA 5DC4B 4ZQKA 3TP4A 2DRUA 4YAQB 4NUJA 4ZXBA 1QVOB 3Q1SL 4MYWB 1JBJA 1D5BB 4PJ9C 5HHOB 1I4FB 5E56A 1S7VA 3VRLE 3CFIC 1BJMA 5CHNA 5B39G 3UPRA 2NY1C 2XZCL 3OKKA 2C5DC 1OGAA 5MENB 1MHHA 5F1NB 1EJ6A 4B7LA 4UV7L 4WFFD 4G6KH 4DZBB 3S35L 4M43H 5HYFA 4M1DL 3QIBD 3OPZL 4GKNA 3DETD 3Q6GL 4XMKH 1SY6A 3I6LD 4KDTC 1V3LA 1G0YR 5AUMB 3ARDC 4MJ6B 5E00B 3PWVA 4PTTB 4X6EA 1FL5A 4U1KB 1OAQL 5E70A 1NAML 3C87A 1CGSH 3QWQB 4IS6B 3VD7A 4BQBA 1AGCB 3ZKMC 3WKML 2NY5L 3MBXH 4FQPA 1AI1H 1BBJA 3R06A 4QHLB 1I9JH 1BVKA 4N0CD 2EEBA 3O6MH 3PQYA 2E7LC 2VDPL 1PEWA 4FXKA 2ZOKA 4K2UL 4CMHC 1XH3A 5IB5B 5C1MB 2A77H 3A6OA 1XCQA 5DVOA 3ARVA 5JHDA 4LKXB 1JPSH 1G7PB 2AJVL 3EJYC 4L8DB 3RI5F 1E4XH 1ZS8A 4G7YH 1E4WH 3TNNB 2EEDA 2DQFB 2DQDH 4JFED 2J88L 4PG2A 5C7XL 3TVMD 3D85D 1QSFA 2QBWA 1Y6KR 1GYAA 1QO3A 5T1KA 4CNIB 4XBPA 4LPXA 2ATKA 1NAMA 3AAZA 3CLEH 5GS1C 4C54A 1BPVA 2Y23A 2VUOA 5TDNB 1VFAB 1KJMB 3QEHA 4WW2B 3NCYS 3EYOA 4X7SH 4HIHB 3C5ZA 4P4RA 5B38G 2WP3T 4HBQA 3C6LB 4OCWL 3BKYH 4TULH 2A0LC 3KAAA 2DLHA 2IFFH 5KG9B 4HUUA 3S7GA 1KLUB 3CK0L 2A83B 4AEEA 3QNYA 5F6IC 5SX5K 3TFKC 2VDKL 4U6HB 3GM8A 4ORGA 4WUUE 3QDJE 4GW5A 5FO8B 4F2MB 1J1XH 5C0CA 1AO7D 3V4PH 1EEQA 3RPIA 2F5BL 1VGKB 3U0WH 1TVHA 2MSPA 5EORL 3RKDC 3WD5L 3KVQA 1BD2B 2C4FU 4PV8A 4M61A 4ELME 5FEBA 1TZHB 2CLZB 2XN9A 2VL5A 3EYSH 4OM1H 2IAND 3TM6A 1KC5L 1MFDH 1S9XB 1J1OL 1T5XB 2VOTA 4PJ5B 1QSZA 4QRSA 5L0QB 1KPUB 2R39A 5CEZH 2L7UA 5H35A 4FOMA 4Y19A 4WW1B 1R5IA 4OCRL 5CJOH 1JGUH 2JCCA 4NJ9H 1JNHA 1JRHL 5DJCA 3VWJC 1YNLH 5T5NF 1FAIL 5F9JA 1AHWA 1HEZB 4LGRB 5ESAA 1T83C 5IM7A 3E6HA 3ECBB 4LLUB 2JJSC 2FX9H 5I1AB 5E9DD 3FQRB 4KRLB 3LMJH 2EIBA 3TZVB 3EOAA 3CCHB 5IHBA 5KBNC 3D87B 1NMAH 1R24A 5JDSA 3BUYA 5IBUG 1T80A 3CDGB 4LLWB 1QUNA 1H8OA 4WEUD 4PJDF 5F7DB 1J5OL 4R7DB 3BYYA 2M26A 3FQXB 4ENED 1FGVH 3REWB 5B8CC 2ZNXA 3STLA 3LIZH 1XF3B 5TGBB 4P3WA 3FT3B 4OZFH 3F6IA 3NFPA 4LOUC 4P4KC 2UZIL 3WLWC 5AAWA 5EBLA 1FORH 1A1NA 4K71C 4BELD 1U8PB 4BKLB 5MP6H 1FZJA 3UYPA 4OCNC 5M95B 2NY1D 4XC3L 3CDYA 1JN6B 2A2QT 5E6IB 3DV4A 4HGWB 4TUJB 4PRNB 2IAMC 3QJHB 4QRTB 2AVGA 4LSQL 5DXWA 1VKXA 2ID5A 4AM0B 1NGZA 2R2EB 5HYJD 2J2ZA 4CU7A 4M93B 3QUMH 2XY2A 4KRMB 2R1WB 2EYSA 4JEGB 4OZHA 4DQOL 3P77A 4H0IA 5C07B 3ARDD 1LEGB 4KUCD 5I1CH 3QWRD 3ARZA 3OWEA 1I1AB 4ZQKB 4OLZH 4Y4KA 3ZKMD 1RUQH 5AG8A 4NUJB 4ZXBB 1ZGLP 4OCXH 1VFMA 1MCQA 4D9LL 1S7VB 2E7BA 2NR6C 2CDEA 4Z8FH 5CHNB 3X3GH 1YDPA 1EZVX 4K7PH 3UPRB 5BMFH 3RWJA 3OKKB 1KJ2H 4MA8H 1OGAB 1MHHB 3UJIH 2BXZA 3TESA 1A1OB 3BIKA 4OIIL 2A74A 3WSQL 4JVWA 5IG7A 1DUYA 4OAWA 3ARBC 3J7HA 4Z0BH 4GKNB 4GLRI 3U7AA 3RGHA 4QXGL 2FEEI 3MA9L 2MCPH 2VXUH 4P46D 4NC1E 3PWVB 4X6EB 1FL5B 1PY4A 2QQLH 4MNQE 3EDEA 1KTLA 2YD9A 3WDIA 3MRJA 3HZMA 3SPVA 5GRUL 1ZSDA 2DN7A 1BBJB 3R06B 2VN7A 1A6WH 2VZUA 1BVKB 3N0PB 4JQXA 3PQYB 4HIJA 3LKSA 4D8PA 3QDGD 1TZGL 4FXKB 2ZOKB 4FMFA 2V17H 1X5LA 2A0LD 4J2XA 5F88A 4C57C 1XH3B 1IARB 2XTJD 4FQCH 2NQCA 5I18H 3MV7E 5DMGC 3TFKD 1LHZA 5JHDB 4XX1G 5DT1L 4BSVA 3V8OA 1K4DA 1FNHA 4QRQA 1ZS8B 3DUUA 2DMBA 5FYLE 2AJUH 4YHKL 4LSTL 1QSFB 4ZFOL 1OAZH 4S2SA 1RZKH 3IAPA 1QO3B 5T1KB 5AD0A 1CXIA 4XBPB 3N85L 2ATKB 1RJZA 1NAMB 1QSED 2ITCA 1FYHB 2DF3A 3AAZB 1JNLH 2R0WL 2WSKA 1A6VL 3QEHB 3HE6C 4WHYH 3B5TA 3EYOB 1LO0L 3SE3C 3RUGE 5J6GB 3C5ZB 4P4RB 3Q6FA 5EA0H 2DKUA 2RAMA 1WBXA 1J0KA 1BZ9A 1IGFL 3V5HB 3OZ9H 2EDTA 3CXDH 3FRUA 3RHWK 5KJRL 2HTKC 4HUUB 4WUUA 5KAQG 3QDJA 1OAKL 2J8UB 1WBZA 1CGWA 1G9NC 5IESH 5C2UB 2BP3A 2YKLL 4JR9H 4GKOA 5AYUH 4ORGB 2ZUTA 1C5CL 3QRFM 2KZWA 4QHMA 4RFNC 4ELMA 1KFAL 4S11A 5KSAC 5C0CB 3DUHA 3RPIB 5E0QA 2NCMA 4ZFOA 1TVHB 5H37H 4XVJL 2BRQA 5IJVA 4PV8B 1UA6L 1WFNA 1X5KA 4M61B 4Z7QF 2XN9B 1FSKC 2VL5B 5E4EC 1FVCA 4QRSB 1MFEH 3DYMA 3GI9H 2YS4A 5H35B 4Y19B 3HA0A 3NGBB 5F96H 1R5IB 4P4KD 3LPFA 3WLWD 2JCCB 3IXAA 3I3BA 1JNHB 1WEJL 5DJCB 3O8XC 2BHZA 5HJ3A 5F9JB 1DVFC 1AHWB 5ESAB 5IM7B 3E6HB 4PJDE 5KVFH 4QY8A 4EXPX 2P1YA 4PRPE 1S7UA 1HQRA 2IAMD 4NC0B 3EOAB 2YA1A 3P2TA 3SY0A 2HKFH 1R24B 5ETUA 2V2XA 5JDSB 3BUYB 3RA7H 1QYGL 1M71A 1NJ9A 4PGCA 1AC6A 1D5MA 4DGYL 5FGCE 4JFFA 1JFMA 4TQEL 5F6HI 1DQQA 1KUMA 1DLFL 5D72L 4E9LA 4ZO8A 4MXQA 4GXVH 1UKSA 3NFPB 1PEZA 5K93A 4JKPL 5EBLB 4AEFA 4XMPL 3LOWA 4JG1H 1GGIL 2BOBA 2NR6D 3MODL 3S4SA 3SKNA 1FZJB 3D2UA 1J0ZA 5B22A 1AIFA 5JIHA 1MRFL 1IQWL 3DV4B 5HYSA 1ZE3C 4A6YL 1VKXB 1NGZB 4P2YA 4DCQA 1KEGL 5GZOC 4GBXA 5CCKL 4ZTOL 1ZGLM 2ZG3A 2ZG2A 2EYSB 4OZHB 1REIA 2VDMH 3P77B 1JMXA 2X4SA 2ESVD 5JMOC 1HXYA 3GIZL 4PJEE 4Y4KB 2HT4D 2I25N 4K23H 5D5MF 4YDVA 5IW1A 1FL6A 4BZYA 3NPSB 1W2KT 2HRPL 3DVNA 5C0DA 2OK0L 2DTML 3MLPA 2CDEB 2ZPKL 4J3TA 1YDPB 3O6LH 4ONHA 3RWJB 1CXKA 1L7IL 4LQFH 1K5NA 2OMBA 4WTXA 3BIKB 2F53E 2A74B 4A6YA 5EU6D 3SDYH 3QNZA 3NN8A 1NEUA 5IG7B 1DUYB 1TJHH 1CQKA 4OAWB 5FGBC 3EDKA 1QLFA 4N0YL 4BFIA 5C0IA 4RGOH 1DQTA 1F6FB 1CK0L 2FEEL 4MNQA 1H3UA 1RUPH 4PB0H 4S1SL 4YHPA 4DGIH 3IFPA 2HTLC 4EZMA 1KTLB 1BZ7A 3MRJB 3HZMB 1ZLUH 1MVFA 3SPVB 3OR6A 1ZSDB 5J1AA 4J23A 4EIGB 3RWIB 5TPWL 3HE6D 2NY7L 1QA9A 2P42B 4JGMA 3LV3A 4F58L 4X6DE 2VITA 4HIJB 3LKSB 4D8PB 4N8CL 3IYLW 1ZVHA 3GSNL 3EGSA 3MV7A 3P0YH 2E6PA 5CMAA 1HDMA 1IAIM 5F88B 5TE7H 4WFEE 3OF6D 5ESVA 5I76A 5D1XD 5L2KE 3B43A 1EJOH 1CGVA 5C6PB 4ZAKC 4Z76A 1VFOA 4MSWA 5IEKA 4BSVB 1K4DB 3H9ZA 5BRZE 3HB3C 3WDJA 4QRQB 3DUUB 1UB6A 1YJDL 3WXVL 1T1XA 4X7TA 1FIGL 2PW1A 5T3ZH 1YECL 4K3EH 4W70A 3HFML 4S2SB 1U3HA 5AD0B 3VXUE 1CLOL 2ITCB 2AEIT 5C0FA 4Y2DD 1RZJL 3AGVA 1OAUH 4CDHA 5ILTH 1H3WM 3BJLA 4AEHL 3BD3A 4HUWA 3Q6FB 3NABL 1WBXB 1BZ9B 3FRUB 2BVTA 3GSNA 3O8XD 4KTYA 3ULSA 2BVEA 1DVFD 2VQ1A 4JKWA 4WUUB 3HI5L 1RPQA 1WBZB 2CKBH 5I16A 4IJ3B 4Y8AA 4YE4L 3B9KC 3RBSA 4QHMB 1OAYL 4KVCL 5ERWA 1J10A 3LS4L 3G6AA 2Q76A 4ELMB 4PP1C 2VZ3A 2DICA 1IM3A 4ZFOB 8CGTA 4J3WA 3F7VA 1U41A 4UI2A 4FQQA 5DVNA 5IJVB 1F3DJ 4L4TE 5EIIA 4YHZL 3GHBH 5K9QG 2DIBA 4JQIL 3VI4F 1FVCB 3NH7H 4QNPF 3U9PH 2CR6A 1MREH 1PW3A 3O4LE 4R6UA 4L5FH 3WIFA 1GHFH 2X2YA 2EIZA 3O2VL 4EDWH 1X4ZA 4N1HB 4K3DH 3V4VL 5HJ3B 4HF5H 3ORJA 4JQVA 5IVXB 3QEGL 5L7XH 1UCTA 3JWOH 1PLGH 3BP5A 4P5TD 4QY8B 1S7UB 1HQRB 5DRZA 1JCKA 1NCBH 5EU7E 3NBNA 3QUYA 3SY0B 2V2XB 3DRTA 4GMTL 4UTAL 4JHAL 1M71B 1NJ9B 3KLDA 2PNDA 5T5FH 4PGCB 3NCCB 1D5MB 3NMEA 5IBLC 1LMKA 4FA8A 3FONA 4JFFB 5I8OH 1A6PA 2DLIA 2YR3A 3DVFA 1DQQB 3D3VE 1RIUL 3QEUA 3WLBA 3RY5A 4K9EH 5M7QA 4PJXF 1FE8H 4IDLA 2YC1A 3BYTA 3KR3L 2APTA 4PJHE 3SKJL 2BOBB 3S4SB 3SKNB 3T1FA 3D2UB 4HPYL 3K7UA 5C0ND 4X80L 2WZPD 1AIFB 3DMMC 4PGDA 2B4CH 1DQDL 3T1WA 4UU9A 4C4KO 3AM8A 3MLSL 5HYSB 2VLRE 1MF2H 4DCQB 1QRND 4GBXB 1S9VA 5I73B 3QQ9D 3LQMA 4Q6IC 3T2NH 2X4SB 2OM5A 1HXYB 4BH8A 3LN5A 2HTLD 3ARYA 3EZJB 3BAEH 3AMLA 4OKDA 4BQCA 4NQCE 3GSUA 2MMXA 3ZTNH 4DUXA 5IW1B 5I8CA 3C5JA 1AP2A 1FL6B 1MIEH 5C0DB 3DVNB 2OP4L 2J12B 1IAOA 2F53A 4OT1H 4ONHB 1OWWA 4QHUA 1G9EA 2DTSA 1TQCB 4DK6A 1K5NB 5C92A 1M7XA 1IAIH 4A6YB 3QNZB 3NN8B 4S1RH 3DBXA 4YH6A 3V6OE 3EDJA 2V2WA 3QFDA 3ZDXE 1QLFB 1E0OB 4M5ZH 5C0IB 4BFIB 4ZSOE 5C6WH 1CFSA 1OP3H 4Z7VF 4KU1A 1UQSA 4PIRF 5F97E 1NC4A 4MNQB 3LEVL 5JNYA 1ED3A 4JB9L 4EUPA 2BFVL 1QG3A 5K9KA 2FB4L 4YHPB 5EC1A 3IFPB 3R0MA 5FYKU 2BSED 4NHUE 2PO6A 2QSVA 1BZ7B 1MI5D 4X6DA 1NGPL 3KJ4C 3OR6B 5J1AB 3C9NA 3PXHA 4UT9H 1J12A 4G6JL 4TPRH 4PREB 1QA9B 2R29H 1FYTE 3LV3B 1QZ1A 3QHFL 2VJXA 4ODHL 2VITB 3UTPE 1A1MA 2RBLA 1BFSA 2A9NH 3EGSB 3MV7B 5I0ZA 5CMAB 1HDMB 1V7NH 3OQ3B 5ESVB 5I76B 4HFUH 2NY0C 3U7WH 1Q1JH 3HUJE 1UM4L 4KRNA 1U58A 4MSWB 5IEKB 4EI5C 2YD4A 2IPKA 1RZFH 1UB6B 1T1XB 4GSDL 4X7TB 2Z91A 1QTYT 4HJ0C 4KK8C 3VXMD 3GKZA 3W5MA 5B3JF 4RRPA 1H15A 1AJ7L 4JHBA 5FKAA 4FG6C 1F4XL 4HW6A 1U3HB 5A2FA 3SDCA 5C0FB 1A22B 3MO1A 1I3UA 4I0PC 3S36H 5A3IC 4L8SA 4OD1L 4HUWB 2LVCA 1IC5L 5CJXC 2OXHA 3DX6A 5GRJL 3GSNB 3ULSB 1FHGA 5JW4N 4LCWE 4L4VE 4LSPH 3TN0A 2D03H 4KMTH 3RWHA 5CIPA 1O5DT 3QUXA 4U2ZA 3PWUA 3UYOD 5I16B 2XRAL 3ZHDA 2GW5A 5ERWB 3G6AB 1O7VA 2ZNWA 1XF1A 4JAMA 2Q76B 4L4TA 4NQEE 4G3YH 1KEMH 5C09D 3MRDA 1IM3B 2PYEA 3F7VB 4HQQL 4FQQB 3WS6A 3RVVD 3U6RA 1TJIH 4U0RB 1D9KC 2VDQL 4NJAH 2HKHL 1XCTA 4ETQA 1GAFL 3WIFB 2I27N 3QHZL 1DBKL 5DFWH 3TO2A 3X3FL 4DFIA 1NLBH 5HHVH 2VDNL 4RFEA 2YMXL 5ADPL 5IR1A 4YHNA 5DYOB 3GHEL 4N1CA 3KPRD 2ZWLT 3DMMD 3BP5B 4GQ9L 2XXCB 3SGDH 5DRZB 1RK0A 1G7HA 2XA3A 3QUYB 4ZD3L 1A14L 1AXIB 4IOIA 1A6ZA 3DRTB 1R5VA 4PJXE 3D3VA 1K8DA 3QCVL 1MJUH 2YD7A 4UV4H 2ZSWA 2JIXA 3FONB 5IP4A 1BJ8A 3MFFA 1QHPA 4OSUL 1EDQA 1ZVSA 5TQ2L 3ULVE 1V5JA 3RIFK 3P9WB 3QEUB 1IC1A 1A7PH 1UM5L 4PJHA 5HTSA 5E2TL 3W0WB 3WLBB 4BYHA 1CDBA 4M6OL 2YC1B 4ZUSA 2DIAA 4DN4L 1NFDE 5E8EA 3WV0A 2VLRA 1BGXH 2W92A 3T1FB 4NN5C 4CUCA 5LCVL 3PWPD 4PGDB 4I8DA 4UU9B 2QADB 1WZ1L 1LO5A 3FAXA 5CP7A 2WINA 4G8FA 3BN3B 4XP9H 1JHKH 1S9VB 2XIDA 5HDQH 4NQCA 4H5SA 1F3JA 2ICWI 4GS7B 5LGHL 1U42A 4KDVA 4HJJL 4BH8B 3LN5B 2HMIC 4UMGA 3VFVA 4GRLA 4PS4L 3GSUB 3DO7A 3V5DA 3FJTA 4OGYH 4IMKC 5I8CB 1U8QA 3C5JB 3MV9D 1AP2B 4ZFFA 1KBGL 1MAML 4YDIH 4MQSB 4AL8L 1LQVA 3ZDYF 1IAOB 3P11L 4OJFH 1YEFL 2F53B 1H3PL 3V6OA 1IT9L 1G9ML 4LAQH 4QHUB 5HDLA 3VFSA 2H45A 3LN4A 2NY0D 4XNUL 1LO2H 4DOHE 2R0LH 3DBXB 2GTWA 1NUNB 2V2WB 3QFDB 4ODWA 4EI5D 1MJ7H 1UZ8A 1CFSB 5D6DA 1NPUA 1UQSB 1NC4B 12E8L 5JNYB 3TJEL 1ED3B 4LLMA 1J8HD 5K9KB 5EC1B 5A2KH 4FG6D 3IDYB 5T1DL 5JDJA 2PO6B 4BSJA 1P4IH 1FYTA 4HAGA 4X6DB 4KTDL 4I0PD 3C9NB 1Q8MA 1JNNL 5B4MC 4FABL 4NP4H 1L6ZA 5FDYA 1EHXA 4R2GD 3NCJH 1P6FA 1MIML 1WC7A 4KDWA 3TF7C 2CUHA 1A1MB 2E9IA 4JM4L 3HUJA 5FM5M 1AXSA 5I1IL 1R5WA 5DK0A 1GOHA 5IVZA 3L5HA 1NMBL 2FR4A 1BQUA 4JJHA 4ODVL 1T7YA 1U58B 2IPKB 3ZT7A 1DL7L 3HZVA 3T0EE 4FQXC 5DMIL 4XRCA 2E7MA 5F7FA 3PL6A 2Z91B 5KANI 5ICZA 5FKAB 5DZLA 4H0GA 4AIZA 3SDCB 2YK1H 4NCC1 3AY4C 1U8LA 1UYWH 3MJ6A 1D9KD 3MO1B 4WUKL 4L8SB 2ORBH 4LCWA 4DZ8A 4ERSL 3CDCA 3DX6B 1MRCH 2MQ3A 2PYFA 3HMWL 4JM2A 4RSVA 3TN0B 1F13A 3UYRL 4PB9L 3RWHB 5CIPB 4PGBA 1KGCD 1T1YA 3QUXB 1E4KC 3PWUB 4NQEA 3W9DA 2B1AL 5TQ0H 1MFNA 4RISL 4HHAA 1N5YL 3RDTC 4S1DC 1QBML 2QHRL 2B1HL 4JAMB 4L4TB 3INUH 3MJ9H 1MSPA 1R3LA 2D7NA 2A73A 1CVSC 1H0DA 3MRDB 3F58L 3MBEA 1NKOA 4QXUH 4AY0A 3ULVL 2PYEB 1ZLWK 4YFLF 3T09A 3AROA 4YDJA 5J06A 1A5FL 3HC4L 3ULUC 3U6RB 1S7TA 2UVEA 3O3AA 5I9QB 4KKCD 1XCTB 4ETQB 4TVPL 3UJTH 5FAAA 2ERJB 5FXCH 4NWUH 2HN7A 4ZG1A 1PJ9A 3TO2B 5C6TH 1A8JH 2W65A 4RFEB 2ZSVA 3L7EA 5IR1B 4YHNB 1B2WH 1T7WA 5GZNC 3GK8H 5JQ6H 1OLZA 3JXAA 1S7RA 1U8IA 3OBAA 5HHQA 5IOPB 1RK0B 1G7HB 1A47A 3WIHH 2J4WL 4NWTH 1Q38A 4WY7L 3WIIL 1S8DA 1OW0C 1BM3H 4IOIB 1A6ZB 1HIML 1WQVT 1R5VB 3UROR 4HKXA 3D3VB 1K8DB 4R97B 3RJDA 3X13A 4J8RA 1PAMA 2ZSWB 2JIXB 2EDYA 4GFTB 4X6CE 3W82A 3MFFB 1KIRA 1ZVSB 5FYKE 4Y1AD 4PJHB 1NFDA 3EYUH 3BQUD 1X5HA 3PWLA 3K1DA 2JLLA 4OD3L 2VDRL 5C3LD 4JHZA 1HH9A 4ZUSB 1FBIL 5L0QC 5C70A 1EHAA 2DJ4A 5E8EB 3BT2H 4JO2H 3IS1X 1OSPH 2VLRB 1ITCA 4TSAH 3GMLA 1PZUB 1M4KA 1R0AH 1TTFA 1T5WA 5ISZE 1FN4A 3MCKA 3MLVH 3QPQD 3V95A 1LO5B 2EDKA 5CP7B 1CICC 2WINB 1CD1A 3W2DL 2FATH 4M02A 1ZTXL 5C3TA 2XI9A 2R2BA 5IHUL 5E2UL 1JF6A 5GS0H 3F12A 4DKFH 4FFZL 1Z3GL 4NQCB 1FIEA 1S5HA 1F3JB 4H5SB 5D8JH 2FO4A 4TSBH 1JZ2A 2KBGA 5D7LE 4C56E 2UZXB 4BFGA 4P5MA 4NQVA 1KN2H 4KVNH 3VFVB 1LDSA 1YEIH 1ES0A 3V5DB 2VXVH 2CUIA 4XCCL 1MCBA 4YXKH 6CGTA 1KCVH 1U8QB 3CFEA 1WK0A 2WM0A 4PV9A 4ZFFB 3S3PA 1FVEA 2XZQH 5BQ7A 1IMHC 3E3QC 4M7ZC 2HRLA 3FRPA 4OIAA 3VFSB 4TUKH 4JO1H 3EOBA 3LN4B 4OLEA 1WAAE 4LFHG 2GTWB 4ODWB 4M1GH 1UZ8B 5J1TC 4HBCL 4CADA 4XI5C 4KUCF 4OTXL 2ICWA 4XNXH 4LLMB 4UDUA 2PTVA 4I5BA 5DJXA 4LKCA 3FB6A 1FLRL 4U31A 4TTDC 2VC2L 3CZFA 5D7KE 1CD8A 1FYTB 4PJBA 4NHCL 4D0DA 3WBDA 1INDL 4KMLB 1WVZA 3SOBL 4O5LH 1WC7B 1X4XA 2ADJA 1JZ4A 4LP5A 1U9KA 3I6LE 3HUJB 4ZXBC 1AXSB 2DI7A 1N0XH 1R5WB 2X1PA 4XC1H 2FHFA 4NZUH 4HJGA 5DK0B 5IVZB 3T0EA 1NFIA 4I9WE 4XMLL 3ZDZE 2FR4B 4U6VH 5E03A 4G80A 3MJ7A 4LBEA 5CEYA 4RMWA 3U4BL 5GGQH 4S1DD 3HZVB 3SKMA 4XRCB 3BDYH 4HXBH 4YDKL 3PL6B 3T3PE 2L4OA 3M07A 4XMKL 1YMME 5ICZB 5SV4A 4UAOC 5GS2H 1B4JH 2DM7A 3TJHC 4AIZB 4UQ3A 3ULUD 1U8LB 4U6XB 3GJFK 4DAGL 3OTTA 2DJUA 3F5WA 3FOLA 1I85C 1VPOH 4LCWB 4PJAB 5DURB 4O02L 3H3BC 4TNWK 1U6AH 5JW3H 4DZ8B 5IHLB 2D2OA 5HGBA 4RMSA 2DL9A 3MV8D 3O6ML 2PYFB 2IF7A 4JM2B 5GZND 4MHHI 3MQIA 2W0LA 1FVDA 1BQHG 1T1YB 3C6LD 4LVNC 4PGBB 4YHIA 1C7SA 1KLGA 1YQVH 3TT3H 3OKNA 1NL0L 2A77L 3W9DB 3BPOB 2EKJA 4HHAB 2FJFA 1T2JA 4N5ED 1JPSL 4F9PA 4U1MA 2E9BA 4I13B 4PJ8A 4TRPL 4YJZL 1R3LB 3DI2B 5GRYA 1E4WL 2A73B 1H0DB 2BOCA 2FDBP 3MBEB 5D93B 2D31A 4YHLH 5FYKL 3SQOL 1QBBA 4K8RC 1MLCA 2CDFA 4YDJB 1QD0A 1T6WA 4WFGD 1S7TB 2VXQH 2X7LA 3UTTD 4WI8A 1F2QA 5A43C 3O3AB 1T03H 3CFDA 1BD2D 5F7EH 1CFQA 5E08H 3PHOA 2BJMH 4P5KA 4S10A 4OCYH 1L7TH 2HN7B 35C8L 4X7SL 4PJ5D 2WQRA 4M6AA 3BVNA 2VDLH 2W65B 2DQJH 4KKAC 3L7EB 4OGZA 5EFIA 1MWAH 3S35X 4P59L 3CDFA 4LARH 2IFFL 3ZKQD 1S7RB 1U8IB 5HHQB 1CICD 1JZ5A 5C0AE 1JGVH 5HHNA 1S8DB 1FFQA 3HAEG 4MA7H 5I75B 3BD5A 4IRSA 3TZVD 4X6CA 3K1KC 4HKXB 5GGRA 1ACZA 3X13B 4J8RB 2IH1A 3BPLB 2Z8VC 3EFDH 1TQBB 3RWGA 4PUBL 1KIRB 4NN6C 3EYSL 1NFDB 3C8HA 3PP3K 2DQIH 3GNML 3PWLB 5L9DH 3PJSA 5GGVY 1HH9B 2P24A 1FFPA 2XG5A 5ISZA 5CZKA 2G60H 3UTSA 5MEPA 2FX8H 1EEZA 3BISA 2FIRT 1JGUL 2QSTA 1EX0A 1YNLL 3GMLB 3DHJA 4DTGL 1T5WB 1FN4B 3MCKB 1CDCA 1CU4L 4MJID 3SJVD 2D4FA 3WFDH 4AENA 1CD1B 4U1JA 1AFVH 2DI8A 4GQPH 3TIEA 3CVIH 5E6ID 3RIAF 2R2BB 3MLTA 1FNFA 4P2QA 3F12B 1XGQA 4XVSH 3DV6A 3BMVA 4XI5D 2F5AH 1S5HB 1YEEH 2FO4B 5AAMA 1JWUA 1QKZL 1EVUA 5D1QA 3EJJX 5D7IE 4R90L 4P5MB 2DM2A 4NQVB 3OR7A 3PV6B 4TTDD 1FGVL 4NGHH 1ES0B 5C07D 3QCTH 1VB9A 1YQ2A 4XPBH 1B90A 2BHUA 3CFEB 2AJYL 1I1AD 5FOBB 4PV9B 1FVEB 4JANA 5E2WH 5BQ7B 1QLEH 1CLCA 2O26U 4ZXBD 5DJYA 3A67L 5F70A 5IMLA 1KTKE 3K2MC 4L3ED 4M48L 2D7OA 1PKQE 3MNWA 3EOBB 3MZTA 4MVBC 4GT7A 4N0UE 4NFDA 5FUZH 4NQXA 3BRFA 3QBTB 1OTTC 1OGAD 4PJ7F 1C16A 5TE4H 5LXGH 1I9IL 5DDHA 3SDXF 3QUML 1CLYL 4CADB 5KS9E 5L6YH 2ICWB 1ZHKA 4UDUB 4JFZH 4U7MA 4I5BB 4X6FA 5DJXB 2ZCKL 4LKCB 2J8OA 3FB6B 5FYJU 3TJHD 5DD0H 4PJCA 4YWGL 2GI7A 4UIKH 3CZFB 1DQLH 2BVOA 4PJBB 4PRHA 2YPKA 5CJQH 2UUDH 5F1IA 4D0DB 2AXFA 5JO5A 1PX4A 4HG4J 1RUQL 3N1MC 2X1WL 3K46A 2VZOA 2FJHA 5E99H 2ADJB 5I1LA 2B39A 3MOQA 3VI3F 1HWGB 2YPVH 4Z8FL 4HJGB 4U6YA 2AP2A 4K7PL 3PQYD 1J0YA 1NFIB 4HIXH 1TXKA 2W0KA 2VERN 1TNMA 2WBJA 2Z9TA 4XPTH 4G80B 4NNYA 5E8DH 4LBEB 5CEYB 4U4BA 1BAFH 4W4OA 3SKMB 3JVGA 4JY6A 5LQBH 3QUMA 2ADIA 5I30L 4X4ZA 4BH7A 1FG9C 3JV4A 1EK3A 3VXSD 2VXUL 1CCZA 4FZ8H 4UQ3B 3WNOA 5I15H 1QSFD 2XTJE 3QYCA 2DWDA 5T1KD 1UZ6E 5I1JH 3RVTC 3PWNA 3FOLB 3FAWA 3C09C 5CLTA 1C08A 1M7IA 2EDOA 3GDBA 2B5IC 4Q9QL 5FM8A 1PZ5A 5HGBB 3MLYH 2Q7NA 4KKAD 3B2UC 4JQXC 5BO1H 3EO9L 1FVDB 4YHIB 1KLGB 3OKNB 1CD0A 4RGNE 4O00A 5JOPE 1MJ8H 4FQCL 1ITBB 2FJFB 4LRNH 5TDPA 4MLSA 2ZUSA 4U1MB 3T4AA 4APQC 4PJ8B 5EUOE 1RUKH 2BOCB 3KJ6L 3TC9A 1LEIA 1UEYA 2D31B 4L4JA 2EC9U 4NZRH 15C8H 1MLCB 2NY4C 1DBMH 1RZKL 2CDFB 3BKML 2X7LB 3DRQA 4D9RD 1JPGA 3IDNA 3CFDB 3RQ3A 4HWBH 1HK6A 1CFQB 2XN9D 3IFOA 3PHOB 3DYPA 4P5KB 1DBJL 3ZTJG 3BVNB 1EPFA 4UT6H 3TCLA 2F19H 3TLRA 4Y19D 5EFIB 1FL3A 4XNYH 1R6VA 5C0AA 4RZCA 1T7ZA 5EUKA 4LLQA 4P23A 4I3GA 2E5EA 4JFXB 3GO1H 5AYUL 5HHNB 2DOCA 2QSQA 2UYLA 3GMPA 4MQXD 4IRSB 4X6CB 1QFHA 4HS6A 3LDBB 1JYNA 4BQ6A 3SO3B 2IH1B 4L9DA 1FDLH 3RWGB 5ESQA 2P8LA 1KPVA 2HVKA 1I8LA 3PJSB 2F58L 1IM9D 2JK5A 2PF6A 3TBVA 2P24B 1FFPB 4G6MH 5MEPB 5DA0B 5ISZB 1RJLA 2BY2A 3UTSB 3KLHC 3UDWA 3ARXA 4F15C 4H20L 3AC0A 5JIPA 4YGVA 4KXZI 1SJVA 3BFOA 1SEQL 5HDBF 2P43B 4NUGH 3GFUA 3V0WH 3WXWH 5KVFL 1NBZA 3STBA 5HVWA 2X6MA 4AENB 2X40A 3OV6A 4U1JB 1RUML 2Q8AH 3TIEB 1FZKA 5D7IA 3MLTB 4P2QB 4PGJA 1XGQB 1IGMH 5HI5C 3DV6B 1D5ZA 1OHQA 1UJ3A 3RVXC 1E6JH 5SWSE 3UZVB 4IIQA 1JVKA 5LGKA 1JWUB 4OGXH 5D1QB 3SBWC 3TT1H 2I5YH 3OR7B 3VFUA 2OYPA 3VFMA 1KIPA 3PP4L 5I6XB 2NXYC 4GO6B 5HI4C 5EO9A 1PKQA 4Y4KD 4JANB 2AJSH 1YEGH 3MRPA 4TSCL 5C0RL 5DJYB 4JG1L 4YIQA 5IMLB 2AXGA 2DLFL 3NA9H 3OJDA 3MNWB 5ELIA 5BV7L 5KS9A 1HOCA 4NQXB 5DR5L 1C16B 2AQ2A 5C0BE 3VGAC 4YNYA 2BVPA 5DDHB 3TH2T 5C2BL 4XPGH 4Q2ZA 4NQUA 3L3OA 1ZHKB 5LBSH 1Q0YL 3GSOA 4L1HA 4X6FB 3TA3A 3ZE2F 4PJCB 2D7QA 2BVOB 2LU7A 4X99A 5JXEA 4PRHB 2YPKB 5EU3A 3KDMA 5F1IB 4BUGA 2AXFB 5JO5B 1VGEH 3RVTD 4G42A 3MRMA 2ZUQC 2FJHB 3X11A 2C1PA 4KMQA 5I1LB 1MEXL 1GC1L 5LWYL 1MCEA 4PJGA 2X10A 4X98A 4YHOH 4U6YB 3TBWA 3DXAA 4WHCA 4NN7B 2X4QA 4NM4L 2VAJA 2WBJB 4PLJD 4NNYB 4LQFL 1FPTH 5SWZE 1S3KL 4JY6B 3QUMB 2ADIB 4NC1C 3MLXH 3Q5YA 5I19L 1HI6A 4BH7B 3JV4B 4PB0L 1XGRA 2NY4D 1BBDH 3SHSA 5I66A 3AUVA 2X70A 4WJ5A 1T2QH 1HHKA 2DWDB 1I1CA 2RIKA 3HLAA 2DLTA 1MELA 3FB7A 3PWNB 1C08B 1M7IB 5J7CC 1VSCA 1FNSH 2KPNA 5DFVC 4OB5H 1MCOH 1PZ5B 1DLHA 5ACMA 4JPVH 4NO3A 4QTHA 5TE7L 3IKCA 5EUOA 4KROC 1HZHH 5HGHA 3S6CA 4WUUD 3VMNA 2XQBH 3ARFA 3QDJD 3MC0A 4M62H 5TDPB 4DN3L 1RIVH 3VMOA 3T4AB 4Z7OF 3V79C 1YEHH 1LEIB 1TTGA 3QIWC 4QHKI 4DGVL 3WNNA 5CZXC 4X9FA 1ZVYA 3DRQB 4FQIL 1FG2A 3L5XH 3N06B 1JPGB 3IDNB 4LCCA 1NAKH 4AK1A 4RDQF 3IFOB 1OAUL 5ILTL 4NCDA 3O9WA 1C12A 3RL2A 5I1KH 2X9YA 4Z9KB 3TCLB 3U4EA 3IDGA 5FM5O 4RIRA 1FL3B 5MI0C 5C0AB 2A9ML 3W11D 1YC7A 1TPXC 5EUKB 4MXVF 2IBZX 1V05A 4HKJA 4Y4FC 4LLQB 5D2NE 4MB4A 4FP8L 4J4PC 4P23B 4MAYB 5E7FA 3LZFL 1G9NH 4PY7A 1T21A 2IBBA 4I77H 2DQGL 2UYLB 2E6JA 3GMPB 1KACB 3QXWA 4HS6B 3RVXD 3BESR 5GRXG 1P4BL 3FRPG 4U1SA 3WJJA 1UACL 2XA8H 3UCRA 4C59B 5ESQB 2B7DT 2NXYD 1A7QH 5FYJE 3KYMA 4KH2A 2P8LB 5HHXL 1KPVB 1MREL 2HVKB 4KHXH 2JK5B 1AGBA 3TBVB 4YXLL 1GHFL 2AW2A 3ILQC 1RJLB 1DTUA 3OB8A 4MXQD 3C08H 5DD6A 4AG4H 3SDYL 3BGFB 3OSKA 4N8VG 1ETZA 4YGVB 4RWYL 1OAXH 5EZIH 2OI9A 1NBZB 1WT5C 4RGMC 1M1SA 3D2UD 2GQHA 5SWSA 5D7IB 5F7LB 3T0XA 2K9UA 4ZUTA 3I6KA 2N7AA 1D5ZB 1UJ3B 2OTPA 4IIQB 4LIQH 4H1LG 2FZ3A 5FO9A 1I7TA 5DHVH 5DEGA 3BE1H 4ZTPH 4XPAH 3AREA 2JJUA 5J12C 3I9GL 3S34L 3VFUB 1M6OA 5DLMH 3VFMB 1KIPB 5I1HH 3MCLL 3SE4A 5EOCH 2CQVA 4N8PA 2FIKA 4LNRA 5CP3A 3NAAH 1B0WA 5EO9B 1PKQB 3VCLA 3KPOA 3SGEH 2E8YA 1XGYH 3MRPB 3DPBA 3RVWC 4YIQB 1IFHL 2AXGB 3OJDB 4YFEA 5C0BA 3RL1A 5EG6C 1AR2A 1HOCB 4YZFE 4LVEA 1MF2L 1KIQA 1CDYA 1GZQA 2PCPA 4OFDA 4YNYB 2BVPB 2C26A 3MRCA 4KV5E 3OKLA 5GJTL 1CFBA 3IF1A 2HLAA 1D6VH 2NY2B 4Q2ZB 2F54E 3GEWB 1P5VA 3L3OB 4G5ZH 3GSOB 5T1MA 3T2NL 3TA3B 1Q0XH 4OZIF 1ZGLA 4MNQD 3SCMC 4IEFB 4PPTA 4X99B 1EBAA 5EU3B 3KDMB 1I8MA 2YD6A 4XWGH 2VLJE 5DQ9A 4G42B 4J3OC 3MRMB 3UAJC 3SE8L 4XP6H 3X11B 5HHME 2C1PB 3K0WA 1MRDL 2CRIA 4PJGB 4QRRE 4X98B 3TBWB 3DXAB 2KZ1B 4Z95L 2X4QB 2CXKA 1YA5A 5BV7B 1WWWX 3MV7D 4KROD 1DUZA 1WWCA 1IAIL 4QCIA 2ZCLH 3IDIA 2HWZL 5FYLD 3LKOB 2WUCH 4DEPB 4FZEH 4M5ZL 4Y5XA 1T4KA 4KZDL 2FH6A 4YXHH 1HI6B 1ZMYA 1XGRB 3WN5C 3BX7C 2P44B 4KC3B 1QFPA 4KAQH 5I66B 3S3JA 4Y16C 4AQOA 2X70B 4WJ5B 4EN3C 1HHKB 3EO0A 3HLAB 1U3HD 4LCYA 2RCSH 2VLKB 3FB7B 3N9GL 3VG9B 4ODTH 5EBGA 4IDJH 1MCHA 3OKYA 1JGLL 3D69A 3EKCA 4MDIA 1NGXA 1DLHB 3VXME 1V3KA 3EJZC 4NO3B 4Z7OE 1XIWC 4ODBD 4QTHB 2PKDA 3G6DH 2X42A 3PHQB 4HZAA 4RFOH 3IKCB 3QI9C 5FUOH 1IRAY 4Y4FD 2Z8WC 5EUOB 3LS5H 4J4PD 1R3JA 5GISL 2L0DA 5HGHB 3U7WL 1Q1JL 4JRYB 3ARFB 3L6FA 1LK3H 5JIKA 4Z7UE 1E28A 3BKJL 3RTQC 4NKQB 3QT2A 4P9HH 1VERA 5FYJL 3JWOC 1NSNH 5FUCE 2FD6H 2C3VA 4L8BA 3ARPA 1A02N 4I3SL 1FG2B 4KJQD 4LCCB 5EZLA 3S36L 3STZA 3O9WB 2Q1EA 3N1QC 4W6XB 2GSGA 2BNQE 1BP3B 1C12B 5D2NA 3RL2B 3TCXA 5D5MA 3U4EB 2YWZA 2X1OA 3IDGB 3LEYH 4RIRB 1ZAGA 4GXUM 4M7JH 6FABH 4LSPL 2D03L 3BN9C 3VFRB 1WV7T 4HKJB 1XT5A 5JOEA 4PRPD 3UZEA 4K9EC 3P30L 3UC0H 4PY7B 1T21B 3IRPX 4MAUH 5IFHL 1P69B 2X09A 3ES6A 5F8QC 1CXHA 3BOVA 2B4CC 1X7QA 4MDJA 5EPMA 4U1SB 3KYAA 2AGJH 1HCVA 3RI5K 1B6DA 3L95B 3KYMB 5HSFA 1A0QH 3DX8A 1MCRA 3MACL 4LVOC 4AIOA 1F4HA 3TO4A 4X4YA 4JN2A 1AGBB 3RWCA 4Z7NF 5E7BA 3KYNA 5DD6B 1RFDH 2WQ8A 3S96A 1ETZB 4H8WL 5HHVL 1QHOA 5KVEL 1S9KC 1KLFA 1VDGA 2W9DL 2AI0H 1WCQA 5SWSB 2Q6WA 2QADD 4OZFG 1E27A 4ZUTB 3I6KB 3ZE1F 1N3NA 2FZ3B 2P5WB 5FO9B 1I7TB 4CVUA 4HMCA 1LNUA 5DEGB 4J6RH 1A3LL 1I3GL 1L6XA 3AREB 4RWHA 4XCFH 2MWCA 1KOAA 1BECA 1M6OB 4M7LH 3V0VA 5HGGS 2AEWA 2Y36H 1JWSA 2FIKB 4LNRB 2MQCA 3DTXA 1OARL 3KPOB 5I71B 1BQLL 2XQYK 3QR2A 4Q0XL 1NCDL 1OM3H 1FNAA 4CKVX 5FDWB 3S5LA 2GUOA 3MJ8A 4RAUA 5C0BB 3RL1B 5FV1L 2F53D 4ELKA 4W81A 1NGWA 5D2LA 5TF1H 3L1OH 3VWKA 1KIQB 5CJ5A 1GZQB 2PCPB 3MRCB 1HILA 2IMNA 3OKLB 3IF1B 4FFVC 4JPIA 3IDXH 1JHLH 4P3CL 5T1MB 3S37L 4XVTL 1FFNA 1A7RH 1ZGLB 1NC4D 2AJXH 2DQTL 3ZHLA 4Y16D 1I8MB 4U6TA 3BPNC 4GRWE 5DQ9B 1L9NA 4GRLC 4OGYL 4QRRA 1DN2A 4FQ2H 2XT1B 3QCUH 4FFWD 2UWEF 1TNNA 3PF2A 4LSSH 4DJMA 3LRHA 4FFEX 3EJZD 5D7JA 1XIWD 1J8HE 4WFED 5DUMH 3RWDA 2DMCA 5L2KD 4G9DA 4LAQL 3V9FA 3RZCA 1HKFA 1EGJH 2F8VA 3V6OC 1DUZB 4NNPL 3NIFF 4J3VA 1Z6JT 1LO2L 2M2DA 5FKPA 5BRZD 3VGDA 4GAFB 4QCIB 2Y7QA 2R0LL 1JZ3A 3IDIB 5HYIA 2I60H 4Y5XB 5ANME 1T0PB 1T4KB 5GSRA 3ZE0E 5AZEL 2WUBL 3VXUD 4G43A 1BEYH 3V52H 2KQNA 1X6NA 4C58B 1KCKA 1PVHA 4XPHH 1F90H 3EO0B 4LCYB 1CBVH 2J8HA 3B5HA 3SGJC 2CMRL 3CVHH 3MXVH 1ZLUK 3CSGA 1NGXB 2CK0L 5B39A 4HD9A 2I26N 1JP5A 1BFOA 1HQ4A 2PETA 3BN9D 1TJGL 1J7VR 1R3JB 1G9MC 1UCBH 1G0XA 1AY1H 5I74C 3HC3L 3L6FB 3CX2A 1E28B 3O6FA 2GJ6E 4QXTA 3V0AC 4K94H 5IBTH 1RULL 2VQUA 2HG5A 5EIVA 4NZTL 3BD4A 3JUZA 3FB8A 3ULUF 4L4TD 2C3VB 1ACYH 4L8BB 2I9LA 3FTGA 3JWDL 5D71H 1ZWIA 2DBLH 4NQDE 5DD1H 3O4LD 3ALXA 5EZLB 2P45B 2EDXA 4JVUA 3STZB 3WUWG 5KVGL 3O2WH 1QOKA 4WW2F 2APXA 4XNZC 3KXFE 1W72H 2GSGB 1I9RH 5D2NB 2UV3A 5D5MB 1C8PA 5TFSH 2P47B 3Q0HA 3T0WA 1MRCL 1FLTX 3C60C 2ICEA 3SE9H 3VRJA 3EYQC 1OCWL 1QRKA 2JJTA 4BZ1H 4UILH 3HAEH 1AGEA 4M5YH 1SBSH 5J11C 1ERNA 2Y07L 2D3VA 3ES6B 3MJ9L 4IRZL 3UZQA 4A2LA 1X7QB 4MDJB 5EPMB 2ZJSL 3TBYA 3D3VD 1S78C 3MLRH 4P2CG 4LDEB 3AU1A 3DX8B 3TO4B 4LHUG 4X4YB 5EWIH 4JN2B 5B38A 3RWCB 4H26A 2R23B 3PABA 4F7PA 3KYNB 5C6TL 3R1GL 1LDPH 1RHFA 3S96B 2XZAH 3TIDA 4XP1L 8FABA 3GK8L 3OHXA 2VIRA 5JQ6L 4JKMA 1A2YA 1HINL 2VLRD 1V7MH 4JZJA 1TTUA 2Q6WB 1YYLH 1HXMA 1IAMA 4OIBA 4NWTL 1TVBA 2XQYG 2N1KA 2X9XA 1F97A 2WWKO 2XOTA 1E27B 1X5YA 1OT1A 1ZT1A 2LV4A 3MJ9A 1GPOH 4FFVD 1N3NB 3RGVC 1RZ7H 4KK9C 1LNUB 1N6QH 4NQCD 4U49A 1MNUH 3NTCH 5T5NG 1XF4A 4M6NH 5DK2A 1JWSB 3EYUL 3WHE1 4GRLD 3W39A 1I9EA 1OTUD 4X8JA 4YX2H 4OF8A 4F7TA 4OF5A 5DO2C 4JO2L 4O58L 1EHLL 4HEME 5B21A 4TSAL 3S5LB 3AS3A 1R0AL 2GUOB 2DQUL 1N64L 3MJ8B 4RAUB 3GKWH 3A6BL 5KTEL 2MFNA 4ELKB 2DD8H 1NGWB 2Q3AA 5D2LB 3VWKB 4S1QH 4H88L 1JTTA 1HILB 1JZ7A 3CMOL 4JPIB 3FQTA 3WO4B 1TCRA 2P4AB 5D8JL 3N1FC 1FO0L 1FFNB 4NO2A 5DJZA 2LTQB 2X4PA 5HHOE 1MPAL 1KN2L 4KVNL 4NO0A 1YEIL 4ZS6C 1ORQA 1H3GA 2VWEE 3CFBA 4GJTB 4GG6F 3VJ6A 2H32A 2FECI 4QRRB 1FYTD 1XGPA 5MENE 3UTPD 3ET9F 2R69H 2DYPA 3OL2A 2P8MB 4OF0A 5I8EA 1WIPA 2XZQL 4NPYA 5D7JB