2BVTA

The structure of a modular endo-beta-1,4-mannanase from cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases.
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
463
structure length
451
Chain Sequence
TIAIVDADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWANFDAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVASAPTTVRVRVGGTDVQSVTVEVAQVVDTLDLAYDGALWWTAPWSPYTVTATATTAAGTLDVTNEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure and Characterization of a Modular Endo-Beta-1,4-Mannanase from Cellulomonas Fimi
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-MANNANASE
total genus 156
structure length 451
sequence length 463
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bvtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2bvtA01
1WCBB 3H2WA 3TT3H 2CHOA 3PWLB 5TDPB 1KR1A 3WN5A 3BW9B 3N1QC 3BP5A 5I1IL 1U3YA 4WEBL 5MEQB 5I0ZA 2FGZA 5E7FA 4QF1A 4Q9BA 2CD0A 1NGPL 1QEWB 4I5BA 2DBLH 3HMXL 4JJHA 5EOCL 3EOYG 1QBBA 4HZLB 2Z35B 3BWAB 5GJSH 1H3VA 3QDHA 1P4IL 4L4TE 4HA4A 4AIUA 1HQ4B 4TNWK 5C2BL 3S2CA 5MI0C 3ARDD 3U30C 3VWJD 2X9XA 2C5DC 4JG1H 1WSST 2AEPL 5CD5D 5EZJB 3PP3H 1B0RB 1Q9KA 3IFNH 2VDPH 4YWGL 4WTZG 1H3PH 2F2HA 3AY4A 4M3JA 3OKKA 1AXTH 1CFBA 1OD7A 3IGAA 4L3CB 4DCQB 5JORB 3VWKB 1XCXA 1JHLH 2VZVA 1GOHA 5DRNB 3VOCA 4JG0L 4HWZA 1S7RA 3ZLQC 1AD9A 3DC0A 2PF0A 3S36H 2DYPD 5EB9A 3BVNA 5IW1B 1H0DB 1QNRA 3TTYA 2V9RA 2X1QA 3PWVA 2Q7YA 5GS0D 4OD3H 2J7HA 1TVBA 3ARBA 1T04B 3GNML 1PEWA 2DS4A 3RBGA 1I9RH 4TVPL 1A4KA 1DQLH 1YEFH 5KW9L 2WYSA 3VNZA 3T08A 5ICZA 2A3EA 5C09E 1JYXA 2W59A 1VGKA 2QHLA 4F33A 2EE9A 4X6BB 4JVPA 5BXFA 1CE1H 1LQSR 1PGRB 3V5DB 3BKML 2W0PA 4QLJA 3UXFA 2I60H 4HAGA 3I6LD 1JHKL 3MLWL 4BKLB 4BQ8A 5FYJH 4U31A 3GSOB 3SE8L 4GT7A 4LDOB 4JFFD 4JFOA 3GXFA 1Z6JT 4WHTA 2DOCA 5CWSA 1HIZA 2VX4A 1HH6A 4G8IB 1U58A 2W60A 5CEZH 4BZ2L 2KH2B 3LMJL 2MNUA 3FT4A 4PGEB 3NA9L 2Y6SD 2WVUA 2VQTA 4KJYA 5EU3A 3SCMD 1BZ7B 4QRQB 2IBZY 4S1SH 1QPPA 1G84A 3PHAA 3DXAE 4Y4KD 3CLEL 1A7PL 3UZEA 2R0KL 4X7SH 1YEGH 5D93C 4C4KT 1N82A 2XY1A 4C7GA 4LPWA 2ILLA 2NY5C 3U4EB 5JW3L 4LAJH 1OWQA 5JW4N 4G7VL 1JPGB 4LPYA 2GJ6A 3GMOA 3HMWL 4YDVA 4QRSA 4AZGA 3X13B 3DVFA 5T1MA 2JIXD 4NF7A 1FGVL 5MHSE 3OGRA 2G3IA 3FO1B 3G6JB 3ETBF 5FIEA 3AICA 3JTTB 1US2A 1U6AH 4PJ9B 4RQQA 5C0RH 4Z7QF 1OSPH 4X9BA 1PIFA 3RZCB 5BOZG 5JA9A 4NYLB 3A6BL 2H45A 3GSUA 4O02H 2VRJA 4WVRA 2N7BA 4PJIF 2X4SB 8FABA 4OV5B 4FHBD 2W4XA 4N0YH 3PGFH 4NHCH 4PJAF 3P40A 1WC7B 2Z8VC 1T4KB 2ICWA 4PB0H 4GRLC 3RWHA 3E2HC 2JJTC 4KVCL 3RL2B 1TCRB 4TSCH 3ROOB 3BVNB 2LV4A 3K46A 4BFEA 5JMRA 1EOKA 2EH7H 4JRWA 4GG6E 3C9NB 3TV3H 3M17A 4OLUL 5T3ZD 5MHSD 4PRWA 5CILL 3KPRA 3BH9A 4KK9C 4MAYC 4TVSa 2ZNWA 4XP6H 2WIMA 5C0CB 4ACYA 4N0FA 3QXTA 3KE0A 2ADIA 2Q3AA 4I18C 3ZL4L 1UZ6E 4LBEB 2WINA 3O2LA 3WL0A 1VPOL 4BYHA 2B7DT 3FB7B 2Y07H 3GSQB 3RWEB 3WCYA 3NGBC 1W9BM 4YEEA 1HCVA 1T2QL 5GS2H 3TO2B 1G0XA 5DLML 1QFUL 4OFYD 1YNTA 5TE6H 3RWIA 2CRYA 3RGVC 4ODWB 3AFBA 1DQTA 1UM4L 2QJDA 2ZG2A 3C6LC 2VUYA 4B7LA 1UQSA 3RWGA 4HH8A 4NN5C 3WJLA 4PJ7F 5EO9B 1YHTA 1QKZL 1KCRH 2B4CH 1UM5L 4PS4H 1BLNA 3DXAB 4ZFOA 4W8LA 4NO5B 3TC9A 3VA2C 1MCOH 4QRPA 3O9WC 2CBJA 3AB0B 2DICA 3VXUA 3B9EA 1MAJA 5DJ8B 4GQQA 2Y5EA 3D3VB 1S7QB 5IFHH 5EBAA 4NO0B 3K2UH 4MNQB 5F21B 4RGND 3L7FB 5A8NA 1YNKL 4P2QB 4PR5A 3KPSE 3OXSB 4YUEH 5J3HD 1CBGA 3BP7A 4YX2L 3TBWA 1F90H 2OX5A 5M17A 4QDMA 5DC0A 3HUJA 1ZT4B 2VXSL 4P3DB 2NPLX 4BA0A 4GUPA 2W07A 3DMMA 5E09A 4FFZH 1BAGA 3P4OA 4PJFB 4X0NA 4PJ5D 4LIQE 1E1EA 4UOJA 3B5GA 3NUKA 1TJGL 3AIWA 3R06A 4ZOCA 5DMKB 4ORZC 2R4SL 3PIQA 3V6BR 2LVEA 1NDMB 2H2SD 1MAMH 4WJXA 1ISYA 1J87A 2DLFH 1RZ8B 3HRZB 4YAQB 1MYRA 2WHJA 4WFGD 4P7NA 4BZ1L 3T1FA 3QIBC 4PRHB 2A1WL 4Y19A 2DT2A 3PV6B 4HKBB 2VURA 3L1OL 3V4PH 5IJVA 5F6IC 5A2IH 1SJVA 1DDHB 3TN0C 1VFUA 2Y7QB 3SKUD 2JFEX 4UTBL 3WXWH 4KJPC 5K9JH 1C7SA 5F7HA 4X8JA 2XHYA 5BXTA 4AD1A 4AD2A 4AZ8A 1BGXH 1VGKB 2ICEA 2X4TB 3T0EC 4PJEE 4MDJA 3BN3B 2EE2A 1MCLA 3O8XD 3WS6A 3UYRL 4G8GB 4HUUB 1K8DA 4KY1L 3S8WA 4PTVA 1T5WB 2MTPA 4X4YA 3QPXL 2AJXH 3REWB 1RUQL 6FABL 3RVUC 1XF1A 2A38A 2C4FT 5C0AB 4OJYA 1OQXA 3BIKB 4GS7C 1QFWL 4G3YL 4ATLA 5CEXB 4RZCA 1BQCA 2NY2D 4WKAA 1TQBC 1JN6A 4D9RD 4BK5A 3LRGA 3N85L 4MNQE 2R39A 3C2AH 3S34L 3BZ4A 1SBSL 3KEHA 1ZLVH 4XNYH 3DROB 1VF8A 4PJ8A 3Q6GH 3HJEA 5BO1H 4DVBB 4QP0A 3VH8A 1RVFL 1L6ZA 3QNXA 3SGJA 3O81A 4Z8FL 2DSUA 4CNIA 4N8VA 1I1XA 2H32B 3M1BB 3T09A 3BZDA 3C6LA 4XRCB 5ISZA 3VO0A 1LO5A 4PUBL 4YHZL 3O8XA 2VC2L 5IQ7H 3OAUH 1OGTB 4PRIA 3DTXB 1EQCA 4M1DH 1NFIA 2GYSA 4UU9B 3O9WB 4C59B 3MV7B 3I9GH 4WW2C 2Q7NA 1K3IA 1PLGH 5IBLD 1ZHNA 4DOHB 4OFVA 5K93A 1XCWA 3RL1B 2XSAA 3KYKH 4Z0XB 4UV7H 2AJSH 3GJFH 3MCLH 5LGJB 3P9LB 3UG5A 3GMNA 3A67L 4ZPTA 4MNGE 5JO5B 4HCRA 2W66A 4JPIB 5CP3A 3HI6H 5EU6D 1D9KB 1ZLVK 4PJ8D 1MQRA 3ZJ8A 1PZ5A 4UZSA 4V1DE 4D6EA 1KBGH 2D22A 3CZFA 2CKRA 4QHUB 5A95A 5GGRY 4F15B 2ZUSA 4ONGL 2V2WB 3FY1A 1VDGA 1NGYB 3LN4B 2VC9A 3KPSA 4PJEB 3MMDA 4P2QA 4MAYB 1ISZA 3I50H 1E1FA 2WNWA 2F5BL 1KTLB 3SOBL 3WENA 1GRWA 4N0YL 1GQLA 3HG1B 4LSPH 3MC0A 1V0NA 4DZ8B 5C1MB 1I1FA 1Q0XH 3U46A 4KJQC 4DWSC 4WW2B 5IB4A 2P8MB 1G7JA 3O45A 5CEYA 3RDTD 4MZ3A 4R8WL 1V3JA 2HJKB 5D5MB 3ULVF 2JTDA 5IMLA 4DTGH 1FNEB 2WUBH 4WSKA 4LLQB 1A6UL 2DD8H 4UFLA 1HJQA 4TTDC 5KVDH 3OGSA 3QUXA 3A3HA 3UCRA 1TPXC 3X17A 2XKSA 1HSBA 2OBGA 1S9VB 1RY7B 3FRPG 3MV8E 5HHVL 3QH3A 2FECL 2GQHA 2Y25A 1R8LA 3UG4A 2C1PB 3B2VH 3JV6A 4L4VE 3PXJA 2YPLE 5GS0H 3LQZA 4APQB 3DYOA 2EDTA 1M05A 3P3YA 2AGJL 2BJML 2VAAA 4QHKJ 3WIHA 3QGVA 3C08H 4ODTL 3Q48A 1CFNB 2YD5A 5D4QA 2YC1B 1P7QB 1EAPA 2A0LD 4PGEA 3VA6A 1CDJA 4LLMA 4D71A 5DJ2A 4ZQKA 4NKIH 1YZZA 3CFJA 1QLFB 1ITXA 2VZSA 2AJSL 4KPHH 4X7DC 2PETA 4JPIA 4BQ2A 2WIIA 4O58H 4PJ5B 1KIUA 3W53A 2Y5TB 5GISL 3ARXA 4KC3B 1T5WA 4OGXH 4UT9H 2IAMD 4UNIA 2NW3A 1U8JA 5CJOH 2UWEB 4NZTL 4RFEA 4AYFA 3QEQD 2EPMX 2F8XC 3FFDA 3V5HA 3UTSB 4J3VA 4F7CA 4LSSH 5KVGH 5KAQF 4R7DA 1ZVSA 1CFVL 4NFDA 3VPLA 4OI8A 4XMKL 4RX4A 3GBNH 3MGTA 4LHUD 5DJYA 3RDKA 4I48B 5IB2A 4D0CB 2YBRA 1I8MA 1FNEA 4X80H 5DQDL 1CFQA 3NFNB 3CFIC 4PY8J 5ANMB 1U30A 4GBXB 2D0FA 3F65A 1OB1B 4KRTA 2F5AH 4EDWL 2NR6D 4PP2B 4NN6C 4H26B 1T83A 3ZR6A 1T0NA 4O58L 5JW4M 2IMMA 1S5IL 2R4SH 5L7XL 4GQRA 2HKFL 5TGBB 1MHEB 4PJCA 4JG1L 2VWEC 2PXYA 2R2EB 4NJAL 5L2KE 2GSIB 1ITCA 4HPYH 3GSWB 2FATH 3U57A 3QDMA 5HHMD 4FFZL 1L6XA 5MEOB 4OLWH 3CFKB 3FN3A 5HPCA 3TVMB 5D7JB 2WKLA 4FZ8H 2RIKA 3TNMA 5DR5L 3PWNA 2NX5D 1DWIM 1MRCH 1P2CA 2VVSA 4KXZI 5BV7C 5C0CD 4H0GA 3SCMA 1FZOA 1AGEB 4NQSB 3QNYA 5JIPA 5JO5A 2ZOKA 3WFZA 4RX4D 4M1GH 1OTUD 4K7PL 5E8OB 1CU4L 2PNDA 3CX5J 1I1YA 3TIDA 4M1CC 2XRAL 4U1HA 3RVVD 1EVUA 4B9ZA 1S8DA 1HDMB 5C6WH 1AJ7H 2A6JA 1U8PB 5KZCD 2YR3A 2EYRA 4LP5A 4D6DA 1BLNB 3DXAA 4ZFOB 5J6GB 3DX7A 4KKBD 3BDBA 2MJWA 4PG2A 3U7WL 1K9FA 2YDQA 4NNXB 1S7XB 2MKLC 1HF6A 1L8NA 5ECUA 1XF5B 4EANA 1BTCA 1JWSB 5C09D 3ILPB 5IB4B 2DQXA 5F7YC 2G60H 3LEVL 1PBYA 5JTWA 4CD4A 1S3KH 1KCLA 4UFMA 5C08D 4R97B 1GOOA 1U8NA 2APBA 2H3NB 3IJSA 5JHDE 3WH7A 1A14L 2ZSVB 1ZS8B 3MNZA 2ZWLT 1IC4H 3EYUL 3CFCH 4QT5A 2DBJA 3FAXA 4N0FB 1XYZA 4R5EA 1BZ7A 3OLEA 4JKMA 5K9QG 4HT1L 1IT0A 4P99A 4YDLC 5GGUA 5M03A 5M7QA 4QWWC 3HI6L 4O4YL 3PDDA 4HTYA 3UETA 1NFDB 43C9B 4Q97A 3P4OB 3W37A 4JDTL 2H1PH 2F19L 4M24A 2BS9A 3FO2B 1ED3A 5C0AA 2FHFA 1A3RL 5FO8B 3QCTL 1T2XA 3NSNA 5IXEA 3BQUA 1ZTXL 3CDCA 2W62A 2ZZUT 4OLEA 3TJEH 5CZVL 1RUPH 3LKOA 3NCOA 1MI5D 5C0CE 1JPSL 5DJ8A 2VX6A 3DURA 3IU3B 2G3NA 3TYGH 3B9VA 4Z7OF 4IRJC 4M4RA 2BRRL 3GHBL 2AJZA 3P9MB 4Q0XH 1AHWB 1AD0A 1IEHA 1CF8H 2F15A 3BPLC 4M80A 2D23A 5ISZB 2KQMA 1MI5B 1A9BA 4NFCA 4DZBA 4P2RD 1IARB 1BD2A 2GDVA 4XP5L 4NPYA 5HDBE 2H6PB 3FZUD 3TA3A 3RI5K 2VDOH 4Z7VE 1OWWA 5GGVL 3AJ7A 3FNDA 5F9OH 5EZJA 4OIAA 1B1YA 2PR4H 3CLEH 4Y8DC 4BH7B 2C7FA 1KGWA 3MODL 4G9FD 2CLRA 4H7VA 2DJUA 3ZE0F 4L1HA 1MNUL 3UBXG 1HYRC 1JTPA 1MF2H 3E0GA 2IH1B 3VD7A 4GKZA 4F7MB 3VIHA 4ZXOA 3FB5B 4E8DA 4Y2DD 3HE6C 2OXHA 3CMGA 4BSWA 5IR1B 4DOHE 1GGIL 3B9DA 3HC4H 3BC9A 2I25N 2WAGA 3G6AA 3RDTB 5IMOB 4PJ7E 2ATPA 4MD5A 2G8ZA 2HTKC 3ZE1F 3MJ9A 5C0RL 5D96B 1FC1A 4XNXL 1HEZB 4FQQA 5CJQL 3VMNA 3C60D 4NNPL 3GO1L 1UKOA 5KJRL 4PJBB 5HDQH 3KWXA 3IDGB 2AEWA 1VJZA 5HVHB 4WUUB 1NMAH 3D0LB 5J0BA 5L6YH 4U7MA 4O00A 1D7FA 3IETB 2YL5A 5CJQH 1W3JA 2VZTA 3L3DA 2DL9A 1S7TB 1OAKH 1WAAF 3O6AA 2DIBA 5AYBA 3DGGB 4B9YA 2BDNL 1E72M 43CAB 2IFGA 2W9EH 2A3AA 4PTUB 1RZIA 3KYMB 5CAYB 4Y5YB 3UPRB 4XPTL 2IADA 2XM2A 1DWGM 3S36L 1XFPA 5FKPA 1DQDH 4HWZB 1XSJA 4HPOL 2PBOA 1B9ZA 1RD6A 3AU1A 3LB6C 4R0LA 5I8OL 1FVCA 2YPKA 5E6YA 2DMKA 2DQIL 3O4OC 4UTAL 1KEMH 4NT6B 3T4YA 5E24E 3OB0K 1VB9A 3MLYH 3C09B 3WFCL 2G3JA 5A3HA 3O11B 1QSEA 4K2UL 1FAKT 4MA8L 1MHEA 4JO1H 3U30B 1XGYH 4KGLA 4RNRA 3D39B 4J4PA 5MERA 1ZJBA 1IKNC 1ZV5A 2NY3B 4YHKL 2ZX8A 1E4WH 2R0ZL 4YN5A 2LTQB 1XAUA 4Y5XB 3FT3B 5DQ9A 3CX2A 4PJCF 4P2OC 4G8EA 3AAZA 5GS0C 1JIBA 2ZWZA 1A22B 4UQ2B 4Z7UE 2WHKA 4WEBH 2QQKH 4K55A 5A8MA 3MOAL 3SQOH 3MJGX 1JBJA 1XC6A 2X7LA 2HFEA 1AXSB 4LRNH 5H2BA 4M4PA 2C9AA 5AYUL 3UTTE 1JFHA 1XCQA 4P57B 4AEFA 3MRFB 1TVHB 1JI1A 3QDAA 2YIHA 2O61A 4IRSD 3VVGA 1C8XA 4HK3J 1CXFA 1ZA6A 2R0WL 4ZFFB 4PRID 1FZJA 4WTXA 4ZUVB 2I9TB 2RFXA 3V8OA 4PJHF 1DANU 1G6RL 1KJVB 4W6YB 4PV9A 1RQ5A 1IAKB 2E8ZA 3GSNA 1E0XA 4IIQB 1J0HA 5I6SA 1JZ4A 3U4EA 4WW2F 3JV0A 5C2UB 4UZGA 4TUFA 3SGEH 2EC8A 4PTUA 1D9KC 2IPTH 1MEXL 1G94A 5CSZB 1H0GA 2A83A 5AD0A 4XBEL 5JIHA 4GXVH 5HGBB 5SWQB 2Z0BA 2VDKL 3PDOB 4WI5A 1NBYB 3GZKA 4M3KB 2W0LA 5GJSL 3FQNA 3QWRA 4N0CD 2GUYA 4LLWB 5KVEL 3O2DA 3NBNA 1BGGA 1IQWH 5LJYH 1AXIB 5F88A 5D1XA 3UYRH 1JV5B 3KPLB 5DJZB 3CO4A 1A7NH 4YHOL 2IBZX 2GY5A 2OSLB 2ZXQA 3K80A 2DQHH 1G9NC 1T03L 3NACH 4RAUB 1UR2A 3VIOA 1IFHH 2DMBA 3BOVA 3AUVA 5JNYA 4LSVL 1NANI 3D87B 4WLCA 1I1FB 1FVEB 4JPKL 4KZDH 1YEIL 4P23B 2P8MA 5GIRA 4L3EE 1IGIL 2BMKB 5KSAD 2FRGP 1JZ8A 2AXGA 3VWJC 4QRRE 4HHAA 3DV6B 1L7TL 3DUSB 4K7PH 4LRIC 3EO0B 4WHYG 2V5DA 4QRSB 1KF9B 4OGYH 1BAFH 3PTMA 3VRJA 1D5MB 1OWRM 2HVJA 1UFUA 4A2MA 5CJ5A 2DQJL 3LKQA 4LVHB 1QLFA 3WDQA 4XVUC 3SDXE 2LE9A 4PJBE 1BLIA 3OPZL 1J8HD 2EEDA 3CZEA 2VIRA 3F5JA 1R3JA 3HCVA 4KK9D 4JDVB 5FUZH 3T3ME 4OCMC 1WIOA 2XG5A 2XWTA 1C5DA 1BFOB 1MELA 3A6CL 2CIPA 5FOOA 5HOSA 3K2MC 3MNWA 1ZS8A 3MNZB 3FQWA 3H3KA 4U0RB 3K8KA 3F7YB 2CR3A 3IYLW 5BXFB 1I3GH 1TZHA 1U2YA 3CIQA 4WFEE 4HLZG 1JGEA 3BO8A 4IMLA 2V5CA 4JKWA 2HMIC 4YEFA 2X4NA 3CH9A 1NEZB 2W65A 3VI4F 1J1PH 2LU3A 3S35H 3MV7A 3EJZD 1AY1L 3KJ4B 5C0AE 3LZFL 3NFSH 4I48A 5IB2B 1RK0A 1JGDA 2OSLA 4Z7OE 2DF3A 3QUXB 3OGOE 4G7VH 1DBAL 2A6JB 4OCWH 4PD4J 1CDYA 1EDTA 2NYYD 4M61A 1U3ZA 4X99B 1AGFB 1BQLL 4OM1H 4LOUD 1ZB5A 2UZXB 5A6SA 5DJ0A 2VUOA 2J7DA 1GGIH 3HC4L 1P4LB 1UEYA 3DMMD 5ACZB 1TVBB 5E03A 3D85D 3LH2H 4CU7A 4EN3B 4WU7B 3OA5A 1F3RB 2A6KA 3MLZL 4R26H 1TQCB 4RWYH 1S7WA 5B22A 3K81A 5HJ3A 3U0TA 1NAKL 1NBZB 5JDSB 4L4JA 3WH5A 3WUWG 5IHZA 4KPHL 2HFGL 4DUXA 1FL5A 1LO2H 3KLSA 3BUTA 2W0KA 3GXMA 1D6EB 3CIVA 4Y19D 5TF0A 4W7VA 4GFTB 4PJCB 4X6DB 4WO4A 5TQ2L 3UYOD 1FH9A 2B20A 4WU7A 1EERB 5KSBB 4PJ9D 3O6KL 1TCMA 3CU1A 3QDMD 3QXDB 5I30H 2H2SC 2YSSB 4ZPVB 1QSVA 4I3GA 2CH8A 2OTWA 4PB0L 2DM3A 4R96B 4PJIE 2JIXB 4FMFA 2QPUA 3VE0A 1CFVH 3DYPA 5ILTL 1G01A 3P0GB 5KTEL 4PRIB 2VL4A 1K6QH 1C5BL 5D2NC 2ESVD 4X9HA 3SUSA 1SEBB 4OQ1A 3D85A 3X3FH 2EPKX 1XH3B 1IAIL 3SCRA 5SX4I 3R0MA 1LL7A 5TQ0L 1J05B 2KZ1B 3SQOL 5IB3A 5F7UA 1XMWA 2WZPD 2XG9A 4JCLA 1MF2L 5TDNA 4NBYB 5C86A 4OGXL 4K3JL 2X40A 2X1WL 4LF3A 1PX3A 1RUML 3OKLB 5CJXC 1T80A 1JNNH 1E6OL 1E4WL 2R0ZH 4OZ4B 3ZHKA 5JZ7D 5ABFA 4JGJA 5GS1A 4OCXL 4ZNCD 5JW4R 1XF3B 2CLZA 4AYSA 1PSKL 3L4WA 1ZEAL 3RVUD 4APQD 1Z0NA 3PUCA 2NZIA 5B21A 1G9MC 3BXNB 4IIQA 5L2KB 1HH6B 4GRWB 3WLWC 1R5WA 3SDYL 3DUSA 3VFVA 4Z78A 3C6LD 3VRJB 1JWUA 1X5IA 2W91A 2DQDH 3U9UB 1J1OL 2IBGA 4C7FA 5J7CC 2GY7B 3DUHA 3MUAA 4G80B 5T5FL 5DJ6A 5GRXG 5KN5A 1F4WH 1HOCB 3VG0L 1N3NA 5D8JL 1CWVA 1X5YA 2Y8KA 1FYTE 1Z9LA 1AJ7L 3SY0A 5EZOL 4UT6H 1N5AB 3SJVE 3ZJ7A 3TFKC 2FWOA 1A3RH 1P1ZA 3LN5B 4OBSA 5TE4L 3OKMA 1NCBL 2OR9H 5K9QI 4QHMA 3TNNB 4F2MB 3GSQA 4FQXD 4F7EA 4FMKA 4RWHA 2QLYA 3DOSA 4NRXB 5HVFB 1E5NA 3GSNL 4Y5VC 1NOWA 3WS3A 1GPOL 5AYIA 2CSPA 2EH8H 1S78D 1JPTL 1J0KA 1P9MC 4D0DB 5IW6B 4HH9A 2OI9B 5JXAH 4Y5XC 1HQRB 3NCEB 1ZWIB 4MJ6A 4XVSL 3X11B 3PZGA 5IG7B 5KSUA 1AFVH 2FBJL 3TH3T 5DJ0B 5D4YA 5FECB 5KSVB 2X70A 2G9HA 3U0WL 1L9MA 4M7KH 2UY7A 1CXLA 4W4OA 1EXUA 4QRPE 4F3FB 3WD4A 5GGSA 2DDQL 2JCCA 3VFWB 1EGJA 2C4XA 4ZFMA 4YFDB 3NPSB 5T1LD 4PR5B 1V8HA 3VM5A 4KHTL 3LPWA 5MENB 4WHYH 4JLRA 4W85A 5D70L 3C5ZD 2AAAA 1JGEB 3BO8B 1AI1L 1MRDL 1MHHA 4XP4H 1FLRL 3F5WA 5J9PB 1TPXB 4LGPB 2X0YA 1HILB 1QR4A 1W72B 1X5GA 3PV7A 1G7HA 1X4ZA 4YLQT 1QI0A 1XGRA 3OKNB 1JNJA 4QKXB 4RCAA 4TNVK 4TTDD 4HQQL 5EO0B 1NJ9A 4JO4L 1FNGA 1MRDH 5HD8C 1GZJA 1P5UA 1EDQA 1UJ3C 3GMPA 3GMOB 2DN7A 4N9OB 3GKWL 3PP3K 4PV8B 4M7LT 2HJFB 4G6FB 1VJSA 4S1RL 5DJDB 1NGXB 3BDYL 2DSZA 2QQQA 4H8WH 2HFFB 3DX9B 4ZE5A 4N9GB 1MJ8L 1ZA3B 2CKBH 4HGKC 5GXBB 2DJ4A 3UTPD 2AJYL 2NY2C 1DEDA 4P5KA 2IFFH 1LO0L 2DWDA 1I7TB 1ZT7B 5HYIA 5F1OB 2VERN 4BSJA 4JN2B 4G6FD 2W60B 3BAEL 3O3DB 4HUXB 1A1OA 1IGTA 5JPNA 1BOGA 3LKRA 4E42A 1KELH 2IC2A 1FVCB 3ZIZA 3MRPB 1LK2A 3BPNB 4BZYA 3QO1A 2V7HA 2HLFD 3QFJE 3LPFA 1BVNP 3C9NA 5GJTL 1GQJA 4KUCD 5BMFL 1QSED 3OIHA 3BPOB 4F57L 3VI3F 1FORH 4J1UA 3KPOB 2WWKT 3FMGL 2AJZB 2XTLA 4ZUUB 3VD5A 3G5XB 4GW4B 4G5ZH 2XNAB 1N4XL 4O9HH 4OB5L 2FECI 5EUKA 1DLFL 2FL5B 1J5OL 1FFPA 3V5KB 5LVEA 4J8RB 3MS8A 1IC7L 1JRHH 3PWVB 2CKNA 2YWZA 3FRPA 4OLVH 4BFIA 1AGDA 5HSFA 3BCFA 4RMUA 3QUYD 4ETYA 3NSMA 4OZHE 2I27N 2QLVB 4W7UA 4GI6A 4HKJB 3VILA 5DJ2B 4KRMB 4YHEA 3TF7C 2NX5A 5BXSA 1X4XA 4GAGL 4QXGL 1B3JA 4L8BA 3U7VA 3NDYA 1U3HA 3INUL 3LQAH 4IPLA 4MA1C 2DT3A 5CG0A 1CGYA 3TBTB 4DGVL 3FRUB 1TA3B 1OTTD 1EQPA 2VDQH 4PJXB 4TVPE 3LS5H 1E6SM 1PPIA 3A67H 4XNMA 1QRNE 4PRBB 2IANB 2IALA 1I8MB 3CMOH 1U93A 1UENA 5IFJB 2R2BA 1NGXA 4Z7VB 4AQ1B 3P4MA 4QGTA 1T7XA 3PWPA 1CCZA 4MDIB 3AQUA 1AR2A 3GJEB 2ERJC 2CJUH 3WNNA 2W65B 4ODUB 5CKAA 3L5WB 3GBML 5J6HA 4XPAL 4EBQH 1NUDA 3BD4A 2H26A 3GI8L 3EMCA 5H37G 3LD8B 3QNXB 3PIQB 1IC1A 4IHOA 1NP0A 3O41A 5JUVA 3O6LH 1R0AL 2ESCA 1LEGB 1T0MB 2VE6B 4NKDB 4JLRB 2XY2A 4OT1H 4V1DD 5GS1C 2BNJA 1KTDA 2GTWB 3L4UA 1YA5A 5A1AA 2NY1D 3Q6GL 2M1KA 2CUIA 4OFIA 2B0SL 2XA8L 3AXLB 1MQQA 3W82A 3KS0J 1MHPH 1I85C 1IEBA 2CDFB 2AJ3A 1WFUA 3BSZL 2M2DA 2YD9A 3FAWA 2HN7A 3ULUF 4X4MA 4ONHA 4ATDA 1A3LL 1WLHA 1L0XA 1LILA 2DT1A 5BVJA 1N8ZA 2VISA 4WI6A 5T3ZL 4R4FH 3PP4H 4PRIE 3ZE2F 1DBKL 1XT5A 2YZ8A 3DVGB 1LQ0A 3MV8B 4K8RC 3QRFM 1ADQL 1ZWIA 2QKIB 4MJ6B 1IC5L 4MXVF 3V5KA 3WE6A 5ALBL 5E99H 5DK2B 2IH3A 4PYHA 4D9QD 2DQEL 5IIEB 3QH3B 1TETH 3ZKMC 5LGHH 1EIBA 3SCQA 1J8HA 4A6YL 5C8BB 4I2XB 2WSPA 1JWSA 4HSQA 3KAAA 4OZIA 1H1NA 3HC3H 4B3KA 4AG4H 3IDIA 5C3TA 2F9BT 2WWMD 2PWDA 1MVYA 4G6JH 1JZ7A 4HMCA 2FSEB 4XH2B 5IQ9B 3O9NA 5LAXB 2X4PA 4DK6A 4MNHA 1LK2B 3F4VA 2PWEA 4K7PX 4OZFG 4RBPK 1OF2A 3L1OH 3QAZC 4JZOB 3V4PL 5IROC 4G80A 2Q8AL 1F97A 3F7VB 4UNTA 1XGTB 5D1QA 3HZVB 1LMKA 3NA4A 3DLQR 2AQ2A 1ONQB 1U8JB 5C07E 2QQLL 4KV5F 4YHGA 4AMCA 1WCQA 5ITBL 3VXOB 3EHBD 3UTSE 4S2SA 4OD1H 3OXRA 4OD3L 3RUGE 5I71C 4YHMH 2A9NH 1NH6A 5AYQA 3JVGA 4H04A 2PO6B 4UOZA 1RZGA 4XCCH 3BX7C 3OG6B 5EIVA 4JG0H 4JANA 5IMKA 1EOMA 1KJ2H 3ZTJH 4UT7L 3GIVB 3HLAB 1EUTA 1YMMD 3U6RB 2A6KB 2QADB 1QFWI 4Z76B 1A64A 2Q8BL 3L7FA 1ZHLB 4D0BB 1AHWA 1NGQL 4D0DA 2QQLH 2DM7A 3OKDA 5TPWH 3HZYB 1WB0A 5EZIH 2HAZA 3FTGB 4M1CD 2B5IB 2V3DA 1KIQB 1L7TH 3PGCA 4Y2DC 4CMMA 4YHNA 1UD2A 4R2GC 3WNLA 4KTYA 1M7XA 1TNMA 3CUFA 4IEFB 1PFCA 2LAGB 1ZLSL 1SJHA 3W38A 5E4EC 3WH6A 5IVNA 2W67A 5CD5C 3EO9L 1B4JL 1U93B 3EGSB 3L7EA 1CNVA 1TMQA 4ZOBA 2OJZL 3VRLE 4S3JA 2DSWA 3RMEA 2WW5A 3VXMA 5CCKH 3MV11 3IU4H 1MCSA 5T1DH 3MTRA 1H3GA 3O11A 1JFQL 1TMCB 5C09B 3SGKC 4JM2A 4M62L 2W61A 2XZCH 3OR6B 5HGAB 4J4PD 2OTPA 3EOTL 4OKVB 5T3ZE 3NCJH 5F7DB 1A6ZA 2WVVA 1JDAA 5H35A 3QUZB 3V7AG 4GSDL 4B53A 5D8ZA 3UJIL 3BP7B 3TBWB 4CL7A 3QDME 1J86A 2BVTA 4ZAKC 3BAXA 2J12B 1N7MH 2IPUG 3FB6A 5DJXB 2FGWL 2Z93B 3AS0A 1PY4A 3MRDA 4I77L 2JF6A 3CFCL 4F15C 2C7UA 2V3EA 1KXVC 3HZVA 5C0FB 3LQZB 4APQA 3RM4A 1I3RB 4ERSL 2YL8A 4P4RA 5I8CB 5HHOB 2K9UA 2ED8A 4IRJD 4JKPH 3MRHB 3MOBH 4I3RH 2OWCA 2FIKB 1Z9SA 3SUWA 3SUTA 5E2UL 3SCSA 4GO9A 2VITA 3BE1L 3EYOB 3NZ8B 3I6GA 2WBKA 4Z77A 4HZ7A 3QNYB 2AKRB 4K7PY 4N1HB 5FA4A 3VJ6B 4X0VA 3WQ8A 1IM3A 5EU6E 1F2XK 2YPVH 5DLMH 2C3HA 2DI7A 3X14B 2YXMA 3LKPB 1FCCA 3QI9D 4CAGA 1SYSA 4L5FL 4YBLB 3ZO9A 5AG8A 3CSYB 3BEWB 1M7DA 1WBYB 4XNQB 4XVTL 3Q1SH 4U49A 5B4MC 5JOPD 4O2FA 1LVEA 5BS0A 2R4RH 2XFRA 4XZUB 4NT6A 4MD4A 3SDXA 2BCKB 5ABGA 4KKLD 2EXWC 2PW1B 2ZPKH 4JVUA 3DMMB 1H9VA 4K71B 2W9DH 3U5UA 3SGEI 1CFSA 5D1XD 1R5VB 2BHYA 5A2JH 1HHHB 4JFHD 4LMQE 1QLEH 2DT0A 1KTKE 1CFNA 3ESVF 4GG6B 3ULUL 4BQ3A 1G9HA 3MUGA 3VFMB 2R8SH 1IQDA 4WUUA 2VRAA 3VXMB 1H8NA 4P7OA 1RFDH 2E7CA 4KMTH 3IETA 4U6YB 1YNKH 4KI5C 3V95A 1CDHA 3S98A 3MKKA 5L8JB 5GRUL 2ZX6A 2BX5A 2VDRH 1DEEB 5H2BB 4WFFE 2NTSP 3CVIL 1MCPL 2XTJE 3KPRE 3RNQB 1INQA 3DX8B 5F7LB 2NY5L 2XPKA 5K59E 5DQJA 4ODSH 3ALXA 3VMPA 5ETUA 5HYJA 4H8WC 4JVWA 2DQTL 1WZMA 4XGZA 3U46B 1ZS2A 2YD8A 4TUJA 3LB6D 1ZT1A 5D70H 5DEFA 1UM4H 3RNKA 1FDLL 4MNMA 1MFUA 4PTTB 5FUCE 1U8KB 1RAMA 2QHRH 5F6IB 5LGHL 2FJGA 4U1MB 1QI4A 1OLZA 2HLAB 3K8MA 2ARJQ 4FQLL 1LLOA 3O2DL 4HX1B 4QHLA 3R4DA 1AGCA 5IHUL 5D1ZC 2AERT 3STLB 2W9EL 1KJMA 1N2RB 1I9EA 1UR8A 3GRWH 4KVNL 4OKDA 3BKCL 4LVNC 1OCWL 3O9WD 4QLRA 3T2NL 1U8QA 3VU2A 5IB1B 1JD9A 4X6FA 4HFUH 4OGZA 2C1OA 5EBWA 3DGGA 1W0VB 2CDEB 1AD0B 4NUJB 1CGSL 4JFTA 1XSIA 4FLSA 3E6FB 1HHGA 3SEPA 3VFOB 1XCQB 3EOBB 3N15A 1NGPH 4HIIB 3NN8B 3IJYA 1JNHA 4UIKL 1CICA 2VCCA 5IEKA 3QEGH 5D2LB 2BVOA 4G6JL 2J6EH 1N6UA 4H88L 4EN3D 4OUEA 1NCBH 4ODUA 5E4EB 4GO6B 4GKNB 2VTFA 2E7LA 3RO8A 3WL1A 1M71B 1UG9A 2GW5A 2XTKA 1DR9A 3QIWA 1R86A 1MW1A 4K94H 5E1AA 3F6LA 2DQUL 2PN5A 4XCCL 1TETL 1F11A 2GJZB 3MFFA 3OX8A 4F9LC 1MUJB 3TZVC 1PZ2A 2BZDA 2D9CA 2DDQH 3KWWA 1UZ8B 1BOYA 1I3GL 1HP5A 3OKEB 3IXAA 4X98A 4YFLF 3SDDB 4H41A 4JFDD 5FYKH 5LQBH 3IT8D 2A6IB 1GC1H 2DWDB 4ZOEA 4HGWA 2WXDM 4NKMA 1GCYA 2Q20A 4JRXB 5IP4A 4MAZA 3HE7C 1JGLL 3WQ6A 4TPRL 4XNQA 3VGDA 3WJJC 1KPVB 1YEHL 4ZG1A 2IQAB 4I9WD 1OB1A 1HKMA 4Y5YA 3UPRA 1CICD 4JJ5A 3MYJA 5FKPB 2H9GB 2R23B 5HHNA 2CMRL 2ZUWA 3CUIA 3SBWC 5D2NB 2QQNL 4BZ2H 4ZEPA 4X83A 3O3EB 1MLCB 1UXSA 1E6NA 2ZE0A 4MDOA 4K8RH 4MSWA 1E6JH 3QWOB 4X4ZA 8A3HA 1UD4A 1J1XL 1E73M 4CN1A 1GZQA 2AK1H 3F12A 2EKSB 2YD3A 3N11A 3D5OF 1E4IA 5M3WA 2BXYA 1II4E 5IV2B 4MD0B 4HS6B 3S37H 2V2XB 3LHPH 4QRPB 1C3FA 3PWPD 4PLJD 3GJEA 3MRMB 2VITB 4ZO7A 2X1OA 1J18A 4MTVA 3HPJB 3ES6A 1KIPA 1BD2E 3MUIA 5KTEH 2PYFA 4JFEE 3IDNA 5IB1A 3RWJA 4JE4B 1ZGLA 1JV5A 1FAIL 3U4BH 2W63A 2O9OA 4WNQA 5BV7H 4MXVE 3VWKC 2YPLB 5I79A 1JD7A 5C0GB 2YPLD 3MA7A 4XMPH 4QXGH 5JPNB 2CQVA 2X4RB 2N1KA 1X5FA 4WFGE 1XD0A 3U4BL 3BAKA 1E4XH 4L8CB 3WUWA 4ZUTA 12E8L 4PGBB 1RZFL 4H26A 4Y4HA 4HUVA 2EDDA 3WNPA 5CCKL 4L3EB 1A4JA 4FA8A 5FL1A 1QOKA 3B6SA 4FFVC 4LLYA 4WSJA 1E6OH 5HNNA 2HN7B 2OJZH 1C91A 1RURL 1FH7A 2NXZC 2G75A 1EBAA 1FFOB 4I5BB 2VQ1B 3HG1D 1P4IH 3KJ4C 1RMFH 1W9DM 4WGVB 1MQ8A 1A7QH 2B2XH 3AGVA 5T1DL 4FQXB 4OJFH 4OB5H 2ADFL 2B39A 1FO0B 4AEHL 4PB9H 5J9PA 3ELAT 1C93A 1LEKB 4U6YA 4V2BA 4R9HA 1IGML 3K8LA 4WW2A 4J3SA 2EDXA 2DL2A 1HJSA 3TN0A 5I66B 2V38A 2VKXA 1SJHB 4LSRH 2UY5A 4LEXL 4PN2A 3HZKB 5I30L 1WDRA 5IEHB 1CLXA 2VQ1A 1VSCA 2CEQA 3NFSL 2R29L 1YDPA 4I0PC 4Y5XA 2BHUA 5DK0B 4J3WA 3QXAB 5B38B 3JWDH 4Y5VB 2E3ZA 2P24A 3F7PC 4QRUB 1K4CB 4J23A 1FNSH 1MCRA 2I5YL 5EC1A 3ZE2E 3GEWB 5D1QD 4N5EC 4KJQD 4E41B 2F53A 1EDGA 3MBXL 5C7XL 3GMQB 5DD3H 4Z9KB 5H37H 4IPNB 4MADA 4OZHA 4CGTA 4RISH 4S10A 5T1LA 1FNLA 5FO7B 4HIXH 3I85A 4NKOA 3MRJB 4KAQL 2CERA 5D9OA 2IQ9H 1KJ3H 2P4AB 4F9JA 2AK4E 15C8L 2BOCA 3C5ZA 2YL9A 3RPMA 3TNNA 2YKLH 5DDHA 4GW1B 4L9LA 4NZDA 4TRPH 1E6ZA 1T3FB 4JFOB 4I2XE 3KPMA 5TJWK 1ACYH 2NY3D 4MJ5B 3VD9A 5BROA 1QW8A 4YQXH 3SY0B 3ZKQD 1G9ML 4WRLA 3FT2A 1CQKA 4N8CL 1FC2D 3AIVA 2HJLB 2DD8L 4BQ9A 3PGCB 5I75B 3NN8A 2NY4D 1NFKA 4Y8AA 5GGSY 4F7MA 4PJCE 3VDBA 1TZHB 1JUFB 5DSCA 3IAQA 4MB5A 4NQUA 3SDCA 3WHE1 4NCC1 2MOVA 1NEUA 1OAUL 3GRWL 4NN5B 5EUOE 5HD8D 4FQJH 3MRCB 1T04A 3CUGA 1U95B 5F9JA 2NXYC 3ARGD 2ZKHL 1BSIA 2X5PA 4XCYB 5J1AB 4IDJH 1EK3A 4GKLA 1FLTX 3T4AA 5F7DA 5F9DC 2APWA 2OYPA 2E9MA 3VX0A 4ODTH 5GRJH 1V02A 1LD9A 2EC9T 5CUSH 4CVXB 4NO2A 4EXKA 1OGGA 5I16A 1D9KA 4JN1L 4F8QA 2WZEA 5TGBA 2I9TA 1U3HC 3B9AA 1ECEA 1CF8L 5F1SA 1MJUL 2VDKH 5HHQB 4Y0GA 3VDAA 2YN3A 4RGOH 3O6LL 1R0AH 3P2TA 1VFMA 4JHBA 4OCXH 1N59A 4AIOA 4F9DA 2H3NA 3IJSB 4CU8A 2DRUA 2XXMB 4GW5A 3IF1A 4JY5L 2ID5A 5KVFH 1UKTA 1K4DB 2JB5H 2HLFC 2VJXA 1MHPL 2X4PB 3SDCD 5FM8A 4EVNB 2V2TA 5FK9B 2Y06L 4CUCA 4PJFE 3S4SG 5HYSB 4W87A 2FD6L 1SJEA 5BW7C 2Y23A 5E9DA 2V3GA 1NDGB 3MGTB 4HWEH 2LTQC 4PRAA 3GK8H 1HWGB 1HHIA 4WK9A 4FQXC 4NQDA 4FMVA 4MCYB 1NCUA 1ORSB 1T1XA 4FXKA 1U8LA 3W81A 3A4AA 1CD8A 4IRJA 5CPQA 1OOAA 2ADGA 2OTWB 3TJEL 4LCCA 4NWTL 4YBQC 3UTSD 1VHPA 2WSKA 3BMWA 5IFPA 4LNRB 4KKCD 1IQWL 5E6ID 4TSBL 5CSUA 1FH5H 3P11L 3C2AL 4WO4B 1U8OB 2AK4D 3GIVA 3D0VA 2QEJA 1Y7VA 25C8H 2OSXA 4JY4A 4HMDA 5JW3H 4ODXA 4PRBA 1CFSB 2Q76A 4WU5A 4DAGH 5I17A 4IOFD 3EZ8A 1EAPB 3FOLA 1MWAL 1PVHA 4D9LH 3CAFA 3DV6A 4QHLB 5FFLA 1KT2A 3ARSA 1QBMH 4JFWA 1GGYA 3VFRA 1SYVA 3T8XB 3WO3B 4Z7VF 2V5SA 3H3PL 3H7LA 5BRPA 4MQXD 3KXFA 4U1IA 2P5WB 4IM4A 4OZ4A 3WIIL 3LHPL 1FRGH 1KXHA 3TCLB 6FABH 2FR4A 5DURD 1MFEH 1OARL 3MJ9L 5I1GH 1X44A 3IU4L 2R56H 5BRZB 3C5ZC 2PYEB 4NQDD 3WQ4A 5SWSB 2AQ3A 1CN4A 2VXQL 2EIDA 1MXDA 3F7RA 1CU4H 3WD1A 1F6AB 4K68A 2GSGA 5E2UH 1QR1A 4GG8A 1KCVH 3R1GH 5INDB 5I1AA 4ZXBB 1BVLA 4F57H 4U1SB 5BXRA 1VFBB 5E6IA 3FT3A 1YYLH 3U36A 5IM7A 1X6LA 2V2TB 3GSVA 4XPFL 2BOCB 1MREH 2AK4A 3WIIH 4GRMB 5L6YL 3V6OA 4FTVD 4GW1A 4KTDL 4L9LB 1V0LA 4Y19E 2CXGA 2CLVB 4QWWD 1UXWB 5D7KD 1GZQB 1DN0B 4YHLH 3JV4B 2JEPA 1EX0A 3ZMRA 2Z92A 1XHGA 3N06B 1CENA 2X0HA 1FSKC 4JQXC 5KZCB 4MAYA 3WFEL 1JYNA 4W88A 3MRIB 4Z78B 1T1YB 3UJIH 2OP4L 3GH5A 1AE6L 5JDJA 2GJPA 1IAII 1HVXA 6TAAA 4NJ9H 5FHAL 2I9LA 3CZFB 3EDEA 2XIBA 3I02B 1R3IL 1KV3A 2GSIA 5TQ0H 2NTFB 3LH2L 5ISZE 2JJSC 4QLKA 1RIHL 3HE6A 4GG6F 1FN4B 4XPTH 3G6JF 5EUOB 1M7IA 1C5BH 4YDJA 5L7XH 1DLHA 5FOJA 1ZLWK 2HP4A 2UWEE 5D7JD 5C0NC 5AUMA 2Y6SC 4YIQB 4GPNA 4F7CB 5JHLL 1A5FL 1E0OB 2XFXB 4YO0A 2DGAA 4JFDB 4NQED 3O9WA 5F7FA 1KN2L 1S7UA 5E2WL 5DO2C 3N1FC 3F6IA 3F58H 4MSWB 1ZU8A 1CT8A 3P30L 3II1A 4ZSOE 4UINH 5IB5A 3ZJKA 2D7NA 1UM5H 2G75B 1OAQL 4ZO9A 1BBJA 3UDWA 4HFUL 1HXYA 3V52L 4XWGL 3ARGA 1V6WA 1IEAB 4K3EH 2J7CA 1MJUH 4MQTB 4C56E 3HRZA 4YAQA 1R7AA 4F58L 2HVKA 4N68A 1PY9A 2NCMA 1UH2A 2XG4A 4P8UA 3QO0A 4DKEL 4PJXA 2X10A 1D9KD 4JFFB 3UERA 1T21A 2VX7A 2VAAB 4KTEH 1IILE 3QIWD 3FW6A 1JPST 4FK9A 1DL7H 3MA7B 2WMIA 4Y88A 2XWEA 5IK3A 4H0HB 3I6LE 1S9WB 1KJMB 4EDXA 4ZS6C 5EU6B 3S7GA 4HIEB 4C55A 1MIMH 1RPKA 4NDMA 3FQUB 3MXWH 2NY5H 2HH0H 2NNAB 5IVZB 1FPTH 4M6ML 2VABB 5EPMB 1KC5H 5L2KD 4CJ0A 4PMNA 1BFVH 5H94A 1WT5C 3CUHA 3WF1A 2BY1A 2R0WH 1S8DB 3GFUA 5F3HB 1QSFD 1HEZA 1KBKA 1OD9A 4OF7A 4S0SD 2X4TA 2CRMA 5T5FH 4ESKA 5T3XE 4R2GD 1MLBA 4D1JA 3NACL 1R3HB 3VXNA 2WMHA 3LSOB 4BQBA 2DQDL 3IXTB 3NTCL 3V0VB 3U9UA 1YUHB 5I9QC 3HC3L 1KJ2A 2EXYC 3BZFB 4UCFA 2NNAA 3C5SA 4A6YH 5GGSB 3VFWA 3DWTA 1R5IA 1IMHC 4OIIH 5SWSA 2IG2L 1E4NA 4RISL 2VLJE 5CP7A 4OCLC 3VD4A 2IALB 5D8JH 1MQKH 3SDAB 1GGCL 2R15A 1DBKH 4JY5H 3TVMA 3QFJA 3HZYA 1MVFA 3SN6N 4XC3H 5DK2A 4JFVA 4TUOB 1KFAL 4U0RC 3WUWB 4PRNA 4OZHF 3IXAB 1OGAB 2XN9A 4MMZC 4X98B 4Z18A 5MP6H 4Z5RB 3HB3C 2O5ZH 1OVZA 1URLA 5BRZD 4DGIH 5A2FA 3RQ3A 3BD3A 5L9DL 1KYOJ 3ZM8A 1SR0A 4OIIL 1A14H 2UYLB 5CP7B 4HAFA 1W9VA 4YR6A 3ZE0E 1N6QH 4GI8A 5I1EH 4NJAH 3SKMA 2WWMC 1HKLH 4W8AA 3QHOA 1KLUA 2DQHL 2Q86A 3VFTA 4H25B 4IRSC 4RRPA 3RIAF 2EIZB 2P8LB 3LKSB 4P5TA 1EJOH 3MRKA 2E9JA 3GSRB 5F96L 5BO1L 4LVOC 1S7SB 1M04A 4ZPVA 5FA3B 2MPAL 1A4KB 4KRUA 1I1RA 3LVEA 3RAJL 4RAUA 1WV7T 2DTMH 4O9HL 1Z32X 5BJTB 1JWUB 2YA1A 4X6CB 5TFSH 5IW1A 1NOFA 2BFVH 4OF3A 2FGWH 3LS5L 5HI4D 2JIEA 3EHBC 3WQVA 1QPXA 4PGDB 5D6CB 4DVRL 2FLBT 3L3KB 2NXZB 4NHUB 4O4YH 4RGOL 1F4AA 4N0CC 3RWIB 3RWCB 3TN0D 2BNRE 1T6VN 5FYLE 5GZOC 4PBWD 4S1SL 1I3RA 1BVKA 4XMPL 2I24N 1BZ9B 2XVNA 4JRXA 3TZVB 4HKXA 3IFOA 3T3MF 3GXDA 4PJGB 1RZJL 2BOBA 3W26A 1CLCA 3M7SA 4PJBF 4F37K 5FB8A 1KCKA 3BSHA 4JM2C 3ULUE 1HQ4A 3T4YB 3QDJE 5KAQG 4WUUD 3GXIA 1X7QA 4LCIL 1BFSA 1EO8L 1IKFL 2OS7A 1IEBB 1HKKA 4IIQC 4PJXE 3RWCA 4WHTB 4LIQH 5F44A 1KNOA 1B2WL 1NCCH 1UA6L 5GGTH 3AM8A 4NKDA 2LU4A 4KROD 5IV2A 3QOKA 4Y16A 1T1WA 1EV2E 1I9RL 3FN0H 1Q6DA 3IDMB 5J11B 1L0YA 4PJFF 3MACL 4XAWH 1KTRL 3HAEA 5J11C 3CFBA 2CK2A 2VRQA 1WWBX 5KSBA 3RX8A 3WHE0 2L0DA 3KDMA 2X9WA 2AJUH 2OYMA 3QXUA 3N0PB 1NEZG 1UQSB 2E8YA 4MAUL 1QA9B 4TYUA 1OP5K 1A6UH 1UA6H 4GZEA 3NCYP 2NSXA 2DIAA 3AOFA 3PABA 4KRPB 1LP9A 1U9KA 2ICES 1BBDL 5GISH 2Z4QA 3ZYJA 1G9NL 1F90L 2ATKA 3W11D 1OSEA 1KCUL 2YD4A 1HSAA 4PCSA 3PZOA 2QADC 2VXUL 5EFIA 4OFKA 4W86A 4KI5E 1UG6A 1MJ8H 2P5EB 1OAYL 2Z92B 1UD3A 3SDDC 1D5IH 2X9YA 4XP9H 4CDHA 1IAMA 3HE7A 3TO4B 4POYA 4LF3B 2VAJA 1RZ7H 5GGQH 5LA2A 5JHDA 4GRWE 4L29B 4N9GA 5CIPA 5ETUB 5F97E 5IKCA 3GMMB 3MRNA 2D9QB 4UV4L 2X6MA 1MFAL 4M9PA 5HGHA 4Q9RL 4PFEA 4YPJA 4XPGL 3UTQA 4CVUA 3SCUA 3RRQA 4JAMA 1CD9B 2IPKB 2HT3C 1FP9A 1CGSH 4WI9A 2VL5A 2JIXA 3HUJF 4I0CC 1K85A 3ULUC 3RTQC 1MCKA 2DB8A 3CVHB 4LBEA 3QFJD 3RJDA 1QFWM 1XGQA 4RBPH 4MYWB 1J8HE 1E28B 3KLAA 3HC0B 4W93A 2QBWA 4X6EB 2X4OA 3B9KC 3FOMB 5EU4B 3RDTC 1OTSD 1L7IH 4UTFA 1JJUA 3RVWD 4WV1A 1MHCA 1T1ZB 3LDBB 5J13B 5JA8B 4HK0B 5FHBL 4RGMB 2IQAA 4OSUL 1U0QA 4QRRD 3H7BB 4PJIB 5DRWA 5D1ZB 4BFGA 1T1YA 1VA9A 5ESVA 2HVJB 4AZ6A 1N2RA 4CKVX 1Z5LA 4U1JA 5GS1B 2PI6A 2XN9B 4Z5RA 2DQTH 3F7VA 1VRXA 2DTSA 3QUKB 3QEUB 4J7RA 3TGXA 1BEYL 1UQYA 4XHQA 5D9PA 3SDAC 4PJEF 3CDGB 4PYGA 5DEGB 4RMRA 4HG4J 1F11B 4P4KA 2ARWA 2F5AL 4ZXBA 4FQCH 1K8IA 5DQJB 2R1WB 3WELA 4U3AA 4P0DA 1S7XA 4NM8L 4OBRA 5MENE 5BZWA 4X0KB 1QD0A 1QVOB 2Z8SA 4NRYB 5C0DB 3GH4A 4L3ED 2J8UF 1MVUA 4J3TA 5JZ7C 1HILA 5DFVD 4M9OA 1BJMA 1CT8B 3D25A 4M7JH 5EU7E 5I66A 1OB0A 4PEEA 3LKSA 5HGGS 1BGXL 4PREA 4XZWA 4JZNB 3NOIA 4LCYB 2GT9B 3NIDF 4HT1H 3MUY1 1NWTA 4ELKA 5IHRA 1E4KA 3OKOB 4JM2F 5C0JB 2SEBB 3D2UD 2BNUB 5CHNB 1QVBA 1M6OB 3F5LA 2MQ3A 4ALAL 4CVXA 3PHSA 4Y4HC 3S3SA 4GRWH 1GYAA 3FO9B 3ARED 3RA7L 1TZGL 1R3JB 2KKQA 3HCVB 3QQ3B 3QJHB 3AIEA 1OCWH 3WS6C 3I02A 4AENB 3CPLA 1V6VA 4RE2A 3RX7A 2NY7H 1V3HA 3W9EB 1CWYA 4QYOA 3OXSA 1OP9A 4Y1AB 1RIUH 1YNLH 1WZAA 5FYJL 2E9IA 2BSTB 2W1NA 1G7QA 3VFSB 3QG6A 3PTQA 4M93C 3O6ML 1NWSA 1OGSA 1J0YA 2HKHH 3KYNB 4IDLA 1FVEA 4L4VA 4TUJB 3MV9D 1NC4A 3VI4E 4LEXH 3ZHDA 4Q58C 3QZWB 2X7LB 1G7LB 4UDTA 3FMGH 4M1GL 3W9DA 5EUOF 1UADC 4EIGB 4HZAA 3WKZA 3OF6D 4Z7VA 1K6AA 5HGDB 4XX1G 2VDNH 4S11A 2X44D 1U2CA 3PZ9A 1YECH 4BM7A 3NGBB 4YHNB 2EE3A 3AREA 5E70A 3FB5A 1AY1H 5HDQL 4I2XA 3BPOC 5E0QA 4DN4L 3S96A 3AXXA 1KLGB 1RURH 4ONFL 4LMQI 2ATPB 4MD5B 5DHYB 1UHVA 3EOAB 4LSPL 1CXKA 5ITFA 5ADPH 2HRPL 4WFFD 4R3SA 1UWXH 2X4RA 3MGAA 4Z7NE 4R7NB 1MWOA 3MV01 3HE7D 1RUKH 3QUZC 5IK3B 3CMJA 4O2EB 4WY7H 3IS0X 4G43B 4L4VD 4LYQA 3MROB 1V6UA 3EFDH 2OM5A 2VH5H 3M17B 3HZMA 4ONGH 1UACH 5SWZD 1S46A 4RIRA 2P5ED 5EU7C 1A3HA 3LEXA 4MXWH 5GS0L 2JE8A 1A6TA 4YX2H 2WBJC 2DQJH 3VFGH 3OF6A 1BAFL 1CDGA 1A6AA 5GGTA 1H11A 2NT0A 1EZVX 2PCPB 3AMDA 3VCLA 3AMLA 4PJBA 1C12A 5DF0A 1TJHH 1UVQB 1Y18B 2ESVE 3H42H 4OF6A 4WWKA 2R2HB 3RWDA 5KVDL 5K9OB 3OGVA 1TUXA 2H41A 3DX6B 5DD0H 4TSCL 3QHZL 2P7TA 4KZDL 3PWLA 4P23D 4PJGE 2ZJSH 2DIJA 1EGJL 4F8TA 4WIWA 5EO0A 4ZD3H 3MV9E 4M1DL 5HXMA 2DLFL 2XTJD 1ZLUH 5LXGH 4OFPA 4NRSA 4M82A 1A6VH 2VCAA 2R2BB 3IANA 1LO4L 3S88H 4OTXL 1FOBA 1MLBB 4OCNC 4DJMA 3MCKB 1UM6L 1WVZA 1NUNB 5TE6L 1QTYT 4CMMB 3VFUA 5K9KB 5LWYL 1RZFH 5ERWB 3MJ9H 4HMEA 1CLVA 1I9JL 1E4XL 4C56B 2J78A 2MSPA 1RV6X 4TSAH 2AGJH 2BJMH 1WGOA 2YUWA 2C1OB 5EBWB 2D2OA 4NJ9L 3B3IA 4OCSH 2NTFA 2YK1H 1WFNA 3CC5A 2CUHA 3O6FA 3MBEC 3TJHD 5C0IA 5AWNH 2PO6C 3SJVA 3PL6A 2V7NB 1DQQB 1BMGA 4OZOA 4HS3A 3LD8C 1MUJA 5EH1A 4LLMB 3TCXA 4K7FA 3WLBA 1KB3A 1VBUA 3MRMA 2XVPA 4AD4A 3BH8A 4Z2IA 1ZA6B 3TLRA 1MQKL 1X6NA 1PYWB 2ZOLB 3WUEA 3TN0B 1FGNL 5HY9B 3ULSA 3REVA 5KZ6A 5LCVL 4GKOA 4XVJL 3PWPE 5JOEA 3RTQB 5HYSG 1DQML 3GKZA 4OTXH 4FXKB 5ICZB 4P7LA 1FFQA 1JZ3A 3EKCA 4YPGA 4TX8A 1IM9B 2XYCA 2AEIT 4Y16B 3WD5L 1KYOK 5IFAL 1QSZA 1PQZA 2B8OT 4M02A 4UILH 3RBSA 5BZWB 5IJVB 4HIHA 3B43A 3GHEH 3N50A 4BSWB 4Z7WA 5FGSA 2Y7QA 5HHME 4NOFA 3FQTA 4WTWA 3DX6A 4PMRA 4OZIF 3AB0C 3RY5A 1FPTL 4M6MH 3DO7B 3BRGC 4GXVL 3AMKA 4ZYKB 3QUXD 2J8FA 5E8EA 4DWSB 2DLIA 1UJ3A 2J8HA 4L3CA 4M7ZC 4DCQA 2XYLA 5D1QC 5FDWA 4GZIA 4EK7A 3B2UC 4XC3L 3FQNB 4HCRL 3CZ8A 3FFCA 3ZO0A 4JZJA 4MNGA 5J06A 2Z31A 3O2DH 3MV9B 3WDJA 4IOSD 3HFML 3QUYB 1MRCL 2J4GA 2DQCL 3KPRB 2EDBA 2F74A 3TO4C 3QJHA 3BXNA 4WV1B 5GRJL 2GK0A 5GSVB 4ZE4A 4R4ND 4RFNC 2WVSA 4RSVA 3HAEG 4JQVA 4HV8B 5IGXL 4IDJL 3QEQB 2V2XA 3WEZA 1U91B 2VDML 5D6DC 3HU7A 1C08A 2YUZA 1TVNA 1T0NB 4WFHD 4DN4H 5AZEL 1R3HA 1S5IH 2EEXA 4CW1A 4FFWC 4HWEL 1R3LA 3QUMB 1HYSD 1HT6A 3N1AA 4LAQL 4YHLL 3W24A 4BQ5A 1S7VA 5HHXL 2EZ0D 5IF0B 3RZCA 4UTBH 2C26A 1UA3A 3WFHA 2D0HA 2Y06H 4ZUUA 5D7LB 2UWEA 4I18B 4GRLB 1VENA 3N85H 5DGQA 1I7RB 5FUOL 2PF6A 3UDWC 2VXTL 3OAYH 2D03L 3IKKA 1K8IB 4JQXA 1NBVL 3GBDA 2XOTA 1KCSL 3U7BA 5ESAB 1Q72H 1RJLA 2R2HA 2Y24A 1UWQA 3POCA 3VRIB 1HKLL 4FZEL 2ESVB 2AMGA 1QNZH 4QCIB 3MO1B 2P5EA 4U0QB 2XQBH 1X1NA 2BSRA 3U82B 1HQRA 1GC1C 2GAZA 1UJ3B 1TVDA 4O2FB 1SYVB 3T8XA 3AHZA 4R0LC 1LL4A 1T0PB 1WJ3A 2WCSA 1P6AB 4PLOB 2Z4QB 3AZTA 1EEZB 2ZKHH 3KVQA 5IVXA 5F1NB 4NNYA 3CFJB 4IISA 3O3AA 2JJVA 4Y4FC 2BDNH 3O0RH 4ZAKA 1FHGA 3GSOA 4NQEA 3SPVA 1RU9L 2WWDA 3IDUA 3MR9B 1CGUA 1KLFA 3G9VA 4KHXH 4G5ZL 2O9TA 8FABB 5F72S 4OV5A 1E4MM 1ITBB 5F96H 1J1PL 1UA7A 1CD1A 3MRBB 1UCBL 1C1EH 2DI9A 1UEMA 2OSYA 3V5HB 5KG9B 4MNHB 1CTNA 4BCEA 5BMFH 2JCCE 5C0BD 4PGCA 3SE3C 2ZUTA 4Q9CA 2BNQB 5FO9B 2B5IC 3OSKA 3O3EA 2CDGA 4X6FB 3UTQB 5HY9A 1D6VH 3OWEA 1NLDH 2CDEA 5E6IC 1MFEL 1OARH 4DFIA 5IOPB 1NGZB 4ZO6A 2FX8L 4BQ6A 4RL3A 1EH9A 3W6LA 1OP5H 4DKDC 5HI3C 1JPGA 3AHTA 3ZJ6A 5E94A 1R5WB 2MHAB 4POZC 3ZL4H 4YDVB 1I75A 3H3PH 1UKQA 2OL3L 5C6PB 4IOFC 3GIZH 2FB4H 3MJ8B 5ECJE 4M56A 2BCKA 3THMH 2VLRB 3MO4A 5FIPA 2BVYA 3SOBH 4FABH 3QQ4A 3QPQD 4PP1C 3BDYH 3CVHH 1KLGA 1AQKL 2MMXA 2VLLA 4BUGA 4JFUA 3F62A 4HIJA 2ADJA 1U92A 3TBVA 1KXVA 2OR7A 4G7YH 2YRPA 5D1ZA 5I74C 4JZ5A 4QRRA 3U79A 1P4BH 4HBCL 1F5WA 4X99A 2X09A 4ZSOA 4NRZA 1BD2B 1WAAE 4YDIL 3RGVA 3PGFL 2OZ4L 4NZRH 4MAVA 1XGUA 2QR0A 2G3MA 3KL3A 3O3UN 4FLOA 4FG6C 5CZVH 3DJ9A 5D5MA 2E6QA 4XWGH 3MRKB 5LCVH 2F61A 2H26B 2Y2WA 1QRND 4HU0A 2X4SA 2H32A 5SWSD 3MMEB 3ARVA 3BQUD 2VL5B 3ZT7A 1XV8A 2IEPA 3F58L 3F7YA 3IJYB 3QDJB 4ZXBD 5I9QB 1UJTA 1FBIH 3QDJD 4NBXB 5INCA 2G2RA 3MX0A 2EXOA 1FORL 1HNGA 5JHLH 4AZ7A 3BZEA 2XN9D 2I9LB 4QXUH 2UZYB 4MPKA 4N0UA 3ULVC 1TIUA 2W0FB 3L5XL 4G8GD 2B1HH 4YGVA 3GH7A 2R0KH 4X7SL 1J9CT 3OR6A 5D1ZD 3WD0A 3TEUA 4NSKA 5LBSL 3PZTA 3F8UB 3KNBA 4ODHL 2J7FA 4FZ8L 1EO5A 5FF6A 5EZLA 2C3VA 1ORQB 4PJDA 1H3PL 3LS4L 3SDDA 5CZKA 5D8WA 2Z91A 1IGFL 1V7NH 3X3GL 2FX7L 5FGCE 3BEVB 4F7EB 5CEZE 1QFWH 4G3YH 4GZJA 2BVEA 3EJJX 2I5YH 1A6VL 3WEOA 1U6AL 2P45B 4YGVB 4D3CL 2CO7B 3RZCD 3QI9C 1BBDH 3TTQA 2CBIA 4PV8A 3AISA 1N5AA 1X5KA 4Z2HA 4PRPE 4ZUSA 3OKMB 3PJSA 4W4NA 4U7SA 4ODVH 4Y2DA 4Y16C 5KVFL 3V0VA 4AT6A 4XXDB 2YOCA 1YEFL 2DYPA 4LQFL 4BZ1H 3MLPA 2XKUA 3O45B 5CEYB 1E43A 5TPWL 1NUGA 3QZWA 1DEEA 1MJJB 4G42A 5IUSA 1FG9C 4LASH 3TZVD 3QQ9D 4F9PA 4P2OB 1BFOA 3K0WA 4JB9L 4JN1H 5EIQA 1DVFA 3QIWC 2FATL 5GHWL 3QG7H 4ZTOH 3L3HA 1PZ3A 4X7TA 4OZFB 5EG6C 5FGBA 4W7WA 4EIZC 3BRFA 4GUPB 4MNKA 1H3UA 5CEZL 5CGMA 4YE4H 4C4KO 1DQDL 2FX9H 3IJHA 2J7EA 2OYLA 3G6DL 2YS4A 5FYKL 5C8JA 3K1DA 4XXCA 5F93C 3MNVA 2XTJB 2CKBL 5ITFB 3ECBB 2A73A 3JBG7 5SV3A 2WAHA 2WMKA 3WIJA 3BHBA 1FSKB 3ALFA 2P47B 4LCCB 4Q6YA 3BAWA 1F3DH 1KPUB 5TF1H 3WJJA 2JK5A 2FZ3A 4AWEA 4MB1A 4FZEH 3OB0H 1LEIA 1U8MB 1DQLL 5KW9H 3ULVE 4RE3A 5EC2B 3L5WA 1E6PA 3LRSA 1TZ7A 1Q9OB 5FD0A 4U3HA 4A6YB 2ITCB 1UH3A 4YNYB 5D7IE 5EULV 4LDLB 3K2UL 1PAMA 3SGJC 1DVFD 2HT4C 5BW7A 1X5LA 1EBPA 2VOTA 1J88A 3JV5A 4WI4A 3S37L 4KQ4H 2WVTA 3SKJH 2HKHL 3BLPX 1US3A 1R3LB 1RIVH 3EW3B 3WKMH 1DE4A 1I4FA 1WITA 2FO1A 3PHQA 3NCYS 1FCGA 2D3NA 2VDMH 3SURA 3HE6B 2I07B 1UQZA 2VWEE 4ZFGL 3Q3GA 5CLTA 3ROLB 5IGXH 1MY7A 3RIKA 2UV3A 4J27A 4JQIL 5JW5B 2F5BH 1E27A 5KS9B 1N6QL 2FGLA 3FL7A 1UD5A 3MLXL 5ESVB 4HS3B 25C8L 4Q9QH 5IDIA 3FKUS 5I77A 4XP5H 4GQ9H 1HXMA 4JB9H 3ARFB 3DARA 1FZJB 1TQCC 3L3GA 3RGVD 3L95A 4LDEB 2A6IA 3UX9B 4EN3C 3MRCA 1TTFA 3EDKA 5MP6L 5IJKC 3KPRD 3RI5F 4X6DE 5C0GA 3B5HA 4N0RA 1XZ0B 4G9DA 2OWXA 3PL6D 2Q6WA 1I8KA 1NOUA 5GNXA 1YC7A 3EGSA 1IC7H 3AHYA 4JY6A 3IKCB 1HSBB 4NZUH 3QWRD 5DS8B 5HGDA 4KV5E 3TV3L 1ZHKB 4JFEA 2WHLA 2BY3A 1UZ1A 2FX8H 5C0DA 3KHOA 4UQ2A 1XGUB 1HH9B 1T20A 1MLCA 4HIHB 4R8WH 4NQDE 1B6DA 1MCWM 2X1XR 4GKNA 3DHPA 1V3MA 1NMCC 1Q0XL 3MLTA 3LKNA 5ISZD 1IGJB 1QPKA 4GW5B 4O02L 5EIIA 1FP5A 1I8KB 2F53E 1C1EL 4I4WA 2WPGA 1NDMA 3S5LG 1FHLA 4P7RA 2OL3A 3NH7L 1GVIA 2BNRA 1BFVL 1FGVH 2NY0C 4I0PA 3GBEA 4XMLL 3U6RA 4HOZA 3CPLB 4QCIA 3ALPA 3L4VA 3PNWB 4NC1E 3P77B 5HYEA 3O6FB 4UNVA 2DMCA 5GRVK 2D7QA 3GJFK 1GHFH 5AWNL 1U58B 1DQQA 2ICWI 4PBVC 2HA1A 4K3JH 1FVDB 4KDTA 1NFDE 2P44B 2G5BB 4M62H 3L3HB 5C9JA 3CLFL 4FFYH 5DRXB 4W6XB 3FFCD 4QTIH 3EDDA 3PQYA 1DLFH 3FN9A 2BNRB 3S3JA 3HR6A 2ITDA 1S7QA 1WEJL 5I73C 2VLKD 4IRZH 4RFOH 1WUNT 1S7VB 5IF0A 1KXTB 4AMKL 5D7KE 5IFTA 5EB8A 4M8QA 4B0MM 1TFVA 5DC4B 3CNKA 3HKFA 2MCPH 3CXHJ 2WC3A 1E4XI 1WBZB 3O8XC 1T89C 3SKMB 2BNRD 3PJSB 1OAQH 4AEHH 5BV7B 2ZWYA 5DC9B 3RX5A 1N0XL 4WV1C 1QI3A 4Z95H 4FTVB 5EC2A 1EO7A 4KAQH 4XTRC 5LGKA 4PJ8B 4EI5C 4HIXL 1BQUA 4XNMB 1GQKA 4MHHI 5DJCB 1D5IL 3QEUA 1NCAH 5A6LA 4U1KA 4GH7B 3S4SA 4M81A 2D31A 3EIFA 1KWKA 5JOFB 4HKZB 2NY6D 3ULUH 4Q6IB 2AJVH 3SCMB 3DVNA 2PXYC 4XVSH 3BGAA 3MROA 4OQTA 3JWDL 4EQ2A 4LCWA 2P24B 2BNQD 4AIEA 1JRHI 3QR2A 2DQCH 2V9TA 3O2VL 4HWNA 4XNUL 2A9NL 3WL9A 2XUCA 3T0WA 5E9DE 4L9LC 5JIIA 4CD7A 3U9PH 5JW5A 5KS9A 5BQ7A 5J1SC 3OZPA 3WEXB 4NSBA 3DX8A 3MRIA 3VGAC 3RWHB 2MFNA 1FFNA 4YBLC 4AM0B 5BJTA 3IJ8A 1X3DA 2OXGA 4YPGB 4JFSA 3MQIA 5E8NB 1RZKL 2C3XA 3OG4B 4MDJB 3VW3H 5KVGL 3IAPA 3RY6C 3ZSSA 4P8WA 1MCDA 5J3HC 3ZKXB 5EZOH 4WO4D 4XX1E 4OJFL 5ACMA 4HUNB 1YEIH 4LLDB 2NT1A 3H8NA 3MR9A 2DBLL 2HFEB 2L4OA 3GHEL 1HIML 1C16B 3J8F7 1MCOL 1EEYA 5DEZA 3B9KD 1WWAX 2YZ1A 3VFVB 5INDA 4ZMAT 1BF8A 1MAML 2FX7H 1RJCA 3PWNB 3VE0B 1KOAA 4AL8H 4U33A 5B3NA 1O0VA 4Y7MA 4S1QH 3T1FB 2R56L 1UWTA 4YHOH 3FB7A 3RWEA 2PBGA 4Z7UB 1KGCD 5C0BA 5GGUB 1QNPA 4MDPA 4MNGB 5L2JB 4UT7H 2CBVA 3KYNA 3DROA 2DQIH 1JZ2A 4CCEA 1AR1D 1EHNA 5FYLD 1HKIA 5ENWB 4TVDA 1YEHH 4RNRB 3BFOA 3WSQL 2V5YA 2VKWA 5DD1L 1BQHG 2JELL 4I4WB 3FOLB 1BHGA 3QEHB 3GM0A 5FV2A 3CH8A 1FIGH 1E4LA 1MH5B 5TFSL 4QXWA 1PZUB 5HHPA 3RA7H 4Z0BH 1WZ1H 2NY4C 3NCJL 3S35X 3DSFL 3ISWA 4L5FH 4EQ3A 1JHTA 5C07B 3NCCB 4G8FA 4NWTH 3P11H 5DHVB 3OL2A 4LAQH 2VDRL 4MQSB 3OZOA 4UOQA 3BEWA 4QCEA 4J3UA 4Q7DA 2NXYD 3ARGC 2A74A 4J12A 1T03H 2C8NA 3VIMA 1GQIA 4JFXA 3FHAA 2MCG1 1I1CA 3MOBL 4NKQB 4LHUG 4HDIA 2Q86B 2DYPB 3VDCA 5TDOB 2A3BA 1D5ZA 1QLRB 2CMRH 5E9DB 1ZXQA 2VSCA 5FYKU 1P4BL 4HBCH 5HGHB 3LEXB 4A6YA 2I26N 5DMYA 4GQ9L 1E9LA 1GIGH 2V9QA 1RSFA 4LFHG 1KIRB 4TPRH 5I8CA 1AQ0A 3WUGA 3WBEA 1CDUA 3QNZA 3TNMB 5ALCH 5I2IA 1T22A 2BSSB 4GAFB 1IM9D 2IH1A 3I3EA 2IPTL 3LEYL 4NQCA 1EEZA 3RIFF 3WBDA 2HFGH 3FXYA 2R1YA 4LVHC 5ABFB 2L7JA 4KK5C 3RKDC 4EZMA 4H8VA 1KB5B 1VFFA 3QO0B 4B7IA 4TUKL 3CFEA 2XZCL 2WMGA 1C8QA 4DEPB 3WS3B 1JFQH 5DJCA 1CFTA 1BVKB 3L3IB 3EYQD 2EDJA 4CCCA 3HI1A 4NZJA 4PJ5E 4QOKB 5JXEC 4Y4FA 4HK0A 2H8PB 2FCBA 3EDFA 3EYFB 1FH8A 1VEOA 3ZQ9A 5DO2D 2QV4A 4OM0H 1M6OA 2FJFB 1PQZB 5ILTH 3H0TB 1A0QL 3VXME 1OAKL 3EMZA 4X6EA 3HNVL 4LCWE 1ADQA 5EWIL 4POUB 3LRSB 1GXEA 1ZTXH 3P9MA 3WFHB 2I60L 1HCFX 3KPPA 1WF5A 1KENH 3NZHL 4X4XB 3GNRA 5FCUL 2CETA 1DLHB 4GW4A 1A02N 2NW0A 2CK0H 2HJLA 4LARH 4FNLH 5BCAA 3I75A 4JFYA 1QP1A 1G7QB 4WGWB 2UUDH 1TQBB 1SEQL 4HF5H 4P2QE 3T2NH 4R6UA 4NQSA 3WLBB 3N9KA 3H0TA 4PRDA 2ZUVA 4AG4L 5IR1A 2Z31D 4M7LH 4S1DD 2F74B 1F8TH 5DMGC 3QULA 5DZNA 3HI5L 2H2PC 2GK0B 1K2DB 1NC2B 3E6HB 4JO2L 3LIZL 4DUVA 4BQCA 3ZDXF 5K33A 1U92B 2LABA 4M93B 4OGAD 5FYJE 1IGCH 3ZT6A 4WUKL 5B38G 5CBAA 3QP3A 4ELKB 2NY2B 2P1YA 3WEMA 3GI9L 3EMQA 4J28A 5I16B 4JRYE 1SJXA 3KLDA 4K3EL 5C9KA 5F9OL 2XSBA 1KCUH 1YEKL 4JZOA 2AXJA 3ARDA 5EFIB 5FYJU 3JV6B 3D9AL 1MFCL 4KUCF 2Q87A 2ZIDA 2J88H 3EBVA 1CS6A 3W39B 1BECA 2FYYA 3NMEA 3VM7A 1RK0B 4YNYA 5C70A 4LPTA 3G04A 3HPLB 2GSGB 4WHDA 3VXPA 1QG3A 2FO4A 1VFAB 3IAGC 1QR1B 1UZ4A 4ZUSB 2WLYA 1WZKA 1BVLB 1QBLL 4EVNA 3MLRH 2APVA 4NFBA 1NKOA 4FQIL 2ZG1A 3E8UL 4Q74A 4U1GC 2A0LC 4DZ8A 1MHHB 1OT1A 4JL1A 1J0IA 1NUFA 4JHOA 3FN0L 1IGYB 4MZ2A 5DJ6B 5J6HB 2ZCLH 1A7QL 2CHNA 5I18H 5HYQB 1H49A 4HJ0C 1QLEL 5E0FA 2DQEH 2E9BA 5F1KC 3BWUC 5JMOC 4FFYL 5CGYC 1JG9A 1CEOA 1EPFA 5F1NA 3THDA 5D7JC 2XFFA 3PP4L 4YHPA 3QUYA 1P7KB 1MCNA 4XCFH 3ZHLA 1S9KC 4FQPA 3D0VB 2WBWB 1H4PA 1E3XA 2BFGA 3LS4H 4JFFA 3V0WH 4LLAA 1I7TA 5ENWA 2WMPA 1DN2A 4WI2A 4DGVH 3HNSL 5BVJB 5CKGA 1LEGA 1T0MA 3MLUH 3K74B 3FJTA 1B0IA 5A2AA 4Z0XA 4L4TA 4K71C 4P57A 5DT5A 2R1XB 3MCKA 1ZBWA 5JNYB 3RUGF 4U2ZA 4AZ5A 1EEUA 3VRIA 5F9AC 5D2NE 1XH3A 4S1QL 5T33L 1ODUA 3T2PA 2DLHA 3VUPA 1WCBA 4LRNL 4HLJA 1QUNA 5D1XC 5IESL 2CJUL 1I7RA 1S7SA 2GJ6D 4M29A 2Z8WC 4X9IA 4ACPA 3TTSA 2F54A 1P7HL 1FRGL 4JPWH 1BYAA 1MSPA 3VXRA 5ALBH 5E99L 4QHNA 5A3IC 1CGVA 1A7BA 2JB5L 5ANME 4NQCD 1ZSDB 3UC0L 1H15A 1E4KC 4JDTH 4DN3H 1UXSB 4ENED 3UP1A 2NW3B 3AXIA 4E41A 3G6AB 4WIQA 1WDPA 4KMLB 3IJ7A 1EEQA 4H20H 4GXUN 4HS8H 4JCMA 3S37X 1U33A 5I17B 4HKJA 4JJ5B 1G0YR 3L5IA 3OHXB 5L9DH 4TTUA 4W84A 1W9PA 3PABB 5IVXB 3JZ7A 5HDRA 1KJ2L 1UB6A 4Q6IA 2J7BA 4UFKA 2KL6A 2GITB 4ZPTB 2X89D 2VNCA 4L3AA 3VNYA 1FZKB 1WFTA 1ZSDA 1HI6A 3C87A 3QR3A 4GQPH 1N0LA 1IAIM 1L4IA 1SYSB 1BZ9A 2EXYD 1FYTD 4ML4A 1HHKB 2FB4L 3GIZL 4N1CA 1M7DB 1WBYA 4WW1A 1QRNA 2V17H 3QDGE 4MCYA 5KSBE 5B39G 2WHMA 2A77L 1DSFH 2DSVA 1A9BB 1NQ6A 1VFBA 2XI9A 2CO6B 4D8PA 2QSQA 4KQ4L 3L4YA 1WBZA 1DUZA 3LSOA 3LPPA 3PV6A 1EHLL 1SEBA 1NM9A 1HH9A 1T20B 1IAOB 3ZDYF 3NIYA 3KPNA 3HMWH 4P46A 2E40A 1QYGL 4FRWA 4PMYA 3RU8L 3G5ZB 3GSRA 1G7LA 2O5YH 4B5EA 5A6KA 4DKFH 1NMBL 4XAKE 4D6FA 5MERB 2IBBA 2E7MA 1BX2A 4L4TB 1YEGL 4OZHB 3G5VA 3EFFA 4LSTH 5KBNC 1MRFH 4WCYL 1IZJA 4L8CA 3SCTA 3X12A 3C60A 3MSDA 2VMFA 4DW2H 5D7IB 3FB8A 1HSAB 1W72H 3L3GB 2VIRB 5CSGA 3BISA 4S0TD 4JFZL 5F1IA 2F8OA 5FYKD 5C6TH 2AJ3B 2R69L 1EXUB 5IT2L 1QOXA 2J75A 2FNBA 3PNWA 3M8OH 4WU5B 1I8LC 4MCZA 5HGAA 4OD2A 1EZVY 4JFZH 3VXOA 4FTVE 4UB0L 5JPMA 4OLVL 2AI0H 1WQVT 2XXCB 5LGJA 1SVZA 3VIKA 1XCTB 1RZJH 3GUTB 3CX5K 1TVHA 3UO1L 4BSVB 1JI2A 4JM4H 4QGYA 3LV3B 4UQ3B 1J11A 1QACA 4BA8A 3WUFA 3OJDB 2CK0L 3D0LA 4LARL 1XRVA 5GRYA 1GOFA 1E71M 4KU1A 1TR1A 3CUPA 3SDCB 4MXQC 3AHVA 1YJDH 3ZKXC 3BDXA 4RGNC 5DT1L 3ARTA 1Y6KR 1V6YA 3FO0L 4NN7B 3QCVL 2OTUB 3PZQA 3V6FB 4PRHE 3WNMA 5IBUG 3AXHA 5A6JA 1FL6A 1J05A 3ZDZE 3MLTB 1BJ8A 4OLYL 3Q5OA 5HHVH 4TRPL 1RUAH 3NPZB 2TAAA 1NCWH 3TYGL 2YKLL 1ACYL 3D69A 3BCDA 2CRIA 3GBLA 2VQUA 5D71L 3P4MB 1JPFB 4KK6D 4M6OH 1GNXA 1KN2H 3EYVA 1HHJB 2B2XL 4OF5A 5FGBC 3DRTA 1F4YL 5K9OA 1A5FH 3QQ9C 4NZUL 5F88B 4OI9A 3AFLA 2CIIA 1SBBA 3BKJL 5C3LD 1XH1A 5DUML 4PJHA 5DD3L 1A6WH 3MUJA 2NY6B 3B9KA 3QIBD 1RIHH 1KT2B 3Q6FB 5DRWB 2GTZA 5FGRA 3RVTC 5D7LE 5ADOH 1AD9B 2GFBA 1Z5LB 5ALCL 1EXPA 2R29H 2G9HB 2PO6A 2YD2A 5GHWH 1RJLB 1JPTH 5FYLL 3P0YH 1MWAA 3FOMA 3CH1B 1S3KL 3RWJB 5MI0B 3AC0A 2F58L 2GHWB 1MHCB 2PXYB 2R2EA 3B3IB 4X8XA 5IOPA 1W9UA 4I18A 2Z1KA 3WD5H 2P8PB 1H41A 4U5IA 4W70A 4PBXA 4LLUB 2XJ7A 3PTKA 3MRFA 4PTXA 1VGEH 5HPMA 4F33B 2A74B 4XT1C 4EE9A 4LLVA 5HDBF 3T0VA 5EUKB 2ZCKH 2X05A 4A4AA 4XVJH 4YBHA 4NM8H 4H25A 1QFOA 4QHMB 3VXRD 4PJ9A 4RQQB 2XGIA 3MPCA 5JIKA 4YXHL 1MVUB 1RMFL 4X5WA 2IJ0C 3KPOA 3BN9D 2QADD 3QCTH 5DHVA 4NRRA 4KKNA 5FYKE 2OSWA 2FYYB 1KN4H 3VGBA 3S6TA 3WF2A 2VLJA 2A6DB 1KQZA 4E41D 4ETQB 2B31A 1N64H 1OHQA 4QRRB 1CK0L 4NKOB 1WISA 2XZAH 2RGLA 4NNYB 3SUUA 1F45A 1LO3H 1WWWX 3CUPB 2ADIB 3AZRA 1F6FB 3MLUL 1IC4L 3EYUH 4M1RA 3S34H 4Z7WE 1RHHA 1WAAA 1QHPA 1BIIA 3AIQA 4ONHB 1U8KA 1K2DA 3E2HB 2VLMD 5KSAA 4ZXLA 1N8ZB 1TFHA 3QNZB 3H7BA 4PJIA 5E5RB 3QUZA 4HWUA 3SGDI 2X4UB 1YDPB 3T65B 4NP4H 5ESAA 2W38A 3VXUD 4MS8C 5E0CA 4ZUVA 2XT1B 3L3DB 4F37F 2CDGB 4JPWL 1ZE3C 4JFFE 4CU6A 1EFXB 3N17A 1OP3K 1K9DA 5AC5A 1FQ9C 3OKNA 1NC2D 1N3NB 4NO0A 4MX7B 1OM3L 3KPPB 4ZDHB 2AK1L 4LKCB 5D5ME 2XA3A 2WMFA 4KRLB 2EIBA 1ETZB 4CJ1A 4LOUC 2XM1A 5LAXA 4HIIA 3VFMA 3IDMA 1GORA 1CIUA 5I1EL 1DBAH 2AAVA 3N1GC 4PJ7A 5DVLA 2XZQL 1KSRA 5D2NA 3U9PL 2NW2B 5E2TH 2DWEB 4LVOB 4NQEB 2R0LL 5ESQB 1ZVHA 1F3JA 3RDTA 4OLZH 4PY7B 1YEDA 3MV7D 2ZG3A 1VADB 1VKXB 4QY8B 1TZIB 2NY3C 1HJWA 5L88L 3IF1B 1QRKA 2ED9A 4P2CG 2NZ9D 1Q1JH 4D9QE 5HYJD 4OUUA 5LQBL 1EA9C 3OLGA 4TOQA 1NAKH 1BF2A 1WTGT 2DI8A 4NQVA 5DA4A 2UY3A 4P8VA 1GGCH 2P48B 4WDIA 3T0ED 5ICYA 4PJFA 2XQYG 3PQYD 1HZHL 1Q9LA 3HZMB 3QPXH 2CNCA 4PBGA 1Q6GA 3IRZA 4IOIA 2QPSA 1IAKA 4PJHE 4O51A 32C2B 4L9DA 1J7VR 1CLYH 3LKNB 5F7NC 4KKAC 1BBJB 4BUHA 3WUZA 3HI5H 4QO1A 2ICWB 1BQLH 1DVFB 4OGYL 2FWOB 3LN5A 4OM1L 5GZNC 4X6CA 4HP5A 3OAYK 5KOVC 1QZ1A 4GXPA 2WP3T 3ZR5A 1DE4B 1I4FB 2ORBH 1VACB 4GKSB 4OOZA 2P8LA 4R4BB