2BW3B

Three-dimensional structure of the hermes dna transposase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
84
structure length
84
Chain Sequence
SHMQSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGDHVNVEELLPSPITLSRKVTSDAKEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of a Eukaryotic DNA Transposase
pubmed doi rcsb
source organism Musca domestica
molecule tags Dna recombination
molecule keywords TRANSPOSASE
total genus 23
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10683 DBD_Tnp_Hermes Hermes transposase DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2bw3B01
4D1QA 2BW3B 2BW3A
chains in the Genus database with same CATH superfamily
4XM3A 1IV8A 4XLPF 2LSOA 4A6EA 2OTJI 3HOVJ 3E97A 4BE1A 2XGDA 4WF2A 3LSIA 5C44J 1SFUA 5FKOA 5HNHA 3WTVC 2JPBA 1VF9A 5E17F 3LSHA 4JBAA 4UVBA 1LJ9A 3WU2C 3ZCOA 1FX7A 1XC5A 3OIQA 5DUIA 1HF0A 4UXNA 1R4NB 3WTXC 5JVTA 3FM5A 3OYNA 3E6DA 4A3CJ 3TEDA 3CD6I 2M87A 5K7FA 2CV2A 4X0GA 2L9RA 2F4MB 5LRRA 1ODDA 2UXXA 1IRFA 3E7LA 1FNNA 2HPMA 1FMVA 2RAEA 3DKWA 5J4YA 2HOEA 2JSCA 1YG2A 1R4MB 4LB6B 1BC8C 1AHDP 2A5YB 2KRFA 4XBFA 2HPIA 4M3BA 1H9TA 2E2HJ 3DFGA 2FOKA 1F36A 3IP4B 1PVEA 1YLFA 1SAUA 3HKZN 2DA6A 3TDUC 1MBKA 5M5WJ 2IGNA 2GA1A 4IRGA 3RYRA 3ZMUA 3QU3A 2QQAA 2QUFA 4IVNA 1K61A 1R36A 2JUGA 5JI6A 1S7OA 4Y4RA 4ESJA 3IWZA 4A5MA 4BDYA 1SFXA 2EZIA 1ZGJA 3H5NA 3OMYA 2J5PA 1XSVA 2W00A 1FOXA 4G8XA 1BBYA 1ZR2A 1TP4A 2O8KA 2JA8J 3JTHA 2YX7A 4UUSB 4HF2A 3OOUA 4HBLA 2V1XA 4M9ZA 2HVSA 1RUOA 1WHUA 2UWMA 3VWBA 3BY6A 1XSXA 2VXZA 4Z2YA 3VB2A 3E6MA 1ETOA 3TP3A 4LOCA 3HYIA 3V8LA 3JSOA 2XVCA 2G9WA 2ZC2A 2L4MA 4E7SA 2F5VA 2IEKA 3M1EA 1ZR4A 3IRQA 2STWA 2X1CA 1P7IA 2EA2A 2Y30A 5FLXK 5GAGJ 4A0YA 2DFFA 3BPVA 3HPGA 3SHFA 1DGRM 3E1SA 3REOA 2L9NA 2R4GA 1VTNC 4EJTA 3C1DA 3DBHB 4OIQF 1R6RA 2CV0A 1WJDA 4WX9A 1YW7A 2QBYB 1V3FA 4MO7A 5ICFA 3DTIA 1L0OC 2XSJC 5FB2A 3G4SI 4RDUA 1K4SA 5IPAA 3GTGJ 2EFQA 3KP7A 3GTLJ 1VQOI 1YO5C 1D1BA 2VLAA 1JUPA 2BY0A 4KIFA 2JJ7A 3S8PA 4RM2A 2Y48A 4GXOA 2EFWA 2IJLA 1NK3P 1FPQA 2X0LA 3LOCA 1X2MA 4NC8A 1MH3A 1RI7A 3QWLA 2DA3A 1PUFA 2CQNA 5JVGF 3A1YA 3WG9A 5JHFA 5FO5A 4DZJA 4CZCA 3A2KA 1SD5A 3PQJA 1QZEA 3H5RA 1VQPI 3H35A 3TQNA 3AKZA 1MW7A 2LMDA 3GFJA 4P96A 2DYSH 2VPLA 3TOAA 1APLC 4HSRA 2J5OA 4QLCU 1L3LA 1WJEA 1JJ8C 4BUPA 4Z6YA 1OPCA 1RETA 3OWTA 3CCLI 4A5NA 4CDGA 3K4CA 4YFKF 4EJVA 1U5TC 3IH4A 1Z91A 3U1DA 2DFEA 5GAEJ 3LSKA 1U8RA 3SJMA 2CUFA 1G3YA 2V6EA 5DYMA 1M1EB 1XCBA 1BI1A 2XPWA 4LG3A 5HVQC 4L0YB 1P2FA 1UG2A 1JXSA 2TDXA 1B59A 5CQGA 2DI3A 2DJNA 2V1NA 4CCOA 1XDUA 4X6AJ 3O8HA 1BW5A 5HS8A 1QVUA 3CDLA 5IP6A 3FDYA 3BTJA 3L2RA 1VQKI 3BJAA 4ENKA 4EQQA 1WCMJ 4NDLA 2LH9A 3LSJA 5TJJA 3WTTC 2LRDA 3CCSI 2COBA 2MW8A 2L9SA 2IS6A 1FOYA 1I6XA 4HX7A 1G8XA 4PGGA 1X1BA 1R71A 2LFBA 4D7NA 4OWRB 3A4CA 4GYIA 3IUOA 1WSUA 4XKBA 3HOTA 3CF2A 4NNJA 1SMYF 2VBWA 4I2OA 2XF5A 2R3SA 2HU9A 4XKVA 1FP1D 1R1TA 3LAPA 3ZQHA 1WPKA 1S72I 2RQPA 3L1PA 2CU7A 3DPUA 2CGPA 2DOEA 2FNAA 5K5OA 4M72A 1Z1DA 4A3MJ 3BR1A 3I71A 3K10A 1GHCA 1XDSA 1XMKA 4IRIA 2JA7J 2VONA 1YI2I 2X9DA 2ZJQF 2WY7Q 1TWGJ 2H6BA 2ZO4A 3IH2A 2PI0A 1QBJA 3CO6C 2RGVA 4GDFA 1BW6A 2DFIA 1TZLA 2HS5A 2V7FA 5EEHA 4A3FJ 5LHIA 4G6TB 4E7IA 4KDPA 2Q1ZB 3ZGKA 3TO6A 1FJLA 4A69C 3G1MA 4BAYA 1P9QC 5GPAA 3CUQA 5LFAA 2JT1A 1JGSA 2DA7A 2EB7A 2OAZA 3DCFA 1Z9CA 1AKHA 3ZN1A 3MKZA 3OYJA 3DV8A 4H4KC 2L7KA 2XAHA 4CO8A 2R5ZA 4IOAF 2HOAA 3K6GA 3QPHA 4DYQA 1GDTA 5D5XB 2E1MC 4PUSA 2P5LC 3MD2A 4BU2A 2Y75A 1YW8A 1UHWA 1S8NA 1R7JA 3VYTB 1MH4A 5D8KB 4HDVA 5IP9J 2ZXIA 3E3VA 3I4NJ 3FM3A 3U1KA 4OIPF 3ABUA 2EIKH 1YOVB 2BHZA 1MSFC 2KIUA 1F9NA 2Y2ZA 4UHTA 1T0FA 5C4XJ 2P4WA 3TKYA 4BJTA 1SEUA 3ZMSA 1KU2A 1VI0A 2GOXB 1YX5A 2EFPA 2DT5A 2E5ZA 2DPDA 3MKYB 4BL0B 2BW3B 2PJRA 2JZYA 5LRSA 3S1MJ 3HL2A 5CLSA 1RRJA 2ISZA 1W7PD 1Z05A 1BL0A 2IXSA 1Y39A 3F3XA 4KMFA 2HQRA 1TWAJ 1H89C 4A2UA 1ETKA 5FRNA 3CCRI 1LKXA 1SVOA 3W2AA 3S17J 1YS7A 5FKLA 1BR2A 3BJOA 2AO9A 3WU1B 2VASA 5E3OA 1MMSA 2E1MB 3BTLA 3TGNA 3NWSA 3GFLA 5DDGA 5DS9A 1OYWA 2R7UA 3OR1C 4D0PA 4II3A 2R7QA 4ZYEA 1T2KA 2M2EA 4IO9F 1W0UA 5F27A 4C2TA 3NARA 4CHUA 4F55A 1ZRDA 2LP0A 1USSA 2KT0A 3VYSB 2PMUA 4MEYF 5FLMJ 4BBRJ 1KYWA 1HC8A 1MNDA 4EVIA 3FHNA 2HYFA 2PBIA 2W7NA 1IZ1A 1Y8RB 2ZNYA 1IRZA 1MZBA 4BJ5C 2MH9A 1ZRFA 2MSYA 3ZQCA 3BDDA 3OYHA 1H0MA 5IOYA 1YJNI 1TT0A 2COMA 2LR8A 5A2QK 4IHXA 2VT3A 5FLXZ 3T1BA 3V7CA 4EJUA 4L9VA 4X1EA 1R22A 2XKPA 1O4XA 2VPRA 4ON0A 2HNHA 4ZJZA 5EEAA 3F22A 3FMRA 2XDVA 3EYYA 2JWTA 2YPRA 2LK2A 4Q48A 2JVGA 4D1QA 1E2XA 4JX5A 1B72A 4YIIA 3WTUC 2QVOA 4Y15A 3ECOA 1ENHA 3Q9VA 4LMYA 4M71A 4AVPA 3HC7A 1QPIA 4RB2C 3JRDA 1X1AA 3VPRA 1XS9A 1Y0UA 1UHMA 2GA2A 5LD2C 1DP7P 4MFDA 2GOMA 1JT0A 5FJ8J 1IW7F 4HV6A 3BCBA 2HZTA 2CQQA 2RQQA 5K5RA 3PNYA 1VQ9I 4RM3A 5BMZA 2X51A 3F0CA 3OYBA 2VOPA 4Y7NJ 2F5FA 3J81K 3CMYA 2Q2EA 2LD5A 2KZVA 3EPZA 4AIJA 3EUHA 2DQLA 4RAGA 1TWFJ 3PQKA 3KETA 3D5RC 2NS0A 3CMMA 4CCJA 1IC8A 1WJAA 1F1ZA 2V1DA 3I4PA 2FUG2 2HTSA 5EJCA 9ANTA 5HS7A 2VODA 1K78B 1ETWA 1MGTA 2ZBKA 1X19A 2L5QA 2NOGA 2LY2A 4L18B 4S0HB 2DT6A 1GVDA 3TO7A 3ZMDA 4ENJA 2VL8A 4XQFA 1IN7A 4BHPA 3KYLA 2BHYA 2ZMEB 2Z16A 4EJOA 2VE9A 2R5YA 1V55H 1S7EA 2M0CA 1FTZA 5FD5A 1AU7A 2BE5F 1K7AA 2L9VA 2Z2SB 3HSRA 4B3AA 1Y56A 1O3QA 4S05A 1XCVA 3H3VK 5EG0B 4UB8C 3I4MJ 3JRBA 4GCVA 1D0YA 3I3LA 2F5EA 2K3PA 4DZPA 2CWEA 1XTAA 1HLVA 2NRAC 1J9IA 3F6OA 4OMZA 2IVMA 1FYMA 3SXYA 5E3LA 3K2AA 3HB9A 2WA0A 3F21A 4MQ9F 4XKCA 5L3CA 1FC3A 2GQQA 2EV6A 2W24A 1MBJA 2E60A 3BR5A 2P5KA 5KVRA 3C7JA 3WHBA 3FXJA 1W5SA 2D5VA 1H9GA 3OYEA 2WWYA 2Z33A 5ILUA 4YEJA 2WAEA 2WAQA 3F9KA 1B8IB 5LGTA 5J40A 2V79A 2YSRA 3FK7A 3KPHA 2W57A 2MABA 2DBBA 3CC4I 4F91B 4U0VA 2QYOA 4B3XA 2Y0SA 2V9VA 1ON2A 1SMTA 4B8XA 4KIBA 4ZTFA 1J59A 5D8LB 4E70A 1IO2A 4FHTA 2ISYA 1QZYA 2DA2A 2OF7A 1B8IA 3I59B 3KE2A 2ZKZA 3V8KA 4AIDA 1Y1VJ 3M8EA 1SFEA 2BY2A 1XB4A 1FIPA 3BR0A 4HF0A 3M07A 3ONQA 4OAYA 1XN7A 3GVAA 1FT9A 2DYRH 5JLXA 5HDNA 2AHQA 1IV6A 4HF1A 1FYKA 4HV5A 4BQNA 1OYIA 4BY7J 2JA6J 3B6AA 2AS5F 2E19A 2DFHA 2M8EA 4A3DJ 1KQ8A 2IA1A 3H0GJ 1GLNA 3I54A 1FOKA 1FIAA 3PJRA 5LHGA 3GTKJ 3Q3SA 3R0AA 1X3WB 1HKSA 1O57A 2LF8A 4LFUA 2E34A 3PNTA 2VOOA 1MNMC 5IY5H 5AONA 3DPLC 3LQQA 5EGOA 2M3AA 1X4OA 3DLAA 4DW6A 2V26A 5DCMA 4HSTA 3M8FA 1T8IA 1LDJA 2F4IA 3TDZC 2ZFUA 5H2FC 5J1RA 3HOSA 1WFXA 3HHHA 2PG4A 3LWFA 1ETQA 3FMSA 2HGCA 4PJNA 2G7HA 3S3NA 2IPQX 4B43A 1DQUA 2DOAA 3BQYA 3K69A 5TGTA 5ICGA 5LGNA 4UUVA 4BE2A 3MWMA 1DU6A 2LC2A 2R5YB 4PJLA 3Q0VA 4PFOA 3RDIA 4BQQA 4HQMA 5L3GA 4XMYA 5E79C 1ZRCA 4E7ZA 1X3ZB 2Z99A 3K0LA 3FF5A 5CJ9A 2M8GX 2RN7A 1G4DA 4HNUA 1PYVA 4A93J 3S2DJ 4BH9A 3AG4H 2Y9ZA 3F72A 1R5GA 2IT0A 5ILSA 3JR9A 1J7KA 5DTDA 3OYGA 1Z0XA 1D1CA 2V4JC 3WE3A 2OZ6A 2MLGA 1XSDA 2VBZA 2CW7A 3QYEA 4JP0A 1UB9A 4AVZA 2HI3A 3ERMA 1ZGWA 2HYGD 4XN0A 3U9GA 2X6OA 1POGA 2GXAA 2KDOA 3G1LA 3KEYA 2XF6A 3SEZA 3IL2A 2IS1A 3H5AA 1PP7U 3F8BA 4UVCA 5FFZA 3GF2A 4KJZA 3ABKH 1GV5A 1RZ4A 2E36A 4RGXA 4XICA 5H6QA 4IX7A 3H9GA 3HJEA 2XAQA 2ID3A 1MDMB 4BHCA 1WJ5A 3LFKA 5A2QZ 3JRFA 2KP6A 2ZSIB 3JTGA 3HOUJ 4BXFA 2DJIA 2HKXA 3JRCA 2I8DA 1LNWA 3PL8A 1ZGAA 1FOWA 4ZH4F 4P1WA 4WCGA 1MSEC 1OCCH 1Y6IA 1KA8A 4NB5A 1Y8QB 3K70D 1LQ1A 4O5VA 5FROA 4CYCB 3I5UA 3R4KA 2LKPA 4RGSA 3KCCA 2KZGA 3HKZA 1JKOC 2AXTC 3LSPA 4ESFA 1QQIA 1A35A 4R8HA 4HZFA 1ZTRA 1ZLJA 2L4AA 1CF7A 2OV7A 2XB5A 2A3SA 3GEZA 1KQ9A 1ON1A 2XUBA 3O6BB 4HQEA 4WWCA 1YITI 3W2VA 4V2GA 1K6YA 1TLHB 2FRHA 4I0BA 2R7WA 1XPXA 3IRRA 2ID6A 2JUCA 2X6XA 4XLHA 1YRNA 1WH5A 1Q1VA 3G6EI 3KZYA 1B4AA 1FSEA 2JTVA 2XAGA 3D5SC 1E3PA 2OU2A 1TNTA 4ZYDA 2BEOA 3MQ0A 3COAC 2K4BA 1H8AC 2ADUA 2XPUA 3PO2J 2JQ7A 2NS7A 1K79A 5K1YA 3H92A 3TO9A 4G7OF 2HKOA 3JAMK 1HW5A 2MD0A 2HQNA 2V9PA 1MIJA 4MEXF 4CXFA 4IL6C 1YHQI 2VI6A 4E4HA 4DNCA 2FMYA 2NS8A 2KPMA 1G3WA 3PO3J 2GBYA 3PSIA 5J47A 3G71I 4HAMA 1BR1A 3PFIA 3SZGA 3ZRGA 1MBFA 4FISA 1LE8A 3J7YJ 2JSPA 4FE4A 1FBQA 2GXGA 2PJPA 2HTJA 1HSJA 1ZYRF 2E1NA 3QOPA 1ZQ3P 5E3MA 1EH7A 1JE8A 1VNDA 2P0WA 2Z3YA 4C2MJ 4BHBA 4P5OA 3C18A 4ESBA 3W6JB 3AL0C 5JLWA 3K9TA 2FA5A 4IF4A 3T5XA 4AWXB 5KAIC 1HSTA 2MBFA 2JRTA 3D1NI 3RYPA 4KYWA 2FMLA 1EKEA 1MMAA 1BN5A 4AD9A 4UV8A 3KFWX 5E3NA 1IXCA 4JX6A 1IN5A 2ZXHA 1LDDA 1IXSB 2ECCA 5JHUA 5L3DA 1E17A 2H94A 3H3UA 2VN2A 4UB6C 4AUXA 4NQWA 4V19K 2QSGX 4XSZF 3S1NJ 3GCMA 4BS9A 5ERIA 4RB3C 4RGRA 1PDNC 1OMIA 5IYDJ 1OCRH 3S1QJ 1EJ9A 4WK8F 1FYLA 2B7EA 4QTRA 5LGUA 5GPCA 1MBEA 3HSFA 2CW8A 4OIRF 1MMGA 4KIGA 3CMEI 4A12A 2LREA 4RLQA 2KISA 1LEAA 4AC0A 3GYHX 4NQWB 1E3OC 5D5VB 3BG3A 4Q5SF 1QU3A 4FX0A 4FCYA 5GADJ 3DP7A 3IC7A 3BC8A 3E0JB 2IW5A 3L2UA 2HQAA 2BOLA 5CVVA 4FX4A 3MMYB 3P5JA 3J80K 3IKTA 5E1XA 1R49A 2O0YA 3ELKA 3L7WA 3JREA 4I99C 1YFHA 3DBRB 3FZVA 1QHHD 1U78A 5D5UB 2L7FP 1MMNA 3BCAA 4OINF 4FASD 1O3SA 1K78A 1X2NA 3HPHA 4UVAA 3PIPF 1BM9A 2JK3A 4ENNA 1JKQC 2BY1A 2O6GE 3BLYA 1JI8A 2P8TA 3C3WA 2VJIA 3SDBA 2XIGA 1OISA 1R5ID 2XGCA 2PMZA 2BXYA 2MC3A 1ZELA 1AOYA 4MHGA 1T0FC 4MFEA 1GVJA 2FQ4A 2WB1A 5K5QA 3RJPA 1Z7UA 3ZR8X 3R0JA 4EGZA 1ZARA 2ZCWA 2DK5A 2QQBA 2RNGA 3HRTA 2EJRA 1D0ZA 2L7MP 3EUKL 3RKWA 4D7MA 1IDYA 4EGYA 1TT5B 5CVJA 3WODF 1Z77A 2K9QA 1YX3A 4OAZA 3KP4A 3FIWA 4MIMA 3ULQB 5M3MJ 1VQLI 1DPRA 3H9QA 1LVKA 4II2A 3S2WA 2DXIA 1WJFA 2BBYA 4ZZDA 1YE9A 1FLIA 1IXRC 5KNLA 5HLGA 3AAFA 4I09A 1R1UA 3MZYA 1E3HA 4LLLA 2QM3A 3OV8A 3K70C 1G6NA 3NEUA 5K7HA 4IHSA 2BVMA 2LY9A 1DGWY 2KIFA 2M4KA 2M4GA 2YR2A 5F1RA 1T98A 2OA4A 1U5TB 3J7AY 5KK1A 4C3HJ 4EV0A 3TOBA 1P4XA 4BACA 3GUDA 4BBSJ 2YUSA 2F48A 2KMUA 3WGGA 5DD4A 4F92B 2E2JJ 2KJBA 2NVUB 4E7JA 3S93A 3DLLF 2VIXA 2D2WA 1BC7C 5BPIA 5CVIA 3FBIB 1K6OA 2O5RA 3QYFA 4N9HA 2VJ4A 4DYRA 5HODA 4F93B 2KLOA 3OS0A 2VT2A 4HLYA 4O6JA 4DYCA 3KLOA 4WXHA 2CJJA 2XAFA 3FX3A 4BXXJ 2AQFA 3CJQB 2VC0A 3ESWB 2DMQA 4A3BJ 4U0YA 3CDHA 3CC7I 1V5EA 1PP8F 1X1DA 3F23A 1NG6A 3LQRA 1A36A 2F2EA 2MYSA 3QU6A 4HW0A 1B6AA 3ABTA 4F52A 2NVTJ 3HOZJ 2GM4A 4LITA 1LEBA 1LFBA 4JX4A 2LDUA 4I02A 2LTPA 1SD6A 3A03A 2W85A 2K9MA 3I53A 3P9CA 4LK0F 4RS8A 3CCQI 5B3SH 2DPUA 3DEEA 3H0DA 2FJ1A 4NBQA 3K7AJ 4W1UA 5LBQA 3KLNA 4LIVA 4G6DA 3WTSC 4H0EA 2DDAA 2XC7A 4RAFA 2BY3A 2CMPA 2A68F 2CV1A 3GTPJ 2HDDA 2F5DA 4IZZA 1RR8C 1RUNA 4OMYA 5FFXA 1W0TA 4YRVA 3ZQLA 3DXJF 2CYYA 3GWZA 4D9JA 3ZN0A 4MLOA 2E1OA 1HDDC 4L0ZB 4LGWA 2EV5A 4EJWA 1KONA 4M3GA 4G7ZF 1B9NA 4C2UA 1REPC 2CFOA 4F3QA 1ZAOA 1WRJA 2X48A 3GFIA 5ILVA 4U88A 2DO7A 2XF7A 2OTLI 1TBXA 4IRHA 4MNUA 1UG0A 4C3JJ 3S3OA 2R7ZJ 3S14J 4ETSA 1BOBA 2WV1A 3GXOA 1I3QJ 4IOCF 2MGQA 2DODA 2RNJA 2H8RA 4A3GJ 1QO0D 1TWCJ 2XB0X 4RB0A 2CUEA 4DJAA 3IH3A 4UV9A 3HRSA 3UNGC 3MFKA 1GV2A 2W1OA 2YU9J 1S29A 4XONA 3K1PA 1SFOJ 2EA4A 2ZMEA 3DTKA 1S7AA 3KEQA 5E8GA 4HLXA 2OZUA 1BI2A 4CCKA 2WAFA 4C3IJ 3K4NA 1O7LA 4I01A 2IA2A 2FBKA 5LEKA 1XG1A 2XAJA 2KRHA 3FXLA 3BG6A 1S6LA 1U2WA 4WXDA 1BOAA 3HUGA 1JUSA 3OS2A 3UR3C 1G2HA 4ZDOA 1YS6A 5HS9A 3VODA 1JTXA 4PFPA 3QAHA 1RR7A 3CQZJ 4FT8A 3ERED 1EH6A 2Q2EB 1QNTA 4PJMA 1IJWC 1WWXA 4M6XA 4PK4A 4BDZA 5J1UA 3S1RJ 2OJED 1FMWA 1N75A 3FXRA 1K83J 3JRGA 2ACJA 4XRSG 5L3EA 1T39A 3HUGB 3QP5A 4RMNA 3RKXA 3B6CA 5EZHA 2EFOA 3OYCA 1WH7A 4M6VA 5EF6A 5M3FJ 2DTRA 3EDPA 2VQCA 4J00A 1QVTA 4XLAA 4M9XA 2RV8A 3LA2A 4XRSA 3ZXSA 2VKVA 1ZG5A 3QPSA 5D5WB 2X85A 3P7NA 1IGNA 2CQKA 1SVMA 1IN8A 3GMEA 3G73A 2C6YA 2FD5A 4ZYHA 2XRNA 5IOZA 1QGPA 2R7OA 3CJRB 4P9FA 1LVAA 3CCMI 1FWZA 3CLQA 4N4NB 4B4CA 1JJ6C 3GZNB 2BVLA 1X1PA 4XOTA 5HNFA 2G7UA 1W5TA 3CCVI 3MZHA 5J8CA 1FP2A 3CJNA 3ASNH 4D5CA 3L2CA 1HA8A 5C3EJ 3G1OA 3VFZA 1TQIA 3KEOA 4A3JJ 5L3BA 2XGXA 2R0QC 1QRYA 1HKQA 1QA6A 1ITYA 2HDCA 2DQRA 3BJ6A 2DA5A 2BW3A 2LLKA 2H1LA 4G9YA 2E71A 4Q47A 3OSGA 5DM6F 3HOXJ 3OSFA 3OIOA 2K85A 2DMPA 2YU3A 4KITB 1YJ9I 5J3LA 3SDGA 5BPDA 4GYGA 2P5VA 1W36D 2KDZA 5E20A 2EH3A 4MTDA 3OYKA 2W48A 1ZK8A 3LA7A 1G3TA 3RCOA 3ZMZA 3TP0A 4BE0A 3I56I 3HM5A 1PJRA 3CCEI 3CP8A 2QZ8A 2LVSA 2Q8KA 1P7JA 3QODA 3ZQGA 5EGOB 3P9IA 4RAZA 2P7VB 3K1NA 2M7AA 2QKLB 2EFNA 2M45A 3FHZA 1YTYA 4IHTA 2DAOA 4CZZA 4A0XA 2GLOA 3A0BC 3OYIA 1HCRA 3HHGA 1ZHFA 3PIOF 4ANJA 1AKHB 4XKWA 4QSHA 4M3FA 4RBOA 3HOWJ 4XRFA 3AFHA 2M0MA 2M34A 2HZDA 4BYYA 5B1AH 1O3RA 2K86A 4PDKA 2R7SA 5HOOA 3OS1A 2HR3A 2OBPA 4RB1A 4DIQA 1TC3C 1T33A 1RPWA 1S3JA 2FU4A 3LSRA 1P6RA 2RC4A 3T8TA 2KQRA 4EM1A 4E7HA 5IT3A 1TL8A 5K7ZA 2H1KA 4A0ZA 5FD6A 1X58A 4B44A 1OJLA 4HG2A 4IHWA 3AL0B 4XNFA 2LF7A 3M1CA 3J7AO 2LYCA 1I50J 2ELHA 1S5LC 2BXZA 4CSWA 1WI9A 3ZQQA 1D3YA 3OYMA 2DMTA 2MA3A 3VYRB 2ZXWH 3BROA 4WXCA 1Z67A 2F6CA 5D4SA 2UZKA 4XR6A 3EQLF 2GXBA 3FMQA 4PSXA 2VQGA 5ICCA 2IS2A 3CCJI 5D4RA 3MEXA 3DTEA 4JYKA 1XD7A 2QQ8A 1JKPC 5FKKA 5LLQA 1QHGA 4LG0B 1W4MA 1LB2A 2H6CA 1K4TA 4AYBA 3MCZA 2P81A 4L9JA 1YIOA 2ELJA 5CVRA 5HLTA 2ZNZA 2FX0A 5FRMA 4A6DA 4CICA 1B1BA 2OCEA 2KFDA 3SYTA 5BQTA 3FKJA 5JR3A 3CF5F 3NQOA 2W4SA 2FEZA 2R7RA 2DU9A 2NOJB 2PFBA 4CA0A 2EILH 2QEXI 4GGGA 3E5XA 3EYIA 2QWWA 1WZ2A 3WHCA 2EWNA 2LY1A 3WE2A 3O2PE 1HBXG 2Q0OA 3KP3A 2M30A 4PGHA 4LLNA 2DA1A 4QPOA 3HTUA 5GTIC 5H6RA 3CESA 2DT7B 1CGPA 2FBIA 1JKRC 4U0WA 4CYDA 1OR7C 2CUZA 4C30A 1Y0NA 3PUBA 3G3ZA 2R7TA 3I9V2 4LLGF 2W84A 3T0YA 3I55I 3G2BA 4IJAA 1D5VA 2D1VA 5E18F 2VBXA 2ZFWA 5LHHA 2KKOA 2VUMJ 1A04A 2IRFG 1UZCA 2GZWA 4L5JA 4XIDA 4CGZA 5DCFA 1J09A 4GFBA 6PAXA 1TW3A 2K02A 2A5WA 3HBLA 3Q5FA 1VQ4I 2VJ5A 2X4HA 4NC6A 5J8FA 1X1CA 1N25A 3O8GA 2FQ3A 1NH3A 3F8CA 2JN6A 5F0HA 4DBRA 4Y52J 2P6TA 4XLFA 2VE8A 2O3FA 3UKGA 2R7XA 1W7PA 1TQPA 2WV0A 2EPFA 1MNEA 3QPLA 5BS6A 1OQYA 3FXQA 1TNSA 4U7BA 3OL3A 2ETHA 1OLTA 3QPTA 3F6VA 3HRUA 2OPTA 5BOXA 2IGMA 3HIFA 4AIKA 3WTYC 2E7XA 3IV5A 3BR3A 2PX9A 3L09A 4IHVA 3MKLA 1MBHA 1UELB 2JMWA 1ZLKA 3IAM2 3DKXA 3FK6A 1P92A 3LAJA 1LDKB 1AWCA 2VKHA 4XSXF 1TTYA 1X3UA 5D6EA 3BZCA 3M7GA 1AA7A 2QENA 3S32A 4B48A 1V5GA 2L01A 1PUEE 5IT9Z 3Q9SA 2N8GA 1ORKA 3RTRA 4UUTA 1T56A 4IKFA 3CP2A 4ZZLA 3M3YJ 5F08A 3PFYA 3LMMA 4E7KA 4R1HA 3OIPA 4C9YA 4F7ZA 2Y0SN 1XGOA 2CSOA 5E1WA 3DU5A 3QOEA 4XLEA 5BNGA 4XLNF 1LFPA 1BIAA 4ITVA 2FF4A 2WBMA 1CQTA 2M1BA 1GUUA 2UV1A 2A61A 2K9NA 5CQEA 1T95A 1KQ0A 5F6FA 5B66C 2XGEA 2EK5A 2FNPA 3A02A 2EIJH 3BQZA 1BI0A 4Y3OA 1MJ9A 5D6FA 3WTZA 4GO1A 4MQVA 3HGYA 3TMOA 4G12A 4KNYA 2LNBA 1IUFA 3KZIC 2NNYA 2X6WA 3CC2I 4P9UA 4A3KJ 1RKWA 3RQIA 1E0EA 1VQMI 4IHYA 2XASA 3ISPA 1SD7A 5F0FA 3CCYA 1V5FA 3OYAA 1ONVA 3WGHA 2L2OA 2RVCA 2XROA 1I1SA 4BEHB 3E6CC 1FEXA 3PSFA 3HDDA 4HX4A 2AXLA 2EBIA 3TW6A 3GZ5A 1ERDA 1MJBA 2OD5A 2HXIA 4FQGA 3CMAI 3CO7C 2W25A 2EINH 1ZN2A 3WGIA 3PM1A 1IUYA 5LEJA 2VC1A 4EM0B 3RIRA 5IP7J 1U6GA 2L7ZA 1LUJB 2ESHA 4HEA2 4I98B 3JRHA 1FBUA 1N77A 4BQAA 1VZ0A 2TRTA 1J75A 5HDGA 2WC2A 1TQMA 3JRIA 3N97A 1P4WA 3K4LA 3CDIA 1ULYA 2X1DA 5DV5A 1RIOH 3VSLA 3OYDA 1U9OA 2A69F 1HOMA 2DMNA 4CUGA 1UMQA 3RZDJ 2OC6A 2CH0A 1VQ8I 1ZH5A 2QF7A 5CVUA 1Z7LA 4IEJA 2OQGA 4UUSA 2G0EA 5L3FA 2FSWA 2OUMA 4J19A 1ZG3A 4Y17A 1KU7A 3W6VA 3LSTA 2MD5A 4B1RA 1RC9A 2E5NA 2PMHA 3GLLA 4M73A 4Y13A 3C2GA 2ICWG 2GIVA 2MH2A 2B9SA 3IKVA 1OCOH 3WG7H 4AU7A 2F4OB 3LL7A 3VEPA 2LKXA 4RLFA 2QBYA 2PLYA 2XRLA 4G6QA 2B63J 5E8IA 3EETA 2FE3A 3OYFA 2WTEA 2MC4A 3NWTA 2HOTA 2JA2A 2CW0F 4I6ZA 2E1CA 1W36C 1KGSA 3KP5A 5M5XJ 4CCNA 3VYUB 4FTHA 4M3DA 5GAHJ 2K9SA 4IQJA 3B02A 1GT0C 3ZP5A 1OCTC 1YYVA 4OOIA 1WQ2A 5DCMB 3ZQIA 3EUAA 3L9FA 3JCUC 4M3EA 2DCEA 3MVPA 2L3DA 1YRNB 2NNNA 1G59A 3V7RA 4YIRX 2KIMA 1OFCX 3W6KB 4HDUA 2DDBA 2HVQA 1Y1WJ 5J4VA 3GTOJ 4PCQA 2RREA 3RSNA 5E1ZB 1NK2P 3W2WA 4JQFA 3WU0A 1OYYA 2BYVE 4MTEA 4JK1X 4ASNA 1XX5A 5AIQA 3ASOH 2YX4A 4J01A 2HFHA 2DOFA 5TISC 2MLKA 4OU0A 4DOZA 5DM7F 1JT6A 2JRMA 1MMDA 2O7OA 4QIWN 3K1MA 1N78A 3BZKA 4W97A 3E5UA 2O61A 4YELA 4KISA 1IF1A 3QQAA 2UXNA 1P4AA 1PUFB 1DPUA 4YIFA 1MKMA 3J81Z 4E7LA 2BZTA 4N0BA 2GAUA 1VQ5I 1D8JA 1BI3A 1USTA 3BG5A 2DA4A 4KN7X 4RAYA 1WJCA 1VQ6I 1EV7A 2NAZA 3D5LA 4BKXA 3LSMA 5GTHC 4XN3A 4HNVA 2XSDC 2R92J 1RNLA 2R7DA 1I5ZA 1Z3YA 2NYXA 2VKEA 1BA5A 4G7HF 1R1VA 1KU9A 2HOSA 1HKTA 3GLXA 1UHSA 1WKMA 1C0WA 3M4OJ 3BR2A 1HW2A 2X1EA 3J80Z 4I0AA 1LFUP 3QP6A 3NRVA 5ED4A 5DD8A 4BNCA 5EEGA 1GXQA 2OCCH 1OR7A 4LJZF 2WY8Q 2A07F 3D0SA 2H09A 4BGDA 4A3EJ 2CQ7A 3RZOJ 2QGUA 2NVQJ 4HNTA 2L02A 4ZYGA 4GRIA 1XMAA 1DUXC 1RESA 3OL4A 4L9NA 3R61A 1OCPA 4L5EA 3FBNB 3WTWC 4RGUA 1A6IA 3DQVC 4B09A 5F0CA 1UCRA 2DW4A 4I7HA 4FE7A 1Z21A 1ACIA 2KL4A 2A05A 4L5IA 3HTSB 3MN2A 2A6HF 2LG4A 1YW9A 1UAAA 1I39A 2DK8A 2DTZA 2VXDA 3BWGA 1U8BA 3S15J 3AG2H 2DMUA 2E2IJ 1T38A 1CF7B 2DLLA 3ML6A 2V9KA 4ZDLA 3LFUA 3FXOA 3OY9A 4S04A 2IA0A 4AYBN 4L9TA 2IGKA 2UUZA 5HLIA 3BG7A 3R60A 3V7SA 2EIMH 3S3MA 3S2HJ 3GTQJ 5IT9K 3K4KA 2K4JA 1SANA 1IRXA 2NXNB 3GTMJ 3F8NA 2XV4S 2QLZA 3KZZA 3BG9A 3K4JA 3KP6A 2R5ZB 1JUMA 4O3MA 1HW1A 3DWLE 4HOBA 4KN4X 3HEFA 1OCZH 4M6YA 2O9LA 4UY8I 1F4KA 3CJTB 2O8XA 2CO5A 5B1BH 1X4PA 3L2QA 3IWFA 3QYBA 3CUQB 1IAWA 1IRGA 3RI4A 4DGWB 4N4OB 1QZZA 3ZMTA 4CCLA 3GBGA 3HGGA 1JHFA 2E35A 1Z3XA 2O03A 4M9SA 2E7WA 2IBDA 5B5EC 5KHDA 3FKIJ 5EG0A 4M74A 3Q0WA 3OYLA 2P7CB 3SEQA 3LNQA 2STTA 1EH8A 3NAUA 5TRDA 2HWVA 1Q1HA 1J0RA 1ETVA 3BR6A 3A0HC 3VDXA 1W5CC 3F8FA 1Z6RA 5EZGA 4AIHA 2R93J 1J2XA 1EA3A 2LKSA 3ECHA 3A01A 3TL4X 1SFKA 4YFNF 4JOMA 2NVYJ 1A6QA 1XGMA 3FXMA 4LB5A 4PSWA 1U5TA 4HA8A 4IPAA 4ENMA 4KICA 3TBIA 3L2VA 3BTCA 4BQOA 2FXAA 2HXOA 3N05A 2Y0MA 3CUQC 2EV0A 3BP8A 3PUFA 1VFCA 1FSHA 2VQHA 3BPXA 4B47A 2IS4A 3FXKA 3OOPA 2JA5J 4HYEA 4D5FA 2ME0A 3HOYJ 3ZOBA 3SFZA 4BJ6C 1XMXA 2ZMEC 2AQEA 2IGOA 2M7BA 2VKDA 1S9HA 3VSKA 5F1JA 2QCOA 2OQRA 1TW2A 1HXDA 1IN6A 4A3IJ 2CRGA 1WGXA 2PEXA 2PJRB 3FISA 5KCMA 4LK1F 3SFIA 2QA4I 2VQLA 3W3CA 2A6EF 4XOPA 4CH7A 1YQAA 3KX2A 4BEHA 3ABMH 1RKTA 4A3LJ 3N4MA 2CG4A 4U7DA 1JHHA 2BV6A 3HZJA 1BR4A 4PJ0C 3B73A 3RPQA 1B9MA 2QKMB 2ELKA 2DN0A 2ZB9A 1HQCA 2XPVA 5KAFC 1QPMA 5DEQA 4ZC3A 3GX4X 1SVLA 1W7PB 3H36A 3MZ8A 3DKYA 3S16J 2CS3A 3A01B 5ICEA 1EF4A 4TV7A 1B72B 1D8KA 1D1AA 2CQXA 1WVRA 5HDKA 1R00A 2Z5UA 1F5TA 2L0KA 4XK4A 1R23A 4HRIA 3KIOA 2FBHA 1NG7A 2M9HA 3HG9A 3K4BA 4ABZA 4XLCA 4UNOA 2YS9A 2HEOA 2HYJA 2W82A 4LIUA 4YFXF 3SQNA 1HDPA 3V4GA 2D45A 2VB6A 3DU6A 2K5CA 3KYCB 1U0JA 2K7LA 2L54A 5GP9A 2B0LA 4EATA 2ZJPF 4XORA 2R7FA 1XGSA 1SAXA 5J6XA 1R9TJ 5EDNA 1KYZA 1NTCA 5HLHA 1DDNA 2CFXA 3C2BA 3U2RA 3L2WA 2KHMA 3SZPA 1SC7A 3RQ4A 1ZKGA 4KT5C 3GO5A 3DBLB 1U3EM 3GW2A 2ME6A 4Q4ZF 2PQ8A 3JSPA 3M9AA 2LBFB 5EYRA 2M5WA 4CCMA 1T6SA 2HVRA 5FGMA 4EMSA 2F5CA 3CUOA 5J1YA 3GTJJ 5FKMA 3GZ6A 3AG1H 5CYVA 1GXPA 1VQ7I 1VQNI 1I1GA 1KU3A 2KIQA 3R6SA 2D1HA 3CCUI 1U9NA 1OKRA 4K2EA 4LG0A 2V1UA 2KJCA 3ZQFA 2PN6A 1IDZA 1O7FA 2QSFX 3K2ZA 1LE8B 4U87A 1D5YA 3T8RA 4BY1J 2QQ9A 3J7ZI 1R58A 1W1WE 4EEFG 3JAMZ 2MG4A 3CLOA 1V4RA 5CKTA 2FOWA 4LD5A 2Y69H 3CTAA 4FETA 1ETYA 2ZSHB 2K40A 3I58A 3Q0UA 4NUBA 3F8MA 1H88C 4AM3A 2EZHA 2WB1N 4IXAA 2I10A 2V6CA 4XRMA 2IAIA 2XKOA 3FXUA 4ZTJA 2BGCA 2VBYA 4NHJA 4YG2F 1JGGA 1MBGA 2PMZN 4P55A 1WI3A 3MAJA 4E6KG 1ZG1A 1D0XA 1MDMA 1I27A 2CUJA 2EZLA 1FTTA 1J5YA 3EUHC 1SD4A 3X2QH 3CZ6A 2H27A 2K3FA 2A6TA 4QPQA 4BXUA 3ABLH 4N9IA 1R5HA 1FBSA 1I3AA 1IN4A 5C4JJ 2NVXJ 3C2HA 3H1CA 1G3SA 4RA2A 1A31A 1STZA 3DEWA 2LOOA 2RKHA 3E6BA 4I76A 2ZJ2A 2XHKA 3BT9A 1MJAA 2GWRA 2IP2A 2KRCA 4MGRA 4KT6A 5H20A 3MKWB 2JPCA 2GIZA 1F43A 1NHAA 2I5UA 4KFCA 1A5JA 5IYBJ 3OR2C 3KP2A 4IQ4A 3RKQA 1UJ8A 4QWQA 3IAS2 3HXLA 4EM2A 4CYCA 2EZKA 3K4MA 3AG3H 2WADA 4PJJA 3I59A 3ZPLA 4R79A 2Y9YA 1FZPB 1IG7A 2WAQN 5F64A 5CPRB 5M5YJ 3P9KA 2K27A 1BJAA 1BJZA 4NC7A 1ZREA 3M8JA 4OIOF 3ROUA 1ETXA 3HRMA 2ZJRF 5FLVA 3LSGA 1DU0A 2TCTA 3JW4A 3E5QA 1I6HJ 4ZDPA 4KA4A 3V42A 3KYDB 1YJWI 4DQ2A 3BTIA 3HSEA 1XGNA 3TW7A 3PNVA 2ESNA 2Y31A 1TWHJ 4HPQA 3V8JA 3FWEA 2XAUA 1DP3A 2P6SA 2K9LA 3RKYA 3I64A 4HX8A 3H9JA 2VJJA 3ZQ7A 4G94A 5F04A 2HDWA 1BIBA 3IHUA 5AIPA 1Z6TA 3DPTA 3LA3A 2QSHX 1WJBA 1V54H 3QRFF 4V2FA 4KMUX 4PZJA 2RDPA 5JFRA 3DEUA 2H8WA 2LBFA 3U21A 2JVHA 4Y33A 1MD0A 4ZYAA 2Z1DA 2X6YA 3L00A 3RPUD 3H3ZA 1JTYA 1UFMA 3VOEA 3JRAA 2MFZA 1T08B 3ZMVA 1LPQA 4DBQA 5FKNA 2ECBA 3GFMA 2ZXJA 2R7VA 3BOQA 3DF8A 3I0TA 3RPUA 3BZ6A 4XL9A 3O3KA 3SZTA 4KUMA 2HQ5A 1YIJI 2EQRA 5DUKA 2Z9OA 1O3TA 1FY7A 1KZHA 5IYCJ
chains in the Genus database with same CATH topology
4XM3A 4XKCA 4LIVA 2DCEA 4BE1A 1G59A 2XC7A 2E60A 2CMPA 2CV1A 3LSIA 3OYEA 5HNHA 4IZZA 2HVQA 4YEJA 3LSHA 4YRVA 2WAEA 3ZCOA 3OIQA 2RREA 2WAQA 3RSNA 3F9KA 3W2WA 4D9JA 4JQFA 4MLOA 4C2UA 1KONA 3OYNA 2MABA 2CFOA 4J01A 4F3QA 4F91B 4DOZA 4B3XA 2Y0SA 1MMDA 2CV2A 2XF7A 4X0GA 1N78A 3S3OA 1UG0A 4ZTFA 1BOBA 4YELA 4KISA 2HPMA 1FMVA 3ONQA 4OAYA 4DJAA 4E7LA 2HPIA 3UNGC 2W1OA 4BQNA 3IP4B 4XONA 1SAUA 3DTKA 2IGNA 1WJCA 3D5LA 1GLNA 4CCKA 3PJRA 2WAFA 3LSMA 4XN3A 3K4NA 1Z3YA 2JUGA 4Y4RA 2KRHA 3BG6A 4BDYA 3PNTA 3OS2A 3OMYA 3H5NA 3UR3C 2W00A 3DPLC 2X1EA 4ZDOA 4PFPA 2M3AA 1X4OA 3DLAA 2Q2EB 4PJMA 2V26A 4HSTA 4PK4A 4BDZA 2WY8Q 1FMWA 1N75A 3OOUA 4BGDA 2HVSA 2F4IA 2UWMA 3VWBA 2VXZA 2ZFUA 3HUGB 4RMNA 4HNTA 3HOSA 1WFXA 4GRIA 3OYCA 3OL4A 4PJNA 3FBNB 4E7SA 3S3NA 2F5VA 4B43A 1DQUA 3DQVC 2DOAA 5TGTA 2VQCA 4J00A 2X1CA 4BE2A 1Z21A 4XLAA 2KL4A 3ZXSA 2LC2A 4PJLA 4PFOA 2LG4A 1UAAA 2X85A 4BQQA 4XMYA 2VXDA 3HPGA 1DGRM 3E1SA 2L9NA 4E7ZA 2R4GA 2R7OA 3CJRB 1R6RA 2V9KA 1WJDA 2CV0A 4ZDLA 3LFUA 4N4NB 3OY9A 3DTIA 2BVLA 2IGKA 1PYVA 2UUZA 2XSJC 4XOTA 4HNUA 5HNFA 3BG7A 3OYGA 1D1BA 3S3MA 2VLAA 1HA8A 1D1CA 2V4JC 3K4KA 1IRXA 3S8PA 2CW7A 3QYEA 4AVZA 4RM2A 4XN0A 3K4JA 2BW3A 4NC8A 2KDOA 3KEYA 3DWLE 2XF6A 3SEZA 2IS1A 3H5AA 3A1YA 5JHFA 4CZCA 4KITB 1X4PA 3L2QA 3QYBA 3A2KA 4KJZA 3H5RA 1W36D 3H35A 4DGWB 3AKZA 4IX7A 4N4OB 1MW7A 3H9GA 3OYKA 4CCLA 3GBGA 2VPLA 1WJ5A 1Z3XA 3RCOA 4HSRA 4BE0A 5KHDA 1PJRA 1WJEA 2KP6A 2ZSIB 3CP8A 4BUPA 3OWTA 4BXFA 2DJIA 3OYLA 3K4CA 3QODA 2I8DA 3SEQA 3PL8A 3LSKA 4P1WA 2M7AA 1Y6IA 2QKLB 3VDXA 3K70D 2V6EA 5FROA 4LG3A 5HVQC 3HKZA 1EA3A 3TL4X 3OYIA 5CQGA 1SFKA 2V1NA 4JOMA 4CCOA 4ANJA 4XKWA 4PSWA 3AFHA 2M0MA 2HZDA 2OV7A 3TBIA 3FDYA 5HOOA 3OS1A 3L2RA 3L2VA 2R7SA 4DIQA 4BQOA 2LH9A 3N05A 3W2VA 2KQRA 1K6YA 2LRDA 2VQHA 2R7WA 4E7HA 4B47A 2IS4A 2X6XA 2L9SA 4XLHA 2IS6A 1G8XA 4B44A 4HG2A 4BJ6C 3AL0B 1X1BA 2AQEA 2IGOA 2M7BA 2VKDA 3D5SC 3A4CA 4OWRB 3IUOA 3M1CA 4XNFA 1S9HA 4XKBA 2LYCA 3VSKA 3HOTA 3CF2A 4NNJA 4CSWA 2XF5A 2HU9A 3ZQQA 2PJRB 3OYMA 4XKVA 3VYRB 5KCMA 2F6CA 2VQLA 3W3CA 4XR6A 4XOPA 4CH7A 3KX2A 4BEHA 3DPUA 4PSXA 2VQGA 2IS2A 3DTEA 2MD0A 1BR4A 3K10A 2QKMB 4E4HA 2KPMA 1QHGA 4ZC3A 2WY7Q 3PSIA 3DKYA 1BR1A 4AYBA 3SZGA 2CS3A 3ZRGA 2ELJA 5HLTA 2JSPA 5FRMA 1D1AA 1TZLA 2V7FA 3SYTA 3FKJA 2W4SA 2P0WA 4G6TB 2R7RA 4E7IA 2Q1ZB 3ZGKA 2NOJB 4P5OA 4CA0A 4HRIA 3AL0C 1NG7A 3HG9A 3K4BA 1P9QC 4XLCA 5LFAA 2LY1A 2W82A 4LIUA 3MKZA 3OYJA 4QPOA 2VB6A 3DU6A 2K5CA 3CESA 4H4KC 2DT7B 1MMAA 1U0JA 1OR7C 2CUZA 2L7KA 4C30A 3PUBA 2R7TA 3I9V2 4EATA 3G2BA 3K6GA 4XORA 2ZXHA 2E1MC 4PUSA 3MD2A 4BU2A 1J09A 3VYTB 3L2WA 2A5WA 2KHMA 3RQ4A 4BS9A 2VJ5A 2ZXIA 1X1CA 2LBFB 4DBRA 2CW8A 1MMGA 4CCMA 4XLFA 2LREA 2HVRA 4RLQA 2R7XA 4BJTA 1MNEA 2GOXB 4NQWB 1YX5A 2E5ZA 3OL3A 4U7BA 1OLTA 3MKYB 4BL0B 2BW3B 2PJRA 1QU3A 2IGMA 3HL2A 3BC8A 2IXSA 3E0JB 3L2UA 1UELB 2HQAA 3IAM2 5FRNA 3DKXA 4U87A 2BOLA 1LDKB 1LKXA 2VKHA 3MMYB 3W2AA 1BR2A 1AA7A 2VASA 3S32A 4B48A 1V5GA 2E1MB 3NWSA 5CKTA 1QHHD 4FETA 2ZSHB 4NUBA 3RTRA 4IKFA 1MMNA 3BCAA 2R7UA 3CP2A 3OR1C 4FASD 4II3A 2R7QA 3PFYA 4ZTJA 3LMMA 4E7KA 3OIPA 4C9YA 4E6KG 4C2TA 3HPHA 4F55A 1D0XA 3DU5A 3QOEA 4XLEA 2CUJA 3VYSB 1LFPA 3EUHC 4ITVA 2WBMA 3BLYA 1MNDA 3CZ6A 1JI8A 2UV1A 3FHNA 2W7NA 5CQEA 1T95A 2A6TA 2VJIA 4QPQA 3SDBA 4BJ5C 2PMZA 3OYHA 1ZELA 1T0FC 3C2HA 4Y3OA 1TT0A 2WB1A 3TMOA 3ZR8X 2LOOA 2X6WA 2RNGA 4ZJZA 2HNHA 1D0ZA 2KRCA 3EUKL 1E0EA 4KT6A 2XDVA 3MKWB 1V5FA 2JVGA 3OYAA 4D1QA 2L2OA 1YX3A 3OR2C 4OAZA 4IQ4A 4BEHB 3H9QA 1LVKA 4II2A 2DXIA 1WJFA 3PSFA 3IAS2 1YE9A 3HC7A 3HXLA 5KNLA 1ERDA 1X1AA 3K70C 5LD2C 3K4MA 2WADA 4PJJA 2GOMA 4R79A 2BVMA 1DGWY 2M4KA 5CPRB 2M4GA 3BCBA 4NC7A 3M8JA 2RQQA 3J7AY 3PNYA 4HEA2 4RM3A 1N77A 3LSGA 2X51A 3OYBA 1VZ0A 4BACA 4ZDPA 3V42A 2KZVA 3EPZA 3K4LA 2KMUA 2X1DA 4F92B 4E7JA 3S93A 3VSLA 3PNVA 3D5RC 3OYDA 2VIXA 3CMMA 4CCJA 4CUGA 3FBIB 1WJAA 2OC6A 2CH0A 2O5RA 2FUG2 3QYFA 4HPQA 2XAUA 1DP3A 2K9LA 2VJ4A 1Z7LA 3H9JA 2VJJA 4F93B 2KLOA 2OUMA 2HDWA 3OS0A 3DPTA 2AQFA 1X19A 2L5QA 1WJBA 2LY2A 2LBFA 3CJQB 2DT6A 2E5NA 3U21A 2JVHA 4Y33A 3C2GA 2VL8A 4XQFA 4ZYAA 2Z1DA 4AU7A 2X6YA 3KYLA 1V5EA 1X1DA 1NG6A 2Z16A 3RPUD 3LL7A 2MYSA 4RLFA 2MFZA 2Z2SB 3OYFA 1Y56A 2MC4A 3NWTA 4DBQA 2JA2A 4LITA 4F52A 2R7VA 1W36C 1D0YA 3I3LA 3VYUB 4CCNA 2K3PA 4XL9A 4IQJA 2K9MA 2WA0A 3DEEA 3H0DA 3EUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1Q A;  2BW3 B;  2BW3 A; 
#chains in the Genus database with same CATH topology
 4XM3 A;  1IV8 A;  4XLP F;  2LSO A;  4A6E A;  2OTJ I;  3HOV J;  3E97 A;  4BE1 A;  2XGD A;  4WF2 A;  3LSI A;  5C44 J;  1SFU A;  5FKO A;  5HNH A;  3WTV C;  2JPB A;  1VF9 A;  5E17 F;  3LSH A;  4JBA A;  4UVB A;  1LJ9 A;  3WU2 C;  3ZCO A;  1FX7 A;  1XC5 A;  3OIQ A;  5DUI A;  1HF0 A;  4UXN A;  1R4N B;  3WTX C;  5JVT A;  3FM5 A;  3OYN A;  3E6D A;  4A3C J;  3TED A;  3CD6 I;  2M87 A;  5K7F A;  2CV2 A;  4X0G A;  2L9R A;  2F4M B;  5LRR A;  1ODD A;  2UXX A;  1IRF A;  3E7L A;  1FNN A;  2HPM A;  1FMV A;  2RAE A;  3DKW A;  5J4Y A;  2HOE A;  2JSC A;  1YG2 A;  1R4M B;  4LB6 B;  1BC8 C;  1AHD P;  2A5Y B;  2KRF A;  4XBF A;  2HPI A;  4M3B A;  1H9T A;  2E2H J;  3DFG A;  2FOK A;  1F36 A;  3IP4 B;  1PVE A;  1YLF A;  1SAU A;  3HKZ N;  2DA6 A;  3TDU C;  1MBK A;  5M5W J;  2IGN A;  2GA1 A;  4IRG A;  3RYR A;  3ZMU A;  3QU3 A;  2QQA A;  2QUF A;  4IVN A;  1K61 A;  1R36 A;  2JUG A;  5JI6 A;  1S7O A;  4Y4R A;  4ESJ A;  3IWZ A;  4A5M A;  4BDY A;  1SFX A;  2EZI A;  1ZGJ A;  3H5N A;  3OMY A;  2J5P A;  1XSV A;  2W00 A;  1FOX A;  4G8X A;  1BBY A;  1ZR2 A;  1TP4 A;  2O8K A;  2JA8 J;  3JTH A;  2YX7 A;  4UUS B;  4HF2 A;  3OOU A;  4HBL A;  2V1X A;  4M9Z A;  2HVS A;  1RUO A;  1WHU A;  2UWM A;  3VWB A;  3BY6 A;  1XSX A;  2VXZ A;  4Z2Y A;  3VB2 A;  3E6M A;  1ETO A;  3TP3 A;  4LOC A;  3HYI A;  3V8L A;  3JSO A;  2XVC A;  2G9W A;  2ZC2 A;  2L4M A;  4E7S A;  2F5V A;  2IEK A;  3M1E A;  1ZR4 A;  3IRQ A;  2STW A;  2X1C A;  1P7I A;  2EA2 A;  2Y30 A;  5FLX K;  5GAG J;  4A0Y A;  2DFF A;  3BPV A;  3HPG A;  3SHF A;  1DGR M;  3E1S A;  3REO A;  2L9N A;  2R4G A;  1VTN C;  4EJT A;  3C1D A;  3DBH B;  4OIQ F;  1R6R A;  2CV0 A;  1WJD A;  4WX9 A;  1YW7 A;  2QBY B;  1V3F A;  4MO7 A;  5ICF A;  3DTI A;  1L0O C;  2XSJ C;  5FB2 A;  3G4S I;  4RDU A;  1K4S A;  5IPA A;  3GTG J;  2EFQ A;  3KP7 A;  3GTL J;  1VQO I;  1YO5 C;  1D1B A;  2VLA A;  1JUP A;  2BY0 A;  4KIF A;  2JJ7 A;  3S8P A;  4RM2 A;  2Y48 A;  4GXO A;  2EFW A;  2IJL A;  1NK3 P;  1FPQ A;  2X0L A;  3LOC A;  1X2M A;  4NC8 A;  1MH3 A;  1RI7 A;  3QWL A;  2DA3 A;  1PUF A;  2CQN A;  5JVG F;  3A1Y A;  3WG9 A;  5JHF A;  5FO5 A;  4DZJ A;  4CZC A;  3A2K A;  1SD5 A;  3PQJ A;  1QZE A;  3H5R A;  1VQP I;  3H35 A;  3TQN A;  3AKZ A;  1MW7 A;  2LMD A;  3GFJ A;  4P96 A;  2DYS H;  2VPL A;  3TOA A;  1APL C;  4HSR A;  2J5O A;  4QLC U;  1L3L A;  1WJE A;  1JJ8 C;  4BUP A;  4Z6Y A;  1OPC A;  1RET A;  3OWT A;  3CCL I;  4A5N A;  4CDG A;  3K4C A;  4YFK F;  4EJV A;  1U5T C;  3IH4 A;  1Z91 A;  3U1D A;  2DFE A;  5GAE J;  3LSK A;  1U8R A;  3SJM A;  2CUF A;  1G3Y A;  2V6E A;  5DYM A;  1M1E B;  1XCB A;  1BI1 A;  2XPW A;  4LG3 A;  5HVQ C;  4L0Y B;  1P2F A;  1UG2 A;  1JXS A;  2TDX A;  1B59 A;  5CQG A;  2DI3 A;  2DJN A;  2V1N A;  4CCO A;  1XDU A;  4X6A J;  3O8H A;  1BW5 A;  5HS8 A;  1QVU A;  3CDL A;  5IP6 A;  3FDY A;  3BTJ A;  3L2R A;  1VQK I;  3BJA A;  4ENK A;  4EQQ A;  1WCM J;  4NDL A;  2LH9 A;  3LSJ A;  5TJJ A;  3WTT C;  2LRD A;  3CCS I;  2COB A;  2MW8 A;  2L9S A;  2IS6 A;  1FOY A;  1I6X A;  4HX7 A;  1G8X A;  4PGG A;  1X1B A;  1R71 A;  2LFB A;  4D7N A;  4OWR B;  3A4C A;  4GYI A;  3IUO A;  1WSU A;  4XKB A;  3HOT A;  3CF2 A;  4NNJ A;  1SMY F;  2VBW A;  4I2O A;  2XF5 A;  2R3S A;  2HU9 A;  4XKV A;  1FP1 D;  1R1T A;  3LAP A;  3ZQH A;  1WPK A;  1S72 I;  2RQP A;  3L1P A;  2CU7 A;  3DPU A;  2CGP A;  2DOE A;  2FNA A;  5K5O A;  4M72 A;  1Z1D A;  4A3M J;  3BR1 A;  3I71 A;  3K10 A;  1GHC A;  1XDS A;  1XMK A;  4IRI A;  2JA7 J;  2VON A;  1YI2 I;  2X9D A;  2ZJQ F;  2WY7 Q;  1TWG J;  2H6B A;  2ZO4 A;  3IH2 A;  2PI0 A;  1QBJ A;  3CO6 C;  2RGV A;  4GDF A;  1BW6 A;  2DFI A;  1TZL A;  2HS5 A;  2V7F A;  5EEH A;  4A3F J;  5LHI A;  4G6T B;  4E7I A;  4KDP A;  2Q1Z B;  3ZGK A;  3TO6 A;  1FJL A;  4A69 C;  3G1M A;  4BAY A;  1P9Q C;  5GPA A;  3CUQ A;  5LFA A;  2JT1 A;  1JGS A;  2DA7 A;  2EB7 A;  2OAZ A;  3DCF A;  1Z9C A;  1AKH A;  3ZN1 A;  3MKZ A;  3OYJ A;  3DV8 A;  4H4K C;  2L7K A;  2XAH A;  4CO8 A;  2R5Z A;  4IOA F;  2HOA A;  3K6G A;  3QPH A;  4DYQ A;  1GDT A;  5D5X B;  2E1M C;  4PUS A;  2P5L C;  3MD2 A;  4BU2 A;  2Y75 A;  1YW8 A;  1UHW A;  1S8N A;  1R7J A;  3VYT B;  1MH4 A;  5D8K B;  4HDV A;  5IP9 J;  2ZXI A;  3E3V A;  3I4N J;  3FM3 A;  3U1K A;  4OIP F;  3ABU A;  2EIK H;  1YOV B;  2BHZ A;  1MSF C;  2KIU A;  1F9N A;  2Y2Z A;  4UHT A;  1T0F A;  5C4X J;  2P4W A;  3TKY A;  4BJT A;  1SEU A;  3ZMS A;  1KU2 A;  1VI0 A;  2GOX B;  1YX5 A;  2EFP A;  2DT5 A;  2E5Z A;  2DPD A;  3MKY B;  4BL0 B;  2BW3 B;  2PJR A;  2JZY A;  5LRS A;  3S1M J;  3HL2 A;  5CLS A;  1RRJ A;  2ISZ A;  1W7P D;  1Z05 A;  1BL0 A;  2IXS A;  1Y39 A;  3F3X A;  4KMF A;  2HQR A;  1TWA J;  1H89 C;  4A2U A;  1ETK A;  5FRN A;  3CCR I;  1LKX A;  1SVO A;  3W2A A;  3S17 J;  1YS7 A;  5FKL A;  1BR2 A;  3BJO A;  2AO9 A;  3WU1 B;  2VAS A;  5E3O A;  1MMS A;  2E1M B;  3BTL A;  3TGN A;  3NWS A;  3GFL A;  5DDG A;  5DS9 A;  1OYW A;  2R7U A;  3OR1 C;  4D0P A;  4II3 A;  2R7Q A;  4ZYE A;  1T2K A;  2M2E A;  4IO9 F;  1W0U A;  5F27 A;  4C2T A;  3NAR A;  4CHU A;  4F55 A;  1ZRD A;  2LP0 A;  1USS A;  2KT0 A;  3VYS B;  2PMU A;  4MEY F;  5FLM J;  4BBR J;  1KYW A;  1HC8 A;  1MND A;  4EVI A;  3FHN A;  2HYF A;  2PBI A;  2W7N A;  1IZ1 A;  1Y8R B;  2ZNY A;  1IRZ A;  1MZB A;  4BJ5 C;  2MH9 A;  1ZRF A;  2MSY A;  3ZQC A;  3BDD A;  3OYH A;  1H0M A;  5IOY A;  1YJN I;  1TT0 A;  2COM A;  2LR8 A;  5A2Q K;  4IHX A;  2VT3 A;  5FLX Z;  3T1B A;  3V7C A;  4EJU A;  4L9V A;  4X1E A;  1R22 A;  2XKP A;  1O4X A;  2VPR A;  4ON0 A;  2HNH A;  4ZJZ A;  5EEA A;  3F22 A;  3FMR A;  2XDV A;  3EYY A;  2JWT A;  2YPR A;  2LK2 A;  4Q48 A;  2JVG A;  4D1Q A;  1E2X A;  4JX5 A;  1B72 A;  4YII A;  3WTU C;  2QVO A;  4Y15 A;  3ECO A;  1ENH A;  3Q9V A;  4LMY A;  4M71 A;  4AVP A;  3HC7 A;  1QPI A;  4RB2 C;  3JRD A;  1X1A A;  3VPR A;  1XS9 A;  1Y0U A;  1UHM A;  2GA2 A;  5LD2 C;  1DP7 P;  4MFD A;  2GOM A;  1JT0 A;  5FJ8 J;  1IW7 F;  4HV6 A;  3BCB A;  2HZT A;  2CQQ A;  2RQQ A;  5K5R A;  3PNY A;  1VQ9 I;  4RM3 A;  5BMZ A;  2X51 A;  3F0C A;  3OYB A;  2VOP A;  4Y7N J;  2F5F A;  3J81 K;  3CMY A;  2Q2E A;  2LD5 A;  2KZV A;  3EPZ A;  4AIJ A;  3EUH A;  2DQL A;  4RAG A;  1TWF J;  3PQK A;  3KET A;  3D5R C;  2NS0 A;  3CMM A;  4CCJ A;  1IC8 A;  1WJA A;  1F1Z A;  2V1D A;  3I4P A;  2FUG 2;  2HTS A;  5EJC A;  9ANT A;  5HS7 A;  2VOD A;  1K78 B;  1ETW A;  1MGT A;  2ZBK A;  1X19 A;  2L5Q A;  2NOG A;  2LY2 A;  4L18 B;  4S0H B;  2DT6 A;  1GVD A;  3TO7 A;  3ZMD A;  4ENJ A;  2VL8 A;  4XQF A;  1IN7 A;  4BHP A;  3KYL A;  2BHY A;  2ZME B;  2Z16 A;  4EJO A;  2VE9 A;  2R5Y A;  1V55 H;  1S7E A;  2M0C A;  1FTZ A;  5FD5 A;  1AU7 A;  2BE5 F;  1K7A A;  2L9V A;  2Z2S B;  3HSR A;  4B3A A;  1Y56 A;  1O3Q A;  4S05 A;  1XCV A;  3H3V K;  5EG0 B;  4UB8 C;  3I4M J;  3JRB A;  4GCV A;  1D0Y A;  3I3L A;  2F5E A;  2K3P A;  4DZP A;  2CWE A;  1XTA A;  1HLV A;  2NRA C;  1J9I A;  3F6O A;  4OMZ A;  2IVM A;  1FYM A;  3SXY A;  5E3L A;  3K2A A;  3HB9 A;  2WA0 A;  3F21 A;  4MQ9 F;  4XKC A;  5L3C A;  1FC3 A;  2GQQ A;  2EV6 A;  2W24 A;  1MBJ A;  2E60 A;  3BR5 A;  2P5K A;  5KVR A;  3C7J A;  3WHB A;  3FXJ A;  1W5S A;  2D5V A;  1H9G A;  3OYE A;  2WWY A;  2Z33 A;  5ILU A;  4YEJ A;  2WAE A;  2WAQ A;  3F9K A;  1B8I B;  5LGT A;  5J40 A;  2V79 A;  2YSR A;  3FK7 A;  3KPH A;  2W57 A;  2MAB A;  2DBB A;  3CC4 I;  4F91 B;  4U0V A;  2QYO A;  4B3X A;  2Y0S A;  2V9V A;  1ON2 A;  1SMT A;  4B8X A;  4KIB A;  4ZTF A;  1J59 A;  5D8L B;  4E70 A;  1IO2 A;  4FHT A;  2ISY A;  1QZY A;  2DA2 A;  2OF7 A;  1B8I A;  3I59 B;  3KE2 A;  2ZKZ A;  3V8K A;  4AID A;  1Y1V J;  3M8E A;  1SFE A;  2BY2 A;  1XB4 A;  1FIP A;  3BR0 A;  4HF0 A;  3M07 A;  3ONQ A;  4OAY A;  1XN7 A;  3GVA A;  1FT9 A;  2DYR H;  5JLX A;  5HDN A;  2AHQ A;  1IV6 A;  4HF1 A;  1FYK A;  4HV5 A;  4BQN A;  1OYI A;  4BY7 J;  2JA6 J;  3B6A A;  2AS5 F;  2E19 A;  2DFH A;  2M8E A;  4A3D J;  1KQ8 A;  2IA1 A;  3H0G J;  1GLN A;  3I54 A;  1FOK A;  1FIA A;  3PJR A;  5LHG A;  3GTK J;  3Q3S A;  3R0A A;  1X3W B;  1HKS A;  1O57 A;  2LF8 A;  4LFU A;  2E34 A;  3PNT A;  2VOO A;  1MNM C;  5IY5 H;  5AON A;  3DPL C;  3LQQ A;  5EGO A;  2M3A A;  1X4O A;  3DLA A;  4DW6 A;  2V26 A;  5DCM A;  4HST A;  3M8F A;  1T8I A;  1LDJ A;  2F4I A;  3TDZ C;  2ZFU A;  5H2F C;  5J1R A;  3HOS A;  1WFX A;  3HHH A;  2PG4 A;  3LWF A;  1ETQ A;  3FMS A;  2HGC A;  4PJN A;  2G7H A;  3S3N A;  2IPQ X;  4B43 A;  1DQU A;  2DOA A;  3BQY A;  3K69 A;  5TGT A;  5ICG A;  5LGN A;  4UUV A;  4BE2 A;  3MWM A;  1DU6 A;  2LC2 A;  2R5Y B;  4PJL A;  3Q0V A;  4PFO A;  3RDI A;  4BQQ A;  4HQM A;  5L3G A;  4XMY A;  5E79 C;  1ZRC A;  4E7Z A;  1X3Z B;  2Z99 A;  3K0L A;  3FF5 A;  5CJ9 A;  2M8G X;  2RN7 A;  1G4D A;  4HNU A;  1PYV A;  4A93 J;  3S2D J;  4BH9 A;  3AG4 H;  2Y9Z A;  3F72 A;  1R5G A;  2IT0 A;  5ILS A;  3JR9 A;  1J7K A;  5DTD A;  3OYG A;  1Z0X A;  1D1C A;  2V4J C;  3WE3 A;  2OZ6 A;  2MLG A;  1XSD A;  2VBZ A;  2CW7 A;  3QYE A;  4JP0 A;  1UB9 A;  4AVZ A;  2HI3 A;  3ERM A;  1ZGW A;  2HYG D;  4XN0 A;  3U9G A;  2X6O A;  1POG A;  2GXA A;  2KDO A;  3G1L A;  3KEY A;  2XF6 A;  3SEZ A;  3IL2 A;  2IS1 A;  3H5A A;  1PP7 U;  3F8B A;  4UVC A;  5FFZ A;  3GF2 A;  4KJZ A;  3ABK H;  1GV5 A;  1RZ4 A;  2E36 A;  4RGX A;  4XIC A;  5H6Q A;  4IX7 A;  3H9G A;  3HJE A;  2XAQ A;  2ID3 A;  1MDM B;  4BHC A;  1WJ5 A;  3LFK A;  5A2Q Z;  3JRF A;  2KP6 A;  2ZSI B;  3JTG A;  3HOU J;  4BXF A;  2DJI A;  2HKX A;  3JRC A;  2I8D A;  1LNW A;  3PL8 A;  1ZGA A;  1FOW A;  4ZH4 F;  4P1W A;  4WCG A;  1MSE C;  1OCC H;  1Y6I A;  1KA8 A;  4NB5 A;  1Y8Q B;  3K70 D;  1LQ1 A;  4O5V A;  5FRO A;  4CYC B;  3I5U A;  3R4K A;  2LKP A;  4RGS A;  3KCC A;  2KZG A;  3HKZ A;  1JKO C;  2AXT C;  3LSP A;  4ESF A;  1QQI A;  1A35 A;  4R8H A;  4HZF A;  1ZTR A;  1ZLJ A;  2L4A A;  1CF7 A;  2OV7 A;  2XB5 A;  2A3S A;  3GEZ A;  1KQ9 A;  1ON1 A;  2XUB A;  3O6B B;  4HQE A;  4WWC A;  1YIT I;  3W2V A;  4V2G A;  1K6Y A;  1TLH B;  2FRH A;  4I0B A;  2R7W A;  1XPX A;  3IRR A;  2ID6 A;  2JUC A;  2X6X A;  4XLH A;  1YRN A;  1WH5 A;  1Q1V A;  3G6E I;  3KZY A;  1B4A A;  1FSE A;  2JTV A;  2XAG A;  3D5S C;  1E3P A;  2OU2 A;  1TNT A;  4ZYD A;  2BEO A;  3MQ0 A;  3COA C;  2K4B A;  1H8A C;  2ADU A;  2XPU A;  3PO2 J;  2JQ7 A;  2NS7 A;  1K79 A;  5K1Y A;  3H92 A;  3TO9 A;  4G7O F;  2HKO A;  3JAM K;  1HW5 A;  2MD0 A;  2HQN A;  2V9P A;  1MIJ A;  4MEX F;  4CXF A;  4IL6 C;  1YHQ I;  2VI6 A;  4E4H A;  4DNC A;  2FMY A;  2NS8 A;  2KPM A;  1G3W A;  3PO3 J;  2GBY A;  3PSI A;  5J47 A;  3G71 I;  4HAM A;  1BR1 A;  3PFI A;  3SZG A;  3ZRG A;  1MBF A;  4FIS A;  1LE8 A;  3J7Y J;  2JSP A;  4FE4 A;  1FBQ A;  2GXG A;  2PJP A;  2HTJ A;  1HSJ A;  1ZYR F;  2E1N A;  3QOP A;  1ZQ3 P;  5E3M A;  1EH7 A;  1JE8 A;  1VND A;  2P0W A;  2Z3Y A;  4C2M J;  4BHB A;  4P5O A;  3C18 A;  4ESB A;  3W6J B;  3AL0 C;  5JLW A;  3K9T A;  2FA5 A;  4IF4 A;  3T5X A;  4AWX B;  5KAI C;  1HST A;  2MBF A;  2JRT A;  3D1N I;  3RYP A;  4KYW A;  2FML A;  1EKE A;  1MMA A;  1BN5 A;  4AD9 A;  4UV8 A;  3KFW X;  5E3N A;  1IXC A;  4JX6 A;  1IN5 A;  2ZXH A;  1LDD A;  1IXS B;  2ECC A;  5JHU A;  5L3D A;  1E17 A;  2H94 A;  3H3U A;  2VN2 A;  4UB6 C;  4AUX A;  4NQW A;  4V19 K;  2QSG X;  4XSZ F;  3S1N J;  3GCM A;  4BS9 A;  5ERI A;  4RB3 C;  4RGR A;  1PDN C;  1OMI A;  5IYD J;  1OCR H;  3S1Q J;  1EJ9 A;  4WK8 F;  1FYL A;  2B7E A;  4QTR A;  5LGU A;  5GPC A;  1MBE A;  3HSF A;  2CW8 A;  4OIR F;  1MMG A;  4KIG A;  3CME I;  4A12 A;  2LRE A;  4RLQ A;  2KIS A;  1LEA A;  4AC0 A;  3GYH X;  4NQW B;  1E3O C;  5D5V B;  3BG3 A;  4Q5S F;  1QU3 A;  4FX0 A;  4FCY A;  5GAD J;  3DP7 A;  3IC7 A;  3BC8 A;  3E0J B;  2IW5 A;  3L2U A;  2HQA A;  2BOL A;  5CVV A;  4FX4 A;  3MMY B;  3P5J A;  3J80 K;  3IKT A;  5E1X A;  1R49 A;  2O0Y A;  3ELK A;  3L7W A;  3JRE A;  4I99 C;  1YFH A;  3DBR B;  3FZV A;  1QHH D;  1U78 A;  5D5U B;  2L7F P;  1MMN A;  3BCA A;  4OIN F;  4FAS D;  1O3S A;  1K78 A;  1X2N A;  3HPH A;  4UVA A;  3PIP F;  1BM9 A;  2JK3 A;  4ENN A;  1JKQ C;  2BY1 A;  2O6G E;  3BLY A;  1JI8 A;  2P8T A;  3C3W A;  2VJI A;  3SDB A;  2XIG A;  1OIS A;  1R5I D;  2XGC A;  2PMZ A;  2BXY A;  2MC3 A;  1ZEL A;  1AOY A;  4MHG A;  1T0F C;  4MFE A;  1GVJ A;  2FQ4 A;  2WB1 A;  5K5Q A;  3RJP A;  1Z7U A;  3ZR8 X;  3R0J A;  4EGZ A;  1ZAR A;  2ZCW A;  2DK5 A;  2QQB A;  2RNG A;  3HRT A;  2EJR A;  1D0Z A;  2L7M P;  3EUK L;  3RKW A;  4D7M A;  1IDY A;  4EGY A;  1TT5 B;  5CVJ A;  3WOD F;  1Z77 A;  2K9Q A;  1YX3 A;  4OAZ A;  3KP4 A;  3FIW A;  4MIM A;  3ULQ B;  5M3M J;  1VQL I;  1DPR A;  3H9Q A;  1LVK A;  4II2 A;  3S2W A;  2DXI A;  1WJF A;  2BBY A;  4ZZD A;  1YE9 A;  1FLI A;  1IXR C;  5KNL A;  5HLG A;  3AAF A;  4I09 A;  1R1U A;  3MZY A;  1E3H A;  4LLL A;  2QM3 A;  3OV8 A;  3K70 C;  1G6N A;  3NEU A;  5K7H A;  4IHS A;  2BVM A;  2LY9 A;  1DGW Y;  2KIF A;  2M4K A;  2M4G A;  2YR2 A;  5F1R A;  1T98 A;  2OA4 A;  1U5T B;  3J7A Y;  5KK1 A;  4C3H J;  4EV0 A;  3TOB A;  1P4X A;  4BAC A;  3GUD A;  4BBS J;  2YUS A;  2F48 A;  2KMU A;  3WGG A;  5DD4 A;  4F92 B;  2E2J J;  2KJB A;  2NVU B;  4E7J A;  3S93 A;  3DLL F;  2VIX A;  2D2W A;  1BC7 C;  5BPI A;  5CVI A;  3FBI B;  1K6O A;  2O5R A;  3QYF A;  4N9H A;  2VJ4 A;  4DYR A;  5HOD A;  4F93 B;  2KLO A;  3OS0 A;  2VT2 A;  4HLY A;  4O6J A;  4DYC A;  3KLO A;  4WXH A;  2CJJ A;  2XAF A;  3FX3 A;  4BXX J;  2AQF A;  3CJQ B;  2VC0 A;  3ESW B;  2DMQ A;  4A3B J;  4U0Y A;  3CDH A;  3CC7 I;  1V5E A;  1PP8 F;  1X1D A;  3F23 A;  1NG6 A;  3LQR A;  1A36 A;  2F2E A;  2MYS A;  3QU6 A;  4HW0 A;  1B6A A;  3ABT A;  4F52 A;  2NVT J;  3HOZ J;  2GM4 A;  4LIT A;  1LEB A;  1LFB A;  4JX4 A;  2LDU A;  4I02 A;  2LTP A;  1SD6 A;  3A03 A;  2W85 A;  2K9M A;  3I53 A;  3P9C A;  4LK0 F;  4RS8 A;  3CCQ I;  5B3S H;  2DPU A;  3DEE A;  3H0D A;  2FJ1 A;  4NBQ A;  3K7A J;  4W1U A;  5LBQ A;  3KLN A;  4LIV A;  4G6D A;  3WTS C;  4H0E A;  2DDA A;  2XC7 A;  4RAF A;  2BY3 A;  2CMP A;  2A68 F;  2CV1 A;  3GTP J;  2HDD A;  2F5D A;  4IZZ A;  1RR8 C;  1RUN A;  4OMY A;  5FFX A;  1W0T A;  4YRV A;  3ZQL A;  3DXJ F;  2CYY A;  3GWZ A;  4D9J A;  3ZN0 A;  4MLO A;  2E1O A;  1HDD C;  4L0Z B;  4LGW A;  2EV5 A;  4EJW A;  1KON A;  4M3G A;  4G7Z F;  1B9N A;  4C2U A;  1REP C;  2CFO A;  4F3Q A;  1ZAO A;  1WRJ A;  2X48 A;  3GFI A;  5ILV A;  4U88 A;  2DO7 A;  2XF7 A;  2OTL I;  1TBX A;  4IRH A;  4MNU A;  1UG0 A;  4C3J J;  3S3O A;  2R7Z J;  3S14 J;  4ETS A;  1BOB A;  2WV1 A;  3GXO A;  1I3Q J;  4IOC F;  2MGQ A;  2DOD A;  2RNJ A;  2H8R A;  4A3G J;  1QO0 D;  1TWC J;  2XB0 X;  4RB0 A;  2CUE A;  4DJA A;  3IH3 A;  4UV9 A;  3HRS A;  3UNG C;  3MFK A;  1GV2 A;  2W1O A;  2YU9 J;  1S29 A;  4XON A;  3K1P A;  1SFO J;  2EA4 A;  2ZME A;  3DTK A;  1S7A A;  3KEQ A;  5E8G A;  4HLX A;  2OZU A;  1BI2 A;  4CCK A;  2WAF A;  4C3I J;  3K4N A;  1O7L A;  4I01 A;  2IA2 A;  2FBK A;  5LEK A;  1XG1 A;  2XAJ A;  2KRH A;  3FXL A;  3BG6 A;  1S6L A;  1U2W A;  4WXD A;  1BOA A;  3HUG A;  1JUS A;  3OS2 A;  3UR3 C;  1G2H A;  4ZDO A;  1YS6 A;  5HS9 A;  3VOD A;  1JTX A;  4PFP A;  3QAH A;  1RR7 A;  3CQZ J;  4FT8 A;  3ERE D;  1EH6 A;  2Q2E B;  1QNT A;  4PJM A;  1IJW C;  1WWX A;  4M6X A;  4PK4 A;  4BDZ A;  5J1U A;  3S1R J;  2OJE D;  1FMW A;  1N75 A;  3FXR A;  1K83 J;  3JRG A;  2ACJ A;  4XRS G;  5L3E A;  1T39 A;  3HUG B;  3QP5 A;  4RMN A;  3RKX A;  3B6C A;  5EZH A;  2EFO A;  3OYC A;  1WH7 A;  4M6V A;  5EF6 A;  5M3F J;  2DTR A;  3EDP A;  2VQC A;  4J00 A;  1QVT A;  4XLA A;  4M9X A;  2RV8 A;  3LA2 A;  4XRS A;  3ZXS A;  2VKV A;  1ZG5 A;  3QPS A;  5D5W B;  2X85 A;  3P7N A;  1IGN A;  2CQK A;  1SVM A;  1IN8 A;  3GME A;  3G73 A;  2C6Y A;  2FD5 A;  4ZYH A;  2XRN A;  5IOZ A;  1QGP A;  2R7O A;  3CJR B;  4P9F A;  1LVA A;  3CCM I;  1FWZ A;  3CLQ A;  4N4N B;  4B4C A;  1JJ6 C;  3GZN B;  2BVL A;  1X1P A;  4XOT A;  5HNF A;  2G7U A;  1W5T A;  3CCV I;  3MZH A;  5J8C A;  1FP2 A;  3CJN A;  3ASN H;  4D5C A;  3L2C A;  1HA8 A;  5C3E J;  3G1O A;  3VFZ A;  1TQI A;  3KEO A;  4A3J J;  5L3B A;  2XGX A;  2R0Q C;  1QRY A;  1HKQ A;  1QA6 A;  1ITY A;  2HDC A;  2DQR A;  3BJ6 A;  2DA5 A;  2BW3 A;  2LLK A;  2H1L A;  4G9Y A;  2E71 A;  4Q47 A;  3OSG A;  5DM6 F;  3HOX J;  3OSF A;  3OIO A;  2K85 A;  2DMP A;  2YU3 A;  4KIT B;  1YJ9 I;  5J3L A;  3SDG A;  5BPD A;  4GYG A;  2P5V A;  1W36 D;  2KDZ A;  5E20 A;  2EH3 A;  4MTD A;  3OYK A;  2W48 A;  1ZK8 A;  3LA7 A;  1G3T A;  3RCO A;  3ZMZ A;  3TP0 A;  4BE0 A;  3I56 I;  3HM5 A;  1PJR A;  3CCE I;  3CP8 A;  2QZ8 A;  2LVS A;  2Q8K A;  1P7J A;  3QOD A;  3ZQG A;  5EGO B;  3P9I A;  4RAZ A;  2P7V B;  3K1N A;  2M7A A;  2QKL B;  2EFN A;  2M45 A;  3FHZ A;  1YTY A;  4IHT A;  2DAO A;  4CZZ A;  4A0X A;  2GLO A;  3A0B C;  3OYI A;  1HCR A;  3HHG A;  1ZHF A;  3PIO F;  4ANJ A;  1AKH B;  4XKW A;  4QSH A;  4M3F A;  4RBO A;  3HOW J;  4XRF A;  3AFH A;  2M0M A;  2M34 A;  2HZD A;  4BYY A;  5B1A H;  1O3R A;  2K86 A;  4PDK A;  2R7S A;  5HOO A;  3OS1 A;  2HR3 A;  2OBP A;  4RB1 A;  4DIQ A;  1TC3 C;  1T33 A;  1RPW A;  1S3J A;  2FU4 A;  3LSR A;  1P6R A;  2RC4 A;  3T8T A;  2KQR A;  4EM1 A;  4E7H A;  5IT3 A;  1TL8 A;  5K7Z A;  2H1K A;  4A0Z A;  5FD6 A;  1X58 A;  4B44 A;  1OJL A;  4HG2 A;  4IHW A;  3AL0 B;  4XNF A;  2LF7 A;  3M1C A;  3J7A O;  2LYC A;  1I50 J;  2ELH A;  1S5L C;  2BXZ A;  4CSW A;  1WI9 A;  3ZQQ A;  1D3Y A;  3OYM A;  2DMT A;  2MA3 A;  3VYR B;  2ZXW H;  3BRO A;  4WXC A;  1Z67 A;  2F6C A;  5D4S A;  2UZK A;  4XR6 A;  3EQL F;  2GXB A;  3FMQ A;  4PSX A;  2VQG A;  5ICC A;  2IS2 A;  3CCJ I;  5D4R A;  3MEX A;  3DTE A;  4JYK A;  1XD7 A;  2QQ8 A;  1JKP C;  5FKK A;  5LLQ A;  1QHG A;  4LG0 B;  1W4M A;  1LB2 A;  2H6C A;  1K4T A;  4AYB A;  3MCZ A;  2P81 A;  4L9J A;  1YIO A;  2ELJ A;  5CVR A;  5HLT A;  2ZNZ A;  2FX0 A;  5FRM A;  4A6D A;  4CIC A;  1B1B A;  2OCE A;  2KFD A;  3SYT A;  5BQT A;  3FKJ A;  5JR3 A;  3CF5 F;  3NQO A;  2W4S A;  2FEZ A;  2R7R A;  2DU9 A;  2NOJ B;  2PFB A;  4CA0 A;  2EIL H;  2QEX I;  4GGG A;  3E5X A;  3EYI A;  2QWW A;  1WZ2 A;  3WHC A;  2EWN A;  2LY1 A;  3WE2 A;  3O2P E;  1HBX G;  2Q0O A;  3KP3 A;  2M30 A;  4PGH A;  4LLN A;  2DA1 A;  4QPO A;  3HTU A;  5GTI C;  5H6R A;  3CES A;  2DT7 B;  1CGP A;  2FBI A;  1JKR C;  4U0W A;  4CYD A;  1OR7 C;  2CUZ A;  4C30 A;  1Y0N A;  3PUB A;  3G3Z A;  2R7T A;  3I9V 2;  4LLG F;  2W84 A;  3T0Y A;  3I55 I;  3G2B A;  4IJA A;  1D5V A;  2D1V A;  5E18 F;  2VBX A;  2ZFW A;  5LHH A;  2KKO A;  2VUM J;  1A04 A;  2IRF G;  1UZC A;  2GZW A;  4L5J A;  4XID A;  4CGZ A;  5DCF A;  1J09 A;  4GFB A;  6PAX A;  1TW3 A;  2K02 A;  2A5W A;  3HBL A;  3Q5F A;  1VQ4 I;  2VJ5 A;  2X4H A;  4NC6 A;  5J8F A;  1X1C A;  1N25 A;  3O8G A;  2FQ3 A;  1NH3 A;  3F8C A;  2JN6 A;  5F0H A;  4DBR A;  4Y52 J;  2P6T A;  4XLF A;  2VE8 A;  2O3F A;  3UKG A;  2R7X A;  1W7P A;  1TQP A;  2WV0 A;  2EPF A;  1MNE A;  3QPL A;  5BS6 A;  1OQY A;  3FXQ A;  1TNS A;  4U7B A;  3OL3 A;  2ETH A;  1OLT A;  3QPT A;  3F6V A;  3HRU A;  2OPT A;  5BOX A;  2IGM A;  3HIF A;  4AIK A;  3WTY C;  2E7X A;  3IV5 A;  3BR3 A;  2PX9 A;  3L09 A;  4IHV A;  3MKL A;  1MBH A;  1UEL B;  2JMW A;  1ZLK A;  3IAM 2;  3DKX A;  3FK6 A;  1P92 A;  3LAJ A;  1LDK B;  1AWC A;  2VKH A;  4XSX F;  1TTY A;  1X3U A;  5D6E A;  3BZC A;  3M7G A;  1AA7 A;  2QEN A;  3S32 A;  4B48 A;  1V5G A;  2L01 A;  1PUE E;  5IT9 Z;  3Q9S A;  2N8G A;  1ORK A;  3RTR A;  4UUT A;  1T56 A;  4IKF A;  3CP2 A;  4ZZL A;  3M3Y J;  5F08 A;  3PFY A;  3LMM A;  4E7K A;  4R1H A;  3OIP A;  4C9Y A;  4F7Z A;  2Y0S N;  1XGO A;  2CSO A;  5E1W A;  3DU5 A;  3QOE A;  4XLE A;  5BNG A;  4XLN F;  1LFP A;  1BIA A;  4ITV A;  2FF4 A;  2WBM A;  1CQT A;  2M1B A;  1GUU A;  2UV1 A;  2A61 A;  2K9N A;  5CQE A;  1T95 A;  1KQ0 A;  5F6F A;  5B66 C;  2XGE A;  2EK5 A;  2FNP A;  3A02 A;  2EIJ H;  3BQZ A;  1BI0 A;  4Y3O A;  1MJ9 A;  5D6F A;  3WTZ A;  4GO1 A;  4MQV A;  3HGY A;  3TMO A;  4G12 A;  4KNY A;  2LNB A;  1IUF A;  3KZI C;  2NNY A;  2X6W A;  3CC2 I;  4P9U A;  4A3K J;  1RKW A;  3RQI A;  1E0E A;  1VQM I;  4IHY A;  2XAS A;  3ISP A;  1SD7 A;  5F0F A;  3CCY A;  1V5F A;  3OYA A;  1ONV A;  3WGH A;  2L2O A;  2RVC A;  2XRO A;  1I1S A;  4BEH B;  3E6C C;  1FEX A;  3PSF A;  3HDD A;  4HX4 A;  2AXL A;  2EBI A;  3TW6 A;  3GZ5 A;  1ERD A;  1MJB A;  2OD5 A;  2HXI A;  4FQG A;  3CMA I;  3CO7 C;  2W25 A;  2EIN H;  1ZN2 A;  3WGI A;  3PM1 A;  1IUY A;  5LEJ A;  2VC1 A;  4EM0 B;  3RIR A;  5IP7 J;  1U6G A;  2L7Z A;  1LUJ B;  2ESH A;  4HEA 2;  4I98 B;  3JRH A;  1FBU A;  1N77 A;  4BQA A;  1VZ0 A;  2TRT A;  1J75 A;  5HDG A;  2WC2 A;  1TQM A;  3JRI A;  3N97 A;  1P4W A;  3K4L A;  3CDI A;  1ULY A;  2X1D A;  5DV5 A;  1RIO H;  3VSL A;  3OYD A;  1U9O A;  2A69 F;  1HOM A;  2DMN A;  4CUG A;  1UMQ A;  3RZD J;  2OC6 A;  2CH0 A;  1VQ8 I;  1ZH5 A;  2QF7 A;  5CVU A;  1Z7L A;  4IEJ A;  2OQG A;  4UUS A;  2G0E A;  5L3F A;  2FSW A;  2OUM A;  4J19 A;  1ZG3 A;  4Y17 A;  1KU7 A;  3W6V A;  3LST A;  2MD5 A;  4B1R A;  1RC9 A;  2E5N A;  2PMH A;  3GLL A;  4M73 A;  4Y13 A;  3C2G A;  2ICW G;  2GIV A;  2MH2 A;  2B9S A;  3IKV A;  1OCO H;  3WG7 H;  4AU7 A;  2F4O B;  3LL7 A;  3VEP A;  2LKX A;  4RLF A;  2QBY A;  2PLY A;  2XRL A;  4G6Q A;  2B63 J;  5E8I A;  3EET A;  2FE3 A;  3OYF A;  2WTE A;  2MC4 A;  3NWT A;  2HOT A;  2JA2 A;  2CW0 F;  4I6Z A;  2E1C A;  1W36 C;  1KGS A;  3KP5 A;  5M5X J;  4CCN A;  3VYU B;  4FTH A;  4M3D A;  5GAH J;  2K9S A;  4IQJ A;  3B02 A;  1GT0 C;  3ZP5 A;  1OCT C;  1YYV A;  4OOI A;  1WQ2 A;  5DCM B;  3ZQI A;  3EUA A;  3L9F A;  3JCU C;  4M3E A;  2DCE A;  3MVP A;  2L3D A;  1YRN B;  2NNN A;  1G59 A;  3V7R A;  4YIR X;  2KIM A;  1OFC X;  3W6K B;  4HDU A;  2DDB A;  2HVQ A;  1Y1W J;  5J4V A;  3GTO J;  4PCQ A;  2RRE A;  3RSN A;  5E1Z B;  1NK2 P;  3W2W A;  4JQF A;  3WU0 A;  1OYY A;  2BYV E;  4MTE A;  4JK1 X;  4ASN A;  1XX5 A;  5AIQ A;  3ASO H;  2YX4 A;  4J01 A;  2HFH A;  2DOF A;  5TIS C;  2MLK A;  4OU0 A;  4DOZ A;  5DM7 F;  1JT6 A;  2JRM A;  1MMD A;  2O7O A;  4QIW N;  3K1M A;  1N78 A;  3BZK A;  4W97 A;  3E5U A;  2O61 A;  4YEL A;  4KIS A;  1IF1 A;  3QQA A;  2UXN A;  1P4A A;  1PUF B;  1DPU A;  4YIF A;  1MKM A;  3J81 Z;  4E7L A;  2BZT A;  4N0B A;  2GAU A;  1VQ5 I;  1D8J A;  1BI3 A;  1UST A;  3BG5 A;  2DA4 A;  4KN7 X;  4RAY A;  1WJC A;  1VQ6 I;  1EV7 A;  2NAZ A;  3D5L A;  4BKX A;  3LSM A;  5GTH C;  4XN3 A;  4HNV A;  2XSD C;  2R92 J;  1RNL A;  2R7D A;  1I5Z A;  1Z3Y A;  2NYX A;  2VKE A;  1BA5 A;  4G7H F;  1R1V A;  1KU9 A;  2HOS A;  1HKT A;  3GLX A;  1UHS A;  1WKM A;  1C0W A;  3M4O J;  3BR2 A;  1HW2 A;  2X1E A;  3J80 Z;  4I0A A;  1LFU P;  3QP6 A;  3NRV A;  5ED4 A;  5DD8 A;  4BNC A;  5EEG A;  1GXQ A;  2OCC H;  1OR7 A;  4LJZ F;  2WY8 Q;  2A07 F;  3D0S A;  2H09 A;  4BGD A;  4A3E J;  2CQ7 A;  3RZO J;  2QGU A;  2NVQ J;  4HNT A;  2L02 A;  4ZYG A;  4GRI A;  1XMA A;  1DUX C;  1RES A;  3OL4 A;  4L9N A;  3R61 A;  1OCP A;  4L5E A;  3FBN B;  3WTW C;  4RGU A;  1A6I A;  3DQV C;  4B09 A;  5F0C A;  1UCR A;  2DW4 A;  4I7H A;  4FE7 A;  1Z21 A;  1ACI A;  2KL4 A;  2A05 A;  4L5I A;  3HTS B;  3MN2 A;  2A6H F;  2LG4 A;  1YW9 A;  1UAA A;  1I39 A;  2DK8 A;  2DTZ A;  2VXD A;  3BWG A;  1U8B A;  3S15 J;  3AG2 H;  2DMU A;  2E2I J;  1T38 A;  1CF7 B;  2DLL A;  3ML6 A;  2V9K A;  4ZDL A;  3LFU A;  3FXO A;  3OY9 A;  4S04 A;  2IA0 A;  4AYB N;  4L9T A;  2IGK A;  2UUZ A;  5HLI A;  3BG7 A;  3R60 A;  3V7S A;  2EIM H;  3S3M A;  3S2H J;  3GTQ J;  5IT9 K;  3K4K A;  2K4J A;  1SAN A;  1IRX A;  2NXN B;  3GTM J;  3F8N A;  2XV4 S;  2QLZ A;  3KZZ A;  3BG9 A;  3K4J A;  3KP6 A;  2R5Z B;  1JUM A;  4O3M A;  1HW1 A;  3DWL E;  4HOB A;  4KN4 X;  3HEF A;  1OCZ H;  4M6Y A;  2O9L A;  4UY8 I;  1F4K A;  3CJT B;  2O8X A;  2CO5 A;  5B1B H;  1X4P A;  3L2Q A;  3IWF A;  3QYB A;  3CUQ B;  1IAW A;  1IRG A;  3RI4 A;  4DGW B;  4N4O B;  1QZZ A;  3ZMT A;  4CCL A;  3GBG A;  3HGG A;  1JHF A;  2E35 A;  1Z3X A;  2O03 A;  4M9S A;  2E7W A;  2IBD A;  5B5E C;  5KHD A;  3FKI J;  5EG0 A;  4M74 A;  3Q0W A;  3OYL A;  2P7C B;  3SEQ A;  3LNQ A;  2STT A;  1EH8 A;  3NAU A;  5TRD A;  2HWV A;  1Q1H A;  1J0R A;  1ETV A;  3BR6 A;  3A0H C;  3VDX A;  1W5C C;  3F8F A;  1Z6R A;  5EZG A;  4AIH A;  2R93 J;  1J2X A;  1EA3 A;  2LKS A;  3ECH A;  3A01 A;  3TL4 X;  1SFK A;  4YFN F;  4JOM A;  2NVY J;  1A6Q A;  1XGM A;  3FXM A;  4LB5 A;  4PSW A;  1U5T A;  4HA8 A;  4IPA A;  4ENM A;  4KIC A;  3TBI A;  3L2V A;  3BTC A;  4BQO A;  2FXA A;  2HXO A;  3N05 A;  2Y0M A;  3CUQ C;  2EV0 A;  3BP8 A;  3PUF A;  1VFC A;  1FSH A;  2VQH A;  3BPX A;  4B47 A;  2IS4 A;  3FXK A;  3OOP A;  2JA5 J;  4HYE A;  4D5F A;  2ME0 A;  3HOY J;  3ZOB A;  3SFZ A;  4BJ6 C;  1XMX A;  2ZME C;  2AQE A;  2IGO A;  2M7B A;  2VKD A;  1S9H A;  3VSK A;  5F1J A;  2QCO A;  2OQR A;  1TW2 A;  1HXD A;  1IN6 A;  4A3I J;  2CRG A;  1WGX A;  2PEX A;  2PJR B;  3FIS A;  5KCM A;  4LK1 F;  3SFI A;  2QA4 I;  2VQL A;  3W3C A;  2A6E F;  4XOP A;  4CH7 A;  1YQA A;  3KX2 A;  4BEH A;  3ABM H;  1RKT A;  4A3L J;  3N4M A;  2CG4 A;  4U7D A;  1JHH A;  2BV6 A;  3HZJ A;  1BR4 A;  4PJ0 C;  3B73 A;  3RPQ A;  1B9M A;  2QKM B;  2ELK A;  2DN0 A;  2ZB9 A;  1HQC A;  2XPV A;  5KAF C;  1QPM A;  5DEQ A;  4ZC3 A;  3GX4 X;  1SVL A;  1W7P B;  3H36 A;  3MZ8 A;  3DKY A;  3S16 J;  2CS3 A;  3A01 B;  5ICE A;  1EF4 A;  4TV7 A;  1B72 B;  1D8K A;  1D1A A;  2CQX A;  1WVR A;  5HDK A;  1R00 A;  2Z5U A;  1F5T A;  2L0K A;  4XK4 A;  1R23 A;  4HRI A;  3KIO A;  2FBH A;  1NG7 A;  2M9H A;  3HG9 A;  3K4B A;  4ABZ A;  4XLC A;  4UNO A;  2YS9 A;  2HEO A;  2HYJ A;  2W82 A;  4LIU A;  4YFX F;  3SQN A;  1HDP A;  3V4G A;  2D45 A;  2VB6 A;  3DU6 A;  2K5C A;  3KYC B;  1U0J A;  2K7L A;  2L54 A;  5GP9 A;  2B0L A;  4EAT A;  2ZJP F;  4XOR A;  2R7F A;  1XGS A;  1SAX A;  5J6X A;  1R9T J;  5EDN A;  1KYZ A;  1NTC A;  5HLH A;  1DDN A;  2CFX A;  3C2B A;  3U2R A;  3L2W A;  2KHM A;  3SZP A;  1SC7 A;  3RQ4 A;  1ZKG A;  4KT5 C;  3GO5 A;  3DBL B;  1U3E M;  3GW2 A;  2ME6 A;  4Q4Z F;  2PQ8 A;  3JSP A;  3M9A A;  2LBF B;  5EYR A;  2M5W A;  4CCM A;  1T6S A;  2HVR A;  5FGM A;  4EMS A;  2F5C A;  3CUO A;  5J1Y A;  3GTJ J;  5FKM A;  3GZ6 A;  3AG1 H;  5CYV A;  1GXP A;  1VQ7 I;  1VQN I;  1I1G A;  1KU3 A;  2KIQ A;  3R6S A;  2D1H A;  3CCU I;  1U9N A;  1OKR A;  4K2E A;  4LG0 A;  2V1U A;  2KJC A;  3ZQF A;  2PN6 A;  1IDZ A;  1O7F A;  2QSF X;  3K2Z A;  1LE8 B;  4U87 A;  1D5Y A;  3T8R A;  4BY1 J;  2QQ9 A;  3J7Z I;  1R58 A;  1W1W E;  4EEF G;  3JAM Z;  2MG4 A;  3CLO A;  1V4R A;  5CKT A;  2FOW A;  4LD5 A;  2Y69 H;  3CTA A;  4FET A;  1ETY A;  2ZSH B;  2K40 A;  3I58 A;  3Q0U A;  4NUB A;  3F8M A;  1H88 C;  4AM3 A;  2EZH A;  2WB1 N;  4IXA A;  2I10 A;  2V6C A;  4XRM A;  2IAI A;  2XKO A;  3FXU A;  4ZTJ A;  2BGC A;  2VBY A;  4NHJ A;  4YG2 F;  1JGG A;  1MBG A;  2PMZ N;  4P55 A;  1WI3 A;  3MAJ A;  4E6K G;  1ZG1 A;  1D0X A;  1MDM A;  1I27 A;  2CUJ A;  2EZL A;  1FTT A;  1J5Y A;  3EUH C;  1SD4 A;  3X2Q H;  3CZ6 A;  2H27 A;  2K3F A;  2A6T A;  4QPQ A;  4BXU A;  3ABL H;  4N9I A;  1R5H A;  1FBS A;  1I3A A;  1IN4 A;  5C4J J;  2NVX J;  3C2H A;  3H1C A;  1G3S A;  4RA2 A;  1A31 A;  1STZ A;  3DEW A;  2LOO A;  2RKH A;  3E6B A;  4I76 A;  2ZJ2 A;  2XHK A;  3BT9 A;  1MJA A;  2GWR A;  2IP2 A;  2KRC A;  4MGR A;  4KT6 A;  5H20 A;  3MKW B;  2JPC A;  2GIZ A;  1F43 A;  1NHA A;  2I5U A;  4KFC A;  1A5J A;  5IYB J;  3OR2 C;  3KP2 A;  4IQ4 A;  3RKQ A;  1UJ8 A;  4QWQ A;  3IAS 2;  3HXL A;  4EM2 A;  4CYC A;  2EZK A;  3K4M A;  3AG3 H;  2WAD A;  4PJJ A;  3I59 A;  3ZPL A;  4R79 A;  2Y9Y A;  1FZP B;  1IG7 A;  2WAQ N;  5F64 A;  5CPR B;  5M5Y J;  3P9K A;  2K27 A;  1BJA A;  1BJZ A;  4NC7 A;  1ZRE A;  3M8J A;  4OIO F;  3ROU A;  1ETX A;  3HRM A;  2ZJR F;  5FLV A;  3LSG A;  1DU0 A;  2TCT A;  3JW4 A;  3E5Q A;  1I6H J;  4ZDP A;  4KA4 A;  3V42 A;  3KYD B;  1YJW I;  4DQ2 A;  3BTI A;  3HSE A;  1XGN A;  3TW7 A;  3PNV A;  2ESN A;  2Y31 A;  1TWH J;  4HPQ A;  3V8J A;  3FWE A;  2XAU A;  1DP3 A;  2P6S A;  2K9L A;  3RKY A;  3I64 A;  4HX8 A;  3H9J A;  2VJJ A;  3ZQ7 A;  4G94 A;  5F04 A;  2HDW A;  1BIB A;  3IHU A;  5AIP A;  1Z6T A;  3DPT A;  3LA3 A;  2QSH X;  1WJB A;  1V54 H;  3QRF F;  4V2F A;  4KMU X;  4PZJ A;  2RDP A;  5JFR A;  3DEU A;  2H8W A;  2LBF A;  3U21 A;  2JVH A;  4Y33 A;  1MD0 A;  4ZYA A;  2Z1D A;  2X6Y A;  3L00 A;  3RPU D;  3H3Z A;  1JTY A;  1UFM A;  3VOE A;  3JRA A;  2MFZ A;  1T08 B;  3ZMV A;  1LPQ A;  4DBQ A;  5FKN A;  2ECB A;  3GFM A;  2ZXJ A;  2R7V A;  3BOQ A;  3DF8 A;  3I0T A;  3RPU A;  3BZ6 A;  4XL9 A;  3O3K A;  3SZT A;  4KUM A;  2HQ5 A;  1YIJ I;  2EQR A;  5DUK A;  2Z9O A;  1O3T A;  1FY7 A;  1KZH A;  5IYC J; 
#chains in the Genus database with same CATH homology
 4XM3 A;  4XKC A;  4LIV A;  2DCE A;  4BE1 A;  1G59 A;  2XC7 A;  2E60 A;  2CMP A;  2CV1 A;  3LSI A;  3OYE A;  5HNH A;  4IZZ A;  2HVQ A;  4YEJ A;  3LSH A;  4YRV A;  2WAE A;  3ZCO A;  3OIQ A;  2RRE A;  2WAQ A;  3RSN A;  3F9K A;  3W2W A;  4D9J A;  4JQF A;  4MLO A;  4C2U A;  1KON A;  3OYN A;  2MAB A;  2CFO A;  4J01 A;  4F3Q A;  4F91 B;  4DOZ A;  4B3X A;  2Y0S A;  1MMD A;  2CV2 A;  2XF7 A;  4X0G A;  1N78 A;  3S3O A;  1UG0 A;  4ZTF A;  1BOB A;  4YEL A;  4KIS A;  2HPM A;  1FMV A;  3ONQ A;  4OAY A;  4DJA A;  4E7L A;  2HPI A;  3UNG C;  2W1O A;  4BQN A;  3IP4 B;  4XON A;  1SAU A;  3DTK A;  2IGN A;  1WJC A;  3D5L A;  1GLN A;  4CCK A;  3PJR A;  2WAF A;  3LSM A;  4XN3 A;  3K4N A;  1Z3Y A;  2JUG A;  4Y4R A;  2KRH A;  3BG6 A;  4BDY A;  3PNT A;  3OS2 A;  3OMY A;  3H5N A;  3UR3 C;  2W00 A;  3DPL C;  2X1E A;  4ZDO A;  4PFP A;  2M3A A;  1X4O A;  3DLA A;  2Q2E B;  4PJM A;  2V26 A;  4HST A;  4PK4 A;  4BDZ A;  2WY8 Q;  1FMW A;  1N75 A;  3OOU A;  4BGD A;  2HVS A;  2F4I A;  2UWM A;  3VWB A;  2VXZ A;  2ZFU A;  3HUG B;  4RMN A;  4HNT A;  3HOS A;  1WFX A;  4GRI A;  3OYC A;  3OL4 A;  4PJN A;  3FBN B;  4E7S A;  3S3N A;  2F5V A;  4B43 A;  1DQU A;  3DQV C;  2DOA A;  5TGT A;  2VQC A;  4J00 A;  2X1C A;  4BE2 A;  1Z21 A;  4XLA A;  2KL4 A;  3ZXS A;  2LC2 A;  4PJL A;  4PFO A;  2LG4 A;  1UAA A;  2X85 A;  4BQQ A;  4XMY A;  2VXD A;  3HPG A;  1DGR M;  3E1S A;  2L9N A;  4E7Z A;  2R4G A;  2R7O A;  3CJR B;  1R6R A;  2V9K A;  1WJD A;  2CV0 A;  4ZDL A;  3LFU A;  4N4N B;  3OY9 A;  3DTI A;  2BVL A;  2IGK A;  1PYV A;  2UUZ A;  2XSJ C;  4XOT A;  4HNU A;  5HNF A;  3BG7 A;  3OYG A;  1D1B A;  3S3M A;  2VLA A;  1HA8 A;  1D1C A;  2V4J C;  3K4K A;  1IRX A;  3S8P A;  2CW7 A;  3QYE A;  4AVZ A;  4RM2 A;  4XN0 A;  3K4J A;  2BW3 A;  4NC8 A;  2KDO A;  3KEY A;  3DWL E;  2XF6 A;  3SEZ A;  2IS1 A;  3H5A A;  3A1Y A;  5JHF A;  4CZC A;  4KIT B;  1X4P A;  3L2Q A;  3QYB A;  3A2K A;  4KJZ A;  3H5R A;  1W36 D;  3H35 A;  4DGW B;  3AKZ A;  4IX7 A;  4N4O B;  1MW7 A;  3H9G A;  3OYK A;  4CCL A;  3GBG A;  2VPL A;  1WJ5 A;  1Z3X A;  3RCO A;  4HSR A;  4BE0 A;  5KHD A;  1PJR A;  1WJE A;  2KP6 A;  2ZSI B;  3CP8 A;  4BUP A;  3OWT A;  4BXF A;  2DJI A;  3OYL A;  3K4C A;  3QOD A;  2I8D A;  3SEQ A;  3PL8 A;  3LSK A;  4P1W A;  2M7A A;  1Y6I A;  2QKL B;  3VDX A;  3K70 D;  2V6E A;  5FRO A;  4LG3 A;  5HVQ C;  3HKZ A;  1EA3 A;  3TL4 X;  3OYI A;  5CQG A;  1SFK A;  2V1N A;  4JOM A;  4CCO A;  4ANJ A;  4XKW A;  4PSW A;  3AFH A;  2M0M A;  2HZD A;  2OV7 A;  3TBI A;  3FDY A;  5HOO A;  3OS1 A;  3L2R A;  3L2V A;  2R7S A;  4DIQ A;  4BQO A;  2LH9 A;  3N05 A;  3W2V A;  2KQR A;  1K6Y A;  2LRD A;  2VQH A;  2R7W A;  4E7H A;  4B47 A;  2IS4 A;  2X6X A;  2L9S A;  4XLH A;  2IS6 A;  1G8X A;  4B44 A;  4HG2 A;  4BJ6 C;  3AL0 B;  1X1B A;  2AQE A;  2IGO A;  2M7B A;  2VKD A;  3D5S C;  3A4C A;  4OWR B;  3IUO A;  3M1C A;  4XNF A;  1S9H A;  4XKB A;  2LYC A;  3VSK A;  3HOT A;  3CF2 A;  4NNJ A;  4CSW A;  2XF5 A;  2HU9 A;  3ZQQ A;  2PJR B;  3OYM A;  4XKV A;  3VYR B;  5KCM A;  2F6C A;  2VQL A;  3W3C A;  4XR6 A;  4XOP A;  4CH7 A;  3KX2 A;  4BEH A;  3DPU A;  4PSX A;  2VQG A;  2IS2 A;  3DTE A;  2MD0 A;  1BR4 A;  3K10 A;  2QKM B;  4E4H A;  2KPM A;  1QHG A;  4ZC3 A;  2WY7 Q;  3PSI A;  3DKY A;  1BR1 A;  4AYB A;  3SZG A;  2CS3 A;  3ZRG A;  2ELJ A;  5HLT A;  2JSP A;  5FRM A;  1D1A A;  1TZL A;  2V7F A;  3SYT A;  3FKJ A;  2W4S A;  2P0W A;  4G6T B;  2R7R A;  4E7I A;  2Q1Z B;  3ZGK A;  2NOJ B;  4P5O A;  4CA0 A;  4HRI A;  3AL0 C;  1NG7 A;  3HG9 A;  3K4B A;  1P9Q C;  4XLC A;  5LFA A;  2LY1 A;  2W82 A;  4LIU A;  3MKZ A;  3OYJ A;  4QPO A;  2VB6 A;  3DU6 A;  2K5C A;  3CES A;  4H4K C;  2DT7 B;  1MMA A;  1U0J A;  1OR7 C;  2CUZ A;  2L7K A;  4C30 A;  3PUB A;  2R7T A;  3I9V 2;  4EAT A;  3G2B A;  3K6G A;  4XOR A;  2ZXH A;  2E1M C;  4PUS A;  3MD2 A;  4BU2 A;  1J09 A;  3VYT B;  3L2W A;  2A5W A;  2KHM A;  3RQ4 A;  4BS9 A;  2VJ5 A;  2ZXI A;  1X1C A;  2LBF B;  4DBR A;  2CW8 A;  1MMG A;  4CCM A;  4XLF A;  2LRE A;  2HVR A;  4RLQ A;  2R7X A;  4BJT A;  1MNE A;  2GOX B;  4NQW B;  1YX5 A;  2E5Z A;  3OL3 A;  4U7B A;  1OLT A;  3MKY B;  4BL0 B;  2BW3 B;  2PJR A;  1QU3 A;  2IGM A;  3HL2 A;  3BC8 A;  2IXS A;  3E0J B;  3L2U A;  1UEL B;  2HQA A;  3IAM 2;  5FRN A;  3DKX A;  4U87 A;  2BOL A;  1LDK B;  1LKX A;  2VKH A;  3MMY B;  3W2A A;  1BR2 A;  1AA7 A;  2VAS A;  3S32 A;  4B48 A;  1V5G A;  2E1M B;  3NWS A;  5CKT A;  1QHH D;  4FET A;  2ZSH B;  4NUB A;  3RTR A;  4IKF A;  1MMN A;  3BCA A;  2R7U A;  3CP2 A;  3OR1 C;  4FAS D;  4II3 A;  2R7Q A;  3PFY A;  4ZTJ A;  3LMM A;  4E7K A;  3OIP A;  4C9Y A;  4E6K G;  4C2T A;  3HPH A;  4F55 A;  1D0X A;  3DU5 A;  3QOE A;  4XLE A;  2CUJ A;  3VYS B;  1LFP A;  3EUH C;  4ITV A;  2WBM A;  3BLY A;  1MND A;  3CZ6 A;  1JI8 A;  2UV1 A;  3FHN A;  2W7N A;  5CQE A;  1T95 A;  2A6T A;  2VJI A;  4QPQ A;  3SDB A;  4BJ5 C;  2PMZ A;  3OYH A;  1ZEL A;  1T0F C;  3C2H A;  4Y3O A;  1TT0 A;  2WB1 A;  3TMO A;  3ZR8 X;  2LOO A;  2X6W A;  2RNG A;  4ZJZ A;  2HNH A;  1D0Z A;  2KRC A;  3EUK L;  1E0E A;  4KT6 A;  2XDV A;  3MKW B;  1V5F A;  2JVG A;  3OYA A;  4D1Q A;  2L2O A;  1YX3 A;  3OR2 C;  4OAZ A;  4IQ4 A;  4BEH B;  3H9Q A;  1LVK A;  4II2 A;  2DXI A;  1WJF A;  3PSF A;  3IAS 2;  1YE9 A;  3HC7 A;  3HXL A;  5KNL A;  1ERD A;  1X1A A;  3K70 C;  5LD2 C;  3K4M A;  2WAD A;  4PJJ A;  2GOM A;  4R79 A;  2BVM A;  1DGW Y;  2M4K A;  5CPR B;  2M4G A;  3BCB A;  4NC7 A;  3M8J A;  2RQQ A;  3J7A Y;  3PNY A;  4HEA 2;  4RM3 A;  1N77 A;  3LSG A;  2X51 A;  3OYB A;  1VZ0 A;  4BAC A;  4ZDP A;  3V42 A;  2KZV A;  3EPZ A;  3K4L A;  2KMU A;  2X1D A;  4F92 B;  4E7J A;  3S93 A;  3VSL A;  3PNV A;  3D5R C;  3OYD A;  2VIX A;  3CMM A;  4CCJ A;  4CUG A;  3FBI B;  1WJA A;  2OC6 A;  2CH0 A;  2O5R A;  2FUG 2;  3QYF A;  4HPQ A;  2XAU A;  1DP3 A;  2K9L A;  2VJ4 A;  1Z7L A;  3H9J A;  2VJJ A;  4F93 B;  2KLO A;  2OUM A;  2HDW A;  3OS0 A;  3DPT A;  2AQF A;  1X19 A;  2L5Q A;  1WJB A;  2LY2 A;  2LBF A;  3CJQ B;  2DT6 A;  2E5N A;  3U21 A;  2JVH A;  4Y33 A;  3C2G A;  2VL8 A;  4XQF A;  4ZYA A;  2Z1D A;  4AU7 A;  2X6Y A;  3KYL A;  1V5E A;  1X1D A;  1NG6 A;  2Z16 A;  3RPU D;  3LL7 A;  2MYS A;  4RLF A;  2MFZ A;  2Z2S B;  3OYF A;  1Y56 A;  2MC4 A;  3NWT A;  4DBQ A;  2JA2 A;  4LIT A;  4F52 A;  2R7V A;  1W36 C;  1D0Y A;  3I3L A;  3VYU B;  4CCN A;  2K3P A;  4XL9 A;  4IQJ A;  2K9M A;  2WA0 A;  3DEE A;  3H0D A;  3EUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...